3U13A

Crystal structure of de novo design of cystein esterase ech13 at the resolution 1.6a, northeast structural genomics consortium target or51
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKACEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords artificial protein OR51
publication title Computational design of catalytic dyads and oxyanion holes for ester hydrolysis.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 69
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3u13A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u13A01
2I7DA 3QU2A 2FDRA 4YCLA 1TJ4A 3IJ5A 2RARA 3QU9A 4YGYA 4CF5A 3DDHA 2PKEA 2WF9A 3B9BA 4YH1A 5ALIA 3OCZA 4BNDA 2Q5EA 2YMMA 1S2OA 4G9BA 4UATA 4BNDB 1ZS9A 1QQ7A 3QUBA 5AESA 2P27A 4Y3UA 2B0CA 4OD0A 2FPRA 1ZD3A 2WF8A 5ALHA 3GYGA 4BX2A 3DAOA 4HGPA 2YMLA 1L7PA 2Q4RA 1XVIA 2YMQA 5AVWA 4HGNA 4YIHA 1RKQA 2Q4TA 4MUMA 3FGOA 2B30A 4NABA 5JJBA 4Y2PA 5AHXA 3ED5A 3PCTA 3N1UA 4RETA 3HYCA 1Z4QA 5AIAA 2JAWA 3E84A 1YJ5A 3OTQA 4Y2QA 4HGRA 3I1YA 5ALSA 2HOQA 3NIWA 3QLEA 3ZW7A 5AKJA 1ZRMA 3S6JA 4L6CA 3WKEA 2FI1A 3MPOA 3E58A 2QLTA 4KNWA 4YCNA 2FPWA 4DCCA 3EF1A 2G09A 5ALNA 4EX7A 4ZEVA 4UAUA 5AVVA 1ZOLA 2CFSA 5ALLA 2P69A 1RPZA 3NALA 3ZX4A 1YDFA 3I28A 5ALYA 4HYTA 3ZWKA 5IS2A 4EEKA 5AW6A 1JUDA 1VJRA 4NFLA 3U7HB 3AR5A 5AW3A 5AVQA 1XP5A 3QU4A 1RMYA 2W4MA 5AKLA 2HSZA 4CNQA 2JGAA 3WK5A 1N8NA 2NYVA 3ZWDA 3CNHA 5AKZA 1EK1A 2OYCA 5ALDA 3R09A 4I9FA 3OCVA 4Y2YA 3NUQA 5AICA 4UM5A 5ALKA 5AVXA 5FP0A 2JARA 3ZI4A 1Z4PX 2GHTA 2W11A 4NAVA 4UW9A 2W43A 4O8CA 3R9KA 4Y2UA 3ESRA 2ZBFA 5AK5A 3U26A 2WFAA 4NWIA 5E0OA 1T9ZA 1O03A 5AKGA 3KC2A 2YJ5A 5ALWA 2NO4A 1SWWA 4Y2VA 3I6BA 5AKEA 1RRCA 3BWVA 3WK4A 1WVIA 2YFYA 3U13A 2WM8A 1U7PA 2RBKA 4J2TA 4Y2JA 5ALGA 2NO5A 3UMCA 3QNMA 4EX6A 2HHLA 4YCMA 4UM7A 4EENA 3WKDA 2O2XA 3D6JA 1Q92A 2YY6A 1Z4MA 2I33A 2G08A 4BBJA 3BA6A 3B9RA 3MN1A 3B8EA 3UMBA 3TLMA 2GFHA 5ALVA 3W5AA 2YBDA 1Z4JA 4FYPA 3L5KA 3W5DA 3K1ZA 1RQLA 2EAUA 3FPBA 4PNHA 1U02A 2I55A 1Z5GA 