3U13A

Crystal structure of de novo design of cystein esterase ech13 at the resolution 1.6a, northeast structural genomics consortium target or51
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKACEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords artificial protein OR51
publication title Computational design of catalytic dyads and oxyanion holes for ester hydrolysis.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 69
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3u13A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u13A01
1T5SA 5AK6A 3BWVA 3MC1A 5ALGA 5AI5A 3WK4A 2AH5A 3WKBA 3U19A 2NYVA 4NWIA 4EELA 4EENA 5ALQA 2ZBGA 5ALKA 1XPJA 1TJ5A 1RKQA 4B6JA 3E81A 4Y2VA 2IA5A 2IOFA 3QLEA 2GO7A 2Q4TA 2OM6A 2WF8A 4EX6A 3WKEA 1TE2A 4XPZA 5AVVA 1S8OA 2B0CA 4Y2PA 3EF0A 5A3SA 4BX0A 3A3YA 1NRWA 5AKYA 1YS9A 5AM3A 1K1EA 1RC8A 1Z4NA 2HI0A 3IJ5A 1YNSA 3PCTA 3FPSA 2YBDA 4KNWA 2WHEA 4I9GA 4XE5A 1VJ5A 4UMFA 2G06A 1Z88A 4UASA 4Y2QA 2FEAA 3QUCA 2YJ3A 1KYTA 3HYCA 3B8EA 1U2SA 4J2TA 2IYEA 3R9KA 2C88A 2W11A 3A1EA 4BNDA 4JDPA 1WZCA 5JJBA 2JAOA 1CR6A 4YH1A 2B8EA 4KX3A 1RKVA 2PR7A 2YFYA 5ALMA 1L7MA 3KBBA 4AS2A 5AVUA 3ESRA 2FUEA 3DDHA 3ED5A 2O2XA 2RAVA 4NFLA 2Q5EA 3N1UA 5AKGA 5AM0A 1Z4QA 2X4DA 4YGYA 1RRCA 1O08A 4KYTA 5ALEA 3U7FB 4YIHA 1N8NA 1ZD4A 3A1CA 4YCNA 1L7PA 1VFPA 3I1YA 4BEWA 3SF0A 2PQ0A 4NABA 5ALHA 4EZEA 2GHTA 4UM7A 1Z4IA 1L8LA 3AR8A 4Y2YA 5ALFA 1T5TA 5IS2A 2R8YA 2WFAA 3MMZA 3ET5A 1EK2A 1RMQA 1SWWA 5AVWA 3KZXA 4F71A 2YJ4A 3WKCA 4KN8A 4FE3A 2P9JA 5E0OA 2G80A 1N9KA 4GIBA 4BX2A 5AW9A 2ZBEA 3QYPA 3E8MA 4OCZA 4UU0A 3ZWDA 4YCMA 4OFZA 3CNHA 1RPZA 3PDWA 4NV0A 2HCFA 5AI6A 2HX1A 1J97A 2HO4A 1L7NA 1WR8A 3DV9A 3QU2A 3K1ZA 3WKDA 3NAMA 5ALNA 4BKMA 3NIWA 2P11A 3ZVNA 3L8FA 5AM2A 3SKXA 3QX7A 3WK8A 3R09A 4L6CA 4Y2SA 4RESA 4Y3UA 3FZQA 2FPXA 2HDOA 1TA0A 2BDEA 2MU1A 4HYTA 3WK5A 1NNLA 3N8GA 5AW3A 1Z4PX 2FPUA 4BEVA 3BA6A 1YDFA 3NRJA 2YMQA 3NUQA 4IG4A 5AKJA 4BNDB 1QQ5A 5AIAA 2GFHA 5IT0A 5AKXA 3L8EA 2VKQA 1U02A 2RB5A 3D6JA 3ZTYA 1SU4A 3OCVA 3WK9A 2W43A 4MWOA 5IT4A 4EEKA 3W5CA 3SLRA 5AI4A 2IOHA 4XQ0A 4CF4A 3SHQA 2D2VA 5AVYA 4ZEVA 2P27A 4Y2XA 4DW8A 4I9FA 4OHFA 2BY4A 1YV9A 2GMWA 4HGPA 4F72A 2B30A 4AS3A 3L1VA 2I6XA 5AI8A 3QGMA 3PGVA 3NASA 5ALTA 5ALUA 3ZVMA 3S6JA 3QUBA 3OCYA 2I7DA 2R8XA 3DNPA 3L8GA 2ZG6A 5AW0A 2FI1A 2Q4RA 2HF7A 1LTQA 5ALDA 3OCXA 1O03A 4UATA 3I28A 3QXGA 5AW6A 2JARA 3ZI4A 1QH9A 2YMLA 2PKEA 2ZBFA 2CFSA 1J8DA 1Y8AA 2YMMA 2ZOSA 5ALZA 3I76A 2B1RA 2ZBDA 5T41A 3KC2A 2YJ5A 1XP5A 4CNQA 4KNVA 4Y2UA 3ZWKA 2WF5A 2C8LA 3U26A 2HHLA 2R8ZA 3EWIA 3ZW7A 2RARA 1YJ5A 3OCZA 3ZX4A 2ODAA 3W5DA 5FP0A 5AW4A 5A3RA 3M9LA 4OD0A 4HGRA 2B1QA 5AICA 5AKLA 3QUQA 3QUTA 1Q92A 4EX7A 3L5KA 5AVRA 2HEGA 4UARA 2C8KA 4Y2JA 2FPRA 3P96A 2CN1A 2AGVA 3ESQA 4JB3A 3KOOA 2OBBA 2CFTA 4PNHA 1WPGA 4UMVA 3AR4A 5A3QA 3RFUA 5AHXA 1MH9A 3OTQA 5AVZA 3FPBA 5ALLA 3KD3A 4O8CA 3ZTWA 2I55A 4ZEXA 4H1WA 3QU5A 2P69A 2JGAA 4UW9A 3E84A 2AMYA 3E58A 3L8HA 1NF2A 3IRUA 1U7PA 2QYHA 1RLMA 1L8OA 1PW5A 4QQFA 3UMBA 4BBJA 3SKYA 2W4MA 4C4SA 5ALWA 5AM5A 3FGOA 5AM4A 2JAWA 1SWVA 4RETA 2EATA 5AW8A 2I33A 1YMQA 3U7GA 1FEZA 3OPXA 3ZU6A 4G63A 3WK6A 3ONNA 3FVVA 2FPSA 3OCUA 1IWOA 3SD7A 3J7TA 3L0BA 2YN4A 3U7EB 5AVQA 3IB6A 4L6AA 3AR7A 1VJRA 2CFRA 3CZ4A 3ZVLA 3WGUA 2WF7A 2RBKA 3N07A 3UMGA 2R8EA 1RMTA 1ZRMA 4FFDA 5AK3A 5AKHA 3WGVA 1CQZA 1RLOA 2QLTA 3U13A 2AUTA 3L1UA 1U7OA 5AIBA 3AR9A 1XVIA 1RQNA 2WF6A 3NANA 2YY6A 1EK1A 3QNMA 3M1YA 5AVSA 5AW2A 2FDRA 1WVIA 3QU4A 2NO4A 5ALYA 4C4TA 4E88A 4HGQA 1RKUA 3I6BA 4UAVA 5ALSA 1Z5UA 1S2OA 4FYPA 2WM8A 2JAUA 3L0CA 3NALA 1Z4MA 2G07A 5ALRA 2EARA 3ET4A 1QQ6A 3AR6A 1Z4LA 2MSNA 3L0YA 4HGOA 3AR3A 2HSZA 2ZXEA 2C9MA 5ALPA 4YIKA 2WF9A 3RF6A 2IOFK 2B82A 4MUMA 5AM1A 1ZS9A 3UMCA 4IFTA 1ZD2P 3N28A 3W5BA 3A1DA 3W5AA 3EPRA 3WK7A 5ALOA 1RDFA 3ZX5A 5AKIA 1Z4OA 1ZJJA 4CF5A 5AVTA 5AW7A 1ZRNA 3MPOA 1QYIA 1RMYA 2NO5A 1ZD3A 4YCLA 3DAOA 1ZD5A 2FPWA 4UAUA 1AQ6A 1TJ4A 4UU1A 3QU7A 2GHQA 2G08A 2G0AA 5AVXA 3AR5A 3KDPA 1U2TA 2DQSA 2YJ6A 2BDUA 3OCWA 3GYGA 3VAYA 1Q91A 5AKKA 4DWOA 4HAIA 3F9RA 2G1AA 4XOUA 3MN1A 1Z5GA 4HGNA 3WKAA 5AK4A 5AI0A 4J03A 4AP9A 2I54A 4BYGA 2O9JA 3QU9A 4C4RA 1TJ3A 3TLMA 4L57A 3N5KA 3SMVA 4ZEWA 3U7HB 2FUCA 3HLTA 4GXTA 3ZUPA 3B9RA 2C4NA 5AKEA 3B9BA 4UMEA 1JUDA 4UMDA 5AESA 2B8JA 4NAVA 3R4CA 1Z4KA 1ZOLA 5AI9A 1L6RA 2G09A 1RQLA 1L7OA 2HOQA 3EF1A 5AW1A 2OA0A 4Y2TA 4UM5A 1RLTA 2HF2A 2YMPA 1X42A 3L7YA 4Y2RA 5ALIA 4DCCA 2I34A 5ALJA 3UM9A 2EAUA 4G9BA 4DFDA 4QJBA 1LVHA 1QQ7A 5AW5A 4CE6A 1F5SA 3AR2A 3PGLA 1T9ZA 1Z4JA 5AK5A 4BX3A 2OYCA 4KX5A 3FM9A 5AKZA 4CF3A 5ALXA 5ALVA
chains in the Genus database with same CATH superfamily
