3U12A

The pleckstrin homology (ph) domain of usp37
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
b'SLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords USP37 protein
publication title The pleckstrin homology (PH) domain of USP37
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.180 Mainly Beta Roll PH-domain like PH-domain like 3u12A00
3U12A
chains in the Genus database with same CATH superfamily
3HK0A 3DXEA 4A6FA 1OMWA 2K2JA 2COAA 1K5DB 2COCA 1XODA 1NTVA 2DA0A 5C6RA 5HE0A 4BBKA 2EC1A 3QWMA 1TXDA 2D11A 4HB0B 1MAIA 3KZ1A 2DX1A 2ZKMX 2GCJA 1B55A 2KIEA 3MDBC 4NSWA 4GMXB 3GYOA 4C0AA 2KGXB 3SV1A 2RVBB 4F7UP 1XR0B 2CY5A 1WGQA 1U2BA 2DYNA 1LW3A 2RUKB 2ELBA 4QJ4B 5L81A 2ROVA 3VIAA 2DHIA 5JHGA 3RCPA 4DIXA 5J3QA 1WVHA 4P7IA 2RLOA 3BINA 5KCVA 1BAKA 1UNQA 1UNRA 3NWFA 2MWNB 1I7AA 1I2HA 4YL8A 3O96A 3HQCA 5D3VA 4CYEA 5HE2A 1ZC3B 2H7DA 2COFA 2CODA 1GC6A 1KZGA 3FVCA 1MKEA 4HAUB 3NW8A 2W2WA 1U29A 5FI1A 1FGYA 1WJ1A 4DXAB 2Q13A 5DIFB 3ODWA 4IAPA 3U7DA 2R2YA 2L1CA 2EJ8A 2Z0QA 1J19A 4L6EA 3LJUX 2D9ZA 2KIGA 1DBHA 2HE7A 1P5TA 5FI0A 3TCAA 4TKNA 2RNRB 2CAYA 1ZSQA 3PZDA 1FGZA 4HB2B 5LG4B 1Y19B 2ROZB 2GUMA 1XD4A 5I2MA 4HSIA 2J0KA 1LB1A 2ELAA 2Z4DA 3KRWA 1DDVA 3F5RA 1WI1A 3P6AA 5I2SA 3D8FA 1SHCA 3A58A 5DI9B 3GYPA 1WG7A 1M7EA 5D3WA 1U27A 1OY2A 5HE3A 3PVUA 1FB8A 3WYFB 4A6KA 3P7ZA 2Z13A 3CXBB 3F0WA 1DROA 2UVMA 3KRXA 4D0NB 3D8EA 1ZC4B 5HE1A 4KHOA 1DYNA 3HW2B 5C5BB 2OQBA 2QKMA 5DHAB 3SYXA 5J3TA 4GOUA 4MY6A 2ZPYA 4CSQA 4Z2NA 3G9WA 4CHJA 3QIJA 2PZ1A 2I1KA 3PP2A 3TW1A 4Z2MB 3PVWA 1OQNA 1EVHA 4GN1A 4QJ5B 2DKQA 2GS0A 3DXCA 2LG1A 5C5BA 3ODXA 4WJ7A 1KZ7A 1WGUA 3T06A 3FEHA 5CLLB 1U5GA 2J0JA 3A8QA 3ML4A 4HHVA 4HAZB 4KAXB 5C79A 1QC6A 2YS3A 1M7RA 2X18A 2YF0A 3NSUA 1E5WA 1V89A 2YRYA 3PVLA 4HAWB 2LOZA 1P3RA 4QXAB 4ZRIA 1FHXA 2D4QA 5M4YB 1BTNA 1Q67A 3U8ZA 1GC7A 3ULCA 4MT7A 1V5UA 1KI1B 1UEFA 2VSZA 2D9WA 3M1IB 2D9XA 2HTHB 5CLQB 3SNHA 1W1GA 4DX8A 1ISNA 