3OCWA 2ZOSA 1CR6A 5ALUA 2IYEA 3U7EB 4G63A 2YJ6A 2CFTA 4ZEXA 3PGVA 1MH9A 5AK6A 4H1WA 1VJ5A 3A1EA 2VKQA 4C4RA 4AP9A 2WHEA 1YS9A 1L8LA 4FE3A 5AI6A 4Y2SA 2FUCA 3N28A 1TA0A 3FVVA 3M9LA 4IFTA 5IT0A 3NRJA 3KD3A 5AW0A 1U2TA 2BY4A 1RLOA 3N5KA 1RKVA 4RESA 5AKYA 1U2SA 3OPXA 1RC8A 4ZEWA 3ONNA 3AR2A 1J97A 5AW1A 1RKUA 3NANA 4F72A 3VAYA 3ZTWA 5AM1A 1ZD2P 4XPZA 3QUTA 3ET5A 4UARA 3MC1A 4HAIA 2I54A 4OCZA 2CFRA 1J8DA 3PGLA 2YMPA 4CF3A 2OA0A 5AM0A 3WKCA 5AIBA 5ALZA 2ZBDA 4J03A 3E8MA 2ZXEA 1RDFA 3ZU6A 4BYGA 1Z4OA 3ZUPA 2FPUA 5AI4A 5ALXA 4UU1A 5AM4A 2B8EA 1X42A 3SD7A 1KYTA 2YN4A 2OBBA 4EELA 5AK4A 3IRUA 1Z88A 4HGQA 2C8LA 3EWIA 3I76A 5AVTA 5IT4A 4QJBA 2HDOA 4GXTA 3SF0A 2CN1A 5A3QA 1XPJA 2HCFA 2BDEA 2P11A 2ZBEA 4CE6A 4KX3A 3AR3A 1K1EA 3J7TA 5A3RA 2I6XA 4F71A 4BKMA 1WR8A 2G06A 3WKBA 2PR7A 4YIKA 2EARA 1F5SA 3ZVMA 3HLTA 4UMDA 4Y2XA 3QUCA 1Q91A 5AM5A 1RMTA 3WK9A 5ALEA 1Z4IA 3SKYA 4EZEA 4FFDA 3ESQA 1L7MA 3FM9A 5AVZA 3OCUA 3DNPA 5AKIA 1ZJJA 1Z4LA 1QH9A 1IWOA 1FEZA 5ALQA 3M1YA 4KYTA 1S8OA 3KOOA 2FPSA 4C4SA 3A1CA 2B1RA 3L8HA 2IOFK 2JAOA 5ALPA 2RB5A 5AVUA 3U7GA 2PQ0A 3R4CA 3SHQA 5T41A 4KX5A 3L0CA 1LVHA 2G07A 5ALTA 4C4TA 1NF2A 4DWOA 5AW4A 4JDPA 1RMQA 2G0AA 3QU5A 2GO7A 3CZ4A 1NRWA 3MMZA 3QUQA 2C4NA 4UAVA 4UMVA 3ZVLA 3UMGA 4I9GA 3RFUA 4UMFA 5ALRA 3FZQA 5AK3A 2FPXA 1RQNA 1N9KA 1ZD5A 3AR6A 1SU4A 1WZCA 3WK8A 3SLRA 1ZRNA 4BX3A 2ZG6A 2JAUA 1L7NA 2RAVA 5ALOA 1U7OA 3QX7A 4CF4A 1SWVA 2GMWA 2YJ3A 4B6JA 2IA5A 1ZD4A 2C8KA 3F9RA 4Y2RA 2R8XA 5AVSA 2HF2A 5AVRA 2HF7A 3NASA 5AKKA 2B1QA 3ET4A 4BX0A 2FEAA 3A1DA 4MWOA 1L8OA 3ZX5A 2GHQA 4DFDA 1EK2A 2I34A 4IG4A 4OFZA 4GIBA 2R8ZA 2X4DA 4UU0A 3KDPA 5AKHA 5AW8A 2MSNA 4HGOA 5ALJA 1RLMA 3WGUA 1L7OA 3SMVA 1VFPA 2WF6A 3W5BA 5AW5A 2YJ4A 2HO4A 1T5TA 3L8EA 2ZBGA 5AI5A 3AR8A 5AI0A 3L0YA 2IOFA 1Z4KA 1CQZA 2D2VA 3EPRA 1TJ5A 2R8EA 4E88A 3L8GA 3L1UA 3NAMA 3WKAA 1TJ3A 1YMQA 2ODAA 3QXGA 5AI8A 3IB6A 5ALMA 3UM9A 1Y8AA 2WF5A 3ZTYA 3ZVNA 3P96A 2EATA 3AR9A 4JB3A 4UASA 2HI0A 2AMYA 3WK7A 3PDWA 5AW2A 