3ZHBA 3I04M 2EFJA 2VCHA 1EGHA 1FOEB 1XF9A 2ZJ0A 2ZULA 2JFZA 1VCNA 3ANYB 4QYMA 3PQ4A 4TQ9A 5IN4A 5CFQA 1HPLA 2A1TS 1GZHB 4WK0B 4YRMA 4XSVA 4DMRA 1CUWA 2XGOA 4G5GA 3HU5A 4M6WA 3RB8A 1E3EA 1UZLA 2ZW9A 2EL7A 2Q5FA 1RKQA 4Y6OA 3TZEA 5KDOA 5KYYB 3THWB 3CGGA 5B53A 1EBFA 3KQYA 3FFBA 5GAJA 1XF1A 3OFKA 1KZGB 1DX4A 3KWJA 3JAKB 2GO7A 16PKA 2F2TA 3QQPA 4KUEA 4PG4A 4Q9NA 4DEYA 5IM4A 1AX9A 2YX1A 3TRFA 4D41A 3SU8A 1XX6A 3QX9A 5TVGA 1QKIA 4NEQA 1NBMA 2O0KA 4JJAA 2ZR0A 1QVZA 4PG8A 1KMQA 5J63A 5K3FB 4CKXA 5EKXA 3I6ZA 4PGHA 4CU5A 1D9ZA 1NDUA 2PSJA 2WIJA 5EWLB 3W9SA 4MKIA 5ESDA 1ZL2A 4RD0A 1KRHA 1ZH2A 2CF6A 3STHA 4KPUB 1TLFA 3DDZX 3WNZA 3V8VA 3FLEA 2GEUA 4LTDA 3AH8A 2YY7A 1V8PA 4K6GA 4JROA 2PGXA 4O08A 1JP7A 3K0FA 2I6GA 2ZSBA 3IIEA 2FSFA 1X92A 3SJ7A 1V11B 5KO2A 5EA2A 1XCMA 3DWFA 2BGNA 2OV1A 3DV0B 3SJAA 4F7DA 3KOUA 1UK9A 1O2DA 1NQAO 1DU4A 1Q5PA 2HW8A 4I4LA 1F14A 5TRTA 1KTVA 3IULA 4M9XA 5IJAA 3FSJX 1SVKA 3MJCA 4FGZA 2FYTA 2CXXA 1UFOA 3P26A 1WX1A 3PI7A 3HHPA 1TK2A 3VR5H 3RGGA 3AT1A 4R9SA 2RJ3A 3WAKA 4CR8A 1QYCA 3ABOB 4UJ5A 5BW4A 3SBXA 3MJEA 1SU8A 4AO7A 3G2LA 2C7RA 1HNZB 3PQFA 3R0IA 2YVKA 4PEVA 3AEZA 1G2IA 2VYCA 1XDWA 2K2QB 1E0JA 1QDEA 2WZCA 2P4EA 2RDMA 4P3XA 5ED4A 1KY4A 4BBPA 2O07A 3KR9A 1XZPA 2H1RA 2Q99A 5BYBA 2CL0X 3GARA 3Q6MA 3FH0A 6Q21A 4DA4A 3ZNQA 2WE7A 4UDYX 1MO6A 3ABQB 5HFJA 4HN9A 4DGSA 4DJAA 3HXQA 3T7DA 4B3XA 4X65B 1FW6A 1QBKC 2QRZA 3R9IA 4BRUA 4EA6A 2PT5A 3E5RA 3MMNA 3C45A 3SHVA 4CCSA 4CM7A 5CFRA 5I7FA 2EEPA 1VPVA 4WBNF 5HM8A 1QBGA 2CWDA 4OUKX 2QMUA 4H1TA 3EOBI 5CFNA 1PBNA 2BFEB 2VDRB 3ORFA 4IHQA 4DANA 1SCBA 2BSAA 4KN8A 4XCQA 4PX9A 2J0UB 1LWOA 2QD1A 3A58B 3CVWA 3EVNA 2ROQA 1RI3A 1L9XA 2Z2ZA 3FUTA 4XYEA 2Q7OE 2H85A 4IMPA 4ZO8A 3M6WA 5KOIA 3F8TA 1C3JA 2QY6A 4AY5A 5NULA 4YGXB 4YROA 3RVPA 2J5BA 4GBED 4N39A 3HJGA 3JSXA 3NBAA 3QXCA 5DGTA 1C3EA 3MS4A 3LBAA 1U9ZA 1R9MA 1L7EA 4K87A 5FA8A 2D1YA 1WR8A 4PSDA 1GAQA 4E14A 1A5ZA 3I6MA 3M89A 1N1MA 4BZQA 2MDTA 1EDBA 2XUIA 4DLBA 5H16A 3ZGVA 3DMTA 3ZK8A 2E85A 3GCXA 4NZOA 4PYRA 3ZBTA 3O3MB 1GGNA 4JQYA 2O4CA 3F47A 4GZ6A 4LJKA 2P1ZA 4KXVA 1MJNA 1A9PA 2I67A 3EARA 1GV0A 5AUQA 2WU8A 4OQXA 3LBYA 4V39A 4J2OA 1C7QA 2PTGA 4BMNA 1TAHA 2WHYA 4FE4A 3QVOA 4ZO7A 1R16A 1TGYA 1IFXA 2ALJA 2ZAYA 2QTGA 2WR8A 3OPYI 1G5TA 3FGNA 1TTQB 1MOZA 2MU1A 2OUKA 2PZKA 3BMOA 1NNLA 3QENA 4FT4A 3Q7EA 4HQOA 4MOWA 3UB2A 1H8ED 2PS9A 3QI7A 1KI1A 2PVSA 1DTWA 1TQHA 4WLFA 3I72A 1L5HA 1P1IA 4LYJA 2CMKA 3M5PA 3PEFA 4M1KA 5AIAA 1FYDA 3D5QA 5A4KA 4TTRA 2DKFA 3G5LA 4FPXA 3SX0A 4X1IB 4MLDA 2VF4X 4C07A 5ERGB 2CVPA 1DUVG 4IZHA 2F64A 3MQFA 2HA0A 3AI7A 2D28C 1C7FA 1QIGA 1EHIA 1B73A 3W5CA 2J31A 3MA0A 4H6VA 1DQZA 2QUZA 1SY7A 3CONA 4RTQA 5AVYA 3ZDBA 3N2ZB 4Y2XA 4RUKA 3FTNA 2OYSA 3KEQA 4OSPA 1C3CA 4IWNA 3L7AA 4G9EA 4DNPA 1QFZA 1UH5A 4GC5A 4HRVA 5FV7A 1GARA 3L1VA 4W6ZA 4OQQA 3WWZA 4I08A 7YASA 1H65A 2GCPA 2VNAA 3EZ9A 2QPTA 2A0KA 2X0NA 1PG0A 2ZSHA 1B0AA 3HP1A 4GLLA 2GO1A 4GT1A 3U0BA 5HGXA 1J49A 1T5LA 2X77A 5F7JA 3DNPA 2RSLA 3FJYA 4NCNA 3VDQA 3IPCA 4YJ2F 2ZG6A 3TLBA 5JI3E 1XP8A 4GOKA 5ILOA 3N7TA 3D81A 4BQQA 1UK6A 1W48A 2V4UA 2CNBA 2QGFA 4DQXA 4JYBA 1BQ3A 4QQ8A 4A27A 3KJXA 1XCPA 3OOWA 5D1NA 5C7OO 2R8PA 2HN9A 1NVWQ 3S2IA 4Q34A 2YXBA 1J8VA 1P29A 3PFWO 5H83A 4A5SA 2Q5HA 2XQIA 3JVIA 2DFNA 3O82A 3OC0A 2YMLA 2H59A 3C6ZA 1R4NB 2JG3A 3LPCA 4TL9A 3WMWA 2F9MA 5CR9A 1JMYA 1ESCA 1GYPA 1Q44A 4XR9A 2CLKB 1SBYA 1X7YB 2FN9A 3NS7A 3DVLA 4RMGA 3D8RA 2SKDA 3SOZA 1H2YA 5LWHA 3Q3JB 4E03A 3NHYA 1D5CA 3W8RA 1VKJA 2WSYB 3KYIB 2CJYA 3FSRA 4JGBA 1P1JA 4M49A 3SK0A 4YMWA 4DQDA 5K6RA 1JSCA 1G21A 4C6TA 1KMHA 2P62A 2QM8A 3NW9A 3U26A 4ND8B 2LRHA 3ZW7A 2LP4Y 3L0ZA 1YE8A 721PA 3K9LA 1GRQA 2W4IA 1YJ5A 3TTXA 3SGLA 3M3PA 4G5RA 3PIRA 1PJRA 2DC1A 2H9AA 2X5XA 2RGWA 3H5TA 3O73A 3CLVA 3I39X 4M8IA 1MW8X 1XR3A 2Q2VA 2NTNA 2GARA 2VP6A 3M1LA 1UWLA 3STWA 2I87A 1V7QA 1BTOA 3I6QA 1GU1A 1JWBB 4Y2JA 5CRIA 2ZE8A 1XXLA 4PF1A 1OFTA 4YLYA 5JYDA 3A4YA 3WFJA 1XA0A 2CBGA 5T64A 2WVAA 3J81A 1GNLA 3PCRB 3DMTC 3O90A 3Q40A 3H2YA 2PVPA 3H8WA 4FJ2A 3ZWXA 5FTKA 1M8JA 2A88A 3EVEA 1QMGA 5BSRA 4CMAA 5IZCA 1D6JA 2C4TA 4MR9A 2P6RA 1LJUA 2J7PA 5EINA 3B89A 5KQPA 4JJ6A 1SAYA 3AETB 3EHEA 3NOOA 5JUWA 1JHDA 2PGAA 1TMGE 2IE8A 2NVBA 1I13A 3GZ4A 3IP9A 1JKFA 1M33A 1UC5B 4J6EA 4PO9A 5TEVA 4ZI7A 3HCWA 1ZHHA 3OU2A 4Q4DA 2FCAA 2Z95A 4MPPA 3TTVA 2DQYA 1KO1A 2O2EA 3TUIC 4EFDA 3TXAA 1QR6A 1KFCB 3N59A 3ZZ0A 3R74A 2XE4A 4N9WA 2B83A 4OQ4A 1NYTA 1C3OA 1TPZA 3JD2A 4XFJA 1YI0A 1H2BA 2Z4TA 5AW8A 2HPAA 3FTPA 3GK3A 5EFZA 2ASEA 3SZMA 3TIVA 1GITA 4R05A 4J29A 1TEZA 3VR2D 2HA6A 2TMYA 2XDQB 4JLUA 3WMRA 1YJQA 2BFOA 1VLLA 1Y1TA 3EJ6A 3L0BA 3K20A 4QGHA 4I5FA 3TR5A 3ZV3A 2DZDA 2HGZA 2ZYUX 5HILA 1Y5NA 3V97A 2BEKA 1QLWA 5K05A 1RWKA 3AY3A 4TZ6A 2FMUA 3DFFA 4RHYA 1IHYA 1SOWA 3PC8A 4X6LA 2HHCA 5K4HA 4H7DA 2WHQA 4JMPA 4RYLA 5A1TA 2QSUA 5T4FA 5HRCA 4H15A 1QFSA 4JHXA 4GLFA 1G5QA 2GDZA 3TR0A 1QIDA 4C1BA 3B13B 1G0NA 1KETA 4WESB 1UXOA 3ESYA 3STUA 4Y30A 1HDCA 1K8XB 1AQUA 1UEXC 3NBFA 4Q6BA 1UWCA 2O2IA 3DYIA 3I45A 1CK4A 1V16A 2CSUA 2GZRA 4EUFA 1Z0JA 4HR7A 1Q11A 1W4AA 5K03A 1GUDA 5A62A 1K7XB 3NHKA 4FUTA 3KSBC 4RF5A 3E2PA 4I8IA 3EZLA 1SC4A 2HLPA 3OMXA 1Y3FE 4HDSB 1U5AA 1QH8A 4IJKA 4M8SA 3ORSA 3FI0A 3FZGA 4D9JA 1YA8A 4HRXA 4JYAB 1L7QA 3R5FA 3F3SA 1SKYE 5CBPB 1QG4A 2J3DA 3MOSA 3ZVKA 2Q3LA 3GB9A 3D2LA 4TUYA 2DT8A 2GA9A 1YVUA 2O20A 1GEEA 1UBRS 2NN3C 3A1SA 2GJKA 4QUDA 3AL3A 4LBZA 2RC5A 2MSNA 2XCOA 1PJTA 1DUSA 4YRRA 5B1DA 4IH4A 2NSLA 5HKOA 1E6WA 1JEQB 1FQWA 1SG9A 3RVRA 5ALPA 4MGZR 5B7GA 1H4TA 1F4VA 1VSQA 2VXCA 3WJ2A 2YWDA 3OAAD 4M7RA 1XRMA 1S3IA 1N6IA 2ACVA 3BKWA 1JVSA 3FWYA 4ZQHA 4ATNA 2HWUA 1RQXA 3DBHA 3A3OA 4ZOLA 1ZD2P 1ECLA 2PUFA 1Z3CA 3KOYA 2CHQA 4O33A 3V42A 3PTZA 3WTBA 1K8RA 1U2PA 4J0JA 4OEHA 4BKPA 1PQYA 2P77A 5ALOA 3B1JA 1RDFA 4JXZA 3K0CA 2OBFA 2QK4A 4X3PA 3DZCA 3K9NA 1A72A 3BPSA 4O1HA 4CQMA 3P9SA 5AW7A 5IZCC 2PSEA 4OBXA 3PDIB 1GGVA 1GUAA 2NZVG 3F9CA 1ATIA 4KE6A 4QQNA 3ZHVA 3SQLA 3BILA 4MVYA 5JRJA 1Z5VA 3IUQA 5ARDA 2QXTA 3OBBA 2C1EA 3IC5A 2C9BA 4OJYA 3TSCA 3DVAB 5BVGA 1TJ4A 2I62A 2PLAA 1JXAA 3RC8A 3TAXA 4KKVA 2DFTA 3KDPA 3LPMA 2X9GA 3ISTA 2W6QA 3LZ6A 4TVOA 1QQBA 4HUQA 2DPHA 4IW3B 2NUBA 4C29A 1QK4A 5FBHA 1P4RA 2OLKA 1IUPA 5ICGA 1GGEA 4O4JB 3VA7A 2W8ZA 1ST2A 3Q0IA 4ZO9A 5IK2D 4BGVA 3VGJA 3UAYA 4UNNA 4LY6A 1T8UA 3EGOA 4J3JA 1LI4A 1IONA 2XTZA 3E2IA 1U0SY 3QM1A 3GUUA 1Y80A 4K9KA 4OAPA 5EWMA 4DNXA 4F4HA 4XZ3A 4ER6A 3K70D 3WWCA 2VFAA 4E46A 1WDLA 2EBFX 4Z8YA 3IT1A 3R8CA 1NUPA 3ESBA 4ARCA 2IS6A 3E2MA 1UBCA 3CEMA 4L57A 4YO8A 1SD1A 1NP6A 2FFBA 1MO3A 4QHTA 4EMTA 3E9MA 2OC4A 3GLUA 2YYSA 3PC8C 4R1LA 2XT9A 3HLTA 4GXTA 4ZMSA 5HXAA 1XLVA 2JDIA 1EUQA 1IHPA 1LLQA 3MJSA 5J40A 1SJ9A 4RVSA 4KI7A 2X8BA 4UMEA 5L3SA 2LV8A 3JZAA 1G8MA 3SX4A 2NV0A 2AQKA 1OJLA 4AJHA 1W96A 3B6KA 5BYAA 3ORYA 2TMDA 3HCOA 6REQA 1K68A 2WLTA 3NBXX 2OFPA 2H9YA 1EESA 3MWDA 2ONJA 4UTPA 1ZOLA 3AW8A 1L6RA 3C1UA 4BB6A 3QE0A 4NFYA 1TUBA 1XRNA 2Q4OA 3PYMA 4L8GA 4PC7A 2C5FA 4WECA 4B6SA 1U9YA 2CNOA 2FKAA 2R4UA 4Q00A 4R2XA 2ECKA 5AW1A 3R7DA 1YRBA 3KR2A 4PQEA 4XFKA 5A6SB 1QO7A 2EF0A 2QL6A 4LRYA 4ZOEA 1CJVC 2GI4A 2QSZA 3G7SA 1L5QA 3LOPA 3FMGA 4QLAA 1D4OA 3W77A 2VOEA 3LUFA 1L4UA 3B1WA 3PR3A 4E6PA 5GINE 3UXYA 4HWGA 3MLBA 4RJTA 4W5TA 5I7SA 2VPXA 5C7LO 1FUYB 4KQ2A 5J43A 2OQIA 2NU7A 3T3EA 5DK6A 2I3GA 4IDCA 1U6KA 4HAXA 4AF6A 1NTRA 5P21A 1UKYA 4LGCA 2AXNA 3Q3IA 4ZGGA 4MHTA 2EBHX 1JEEA 1UC4B 4Z3KA 3ZEAA 4CG1A 1NJGA 3GVCA 3GG2A 4JHLA 1H9CA 3VOAA 2ZIVB 4E5PA 1NU6A 3N8IA 4R1NA 1KKUA 1KVSA 3PG5A 1WCYA 1NNI1 2MYPA 3PGA1 4H6WA 2JATA 1MQSA 4CTOA 1ZH4A 1HE2A 1XZGA 2LCFA 2OHVA 4N3AA 4YB8A 3U17A 3K0CC 4BNVA 5THXA 4NFHA 2CE2X 2QN7A 3A9TA 4W82A 2JI8A 5FULA 4AO8A 3TVYA 1YCGA 4RD4A 1C7EA 2M32A 3A25A 3NFYA 4GVLA 5FFMA 4B6JA 2JGMA 2IA5A 2I22A 3BWYA 3Q7SA 4W1QA 1I2ZA 4YDHB 3DBVO 3ESDA 4YT5A 3SAJA 1IHOA 3Q7IA 4BHTA 3JD0A 3X1DA 4JV5B 4WNIA 4WJLA 3JU3A 4KYIB 5IU6A 2DHDA 4O29A 1E6UA 2QTNA 2WAOA 2YUIA 4RDXA 5FI0B 1U3WA 3L9XA 3DEAA 4OHBA 2UZ0A 3E7PA 1FC0A 4N18A 1RC8A 2PGDA 1QHHB 3TSYA 2FXVA 3FPSA 2ICAA 3UWDA 3WLSA 2DTEA 3I2JA 1VJ5A 3RVJA 1XSEA 1HTWA 2P78A 2WEKA 1XMVA 2Q5OA 3QKIA 3WI7A 1YIOA 2MMCA 1YZGA 3GUCA 5LP6A 4RE6A 1Q1BA 4OJTA 1DCNA 1L8XA 4RSGA 4YO7A 4ADLA 3OX2A 4XH9B 4A91A 2GGSA 5BV2P 4C43A 2OCXA 3JATA 4ND7A 2A3NA 4KE8A 1RCTE 3R3HA 2EZUA 2BMFA 3ZGYA 1U2SA 3JSAA 3EDRA 1J99A 1FNSA 3OJCA 2CUKA 4LA4A 2OZLB 3TZBA 3UNXA 3ROTA 1BYIA 2O8BA 2D1RA 1E9FA 2WT9A 5EJEA 1ORRA 3TGPA 5LQCA 1K98A 5JJKA 3FYSA 3M83A 4X8OA 5CAEB 2XTJA 2YC4C 1TAUA 4TWBA 4JASB 5ALMA 5HS6A 3SQXA 1P1BA 2CBXA 1JU9A 2IXEA 4AROA 5CJ2A 1RXCA 4D6XA 5K4GA 5EHIA 2ZYVX 4EKIA 5JXHA 1O0BA 2ZJ1A 1RHJA 3ED5A 4BNXA 3HR8A 4W5HA 4AX8A 3EZ6A 3N1UA 1ONOA 2X1VA 4EH1A 4XYMA 3Q4GA 3I64A 3AFMA 3AF0A 4IYRA 5CW2A 5ALEA 3R7WB 3A1TA 1XHLA 1AKQA 4TMVA 3W78A 1NW7A 1TCCA 2P35A 3LDFA 2CL5A 2JJQA 1FXWF 1ICIA 2DTXA 4P3PA 4XQEA 1NP7A 3OOYA 2WYWA 2WNHA 2FDXA 3RRYA 2IY7A 2VJMA 3OWOA 3GWGA 2IZ7A 3OEHA 3U4IA 5HEKA 4DLYA 4PAWA 2J5XA 4YJKA 1SXJD 3O93A 4DQKA 4U2KA 2V9CA 3F5SA 3JYPA 1TTTA 4X8LA 1R27A 4RPJA 3RHTA 3Q7QA 4BE7B 4PHFA 1Y8RB 4DT1A 2OOSA 3IMKA 5HJ5A 2F4VB 1SXHA 2OBLA 2R2AA 2UYHA 5HR5A 2Q6IA 4IO1A 1P72A 5T8KA 3OURA 1RQ2A 4N5IX 5CVJA 2ZRNA 4R84A 1B1AA 4OHZA 3ZZMA 4RBNA 2YZGA 2P9JA 3PFFA 4MB2A 2E6UX 1ESNA 5CNMA 3ROZA 1SU7A 1DRVA 3BVPA 1HFEL 1CNFA 1RZVA 3ZNOA 4ZCMA 2QRVA 4Z9XA 4EW1A 1R8QA 3Q87B 4AMGA 4YCMA 4WCFA 4Z4QA 4OHOA 2VPPA 4O2BB 1D0IA 1U8UA 1U0BB 1G63A 2JLUA 3KYJB 4LF9B 4MYCA 4A73A 4U0KA 3DFKA 5JSYA 3UA4A 5E7QA 3Q1LA 4MQEA 1UBTS 4ZI2A 2PU7A 5FKJA 2BD0A 4EHKA 2Q6LA 3HBAA 4MS3A 4PLGA 4EL0A 5CA0B 1Z63A 4DIDA 1ZM7A 2PT7A 4JSTA 4JJZA 4ZZ1A 4PLYA 3A14A 4QJ5A 5CG1A 3R3XA 1HDOA 3NMUF 3TKLA 4RZSA 1AK1A 4TSKA 3E03A 4BLUA 4EZBA 3Q3CA 1YACA 4ILKA 4CLOB 1KRXA 2PUDA 4C7MA 5U1PA 1NKTA 1NG9A 2NU8A 1E6CA 1TO2E 1U0GA 2FPXA 4OGFA 2HDOA 4XAQA 3V5NA 2HBRA 1EU1A 2GETA 5KEIA 1U9JA 2Q4DA 5DH9A 4GKBA 3DJFA 1OWMA 5IKEA 3FCYA 4UHEA 5DBFA 4BX8A 3LFTA 1YE5A 4PTLA 3GEEA 3F7MA 4QHSA 5B7QA 3GY0A 3HBLA 1PCXA 3AB3A 1THTA 2VNIA 2ZJ5A 4KC0A 1XQYA 4ZU6X 3S8MA 4ZIRB 1R0BA 1XE3A 3HZOA 5I47A 2C0PA 2WBLC 5LP6C 3ZWMA 3TPZA 3OM1A 5KYNA 4QGSA 4UCFA 1JDUA 3VISA 2Z3VA 2ZANA 3JQAB 3P8ZA 4MKGA 1MLDA 4C0KA 5CDSA 2C2MA 3GJ7A 5HA5A 1QIMA 4NOKA 2V96A 1U0TA 2IOHA 3T7EA 5HKKD 3T9AA 4WOJA 3COWA 4NHOA 2D2VA 3OPYA 3ILXA 4TS4A 2TSYB 1H69A 3VPSA 5TMBA 5K8CA 1BU5A 1JDNA 1E9RA 5BN4A 5JO0A 2ZR7A 3UT5A 4P7BA 3R3ZA 4UKDA 3EBPA 5BWOA 2PUGA 3ONWA 4BJ6A 2QG4A 4DDMA 4HFRA 2I78A 5C0OE 1TCVA 1XRPA 5DHRA 5EE5B 4N0PA 1XELA 5IC4A 1GPLA 3NDPA 5TR9A 4DCGA 4MPTA 1YB6A 2FEPA 1RQGA 4FGSA 3VR4H 5KNBD 1ZNYA 1C7RA 1Y37A 1H6CA 4P08A 3H3FA 5T3UA 4HQRA 2YDXA 3RIEA 2HJGA 1S3SA 3DXXA 3H1FA 4WJZA 1APBA 4CKWA 5AXAA 5KOHA 2YZ2A 3U0VA 5LUAA 4FW8A 1HL3A 1ENYA 3RLIA 3EDQA 4LYYA 1YOBA 5IXYA 3HSYA 1O03A 5KAMA 1I0IA 1ADGA 3FBTA 4KSCA 2RAPA 4G8CA 5AW6A 1YZNA 4JFAA 4C7VA 5THKA 4ZDIA 3LW8A 2PKEA 1H1LA 4GDMA 4HDNA 5LXTF 3TF5A 1JIXA 2O19A 1X1EA 1CE8B 2E48A 3UJAA 3O4JA 4PAMA 1QVVA 3S29A 4F9EA 5KBYA 2V7VA 3ZXUB 4YFYA 2MSDB 2MR5A 1QXSA 4YUVA 2YJ5A 5IFKA 4BGIA 2WWGA 5T8KC 1L5MA 4EVSA 1JYSA 1RI2A 2I7TA 3PC4A 3OM9A 1N0IA 3UWPA 4IRUB 1H4VB 2WF5A 4OO3A 1UZNA 2ZE7A 2NYUA 3CGWA 2H52A 4OL0A 1DNPA 3KG2A 3QMPA 3AUAA 1VQ1A 3K92A 3DD1A 4W1PA 3NKFA 1N4AA 3SDBA 3EBLA 5AQ1A 4FEGA 1JFFB 7REQA 1RC1A 3BM5A 1H85A 3RG8A 2WKPA 3QE3A 4NKRA 2EXXA 3JTEA 4PZPA 4WCFC 5A06A 1DQNA 2OK8A 1QRUA 4AP6A 2CV2A 2F8TA 1DRUA 4Q16A 4BAGA 3I9JA 4Q9KA 4Z4FA 5DZSA 3EN0A 3VTFA 3V1MA 4JQOA 4Q48A 4EYQA 3IOYA 3FMVA 1QGUA 2FR1A 1QM5A 5CFMA 1IN8A 1YDWA 4I50B 5CXXA 4AQYB 1VP9A 2PRZA 4PWZA 4EBFA 2HK6A 2R6DA 3H0KA 2RJOA 2OORA 4ETMA 1E5QA 2E7ZA 2O06A 1UBKS 1WPGA 4CEJA 4UD2A 2XA9A 1EUZA 1SXIA 5DXAA 4X94A 2IUFA 3EXFB 3VR0A 5I48A 4D8TA 1YDGA 5L6MB 4L9SA 3B82A 1S1MA 3HU3A 5U4XA 5IJ0A 4AJNA 1Q0UA 4F6CA 5IAAA 3QU5A 3GJTA 4XGNA 1L4MA 2VA9A 2IIBA 4G26A 4IX1A 4B6GA 1Y6JA 3E84A 4ZVTA 3P0EA 1IHXA 4HLQB 4KXWA 3VZRA 2GKGA 4FINA 1JJVA 2K6GA 3RARA 1HR0B 3IRUA 1S9DA 1YKSA 3D6UA 3WRVA 1PE0A 2BI4A 2AZMA 3O92A 2A7QA 3FCOA 1SD5A 4XASA 3FJOA 4QUBA 1WXGA 4PRZA 4R8MA 1DEOA 3DZGA 3MCUA 2FOLA 3QMWA 3R0XA 4YREA 1IWBB 1N6OA 2JAWA 3SF8A 3GRKA 4B3RB 2H7VA 4QOJA 3V2GA 1MQAA 1S7CA 2EATA 1BWPA 4ZAYA 1L5NA 1R5BA 3ZDRA 3KR0A 3F4TA 1YMQA 1TTPB 1N2CA 1U0EA 2WVGA 3OEYA 4JU8A 5C7YA 2HWKA 2PH5A 3W6OA 1HNNA 5SV2A 5KPJA 1ZDMA 3CHYA 3R3YA 3TIXB 1TO1E 4NYIR 3FN4A 3U16A 2M98A 2EJWA 1J21A 4KLZA 3SYKA 1WV1A 2JAXA 4DBLC 1FNDA 2XCRB 3PWSA 5FNVA 4FGKA 4PLHA 3TMAA 1XNGA 3GJ4A 4LYDA 1I9CA 4OHCA 3PJDA 2BZSA 4C6HA 2Z6UA 1SBQA 5EKTA 2FB9A 4W99A 3LVFO 5CPFA 2HR1A 1IG3A 2OV2A 2OSBA 3IV6A 4GOND 1IQPA 2EFDB 1MJGM 2SNIE 4JUCA 3BXXA 5E8RA 5K8TA 3U13A 1GG9A 2PXXA 3A3PA 3HDQA 1W8IA 3DPUA 3IT3A 4LECA 2ZS9A 4HC4A 4IILA 1HWYA 4HEA6 2E5LB 1H6BA 3NEAA 2RKBA 4ZC1A 2QAGB 3LFHA 2C00A 4LSMA 1VA5A 5D7BA 3P94A 4Q4CA 1PZNA 3OPQA 4IIJA 3FLBA 2LCQA 1OU4A 3CVVA 3CURA 2FQWA 1YK1A 3CNOA 4LGYA 3GPLA 5G40A 4UAJA 3ZR4B 3RYCB 5AXBA 1N2HA 5LOVA 3TDKA 3F90A 3NH6A 1PT8A 4E88A 1N7GA 4K03A 2GCOA 4IYJA 1RKUA 3I6BA 1RPAA 4PU0A 4D79A 1OXUA 1RWVA 4G07A 3VH1A 2PTSA 1KK3A 2ATCA 3BF7A 3MW8A 4AUMA 3CRNA 1R64A 3G1UA 3KTOA 1JFSA 1QYXA 4PYIA 3BIXA 3PI6A 3DKIA 2AK2A 1O0CA 4WPGA 1W34A 5G53C 1X87A 2R97A 2IY8A 3DG9A 1K9SA 1LS6A 2HWXA 4ZRMA 5DIFA 3OZEA 3QMVA 1CR4A 3QKSB 2ZVJA 1NLZA 1XAGA 3C7TA 5C3MA 1JB9A 2VPQA 2VTEA 4QULA 1JLRA 2DBYA 1JXMA 1OLSB 3E6AA 5F5XA 5IM5A 4OMUA 3ZY5A 2BGJA 2ZB4A 4LWQA 5KMGA 5FUVA 2F59A 1FX0B 3V8NA 4B2PA 2QP9X 2A9PA 3LPNA 3NXKA 3UGKA 2WKQA 2OORC 2QU8A 1VHWA 3DBIA 2NGRA 2XBMA 3ZLUA 3MWFA 1DDIA 4Q1DA 5HS4A 3A6PC 1GAEO 1PEKE 3L2OB 1ZJJA 4EATA 5AVTA 1OB5A 4D46A 2FP4A 1Y9ZA 3QKUA 1FU8A 2BSXA 1LBSA 1GCAA 1YNOA 2J0EA 4OQLA 3OAAA 1ND5A 2D00A 4N0DA 3KTAB 4UNQA 5D5HA 4JEIA 3D6NB 4TLAA 5BWLA 1MV8A 3JR7A 3KUDA 1T2AA 4NBLA 3T7TA 3UK2A 1TVMA 3JXEA 1N0WA 5H3HA 3T4UA 1J22A 3NETA 4LBVA 3RC1A 2HRZA 2W2LA 3SSNA 4DCVA 2BMJA 1DWOA 3GZJA 3WNQA 4AJ1A 2I9KA 1OFIA 1Y5LA 3OE5A 4JQCA 4RVHA 1RHQA 1Z12A 4HAIA 4KQXA 3QHPA 1E9EA 4YDRA 2G1AA 2MWMA 2O8EA 3KIPA 4P4LA 2X58A 3DO5A 5AHKA 3JQCA 1OZ0A 3DE0X 1C3VA 3IDSA 3BEDA 4JJGA 4PSKA 4Q4LA 2R62A 2J6CA 3BH0A 1J56A 1ZISA 2XMSA 4MQFA 1P17A 3SYNA 2I54A 5AXDA 1K75A 2YJGA 3OIDA 3QU9A 1K3FA 2OBYA 4RMIA 3AQIA 4ARIA 2V0NA 4E08A 3PPWA 2CXSA 3Q10A 5IK2A 3RBZA 1IHUA 3B9RA 3QWAA 3B9BA 4Z99A 3KQWA 3RBVA 1CRLA 1QP8A 3BJMA 4HNAA 5ITZA 5K1ZA 2X8JA 5AO9A 1T1RA 3UCFA 5KQRA 2R9VA 3K73O 3AVTA 3NUGA 2BF7A 3GI1A 1O6GA 3I9LA 4CU2A 2JFGA 3HYLA 4G65A 3ZV5A 1NFRA 1K5PA 2P6PA 1LV7A 3WL7A 4AWAA 1P3JA 2IU6A 4CL3A 3OHMA 1GY8A 3F5FA 4NK4A 4KYVA 1TQDA 4U5XA 2GN8A 1US8B 5CEFA 2OA0A 1OYOA 2ZM6B 1RLTA 4OHYA 2CFCA 2PPLA 2Z9BA 2B4KA 3TWOA 3L7YA 4LKOA 4ZZ2A 2X0EA 2XLBA 3BAFA 4ND4A 1ISSA 1QNFA 1RXIA 4NCBA 1ZCZA 2Q2OA 3U1VA 4JYCA 4FWIB 3L4BA 3SLGA 3BSYA 4EYSA 4F93B 1CQWA 4R7TA 1FFSA 3ZUGA 3A6HA 1MJFA 1YZ3A 3P9CA 4UPVA 1QQ7A 3RHFA 3L9WA 1O6FA 4MO9A 5EUMA 5FQOA 3IGFA 1HLGA 1ODJA 1ZKDA 4EBBA 5IUNC 2JC3A 1JALA 1DJQA 4CE6A 3QYJA 2FPPB 5LQSA 4QDJA 1HH4A 3ONEA 4RPGA 4GFDA 2PGOA 5MFZA 4XYGA 2AE1A 2FMHA 3CWQA 4KWEA 2J3EA 2N47A 1GIAA 2BJWA 3JZFA 2RGNA 1D2NA 1DB3A 4P36A 4IQ8A 4RVGA 3O2NA 3G2IA 2WWRA 5AK6A 3WYDA 4V1CA 4X64B 2VTVA 4GPIB 4G0ZA 1QZXA 4DV4B 5D2CA 1JU3A 3TRKA 3V4ZA 5E6UA 5TE9A 2WWXA 4OG2A 1KBOA 5ALGA 2QG6A 3FYCA 3WKBA 3KLPX 2NVOA 2NYVA 2QN9A 1BA3A 1F8YA 2CZQA 2O7NA 2XKAA 3EZYA 5F77A 2EZTA 2BYTA 3JZDA 2PIDA 4JT4A 3M49A 4GNKA 2APJA 5EGNA 2OFWA 4JLMA 4KWTA 4KGDA 4Y2VA 4FZRA 3KALA 4HMQA 3T9BA 3FKSD 5LL6P 3PTLA 2Y76A 1QV7A 1ZSNA 4FHDA 1XVAA 1OVMA 3QWIA 4N3BA 4YJHB 3DUWA 3CVJA 5IBCA 4N5HX 3QSYA 1MB4A 3RTGA 5A0FA 2RI6A 1EVQA 3DT6A 3WKEA 4IGFA 4WD3A 1DAFA 1UBSB 1ZOIA 3IEKA 1JYEA 3CZAA 3V8EA 4WIAA 2VDVE 1CB0A 5IDQA 1ZM9A 4QXPA 5C8YF 1F6WA 1RYHA 1R5JA 2GBIA 3M8KA 2C92A 