4HB4B 3HSAA 3QBVB 2Y8GA 2RSGA 2YVCA 5KQ1A 2GCLA 1BTKA 4D6WA 1ZVRA 1J0WA 2D10A 3KSYA 3ODOA 2DHJA 2YSZA 3UZTA 4DBBA 1X05A 3PSCA 2MKRA 4HDOA 4OT1A 5JP4A 3OANA 2P0DA 2LOXA 1FHWA 2Y8FA 1UPRA 4K81A 1U5DA 3ZVRA 3B77A 3IVFA 2NBVA 3DXDA 4MK0A 2E2XA 3N7CA 4KVGB 5D3XA 1WJMA 4K2PA 1XKEA 2DLWA 3D8DA 2KCJA 2QKLA 5DHFB 2K8EA 1QQGA 2J0MA 3SUZA 1W1HA 1V61A 4WVFB 4Y94A 2Z0PA 1NU2A 2YT0A 1AQCA 4A6HA 3TVVA 1N3HA 2W2XD 3OHMB 1UPQA 2MFQA 2P0FA 2V76A 2RRFA 1PLSA 1V88A 1MIZB 2L2IA 4HAYB 2DFKA 3SO6A 5IRSA 4KHBA 1V5MA 1X11A 2UZSA 2R0DA 2KUQA 2EMSA 3TFMA 2K00A 5LONB 2DN6A 2FJUB 2CY4A 2IFSA 1MK9B 2Z14A 2J59M 4GMVA 1ZM0A 1H10A 2YT2A 2D9YA 1TJ6A 1PFJA 2OTXA 2JP2A 1P6SA 2H7EA 2DHKA 2DTCA 1EF1A 2YT1A 2K49A 2EMTA 3HIEA 4ZRJA 3NWAA 1NTYA 2K2UA 2NMBA 3A8PA 1BWNA 1RJ2A 3AU5A 3CIKA 4PNKA 2M14A 4K2OA 2M38A 4PQ0A 2AEHA 2DX5A 2FJLA 1U5FA 1MPHA 1X1FA 5GOWB 1EAZA 1RRPB 4HB3B 3WA0A 2LKOA 1SGHA 1NI2A 1XX0A 2CRFA 3AJ4A 3BJIA 2YS5A 4HAVB 2P8VA 3KY9A 2Y7BA 2D2QA 3PEGA 4EMOA 2D9VA 1DDMA 2W2XC 2LULA 4EJNA 4GPTB 4CHMA 1W1DA 5C16A 5KQ4A 3A98B 1T77A 1V5PA 5EFXA 5D3YA 1X1GA 1XCGA 1TQZA 1K5GB 2DYQA 3ULBA 2I5FA 1GG3A 3DCXA 4F7HA 4QJ3B 1UNPA 4EKUA 3U12A 4GXBA 3PG7A 4OSNA 4HATB 2RGNB 4K17A 1PMSA 3VOQA 4KHAA 3ZDTA 4WSFA 3FM8C 2I1JA 3NWDA 2G35A 2YS1A 2XQNM 5JLJB 4KHBB 2N0YA 2VKIA 2KUPA 4ZRKA 3MPXA 1MI1A 4XWXA 3TO1A 4L1RA 2UZRA 4TYZA 1DDWA 2ADZA 3V5WA 1FHOA 2MDXA 4A5KA 3AU4A 1Z87A 5J3YA 2AL6A 2IYBA 4HAXB 3X23A 2R09A 5LOPB 4H8SA 3FSSA 1EGXA 2BCJA 1H4RA 2VRWB 4DX90 5D27A 2LYDA 2P0HA 4GZUA 2NZ8B 1MIXA 2KR0A 5DH9B 4A6FB 1Y5OA 1FAOA 2I5CA 4IOYX 2N23A 1FOEA 1X86A 4F7GA 1AWEA 4GNKB 2DKPA 1ZYIA 4B6HA 4NY0A 4YONA 1IRSA 2Z59A 5JHHA 4HDQA 2Z0OA 2GJYA 4IFSA 1MK7B 1U5EA
chains in the Genus database with same CATH topology