4XE5A 5AM3A 3KZXA 4XQ0A 5AM2A 1AQ6A 3OCYA 5AW7A 4XOUA 2AUTA 3L0BA 3WK6A 3QYPA 3U19A 4QQFA 1WPGA 2HX1A 3L1VA 4BEWA 3AR4A 2BDUA 1Z4NA 1L6RA 2O9JA 3OCXA 4AS3A 3QGMA 3QU7A 2DQSA 3DV9A 3U7FB 3A3YA 2MU1A 1O08A 1QYIA 4BEVA 2B8JA 2HEGA 2P9JA 3L8FA 2C9MA 3FPSA 1Z5UA 5A3SA 2B82A 4OHFA 1RLTA 4NV0A 1QQ5A 3KBBA 2OM6A 4DW8A 3AR7A 4KNVA 5ALFA 4AS2A 4UMEA 4Y2TA 1QQ6A 3L7YA 1T5SA 5AKXA 3N07A 5AVYA 3N8GA 1TE2A 1LTQA 2IOHA 2G80A 3EF0A 4KN8A 2AGVA 1YNSA 3SKXA 2FUEA 2G1AA 2QYHA 4L57A 2R8YA 2WF7A 3E81A 5AW9A 4L6AA 1NNLA 2AH5A 3W5CA 1PW5A 5AI9A 2C88A 1YV9A 3WGVA 3RF6A
chains in the Genus database with same CATH superfamily
1WHSA 3TH5A 3D64A 1NBIA 4OGKA 1LRJA 1QYRA 5EL0A 3KWMA 1F8UA 2APJA 3F7TA 4YGYA 2Q4BA 1HX7A 2VWQA 4QA9A 1G7CA 1LDNA 1V1MA 4WQMA 5J9FA 2LGJA 1XQWA 5DGDA 1E3IA 4YN3A 3ASYA 2DLDA 4LRYA 4MICA 3ZK8A 4E31A 1BVHA 1OV6A 1U0SY 3UGQA 1ESMA 1HYHA 4TOIA 5AESA 1ZVMA 4JJAA 5DOZA 5ED0A 1JDPA 3Q8XB 2HL6A 5DTQA 2OXCA 4IDBA 4D4HA 3MG9A 5K3FB 1NLYA 2ZUEA 1U04A 2AYZA 4I55B 2I1WA 4LDZA 1H85A 1EHIA 3BH0A 1F1JA 2ISSD 2ZGVA 3OOSA 4MUNA 1T3HA 5E7JA 3VR5H 1LV7A 4IKPA 1DELA 4KVFA 2BH9A 4QJ3A 2O8EB 1OREA 2QX4A 3A1VA 3HUTA 4PYNA 3MEQA 1PEKE 4XKJA 4CKZA 2UUPA 3FYHA 4CT5A 3Q7PA 3WX0A 3RAEC 3R9XB 4R8KA 3D0KA 1DKPA 1NKSA 1OX4A 1ZCAA 4I46A 4NCJA 2WQ7A 1X3SA 4C2UA 4UEWA 3JZDA 2XRMA 3GOQA 5EPOA 1WXDA 3LV8A 5TF0A 3RHFA 1T0JB 2XODA 5K0SA 3C3KA 5EP4A 4B4UA 1ARZA 3DE4X 5DN6A 2OHJA 4EA9A 1Z25A 2JI4A 4BRZA 1SQ5A 1CZNA 1E0DA 2HPAA 3H8SA 2OSBA 4X6YA 5FEUA 3KUCA 4G26A 1D0VA 1X74A 2NTJA 2XZPA 4I1IA 3DOFA 5DYWA 4H08A 1CDOA 4HGRA 4EMTA 2ZYUX 3S44A 3GJ5A 1ADFA 1S1CA 4LCJA 3ZW7A 4QBFA 1VDZA 4IJ5A 5BN1A 1PL0A 4X92A 3ER8A 4OLAA 3BK7A 1YR1A 3N2KB 5FV7A 3OZVA 5LQKA 2BFCB 3HADA 4S3MA 6PFKA 3SJCA 2JK0A 1PYDA 3CT4A 3I1FA 5ESRA 1ULAA 5AJHA 1IN6A 1WMAA 4RS3A 1QHHB 3D7LA 3IMEA 1UC9A 3IV6A 2P69A 1QIGA 4FFVA 4HADA 4YJ2F 3F71A 3RH0A 4PSVA 1HNZB 1HEUA 4W5HA 1YKFA 2XQIA 1F5NA 3NM4A 2XVYA 3QELA 4AZTA 4YAIA 5JRDS 4ZGGA 4AMGA 2GAOA 2G3YA 3KZKA 4FI3C 