4L5JA 2C98A 2O2YA 3GUZA 1VYTA 4R8VA 5BNFA 4Y1RB 2B21A 4CLHA 4CTNA 3FWZA 1QHEA 2QF7A 1EXWA 3IIMA 5DPMA 3WLJA 4EEXA 5B1EA 1TNDA 4Q12A 3HKCB 2BFDB 1TXGA 1UOPA 4RHXA 2O2ZA 1QTNA 1CX9B 5D6NA 4J0EA 3DW3X 1EA7A 1QGOA 2O0JA 3IVRA 4GR4A 4IHJA 4IV5A 5EMJA 4EABA 5I4IA 1Z28A 1MEEA 1BG6A 4R4JA 3A1EA 2SKEA 2R00A 1MB2A 3ANSA 3KXIA 4F4UA 3V33A 4PCVA 2XRZA 3EGDB 1LDGA 1GG8A 2J87A 1T2FA 2DPLA 4MWGA 1DEXA 1KYQA 1S01A 3NDJA 3V55A 5L4NA 5MN6A 4MKHA 3ADKA 4YP0A 3CTPA 1AS3A 1VSUA 3VU1A 1MZVA 3RSOA 4M54A 5GONF 5K0ZA 1QK3A 1V1RA 2VNKA 3OF2A 3W90A 4FZJA 2XMCA 4XJXA 3NNDA 4PAQA 4X6YA 1OFGA 1ZUNB 1G4UR 3L84A 4YGYA 2OEPA 3TJZA 2P9YA 1PT7A 1KI6A 5JD3A 4BNMA 4EGQA 4PZUA 5JISA 2AS0A 3A1CA 5T5QA 1V5IA 1YB5A 1HE1C 1G8HA 2AN3A 2A67A 2P79A 2PKWA 2JI7A 3FFWA 3HJNA 4U7DA 4NBUA 3P9XA 1JG1A 1QIEA 5FFNA 1WKBA 5IH3A 3UV3A 2QWXA 4JCOA 4G0NA 1NBAA 2WHXA 4KAXA 3MCAA 4MNTA 5CT5A 4UM7A 4D7AA 4OIMA 4QFCA 4MCIA 3VDNB 5C1IA 2VPIA 4DA9A 1WWKA 3EK2A 1N36B 1HRDA 1IPHA 4EI9A 3EA5A 5M3BA 1W73A 4HZIA 4JI3B 2VP4A 4K6KA 3PNVA 4PYQA 4OK3A 2JASA 2PJRA 4RWZA 4N41A 1R0ZA 3EIUA 1UDXA 3DFMA 3KYCB 2P9QA 3MMZA 5F3RA 3WBBA 3TFOA 2QMHA 1QGAA 3VNQA 2PXAA 3KZXA 2YJ4A 4QBGB 5ABPA 1K4KA 3NRBA 3B5EA 5JR3A 4E5UA 3TGWA 3DZKA 2RGNC 3TN7A 3ENNA 4DLPA 3RIHA 1W47A 1N8SA 1W4ZA 4J1SA 1LC0A 1SXJA 2KS6A 1I5RA 1P4JA 2XKJE 1NXPA 4JYMA 1W29A 3PE6A 1PL6A 4JDUA 1HLPA 2RI0A 5BPHA 4B74A 1COWD 3SI7A 1FSFA 2B7CA 3PHGA 2NXWA 5ALNA 1H4QA 3ZJVA 2RCYA 3LCUA 2OV4A 3W8FA 3DUFA 5GMOA 1AN0A 2HU2A 1NGSA 3CLRC 4RIEA 2WPDA 2A8YA 3HXPA 1VYUA 1Y6RA 5C1OA 5BN1A 1F1BA 3GR6A 4HDMA 5K3CA 3QX7A 1E59A 1GPMA 3WBFA 2PFSA 3U1TA 1Z6YA 1MC8A 2PGLA 3E9ZA 1R0CA 2FEKA 2YOHA 1OROA 2RH8A 1OA0A 3AIMA 4ONEA 5JPIA 2GLXA 3EEYA 3BGWA 1A2KC 1HXHA 3NDRA 2FPUA 2Y1LA 1A2BA 4DXAA 3FNHA 3OZUA 3W5UA 1E2FA 1X74A 2BFMA 1KJQA 2IX9A 4IMIB 1OZHA 3LF2A 2BKUA 4INAA 1SHKA 4K5QA 4KFTA 2G9NA 2E87A 2BP7B 3RC7A 3IAM6 4G23A 3H5VA 1TYEB 1DFIA 1EH5A 1GPJA 2YWRA 3EE6A 3KKNA 4QEDA 2EDAA 4ZT7A 2QJWA 1U02A 1ULBA 4E32A 4Z4IA 2RB5A 1NJ5A 1WSAA 3IHLA 3K4PA 4U7FA 4Y6LA 3V32A 3RRJA 2XOXA 1UMBB 2JLCA 5AHWA 3K0SA 1UFRA 1EB9A 1VZ2A 3K2IA 5KWIA 1WU7A 3MERA 3FZYA 3DP7A 4TMKA 4DWJA 1F2UA 4EMSA 1U1GA 2IPXA 3TCKA 1EJBA 3PNYA 4D4MA 2BY4A 1UIMA 2R00C 4HF7A 5JW6A 2WWHA 3IEUA 1VIMA 2L19A 2Z5VA 3PC6A 3NTLA 3RBXA 1MVLA 1V5FA 2FW0A 2WTXA 3U49A 4CIBA 4RMHA 3TUJC 3OO1A 1SCNE 2AG6A 3HG7A 3LXMA 3B3GA 3O4RA 3HJBA 4ESVA 2PL1A 3OCYA 3HA3A 4N76A 1KZHA 4XWKA 1EKXA 1I4DD 2PFKA 4UBNA 4J8PA 5AJWA 4FLFA 3DE5X 1XQWA 1QORA 1SCDA 3RRZA 1RFLA 3CEPB 4I3FA 3NV7A 3OPVA 3RNOA 2XKBA 4YBZA 2Q4RA 1YZVA 1NXWA 2HT1A 3EXHA 3F6PA 1YH3A 4RZQA 3I28A 5ADHA 3DF9A 4RGYA 2ZIUB 3DPIA 4K86A 3Q41A 1IJBA 1GPAA 2FPIB 3TTSA 5LJLA 2HUNA 4LQDA 1AZSC 2B94A 4IDGA 4URUR 3R6WA 4NU5A 3KD2A 5EZQA 2Z5FA 1G3MA 1UJ2A 1DMSA 2R6FA 1VM6A 1KR2A 1DAHA 1OTHA 1NVMB 1BC5A 1U8FO 3HJAA 3AZQA 5DOVA 1OFUX 4C6SA 2W83A 3CM0A 2QTLA 4KO4S 1CR2A 1ZK1A 3AHIA 4LTNA 2PRIA 1QHGA 1X94A 3DTYA 1LH0A 3K5IA 4HH1A 3C39A 4KV7A 3R44A 1B1CA 1X1QA 2ZVQX 3LSYA 1WBDA 2ZRQA 4DIBA 4RGVA 4CNBA 1AV7A 2REBA 3GJ3A 1PV4A 3UFXA 3GRRA 1SXJC 5E2AA 2MYNA 1WABA 1ZQ9A 2QRUA 2VHWA 2H3HA 1AZWA 4BMCA 1T0BA 4W7SA 1O9GA 3WP1B 1JLMA 3ZCTA 1I3NA 1OKKA 3HRIA 3NJ4A 5DGDA 4DR1B 3BGDA 3P2JA 4OVKA 4EI2A 1LV8A 1TT7A 4Z49A 1NQ5A 4RDCA 1LY1A 3CYFA 1TU3A 5ICEA 4CVNA 1SC3A 1BGXT 1FFXA 4QELA 1ZYUA 1A71A 1SUAA 1FUEA 4HLUA 3H2GA 5DTJA 4OQFA 1UXIA 2PBFA 3L6UA 1KMCA 1ZITA 4GKAA 1QHFA 2CBZA 4AJEA 3L6BA 1CUZA 4UUNA 3K96A 4O8CA 4EJSB 4H1WA 2IEGA 4KXQA 3AF4A 1GQQA 3H5LA 1ZNZA 3A2LA 1FU4A 2DBRA 4K26A 3AF2A 2FZEA 4X9XA 2ZUVA 3ECAA 3F1LA 3IELA 3TMYA 4HRAA 1P4AA 1HY1A 4AG5A 4K8RB 1U2DA 1IY9A 2VCEA 4P5DA 3AKEA 3UMRA 2H2HA 3K1JA 1ECGA 1KAHA 1Q15A 2OFOA 3NATA 4HNRA 1U7WA 3D6VA 5IARA 4D9CA 3G2OA 1WXFA 2PBLA 3IJEB 4NZNA 3T1TA 4GZLA 2LTAA 1P80A 1YIDA 1Z18A 2C7QA 3RVDA 1OR8A 2GKOA 3V8PA 4KXNA 1VHDA 4Q5IA 3W3AA 3FROA 1K62A 3LCVB 3T1HB 4MRMA 4DV2B 2PM8A 2JGDB 2KYRA 2VPZA 2BPOA 3QHQA 4JLAA 3EA4A 4RVUA 4CCAA 2P2NA 1SKYB 2EV9A 3BRSA 4UZFA 2A0XA 1ISFA 2GN9A 3HUDA 2Z83A 3OCUA 3AFOA 4FOSA 3G2KA 3P1JA 4IJ5A 5C46F 2ZCJA 3F7OA 3SLKA 1GKYA 2P90A 3KT3A 1J39A 4JLOA 4KAAA 5T67A 1GU7A 9GPBA 1VJRA 4J91A 4ZJZA 2WD7B 5TB5A 5KC8A 2PU5A 3TRHA 1T4BA 5FLXA 4QQRA 2QL5A 3DS8A 4OK5A 5AK3A 2R6HA 3NHAA 1BH6A 3UT0A 1BZYA 2IEBA 4JY7A 1RYYA 1Q0SA 2GF0A 4Q9JA 3D4NA 5DT2A 2JEYA 1D2AA 1HY0A 1KS2A 1EFDN 2Y1WA 3FYUC 5BWBA 3USCS 2C5SA 2ZS8A 3EIQA 4BB0A 3EXHC 1NV8A 4P86A 1OBFO 3UVEA 4EHBA 3DNMA 3TG8A 2XCTB 3JCZA 2H4FA 2A9QA 2D2FA 1MNQA 2WUGA 3S5JA 1XNQB 4HQFA 1E2IA 5E1OA 1X86B 2FVXA 2W37A 4L5YA 4UUAA 4JL6A 1DP4A 1M2VA 5A2GA 3VPBA 6ADHA 2H2FA 3B12A 1GU0A 3I4LA 3MCWA 2XTMA 3FAZA 1XCBA 2R5NA 3E22A 4AZSA 4UAVA 1JE1A 1V6AA 3CE9A 3KL4A 3OSUA 1D6SA 4HS4A 4P7GA 3RUAA 4CIXA 1DCMA 3LT2A 3BERA 3E23A 2FSPA 1J0DA 3SC2A 1I3CA 2MOKA 3RYFB 5GY7A 1JDVA 1S8NA 1LRJA 2DF8A 5JAUA 4AKIA 4XDHA 4QT4A 3CKKA 1I2MA 4KQEA 4N49A 5JZBA 5ALRA 2E18A 3TEJA 3OLVA 2K7FA 1M7HA 2F3PA 3DBRB 4YCJA 1REQB 3CF4G 5HP4A 2QQ5A 3DULA 4FE7A 2PA3A 3FKJA 2IUEA 4LQCA 1EGAA 3DDOA 4JJ7A 5H82A 2AVNA 1DQSA 4PC3A 4E2ZA 2AYZA 