4OT1A 3GYOA 2KR0A 2K49A 4GOUA 3HIEA 3TO1A 3A58A 4L1RA 4IOYX 4CSQA 2KIGA 3GYPA 3NWFA 3NWAA 3TVVA 4Z2NA 3OHMB 2NBVA 2GCLA 4QJ3B 2FJUB 4D6WA 3U12A 3FVCA 4GNKB 4QXAB 4OSNA 2Z13A 2RRFA 3TW1A 5LG4B 1ZYIA 4Z2MB 3NW8A 2Z14A 4PQ0A 4KHAA 5M4YB 3FSSA 2GUMA 2YT2A 2K8EA 2Z59A 3NWDA 5I2MA 2ZKMX 4HSIA 4QJ5B 2GCJA 4QJ4B 5IRSA 4KHBA 4KHOA 2KIEA 2Z4DA 4IFSA 4KHBB 4DIXA 5I2SA 2R2YA 2KUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U12 A; 
#chains in the Genus database with same CATH topology
 3HK0 A;  3DXE A;  4A6F A;  1OMW A;  2K2J A;  2COA A;  1K5D B;  2COC A;  1XOD A;  1NTV A;  2DA0 A;  5C6R A;  5HE0 A;  4BBK A;  2EC1 A;  3QWM A;  1TXD A;  2D11 A;  4HB0 B;  1MAI A;  3KZ1 A;  2DX1 A;  2ZKM X;  2GCJ A;  1B55 A;  2KIE A;  3MDB C;  4NSW A;  4GMX B;  3GYO A;  4C0A A;  2KGX B;  3SV1 A;  2RVB B;  4F7U P;  1XR0 B;  2CY5 A;  1WGQ A;  1U2B A;  2DYN A;  1LW3 A;  2RUK B;  2ELB A;  4QJ4 B;  5L81 A;  2ROV A;  3VIA A;  2DHI A;  5JHG A;  3RCP A;  4DIX A;  5J3Q A;  1WVH A;  4P7I A;  2RLO A;  3BIN A;  5KCV A;  1BAK A;  1UNQ A;  1UNR A;  3NWF A;  2MWN B;  1I7A A;  1I2H A;  4YL8 A;  3O96 A;  3HQC A;  5D3V A;  4CYE A;  5HE2 A;  1ZC3 B;  2H7D A;  2COF A;  2COD A;  1GC6 A;  1KZG A;  3FVC A;  1MKE A;  4HAU B;  3NW8 A;  2W2W A;  1U29 A;  5FI1 A;  1FGY A;  1WJ1 A;  4DXA B;  2Q13 A;  5DIF B;  3ODW A;  4IAP A;  3U7D A;  2R2Y A;  2L1C A;  2EJ8 A;  2Z0Q A;  1J19 A;  4L6E A;  3LJU X;  2D9Z A;  2KIG A;  1DBH A;  2HE7 A;  1P5T A;  5FI0 A;  3TCA A;  4TKN A;  2RNR B;  2CAY A;  1ZSQ A;  3PZD A;  1FGZ A;  4HB2 B;  5LG4 B;  1Y19 B;  2ROZ B;  2GUM A;  1XD4 A;  5I2M A;  4HSI A;  2J0K A;  1LB1 A;  2ELA A;  2Z4D A;  3KRW A;  1DDV A;  3F5R A;  1WI1 A;  3P6A A;  5I2S A;  3D8F A;  1SHC A;  3A58 A;  5DI9 B;  3GYP A;  1WG7 A;  1M7E A;  5D3W A;  1U27 A;  1OY2 A;  5HE3 A;  3PVU A;  1FB8 A;  3WYF B;  4A6K A;  3P7Z A;  2Z13 A;  3CXB B;  3F0W A;  1DRO A;  2UVM A;  3KRX A;  4D0N B;  3D8E A;  1ZC4 B;  5HE1 A;  4KHO A;  1DYN A;  3HW2 B;  5C5B B;  2OQB A;  2QKM A;  5DHA B;  3SYX A;  5J3T A;  4GOU A;  4MY6 A;  2ZPY A;  4CSQ A;  4Z2N A;  3G9W A;  4CHJ A;  3QIJ A;  2PZ1 A;  2I1K A;  3PP2 A;  3TW1 A;  4Z2M B;  3PVW A;  1OQN A;  1EVH A;  4GN1 A;  4QJ5 B;  2DKQ A;  2GS0 A;  3DXC A;  2LG1 A;  5C5B A;  3ODX A;  4WJ7 A;  1KZ7 A;  1WGU A;  3T06 A;  3FEH A;  5CLL B;  1U5G A;  2J0J A;  3A8Q A;  3ML4 A;  4HHV A;  4HAZ B;  4KAX B;  5C79 A;  1QC6 A;  2YS3 A;  1M7R A;  2X18 A;  2YF0 A;  3NSU A;  1E5W A;  1V89 A;  2YRY A;  3PVL A;  4HAW B;  2LOZ A;  1P3R A;  4QXA B;  4ZRI A;  1FHX A;  2D4Q A;  5M4Y B;  1BTN A;  1Q67 A;  3U8Z A;  1GC7 A;  3ULC A;  4MT7 A;  1V5U A;  1KI1 B;  1UEF A;  2VSZ A;  2D9W A;  3M1I B;  2D9X A;  2HTH B;  5CLQ B;  3SNH A;  1W1G A;  4DX8 A;  1ISN A;  4HB4 B;  3HSA A;  3QBV B;  2Y8G A;  2RSG A;  2YVC A;  5KQ1 A;  2GCL A;  1BTK A;  4D6W A;  1ZVR A;  1J0W A;  2D10 A;  3KSY A;  3ODO A;  2DHJ A;  2YSZ A;  3UZT A;  4DBB A;  1X05 A;  3PSC A;  2MKR A;  4HDO A;  4OT1 A;  5JP4 A;  3OAN A;  2P0D A;  2LOX A;  1FHW A;  2Y8F A;  1UPR A;  4K81 A;  1U5D A;  3ZVR A;  3B77 A;  3IVF A;  2NBV A;  3DXD A;  4MK0 A;  2E2X A;  3N7C A;  4KVG B;  5D3X A;  1WJM A;  4K2P A;  1XKE A;  2DLW A;  3D8D A;  2KCJ A;  2QKL A;  5DHF B;  2K8E A;  1QQG A;  2J0M A;  3SUZ A;  1W1H A;  1V61 A;  4WVF B;  4Y94 A;  2Z0P A;  1NU2 A;  2YT0 A;  1AQC A;  4A6H A;  3TVV A;  1N3H A;  2W2X D;  3OHM B;  1UPQ A;  2MFQ A;  2P0F A;  2V76 A;  2RRF A;  1PLS A;  1V88 A;  1MIZ B;  2L2I A;  4HAY B;  2DFK A;  3SO6 A;  5IRS A;  4KHB A;  1V5M A;  1X11 A;  2UZS A;  2R0D A;  2KUQ A;  2EMS A;  3TFM A;  2K00 A;  5LON B;  2DN6 A;  2FJU B;  2CY4 A;  2IFS A;  1MK9 B;  2Z14 A;  2J59 M;  4GMV A;  1ZM0 A;  1H10 A;  2YT2 A;  2D9Y A;  1TJ6 A;  1PFJ A;  2OTX A;  2JP2 A;  1P6S A;  2H7E A;  2DHK A;  2DTC A;  1EF1 A;  2YT1 A;  2K49 A;  2EMT A;  3HIE A;  4ZRJ A;  3NWA A;  1NTY A;  2K2U A;  2NMB A;  3A8P A;  1BWN A;  1RJ2 A;  3AU5 A;  3CIK A;  4PNK A;  2M14 A;  4K2O A;  2M38 A;  4PQ0 A;  2AEH A;  2DX5 A;  2FJL A;  1U5F A;  1MPH A;  1X1F A;  5GOW B;  1EAZ A;  1RRP B;  4HB3 B;  3WA0 A;  2LKO A;  1SGH A;  1NI2 A;  1XX0 A;  2CRF A;  3AJ4 A;  3BJI A;  2YS5 A;  4HAV B;  2P8V A;  3KY9 A;  2Y7B A;  2D2Q A;  3PEG A;  4EMO A;  2D9V A;  1DDM A;  2W2X C;  2LUL A;  4EJN A;  4GPT B;  4CHM A;  1W1D A;  5C16 A;  5KQ4 A;  3A98 B;  1T77 A;  1V5P A;  5EFX A;  5D3Y A;  1X1G A;  1XCG A;  1TQZ A;  1K5G B;  2DYQ A;  3ULB A;  2I5F A;  1GG3 A;  3DCX A;  4F7H A;  4QJ3 B;  1UNP A;  4EKU A;  3U12 A;  4GXB A;  3PG7 A;  4OSN A;  4HAT B;  2RGN B;  4K17 A;  1PMS A;  3VOQ A;  4KHA A;  3ZDT A;  4WSF A;  3FM8 C;  2I1J A;  3NWD A;  2G35 A;  2YS1 A;  2XQN M;  5JLJ B;  4KHB B;  2N0Y A;  2VKI A;  2KUP A;  4ZRK A;  3MPX A;  1MI1 A;  4XWX A;  3TO1 A;  4L1R A;  2UZR A;  4TYZ A;  1DDW A;  2ADZ A;  3V5W A;  1FHO A;  2MDX A;  4A5K A;  3AU4 A;  1Z87 A;  5J3Y A;  2AL6 A;  2IYB A;  4HAX B;  3X23 A;  2R09 A;  5LOP B;  4H8S A;  3FSS A;  1EGX A;  2BCJ A;  1H4R A;  2VRW B;  4DX9 0;  5D27 A;  2LYD A;  2P0H A;  4GZU A;  2NZ8 B;  1MIX A;  2KR0 A;  5DH9 B;  4A6F B;  1Y5O A;  1FAO A;  2I5C A;  4IOY X;  2N23 A;  1FOE A;  1X86 A;  4F7G A;  1AWE A;  4GNK B;  2DKP A;  1ZYI A;  4B6H A;  4NY0 A;  4YON A;  1IRS A;  2Z59 A;  5JHH A;  4HDQ A;  2Z0O A;  2GJY A;  4IFS A;  1MK7 B;  1U5E A; 
#chains in the Genus database with same CATH homology
 4OT1 A;  3GYO A;  2KR0 A;  2K49 A;  4GOU A;  3HIE A;  3TO1 A;  3A58 A;  4L1R A;  4IOY X;  4CSQ A;  2KIG A;  3GYP A;  3NWF A;  3NWA A;  3TVV A;  4Z2N A;  3OHM B;  2NBV A;  2GCL A;  4QJ3 B;  2FJU B;  4D6W A;  3U12 A;  3FVC A;  4GNK B;  4QXA B;  4OSN A;  2Z13 A;  2RRF A;  3TW1 A;  5LG4 B;  1ZYI A;  4Z2M B;  3NW8 A;  2Z14 A;  4PQ0 A;  4KHA A;  5M4Y B;  3FSS A;  2GUM A;  2YT2 A;  2K8E A;  2Z59 A;  3NWD A;  5I2M A;  2ZKM X;  4HSI A;  4QJ5 B;  2GCJ A;  4QJ4 B;  5IRS A;  4KHB A;  4KHO A;  2KIE A;  2Z4D A;  4IFS A;  4KHB B;  4DIX A;  5I2S A;  2R2Y A;  2KUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...