1YFZA 2WJJA 1U80A 1BGXT 1NQAO 1U9JA 3KKOA 4RKRA 4ZOEA 3U4CA 4EG1A 3DFZA 2VNJA 1GPJA 4URFA 1FK8A 4C6SA 2FRVA 3OQPA 5A62A 3X0DA 5IAAA 2O8DA 3FNIA 4V2IA 4ZQCB 5IC6A 4GPAA 5DHUA 4GGOA 5HW0A 2W6JA 4MVJG 4CNQA 1QGOA 4BNGA 4PYRA 2CK3A 1J1ZA 3PFCA 1XD2A 2CDCA 5ECYA 2UZ4A 1SIBE 4EOGA 5CD1A 1N8NA 3V1TC 1ZOOA 3ZWDA 4ZI7B 4J4HA 3AI7A 3UOGA 5F92A 3BE4A 3ESZA 2WAXA 2GAAA 2Y6VA 1OWLA 2PX4A 3JQAA 3QE0A 3DP7A 1UIMA 1I0LA 4EGQA 4UW9A 1DRVA 1DMRA 1Y7IA 4CV3A 3ESRA 2VXCA 4NMXB 3VHXB 2FW1A 2JFQA 3GC6A 2XYRA 3U26A 1R0SA 4BV8A 2NV6A 2RCYA 2F90A 4LZWA 3G8BA 4NULA 4UU7A 4KOAA 1GWNA 2Q5CA 3CO5A 4C0BA 2XX3A 3E7FA 3TINA 3OTOB 2C04A 4IOJA 2BZSA 2NO4A 3EMVA 4ZD6A 4ZAYA 1ENPA 5E6RB 1DKMA 5A9SB 3U13A 3WMRA 4ALKA 3GNTA 2X9NA 3BMNA 4AYXA 2BUBA 3W1VA 2AZTA 4V3CA 1NRJB 1Z15A 3CWZA 4LRWA 1KO8A 3DE3X 3T3MB 5CFOA 3GEPA 3BIJA 4PYJA 1KRXA 1WY7A 4GVLA 5L7WA 4AQYB 2R11A 2RAPA 5EOVA 4QUDA 4FFMA 1HSZA 3FROA 4EB6A 4UPVA 5HDBB 4FUTA 5IK2A 2UUBB 4REQA 2FPMA 1OIWA 2AT1A 4I50F 4F9EA 1JPJA 3LMKA 3QXXA 4QNRA 3CB2A 1GPNA 1GCIA 3EQ9A 4BO4A 1P29A 1DQSA 3UWOA 3AVTA 1IQ0A 1DIRA 2C1EA 3BGSA 4FS3A 2QMOA 1FZQA 3UGTA 1FF9A 2GNAA 3GLGB 9MHTA 2PTHA 2GEBA 1IXSB 4QQ8A 4Q24A 1HLDA 1N7JA 3OQVA 5GIPE 4JSYA 3BXXA 3BZBA 4MJXA 3JVDA 3LY7A 5C51B 3Q5GA 3TGLA 1P19A 1CRQA 1DAKA 1EZZA 1PJAA 3KAKA 3FDFA 1IJFA 4N6NA 5F1YA 4Z7NB 3HXMA 4HKTA 4Q7KA 3E7WA 3EIEA 4Q16A 3PEVA 1VIYA 1YR9A 3L9XA 3A2KA 4K46A 2UUOA 5HR5A 2KSQA 3D6FA 3SWWA 3SOPA 4QAQA 5KOYA 1KI8A 2H16A 3JARB 3VH2A 1HNNA 4EVRA 4K9PA 1A4RA 4TYYA 4YUVA 3D7KA 2PNFA 3P71T 2BY4A 2DX7A 3MCVA 3PHGA 4C08A 4JUIA 4ZGBA 1ZA1A 4LYGA 3OM9A 2ZBPA 1Y1QA 4CLRB 1G41A 3ZHUA 5JYDA 2M2IA 5IVPA 1IXKA 4EG5A 1IN8A 1G1AA 2OXEA 3EH2A 2BFFB 2GPBA 3L82B 4HEA1 3A05A 4CMEC 3V1YA 2QJFA 2WMYA 2WTAA 3GLIA 3JD3A 1VHQA 3PXEA 2CF6A 2LKCA 2QE6A 2UDPA 1IXYA 2ZTVA 1U90A 5EQFA 4JXZA 4BNHA 2MINB 5FBQB 1QVAA 4AURA 2ZEJA 1FJGB 4GMDA 1NFFA 1PWYE 1ZH2A 2ZKLA 4RVFA 3WNQA 3FNQA 1ZCBA 3HDTA 4ZO9A 2WM2A 3M4JA 4RJIA 4F2WA 1E6EA 1M1YB 4LQDA 4C7XA 