4KFSA 4R2KA 2EZ8A 4DNOA 5LXTB 2PZGA 5T4EA 5FUMA 1XIVA 2XHZA 3ZW9A 1Z7BA 4G5OA 1M0EA 4O2RA 3UKDA 1B26A 3NT2A 4GL2A 4U9IS 1EGMB 2ZYDA 4LEIA 2VZ9A 1CY1A 4NULA 2WJ6A 1Y3AA 3E15A 1J8YF 3EEQA 1DAIA 1JHOA 3SP1A 1FXSA 2C1XA 1G6Q1 3A1WA 4AF7A 1YB7A 5K3SA 2BFBA 1JE0A 1NAHA 1NW9B 1S1CA 2WMDA 3NP7A 2IDZA 3OX4A 4UD6A 5DCLA 4W9MC 4RU1A 3WK7A 4MV8A 1F2VA 4HLUC 2DFLA 3A4TA 3NWPA 4WKNA 1ECJA 3WHPA 4AL4A 5L3QB 1Z4OA 3I92A 4B5KA 5KTSA 2A9FA 3IQXA 2IHUA 3Q11A 1CP3A 4QICA 4R69A 2V3CC 4OPMA 5EXEA 3JASA 2IHTA 1I1QB 1DO0A 1XL0A 2ZSFA 1EWYA 3GAFA 5TDHA 3AEQA 3SC6A 3HKDB 3VI4B 1A04A 4V38A 4QYTA 4UHFA 2J9GA 4EPRA 2LBPA 1IM2A 1U2DC 1ZNXA 3S8YA 5I3ZA 4LSGA 5HM6A 2V98A 1XU7A 3GELA 5HZGA 3UHFA 3C6QA 4BVAA 4BKQA 4F9GA 3SS9X 3ZIAD 1M2FA 3ISJA 3JS5A 5F23A 2BDUA 4XLZA 1I0LA 2IPLA 5EIHA 2O5EA 5BMVA 1DC5A 3P19A 2G77B 1O8CA 2BR3A 2LKCA 1BE1A 1UPBA 4RLSA 5JZSA 4DQ0A 3LIPA 4I19A 1QH1A 2O8FA 2XITA 1EXVA 1BWQA 4WFIA 1OASA 3VMMA 1Z5GA 3LUAA 1QHNA 5E38A 3KDSE 6NULA 2NU6A 2ID8A 4Y7CA 1GXSB 2FW7A 3H86A 4KAJA 1VKOA 4YJFA 3SFVA 1G3QA 1DIHA 2OV3A 2O1XA 2UYQA 2YZKA 3ENZA 3WL8A 3PXCX 4X60A 3SJCA 4A8JA 3WAGA 3MINB 4MITA 3KKMA 4H3HB 3S81A 4DVGA 2XYQA 3SHTA 2JPDA 4YC7A 1W35A 3GNQA 4R2IA 8MHTA 2CDAA 2OL4A 3H0EA 1I4LD 5FL3A 4D26A 2D0DA 1WEHA 1U81A 2H5EA 4D8XA 4EKNB 1M6VB 1P19A 2NQ2C 4EG1A 1I01A 1E8MA 5JFTA 3DKPA 2P0EA 4LI0A 1MF7A 1R4ZA 1WDTA 1QX4A 3CBQA 3QEBZ 2YNMD 2PWZA 3UQZA 4DRZA 2HBQA 4XTRA 4OHVA 1QG6A 3LHDA 3MGKA 3F6YA 5CU7A 1KARA 4TZ0A 1WZNA 3IP1A 4CLDA 1ZI9A 1R3DA 4JN6B 5KZMB 3FFAA 5BUQA 1E2KA 4YV1A 1KYWA 4OKNA 3I05A 3EXEB 4YAEA 4GXRA 4R6WA 3Q9NA 4NCKA 4RFSA 2JCGA 3T7SA 4MV5A 1KYYA 1WOYA 3UM9A 3DTVB 3RKSA 3FMPB 5IM4F 2E4XA 4Z8XA 1EUDA 3ILVA 3PD1A 3V34A 2ZRDA 4MUIA 3RTEA 4BVFA 3EQ2A 4WEQA 2EG9A 4R3WA 5I9IA 1V5GA 2W48A 2ZFUA 1ORIA 2YIMA 2PX4A 3JQ8A 3OLCX 3GTDA 4BQOA 2CK3D 2WG2A 5D3KA 2C7PA 4KPYA 5LZ2A 2L0XA 5AK5A 1G2OA 2QTWB 3QBTA 1T1GA 2A5YB 2Y3IA 4WRRA 2PV0A 1G8GA 3I53A 4BFWA 4WLUA 1ACJA 2YS6A 2QPOA 3QV1A 4E3ZA 2IP1A 3NC0C 3UV6A 1ESZA 2ORVA 3GCGA 5GIOE 1JEAA 5CA1B 1FUUA 3F98A 2C4UA 1QZTA 4ZODA 2JGFA 3WJAA 3SS7X 5EEGA 4WFKA 2VAVA 3FDZB 2ODBA 4WZAA 3T5TA 5E7IA 2WZDA 4AYWA 1C50A 1K9VF 1BCSA 4J43A 1SC1A 3KJZA 1GAWA 4DF3A 1W36C 1JZTA 3U7IA 3T54A 4B9AA 4M4SA 1Y6ZA 4UNIA 1S6YA 4Q7JB 3VHLB 4PLFA 4Q3OA 3VYSB 1N2OA 1N5LA 1NI4B 2PYDA 2I6QA 3DL2A 1NRJB 4RK0A 4RJKA 2ZAOA 2E21A 3WSTA 1LRLA 1BX3A 2XUOA 2GR9A 4OP1A 4XPZA 2ZPUA 2O52A 1J0BA 2NUTB 2XE6A 3WBJA 2WDPA 4R16A 1CDOA 4OH1A 3QEAZ 3RC2A 3EF0A 2CLDX 3BXFA 5A3SA 2QTVA 1Y5RA 2P3OA 4IDFA 5JS2A 1B00A 3A9SA 3BHNA 1KK1A 3PCTA 3DR5A 4X3CA 4DMUB 2C77A 4RKYA 5JRDS 3FKSA 2GB4A 3OHPA 4KG7A 5FNZA 1D1QA 2N9UA 2WB4A 3ZHOA 2Y93A 5LQAA 4B6EA 2HA3A 2VRBA 3FFXA 4L8WB 2CWWA 2IYLD 2R1TB 2I8LA 3GLIA 1CQJB 2GYWA 3TR6A 1OJ7A 3QUCA 5CDFE 4YAWA 3ZQUA 3QPWA 3AYZB 3R5XA 4IFBA 4L73A 4QQKA 2GPTA 2QI9C 4RM2A 2A6PA 1E66A 3FNGA 3BYZA 4DA7A 2YXEA 4IQ4A 4KN6A 1ATZA 4TYQA 5K3AA 4JLVA 3T9FA 1GN9A 3IBYA 1FS5A 1JDBB 5GV8A 1YI1A 2I3BA 2KLHA 4ZIRA 4DR6B 4LZAA 3P9QA 4DB4A 4RVDA 5IYZA 1WP9A 1CUVA 1ONPA 1RKVA 3ETLA 1P5RA 4H0CA 4WERA 1Z83A 2F48A 2IYAA 4AS2A 1ONBA 5KYKA 5MGNA 1SGWA 3ASUA 5LQKA 1CJSA 2XGGA 3QWBA 4TLMB 1VPTA 4M37A 5F9HA 1X13A 1G8PA 1AY0A 4FJ0A 1JI3A 5CHEA 2ZRBA 5LQUA 3HCBA 3PFHA 2Q5EA 5FH9A 1I3KA 3H2BA 1XDGA 4OXYA 4BL5A 3K9WA 3FOWA 4MVJG 4YIHA 2Z04A 3H6HA 4XIFA 2ZJ7A 3BMQA 1JDZA 4ZCLA 1V3TA 1J2EA 3UK1A 5K99A 4MB6A 4WZBB 4ALKA 5JLJA 3RSFA 1JEYB 3R9XB 3G0GA 1QHIA 5EMMA 2XTNA 1GDHA 4L9WA 3RBAA 2DCMA 1JG2A 3NBUA 4ZDKA 1BKSB 3IAXA 4BEBA 3DMNA 5KX5A 1CB7A 5L3VA 3PNSA 5HF6A 5IXSA 1IVSA 1E5TA 5CM2Z 4BMSA 2Z58A 1E4EA 3HGQA 4JVOA 4QASA 5LQMA 3UAXA 3R9WA 2D7CA 4XGQA 4BTVA 2EGHA 2HBYA 3O2SB 3TOXA 2BCEA 5CFOA 1JEOA 3ET5A 4JVSB 4RX1A 6AT1A 1RMQA 3L4JA 3N6RA 5JAPA 4BQPA 3CT6A 1O95D 2ZYSA 3H19A 4NDAA 3RUPA 1PFGA 4IJWA 4XIJA 3ZV7A 4EVQA 4RY0A 2OQVA 1WUHS 3BBLA 3ZWYA 5MHTA 3W6UA 2OO5A 4MINA 2E3JA 1UBOS 4MYSA 4OLHA 4IZ6A 2EDCA 1NX9A 3KQMA 2IOYA 4NAHA 2XXJA 3G5MA 4URZR 3TSAA 1ZMRA 5SYMA 4GH5A 5D85A 4ALIA 1CDZA 1TU4A 4JENA 1O58A 3B2NA 5J5VA 4NV0A 1DADA 5FT9A 2OXTA 2O8CB 1J20A 4PHGA 4OQZA 2HO4A 2Y8EA 4CCYA 1CP2A 3KDAA 1R2QA 3T61A 2AXEA 2ZDQA 1OX6A 1PG2A 3W79A 1PGJA 3GCDA 1QIKA 4B87A 1CWUA 1B42A 1O8BA 4LXUA 2YXLA 3FOAA 3GGSA 4Q1CA 4WXHA 2WWTA 4PPNA 3SSMA 4RIIA 4A8HA 5CB0A 2AOTA 3U60B 2NMVA 1CUFA 3F4RA 3ZVNA 1T9CA 3IVXA 1RP1A 1TL7C 1JR4A 3L0IB 5LMNB 1HSZA 1IN5A 3HKBB 5IFLA 1O0SA 4RK7A 2ASVA 4LF8B 1ZAKA 3IA2A 2CLLB 3KOXA 4BS9A 3GXBA 4N5MA 2HLHA 2WLSA 1K5HA 4NI5A 1Z6XA 5D84A 4BNIA 4CF6A 5D00A 4QYIA 5JCJD 1COWA 2Z56A 4TLCA 5CDTA 1W88A 3EAGA 4DN6A 3FPEA 5DT9A 1DXYA 2FSVA 4RS3A 1DAPA 3JQGA 3T5MA 1TF2A 4LI3X 5A0TA 2HT6A 3TQCA 2AI2A 5JAMA 1QG2A 1WXXA 2KQUA 4L2IA 3KYDB 1V37A 1L5WA 4MR7A 5LDHA 2ZTLA 1WVMA 2NUPA 4N8SA 4ROSA 4QDUA 1DBQA 1GV1A 3EVDA 1EX1A 4D99A 3N6XA 2EJTA 3QHAA 2XOKA 3WGNA 2JLXA 1JR3D 2PCLA 4MCAA 1PGPA 3GVPA 3IDOA 4MS1B 1JF8A 1FP2A 3O1LA 3H1PA 5J5CA 4H7JA 1CQIB 2CFIA 5F64A 4P32A 1M2EA 3PYXA 2WYHA 2B30A 4PZCA 2QTBA 2DUNA 2ZUFA 2WM2A 1E8DA 2AMVA 5GQSA 1QAMA 2MSWA 1XQVA 5ALUA 1WQ3A 1HQDA 