4FOOA 4HMOA 3TOXA 3ORFA 1NE7A 1UBCA 3WB1A 4BEJA 2JFFA 1FRVA 1OLUA 3ZUPA 4BYGA 5JASA 1EB8A 4MKGA 4NE9A 4IDNA 2HT6A 5ALXA 5HIIA 3LOPA 3TOZA 2EIHA 4J0EA 3ZN2A 2JDID 5AJYA 3S5JA 5JADA 2YC4C 4QTTB 2PT9A 2XT9A 4MW7A 3LTEA 5HQ3A 1VYUA 3TD2A 2XZDA 1H8EA 1U7ZA 2ZIWB 2CMHA 3HEBA 3W5SA 4CF6A 6Q21A 1R2QA 4AF8A 1XVUA 4ML3A 4QO8A 1KSHA 2W8ZA 4C21A 5T67A 1EPUA 1AA6A 2YWJA 2ZRLA 6REQA 2P3OA 2FVYA 1JXAA 3QJYA 4JLUA 3HK2A 1K0FA 1SHZA 3RNLA 2Y4NA 3MXTA 4EI8A 4CE6A 2XHZA 1CVRA 1H2EA 1I80A 1FDOA 2R7KA 2FQQA 3BG5A 2FVXA 2AXNA 1R0BA 1YA8A 3ZZUA 3AKCA 3KZCA 3VV3A 3CBGA 3MUEA 2FP4B 1H8HA 1SC1A 3OZWA 4YJ2A 4F6RA 3AF1A 3VVBA 1L5ZA 2MMGA 1QGZA 2I2AA 3FSGA 1W19A 1RYYA 4YAFA 1F5SA 1X38A 2C59A 3DHVA 4XLLA 5F2KA 5JS2A 2C7OA 1LVUA 3O4RA 2FW6A 2XTJA 4BFCA 3SICE 4OB6A 3H5RA 5DTJA 1SCNE 1FVOA 1SUEA 5B3AA 3IDAA 3S2ZA 4C78A 2IITA 2EFYA 2LE0A 4EZIA 2ECPA 1DQPA 1M2OB 5H4GA 3JQ7B 5LMNB 1Q21A 2OB2A 3E9ZA 3DTVB 3P32A 4KLZA 3MWEA 2FRDA 2X7HA 1QDLB 1CS0A 4UUNA 5JECA 3U6BA 3MT9A 1ZJJA 3BH6A 1QV7A 4QXAA 3ULKA 2AOTB 4G07A 3FF4A 1OFVA 1D2NA 4X1OA 2CLLB 1FX0A 3P0EA 4JJ8A 1J22A 4Q6WA 1M5TA 1XQ1A 4RQAA 1FVXA 2VOEA 3IJRA 1QZXA 3INTA 3NBAA 3SQLA 4BNNA 1JKXA 4NJMA 1KEEB 3DNMA 2OHIA 2PWYA 5HGXA 3VH4A 2QQGA 5IF3A 2H4YA 1L4MA 2OFFA 3NC1C 2PQ0A 1AK1A 4BNKA 4KX5A 3B6JA 1U1EA 2HRBA 2XITA 3GOHA 4TZ6A 2IJGX 4DMGA 2YCLA 5FPYA 4PZYA 1U3FA 1E1QA 1RMQA 2JFHA 5I7HA 1Q0RA 2A57A 4BN4A 4L22A 3Q8LA 4GDMA 4JBNA 3CZ4A 2A14A 4NZZA 3AERA 3FYUC 2BVNA 5IBCA 2JAQA 4NY1A 2ZJ0A 3RJMA 5CB8A 1ZUWA 2GZRA 3GEEA 1EVLA 2RK6A 1N1GA 1R0XA 3SLRA 4KMSA 4EVQA 2Y1OA 3ICQB 1DOZA 4Q1VA 3WLSA 4QTXA 1PD0A 3AVUA 1U7OA 1JPUA 1EYZA 1KY3A 4CF4A 3LZCA 3ZJUA 4Q7JB 1UM8A 2RMKA 3A4VA 4R9UC 5L3RA 2C7QA 1II8B 3OIGA 5GINE 2BM1A 4JSTA 2C98A 1Z16A 1Z2OX 4BOYA 2HF9A 4CQMA 1VLLA 3HYTA 5EMNA 1HGXA 4EFMA 5CAEA 3QQ5A 2BRUA 3ZWQA 1OBOA 4RJLA 3OZXA 4OH7A 4DRXB 1AZTA 5G02A 4R9RA 4C87A 4B3DA 1EZ4A 1FS5A 4ZQIA 3OJ0A 4G23A 4QUGA 2JFZA 4ZQEA 3SVLA 5CVUA 4KIGA 1BD4A 1JT2A 3AF3A 4MWOA 4ZDJA 2G5CA 3M3DA 5KPJA 2VYVA 4AUEA 1KK0A 2GN0A 4JJZA 1X1QA 2VJOA 2P79A 1PS0A 2FKAA 2XXAB 4MVJI 4YDQA 3I09A 3CNOA 4RXUA 4Y2GA 3KDPA 5AKHA 3OPYI 1RABA 1U1FA 1JWLA 3OPMA 3GJ6A 5DT2A 1WHTA 2A0WA 3GJ4A 4CQLA 3WYDA 1QYVA 1QHIA 4ZDWA 3GRRA 3RKSA 4XYLA 4N5MA 3WBBA 1CUHA 2VK4A 3FNEA 4DB2A 3E27A 3OI7A 2XRYA 1TW3A 1SU8A 1WDKA 5I9SA 4K87A 4DZRA 1EP2B 4S1TA 5AXCA 1X7WB 1JAYA 1T5TA 3CVXA 2YIMA 4ZRMA 2FJUA 3H2KA 4Q3LA 2PGDA 3FWHA 4EHBA 1OD6A 2FN3A 3FDZA 3SJAA 4IR7A 4NMMA 4XIJA 3LX6A 1S96A 3F7NA 4DGSA 1NVXQ 2QAJA 5HBRA 3G2HA 3E7PA 4TGLA 3ZIAA 4URVR 1QZTA 4XJSA 1Z28A 3DL7A 3UGKA 1WBDA 3OJOA 4CLEA 1BIFA 1N2ZA 3HJFA 2XZLA 3H0EA 1GL6A 4Z3KA 2GVZC 2ZAGA 3HVRA 1W29A 1C50A 4DA6A 1QO0A 4XCQA 2MYUA 3NWBA 3URKA 5HE9A 4IV8A 1RI1A 1VSQA 2H4WA 2HADA 2BEJA 1KZ6A 2VHXA 3H8JA 1EB9A 2QXTA 5SY6A 1ND5A 3ELYA 2X1VA 3KJQA 4Q01A 4UBLA 3ZJYA 4DCNA 1NFRA 4LJSA 5EZYB 2YC2C 3N3AC 4QPJC 1C9KA 1R4MA 1OVMA 4HQNA 1RPTA 1UK7A 3KZXA 4Q47A 3TN7A 3LX5A 3NBKA 2REQA 2QW0X 3CF4G 2A94A 3KXIA 4FGJA 1UKBA 4GPTA 1TAHA 4IHJB 4P4LA 4HR7A 4JHLA 4AMZA 4I7EA 4EQ6B 2YV5A 3BRWA 4KXXA 3L0SA 1X1EA 4QPCA 5IXSA 2WJIA 3WAJA 5CM8B 5KC9A 5H0IA 1WPGA 3I92A 5BWBA 5JCJD 1M7HA 3K70C 3QE9Y 4TXLA 5TGDA 3B78A 4ZQFA 2UYYA 2FSIA 3OCXA 4UUAA 3TGPA 3VA7A 3ND8A 2R7MA 2VJMA 3GUYA 1ATIA 5DZSA 4E15A 4EJ6A 4ZYWA 2J3EA 2YVKA 2OVBA 2Q9BA 1HL7A 3RB8A 1UT6A 4XLZA 3TE7A 1O08A 2QJRA 4JA2A 1MKYA 4FSDA 1NBMA 1KE1A 4Z5XA 2PUBA 2F17A 3W2IA 5KOJA 3ZD9A 2G72A 3ENQA 1DRWA 1GEGA 4M89A 5JVDF 3NV9A 1HR0B 4FINA 4QM6A 4AF6A 3UJBA 2AR7A 2ZJOA 4J2HA 3GLGE 4AN4A 2CF5A 3E9NA 1PR2A 4LXXA 1N2HA 3UXMA 2QD2A 1AUVA 3E35A 4TWZA 5JD6A 3DGFC 4WT7A 3R7NA 3H5LA 1IQRA 1JWBB 1OJ7A 2G17A 2I22A 4BMVA 4D1YA 5CG2A 1ZIDA 4PC6A 4YRKA 3T38A 5IN4A 3FBGA 1EG2A 1K92A 3KFVA 3V8VA 4DJTA 3B85A 4FB5A 5BW4A 1SGWA 5ANRB 1SXJD 1T0IA 2K87A 2QL5A 3HFGA 1V37A 5A4IS 2JI6A 3BD9A 1EJ2A 2ZTHA 4NEGA 3PLNA 4LSGA 3PRYA 4LOIA 3WSTA 2XZTA 3KKZA 2IU4A 3W1WA 1CZLA 2MJLA 1V96A 1SOVA 2HQRA 3UCFA 1H9BA 1LBSA 4HS9A 4DLSA 4E7PA 2CV0A 