2W2QA 2YL2A 3LL4A 4EGCB 4YLGA 4EO4A 1IATA 2H1OA 4EMBA 3VPHA 2WJGA 3N70A 4HATA 4Q9LA 2BKAA 2WJ3A 2YVLA 3QYFA 1SG0A 3EF3A 5LB4A 2CDRA 1A2OA 3K5HA 1GR1A 3VX4A 3H11A 1WETA 4KAFA 5ALDA 3K6KA 2Q9CA 4OL9A 4TTAA 2R8RA 3SE0A 3II6X 5HE9A 2E4VA 2ZT8A 3ZI4A 3VKHA 5CM8B 3A05A 3I5UA 3V7YA 1GRVA 3MTGA 3PD7A 3E1GA 5BWCA 4KUGA 2N42A 3MF4A 1MKYA 1P75A 4Z0NA 2ESRA 1W46A 2OB2A 2YMMA 3HMQA 5FL7D 2B1RA 2GBGA 3GLRA 3KR1A 5GONB 1C1XA 4BB9A 4EQ6A 4GQIA 1E1QA 5GJVC 2HL6A 3QVMA 4XEHA 4M53A 1A76A 5BYKA 5HF9A 1A8HA 3WMXA 1H3NA 4G1CA 3QF4A 2V54A 3G9ZA 4G01B 3MLAA 4MK4A 3W6PA 3AV3A 1L8AA 2F43B 1OTYA 2Z4SA 1KKMA 1TA4A 4A6EA 3BXPA 1MBZA 4UXHA 4HMOA 1QHXA 4EO7A 5BP7A 4P3NA 1ISPA 2OO5C 5EJFA 3HE3A 3HM2A 3OCZA 1JXQA 2OV6A 3OLQA 3LXRA 2ODAA 3W5DA 1EQAA 1HORA 2VHVA 2G1UA 2IKQA 3FFTA 3AF1A 5ERXA 1U1IA 2DYKA 1KMMA 3FVQA 4YNBA 1JQ3A 1RJEA 4II3A 3K35A 1E6LA 1PNVA 5F98A 1CYDA 4FB5A 3K1AB 2VF2A 1P0PA 2GJSA 1E1CA 5CB8A 3VV2A 4F4IA 5CIYA 4LE2A 3FXAA 2ZBUA 4L22A 2JLBA 4I55F 3HMKA 3BL8A 3V1NA 1C3XA 4HWRA 2Y1FA 3EEBA 4QRDA 2RKOA 1GZUA 2F1OA 4UMVA 5EJ7A 2AL7A 1OV6A 5HRAA 4CTKA 4DV5B 2YOGA 4ZQBA 3D4PA 3SMQA 2ZAMA 1Y1SA 5EQDA 3R3SA 3TPFA 4GZ3A 4P8RA 4RHEA 2SBTA 3OP4A 4KLRA 5LBUA 3AEXA 2Q8QA 3E1SA 3GEBA 4N8DA 3OOHA 1JHAA 5FWAA 2AQ8A 2R1ZA 3QVJA 2NVUA 4G1BA 1KH2A 1GUFA 4QQFA 2C95A 3IBSA 1C1HA 1K7YA 4Q1EA 4PIVA 4X6XA 4Y2HA 1M2OA 2AEFA 3NWOA 2FMKA 4FOLA 4FXPA 4QDXA 2JBAA 4BLQA 1Q57A 3D43A 3W9UA 4ZYZA 5JCXA 1T9GR 1ISGA 1AHIA 1IWPB 1ODLA 2YRFA 3QVGB 5KNDD 3GUYA 5B30A 4B3FX 1DOHA 2EQBA 4BYMA 4TXLA 3GDGA 1ENZA 5T6MA 2RHTA 4KLNA 3RAFC 4EY7A 3REFA 3TB6A 5AUOB 2ZQ5A 3SD7A 3QVLA 4MUNA 4D9MA 5DNEA 2DTDA 3RK0A 1W1IA 1ZN7A 4HWTA 3KRTA 1DJNA 5IN5A 4JLDA 1Z0FA 3AX6A 4EUNA 5GADl 3M5CA 4BE4A 2VG8A 1AXGA 4XGKA 1IEVA 2CXHA 1E1YA 1NVVQ 2F3SA 3P2YA 1PR5A 2KX7A 3AUKA 1XAHA 1IIBA 1YCFA 1MD9A 2PHZA 2H08A 3I0MA 3OZDA 4TXNA 3DE4X 1K7SN 4M7OA 3L1UA 4GUDA 4KQWA 2OCIA 2JA1A 3BMNA 4PIMA 3QPBA 4QC2A 4ZOLF 3OWXA 4BNKA 1YRLA 2XE7A 3WSVA 4IV0A 1Y9JA 5GTDA 3X1MA 3G6KA 4P54A 4IJ6A 1CVIA 2BF4A 2D59A 4WNAB 3K9CA 2WV7A 2C3PA 2QLLA 1I1OA 4B6RA 1LVGA 1Q83A 5D3QA 2H4WA 2Y2UA 4RDHA 2GD2A 5FWDA 4RTPA 2XCSB 1GTJ1 4KRFA 2Q3DA 3PKJA 4WQMA 1YBHA 1HC7A 3WGZA 2E55A 5NLLA 1UM8A 3EHDA 1HETA 3LL7A 1SFRA 5GWXA 5G0VA 1THZA 1YR8A 2TMGA 1OXKB 2XX3A 1QYWA 3C2QA 3CF4A 1VDZA 3EW9A 2H7XA 4Q82A 1MQ8B 4YCAA 3ZCSA 5JQWA 3UCEA 5CJPA 5FWNA 2N75A 3CW8X 5EE3A 2HSZA 4O25A 3GPDG 4BNTA 1E2MA 2GS9A 2V58A 4BAUA 4K9OA 4Q7LA 3GDWA 3TQSA 3LP6A 1TZMA 3FTEA 4RCVA 3G89A 3UAWA 3WO0A 4B2IA 5J2UA 1DIRA 4J4BA 2YJZA 4H27A 4WEOA 4TV8A 1R4MB 2BEUA 3IUBA 4EPWA 1RKBA 3MWLA 1EM8A 3RRNA 3L49A 1LBIA 5EIWA 4MQLA 3EPJA 4E21A 3LO5A 2OGZA 3IMFA 1JSRA 4B3DA 4QPJC 3ZX5A 1X7WB 3CN7A 3ZKWA 5JQGA 4JR1A 4C78A 1Y4SA 2CMGA 3W2EA 5J4HA 2QD2A 6LDHA 1EUCB 3BDIA 3OZFA 4LHYA 4PNZA 3V00A 1S3FA 5JWOA 4DABA 3LY7A 3OCCA 3X0DA 1ZD8A 1V1MA 4YAOA 3R75A 1AO0A 3VR3A 3FOEC 4KR7A 2QIPA 4LF7B 4D42A 2EBWA 4J1QA 4X63A 2IF0A 2R6GA 5DP2A 3KM0A 2Z2KA 4LPKA 4MJ7A 4GECA 3BIJA 4MWEA 3I2FA 2JKVA 4C88A 2HRRA 1HTTA 2YHUA 3W5BA 3ASYA 3CINA 3NORA 4C7JA 4V2IA 4D9FA 3L1IA 4Z7QB 3ICCA 5J9FA 3J81k 1G1MA 1V5WA 2WAAA 4TROA 3EUWA 1U3TA 3TTTA 2J45A 3IFSA 1EFRA 5JE8A 3U7QA 3W2FA 2WFLB 4MVJE 4A92A 3T5BA 3P20A 2GEFA 2WJYA 3CR3C 2IYFA 1ADFA 2HK8A 2WTBA 3TK1A 4YUWA 1ZWKA 2WG1A 3HO8A 3GP8A 2XIJA 3EXAA 4OP2A 4C4RA 2XMGA 4YMTA 4M83A 2DUUA 2FH5B 1SXGA 1GYQA 5FPHA 3OTHA 1LBEA 1N2EA 1HZJA 1ZZGA 1LC3A 1OY1A 2EF1A 2IZ6A 5ENDA 3LCMA 4ZEWA 3ZH2A 3VHXA 1ZMBA 3VNSA 2PTQA 1XYVA 2X8AA 1N4DA 1AXRA 1ZI6A 3RIYA 3WG9A 2C4NA 2JIQA 3DBOB 3L7CA 4TZTA 4IOLA 3BWBA 3D3JA 1FW8A 4NBSA 3GLFE 2CD9A 3GMIA 4QLOA 1SBZA 2GAOA 2JFHA 1N2CE 3SDZA 2XNDA 4F60A 4UPEA 1U4OA 4PGFA 3ZWPA 5M04A 5E2BA 4OKSA 1M6WA 2AEMA 2AVDA 1JFTA 3HM9A 2YFHA 3GRAA 2VC2B 1FBNA 3HH8A 2VS1A 4O2AB 4PZZA 1D0SA 3C3CA 4I6JA 4KWCA 4P5EA 5TGTA 4AMBA 4MVWA 4XVUA 4UEKA 2CXRA 3D8SA 3GAZA 1TVKB 3FVWA 4FSXA 2FG6C 3Q8WA 4WGFA 4E2XA 4DMKA 2OXFA 2G28A 1Q5NA 1YVEI 5L7WA 1KEUA 1ZZEA 3B6MA 4TT3A 1V8DA 3K72B 4H7KA 1SXPA 1Q1AA 1P2GA 2PUWA 2YNMA 3AFGA 2EW8A 2WTMA 4FFBB 5A5GA 2UZ1A 4HB4A 3UH0A 5ESRA 3K8ZA 4QSHA 4JMLA 1N2JA 3AHEA 2WQ6A 3IPXA 3V4FA 2X9QA 3RR2A 3ZD9A 1SQGA 1Y8QB 3ZDYB 3A9RA 1DUIA 4MV6A 4HDOB 2CUTA 2ZK7A 2WSSD 4C0QC 3D6TB 1OQAA 3AJ9A 1DELA 1P0IA 4DCMA 2FFRA 1KWGA 3PB3A 2P41A 3GFVA 3PL1A 5BMOA 3TBFA 4L6IA 1WZEA 2H06A 5JFGA 3CA8A 3VZSA 4RLHA 1VHLA 2D5CA 3BD8A 1JU4A 1K0UA 1AUOA 2P9ZA 4BVBA 4WBNA 2N1BA 2Q9BA 3C87A 3G1TA 2BGMA 4JKIA 3AM1A 3CNLA 3K0BA 3VC2A 2PMEA 1E79D 1DX6A 1E3MA 1JMVA 4ZJPA 4B1FA 2WJJA 4EY6A 5A4JA 2B0JA 2LKDA 4DLRA 1FRNA 1HGXA 2O2HA 2Z2JA 1ZCJA 4IQGA 5D01A 4EELA 4ZRDA 5ALQA 1EE1A 1ZC4A 4UUPA 1I3MA 2CK3A 4F4DA 4J4HA 3PLNA 3EOZA 1XD2B 2H9IA 3EZ2A 3UUEA 3WY9A 3O0TA 2IH2A 1RCFA 4AWBA 3S70A 1NW3A 3SZUA 4JP5A 4TYYA 5JVDB 2IOFA 5FWXB 1FP4B 2CE7A 4GR9A 2EWMA 4O63O 4WKPA 2OKCA 1E60A 3U4CA 3B7PA 3KFVA 1E62A 4QUAA 4D3XA 1FNNA 2W0MA 4F06A 4AJIA 4DY4A 2QQEA 1SMKA 1AM4D 1RIIA 1ZGCA 2RHOA 4BO5A 1B14A 2TECE 3UMSA 3PNOA 3B3QA 1KL7A 4CG0A 3OHSX 5AVVA 5IAOA 2Z43A 4KRXA 1UC8A 2X8LA 4JQZA 3T5DA 3IBCA 1P0MA 