4BV9A 4E2WA 2BJVA 2VEDA 4CLOB 1MHTA 5KCMA 2JLAA 4WOBA 1FP4B 1S8AA 1Y4DE 4LISA 1TJ4A 4M54A 3RT7A 4C1NA 1A7UA 2AOWA 2BC9A 4YA6A 2UYCA 3RRMA 1WUHS 4ECEA 2A5JA 2Y0EA 3GQBB 3K1AA 1A27A 3TLGB 1RRPA 1ZN8A 1S2OA 3GD5A 1C1DA 1G9SA 3PJDA 1W48A 1T2VA 1ZS9A 5TQ2B 2PFGA 1XN1A 3HNOA 3O1LA 4INPA 3E22A 4FKBA 4NONA 4F84A 1YQGA 1ECBA 4AMYA 4RPCA 1GSIA 5D2CA 4ZJYA 1QIIA 3GXOA 5GOZA 3ZOKA 4TUYF 5K51A 4WBNB 5DOVA 1OLSB 3BC1A 5CVJA 3DMTA 4WN3A 1JKMA 3IE0A 4FCWA 5EXDA 1OF1A 4UHHA 2PX2A 3RYHA 2O3SA 1GKLA 4YUWA 2QPLA 1I7SB 3L4KA 1EHCA 1H4SA 2RG1A 1GAWA 1M1YE 2G63A 4JJKA 4KXUA 2AVDA 2Q4OA 4FLEA 4M53A 2IGBA 2H1WA 3MOIA 3OQ1A 3QYFA 4U2CA 1V7ZA 1F8FA 4YAWA 3TPFA 3W7VA 5C32A 1DEAA 3L8ZA 1V43A 3OKCA 3VR3A 3A1FA 4DTCA 1GTMA 4QWMA 1E3SA 1GEEA 1JXQA 2I4IA 3G2OA 3MJDA 1Q1GA 1YJXA 2HZ7A 2JL1A 3GTDA 3BE5A 2PZAA 3PUYA 3CI0K 1CUIA 3HYCA 1EFUA 4Q1EA 3IAXA 3ISVA 5HKBA 3NWOA 2WVAA 3PB3A 2KI5A 3I30X 4KBYA 3VZPA 4S1NA 1R6UA 2G6TA 4Y2QA 1U28A 1B0AA 4RTMA 1TUBA 2EBUA 3DZDA 4RMJA 5KYYB 1E5TA 2G5PA 2XQGA 3PUVA 3QLEA 3OE7A 1P5JA 4PX3A 4YTEA 1TC2A 2C2OA 4CL8A 2RI1A 1A7JA 4UC0A 1SBZA 1QDEA 1Z45A 2GCOB 3FPLA 5E6SA 3WRYC 1OU0A 4RKEA 3U1TA 4NJEB 1EMDA 2XEXA 1DC8A 4BWGA 3EF1A 3K09C 3B1KA 4E5SA 1LI7A 1C9NA 2AHRA 2YYAA 3HBAA 3NHUA 2BKUA 4WXMA 3HCDA 3O8OA 2IU0A 3RYCB 2XYHA 1AXGA 1OBVA 4MJLA 4PTZA 3IJPA 3W1EA 5EJ4A 5L53A 1NHWA 1YRQA 2TMYA 3M49A 4N0MA 2DB3A 1OILA 1H23A 4U3JB 1KNXA 2ZJYA 5FTLA 1GLVA 2II6A 2BUCA 3R7DA 4MWTA 3D54D 3DMDA 1PWXA 5GMOA 5BW5A 3QF4A 4A0HA 4EUEA 4M98A 1MRSA 3USZA 2SHKA 4M83A 1UPCA 4ZZ1A 1IY1A 4FHCA 2Z2IA 1R4AA 2HLHA 1NF3A 3QIAA 4IV0A 5JNRA 2PH3A 4BNUA 5AVQA 1IHYA 5AYVA 1RMYA 4TMVA 1EUDB 1U2ZA 5FLEX 3VSAA 2WHPA 2WV9A 1EFRD 1Y81A 3SI7A 1YQUA 2W37A 4C22A 3B1XA 4AKEA 3Q6IA 3R7LA 3BQNB 1NULA 3KYCB 3ZWXA 4RSGA 1JLLA 3O2SB 1XDGA 4CR7A 3IQZA 3LQ1A 3MJSA 4WJZA 1ZCJA 1Q0PA 3HRIA 4ALLA 5HZHA 1C4XA 5IH3A 2IS4A 1M5UA 1W5SA 1KOJA 3C6MA 4EH1A 3LPDA 1D8AA 2M6RA 1T1RA 2J07A 2JBAB 1XZPA 4MQFB 4Z0HO 5LLDA 1AQNA 3X1ZA 1ZZGA 4RPKA 