5AM3A 2CVFA 2HMWA 1SK8A 1PZFA 5IPFA 5LMZA 1XMQB 1MGOA 3G2NA 5J58A 3UQYS 1Y81A 4KNWA 5EUCA 3G7UA 1DGQA 4LJAA 3U3RA 1XN1A 1VE6A 3GDOA 2R6R1 3IILA 2AR7A 4GPBA 4PINA 2PWBA 2F1IA 3AJ8A 3KJEA 3U3DA 3IHTA 5AP9A 3BREA 2W6JD 3AFNA 2ZI7A 3ZGNA 4AULA 2CCGA 4ZTZB 1KKLA 3C8ZA 3H2JA 3CLSD 2GCGA 4KACA 1U7TA 4N9QA 3KSAC 3LY5A 4JBWA 1VL1A 2P5UA 4JZYA 4V0RA 1R5NA 1ZM4A 3FSGD 5F7OA 1C0KA 3TI9A 3DLAA 5HNKA 1WD5A 3H9GA 4OM8A 3GVHA 4DR3B 1AGRA 1OX4B 4BLSA 3L46A 2I4NA 2FXIA 2IXBA 3ILSA 2WTEA 3UTDA 4JB2A 2O3JA 2W42A 1RCUA 5FOUA 1JHYA 2PWYA 4DADA 5KNCA 1C81A 3EPLA 4R1SA 2HRDA 4D0LB 1EVEA 1KY2A 5H8WA 1EWRA 1L1EA 1LBTA 3IESA 4GBJA 1SHLA 2XYRA 3FZNA 1ABEA 3STXA 1OF1A 4BWYA 2RFLA 4Z54A 2HF9A 1YHZA 1CRPA 1GCOA 4KYTA 2BKEA 5EYPA 4RM3A 4OLAA 4Q3CA 1Z0DA 2C7VA 4E07A 1USGA 4M0EA 3I1YA 3QG5A 1WU8A 4LDJA 4BEWA 1J6UA 4YJ2A 1NWHA 3FTQA 5AJYA 3QV2A 1A2QA 1MPXA 5LVAA 1E2JA 5DX1A 2YNMC 3AILA 3DMRA 2VDLB 3U9TA 421PA 4YRSA 5BW5A 1DOZA 2X4IA 4UHJA 4DKJA 2A5GA 5AVOA 1KNXA 2VRCD 4IVPA 1J8QA 3TQIA 3OFJA 5F78A 1VZ3A 4Q0MA 3QP9A 1KERA 1G7SA 2YWBA 3HVKA 4BCCA 2AC7A 4M6WB 1Q1NA 1SWWA 3H5RA 4FS3A 3A6LA 1K6JA 4IVRA 4UPDA 1WMFA 2JLRA 4X97A 5A7FA 2BV3A 3OE4A 4TYPA 2VL7A 3HB4X 4BTEA 4D82A 3OA0A 2BGTA 1XVLA 3O94A 4DIKA 1GL7A 4O4LA 3Q2OA 4XWGA 2EGUA 5DTQA 2ZWVA 3O4GA 4AYXA 2RGBA 2VH5R 3HN2A 2CZGA 4N0MA 1H2WA 1UJ5A 3P9YA 4QOEA 4MGHA 3S3TA 5C80A 1DLJA 1Z25A 4Z4GA 2NV2B 1XEFA 3HDJA 1F06A 1ZU5A 1UPUA 4QTTB 3W8DA 1Q3KA 1HURA 2REXB 4OUDA 2QX8A 3WOHA 5JDIA 2C8VA 2DKNA 1O95A 5FUBA 2V55B 2AW5A 2A9RA 4FBGA 1E9AA 3L7BA 3QY9A 2UV8A 2OYRA 5JJLA 1GKKA 1U0NA 2YXDA 2NXEA 4A2CA 3BRCA 2FWNA 2A14A 1G7CA 1VI6A 2XE8A 3QXHA 2PKCA 4CCWA 5FPYA 5IVHA 3K0FB 2PT6A 3C6KA 4BMXA 4B35A 4D9NA 1CETA 4FUQA 1R4AA 3NGXA 4BO2A 3B3JA 4EA7A 5CYFA 1UKAA 3BA6A 3E70C 3W9BA 4CODB 4L7QA 2V4MA 1IXSB 3SR3A 3DLBA 5DX0A 3VX3A 3WGVA 1QCZA 1VI5A 3VKFA 1AQIA 4Z7JA 2JLYA 1PG5A 1VSTA 2PAAA 2V5VA 2JJYA 3L0OA 4LDZA 4C0SA 2CXUA 2F55A 2VKQA 5TMDA 5I8ZA 4M46A 3GZTB 3WZLA 3W8EA 3FCAA 5CVUA 5TGZA 1MAHA 3NHPA 4B33A 1U2GA 1KHTA 3PEVA 2NYRA 1P0FA 4NYJR 4QGGA 2J9FA 3UHAA 3ZQ4A 1W5FA 5H80A 5C7IO 1DTSA 1G5IA 4BCDA 3NWJA 1B0PA 2GZHA 3T0GA 4E7OA 2XECA 4HZUA 3FUUA 1L5FA 3ZWCA 1BMTA 1O7JA 1B76A 3MGGA 4UAGA 2Y0PA 1QH0A 2H1WA 3T5PA 3KKPA 2Z8ZA 5BWNA 1YU6A 1N6NA 4G0VA 3PS9A 1WKVA 3G68A 1RYDA 5KYUB 2UXBB 1SA0A 2R8XA 4QTYA 4QAJA 1JR3A 1ZRHA 3U4HA 4AY3A 3CNNA 2BC9A 3DGEC 3KOWA 4RPKA 4C2AA 4ER5A 3IQWA 4KIWA 5EP4A 5HIAA 2GM9A 1I7PA 4E30A 2RAFA 1ZN9A 2PL3A 2Q07A 2NO1A 4D4GA 4ZV9A 1Z29A 4FGWA 4PQYA 2R84A 4R71A 4YMLA 1KP3A 1QKJA 2AFVA 2QQGA 2W2NA 4FFRA 3WMEA 3KFLA 4MW5A 1E9DA 2ZOSA 1XJ0A 3K0HA 3I76A 3KJNA 4Q4JA 1V71A 5KTRA 1DINA 1TYAE 1L3BA 1W2GA 3V8QA 4RC9A 2YW2A 4UVHA 2RK3A 4I1SA 3THXB 1PS8A 1TMYA 1XTTA 5JLAA 1P18A 5LQNA 2X41A 3A6DA 1E2GA 1PZEA 1TO6A 3JWEA 3MTIA 3L7JA 4B31A 4ZJUA 2I4OA 2GZ2A 5DHFA 3RF7A 1KDTA 4EG0A 5FL7A 2VSQA 2O1SA 1NVKA 2WK1A 3IXMA 3PNMA 4B34A 4C0LA 2C5AA 3FA2A 5ES4B 2PMFA 3C0KA 5BSFA 4HDQB 4ZVLA 3LF1A 1PUJA 1KJWA 1SEPA 4I5DA 4ZO4A 4YAKA 2Z3ZA 4M3NA 3BMOB 2ZIAA 4DMLA 4EPYA 1ZQ1A 5JDIC 4K0KB 4Q1BA 2DB3A 1O95C 1EIZA 2FEXA 3IDQA 4M87A 2CKMA 1L5HB 1ZINA 3M4ZA 1A27A 1F4LA 3NHFA 3QWHA 4B75A 4I1OA 4D4KA 5MFPA 1UPXA 1NN3A 5FNVF 1Q84A 1V7ZA 3SSAA 3GJZA 3W1VA 1BU8A 4CFYA 1U04A 2ZU0C 5TQ2A 4MR8A 1N0VC 3KK0A 1H22A 2P1DA 4TKLA 2FZWA 4ZPXA 3DTTA 1M76A 2BONA 3GMSA 3HCNA 2VVTA 1EEXB 4AXBA 1KYIA 2BFWA 5LFAA 4NH0A 2P69A 3G23A 3KB6A 1SCKA 4M1TA 1U3DA 2QE7A 4UW9A 4GG1A 4JSYA 4MO2A 3S27A 4KITB 2IXTA 5BV8A 2ZUBA 3P0JA 2IYXA 5BW8A 5IKXA 1FJHA 1U7PA 2QYHA 3DOHA 4IIJF 4EFMA 2XKKA 3FHTA 4XCXA 1UBJS 1TDJA 1O6CA 4K1XA 3RAGA 4EB6A 4YEDA 1E2DA 2VK8A 3QTLA 2Z4RA 1Y89A 5AM4A 1Z82A 3GVXA 4U7WA 4BBAA 1SWVA 4RETA 1S8FA 1XZHA 1I2AA 3UMFA 1CRWG 1H9BA 2G7MC 1U2GC 1X8KA 2I1LA 1IXRC 3FE2A 4UTNA 3D8TA 2ZZNA 3F6SA 4Z1MD 3HFRA 4UULA 4LMBA 1I24A 3E5HA 1OWNA 1HLDA 3R7FA 4YS6A 1JEJA 4BNYA 4P4TA 2TMKA 3IRVA 3DXZA 1I6WA 4RJIA 3SR0A 1A69A 1MPTA 2N1MA 3KJFA 3OQOA 3DE6X 4M8NE 3B6JA 1I51A 3O3OB 1UKVY 3NKLA 1IBRA 1U8XX 1L4EA 4RH0A 1MT3A 1EPUA 1PK7A 1MV5A 1ZW6A 2GPYA 2MYTA 2XCLA 3BTSA 4XB1A 1LPNA 4E31A 5ISMA 3G8DA 1T43A 1ZRMA 5AKHA 3U6BA 4R1UA 5HRUA 2B4RO 3ELWA 3CR8A 5CK5A 3ADDA 1FNMA 2J3LA 2B8WA 3D4IA 5FUWA 1Z16A 2FEOA 3URMA 5AIBA 3BIFA 4AZ0B 2JLVA 4UE3S 3GDFA 1TM7E 4O8ZA 5KSYA 1G21B 4H9GA 1KMHB 1RXYA 3VPDA 4C6TB 4U00A 2VTBA 1W581 3PHBE 1EK1A 4RXMA 5AVSA 1E2QA 4LIPD 4KCGA 1PWYE 3OKFA 4OX9Y 1NA5A 3ICPA 2PG3A 4J76A 2J0QA 5ECGC 3PQ2A 3FUVA 5CITA 4HLDA 1V9SA 3AEUA 2O6LA 3E9DA 4H4EA 4B8WA 4EHAA 3EMDA 2EKBA 3NNNA 3SZGA 4LXIA 2HIHA 4LCJA 2XMBA 5SY4A 2H2WA 2WM8A 4MWCA 4LYAA 2AJLI 3MGCA 4R8KA 4HV4A 2H0AA 3MTDA 3FGPA 1I4TD 4O4HA 2C2KA 3O21A 2WYUA 3UYKA 3UO8B 1T1IA 1M6HA 3VJLA 1RXWA 4ZYUA 1NVGA 4ENUA 3VPXA 2PEYA 2O1EA 1UZUA 1ZD9A 2BKLA 4BX9A 4CQLA 3UBTA 2HJWA 1KQOA 4YP7A 4BXOA 2G70A 4FYHA 4JP2A 2WF9A 3QQ5A 4FMBB 2P4QA 4MUMA 4MMYB 5JHGB 4KR6A 3LUCA 1ZS9A 3P2OA 2IITA 2RGRA 3SKVA 3GA0A 4RK4A 2NZJA 5AOCA 1T0IA 2VBGA 2A2ZA 1UM9B 2PSFA 4ZI7B 3S2GA 1OXTA 3EPRA 3F73A 4LDNA 1A7AA 3PNKA 3M5WA 4ZK6A 2PMDA 4YRIA 1FNBA 2PCJA