4XWKA 5TX7A 1X7GA 3R9KA 4UM8B 5I51A 1XV5A 4GRAA 2XE4A 3SC2B 1I33A 3VNUA 3FI9A 5CDFE 2BN4A 3JQPA 3IL2A 2IS1A 2OCXA 4L3WA 2O8BB 2P2NA 1LK7A 2BM0A 4F6LA 3MWDA 3AL3A 1G5FA 3ZE2B 1SWWA 2W00A 3FZEA 3MF4A 4CU2A 3WDKA 1IVSA 2BMWA 1N7IA 2HXGA 4WWHA 3ZE9A 1J5XA 3N8IA 1U2DC 1U7PA 2VP2A 1C7ZA 5FTWA 2EP8A 4DIKA 3ESYA 1B8UA 2OCPA 3A4TA 2YR0A 4GH5A 3HACA 5TMEA 3UMSA 1DAIA 4OEHA 4UM7A 5FXMA 1PT5A 2H29A 2JJ2D 3IQGX 1GAJA 1TJ7A 5LP6F 1QIHA 4B6FA 3B1YA 3KQOA 3KVVA 4LX8A 3PKJA 4QGAA 1N5RA 3T1NA 4A1OA 4ZFNA 2ISQA 4N3NA 2RK3A 4EA8A 1X80B 1F0PA 5EAIA 2OY0A 2ZI9A 3LM8A 3H1FA 3WQSB 2OO5C 3BA6A 2JGDA 5GONA 3SYNA 1I3KA 3GRKA 2J3LA 2RC6A 3R6QA 1KPGA 1I32A 2DSNA 2F8LA 2HTFA 3KVOA 1W49A 4HRXA 1N2SA 1ZAKA 2NU7B 2LTAA 4PONA 1GLGA 1PIWA 2P6PA 3H84A 4XVCA 4ZANA 4CM8A 2IXGA 4PRZA 5JVDA 1NW8A 1L7XA 2BZ0A 2PS1A 5DO9A 1G3MA 3PX7A 5A0VA 1TL7C 2AFIB 1VPLA 2J9FA 1OGYA 4K3VA 4F06A 4M49A 2P8JA 2O0MA 2YY7A 5FHRA 1GPYA 4HDQB 4FT2A 3KT6A 4K9RA 3SM3A 4ZI5A 2YQZA 3AKEA 5A02A 2JIDA 1U7HA 4U9HS 2B0JA 4OI0A 3M5PA 4JD5A 3MT8A 2VQ3A 2FR8A 4MUGA 1P72A 1CJBA 2VP3A 5L7YA 4F7WA 4KK4A 1K5DA 1N0HA 2LVBA 3WC4A 1T5LA 4ODIA 4A0FA 2AI1A 4AG3A 4ZCTA 1YS9A 3WJ7A 3BQMB 3O4FA 2RKWA 3SAJA 3FSEA 4FHFA 3U56A 1PJ3A 1RJDA 2DERA 2H3EA 5A7FA 1X7ZB 3AOEA 2O2HA 4XFJA 4QGSA 2FZVA 1PSZA 1DJOA 4JLWA 4UNSA 1WCIB 1O2DA 1A5SB 1VG1A 3NVDA 3MWYW 1F0NA 3LUGA 5TRTA 5G0TA 3RUDA 4N6GA 1GNSA 2QTVB 1FMTA 1BH2A 1QONA 1IC6A 3GUVA 1CLUA 1T6XA 1HFWA 1R5JA 3IMCA 3AJAA 3PNYA 4IOMA 4Y8VA 1Q0ZA 2HHCA 3TLBA 3ZOZA 2P9BA 4L9RA 1BCRA 2FF7A 2NZYA 3P4YA 3WYCA 4DDMA 4EPTA 4LQCA 3IDFA 3FETA 1J97A 2Q3CA 3B1WA 1MT0A 3QNWA 1CC1S 1GDHA 4FGSA 1DZ3A 2VP5A 3O0TA 4X93A 4JV5B 1ZYUA 3EX7C 2R9VA 3IKTA 3CGWA 1E89A 2R97A 5BRJA 2O4CA 2YYSA 4ZV9A 5JC8A 2FEPA 1HE4A 2V4MA 4YMLA 1RJEA 3FVWA 3WLRA 2Z8YA 2CE7A 2ECOA 4W6QA 4F2DA 2XWJI 2W8BA 4HGYA 3AHJA 3F98A 1XTKA 4WSOA 1GSOA 2O5VA 4G09A 4L3OA 2E0IA 3H1EA 1LDYA 2IHBA 2XMZA 3WO0A 5JBQA 3M6UA 1YIDA 2ZQYA 3OPYB 4LPKA 5EP1A 3TQTA 1QIMA 4RBNA 5LNK6 1N5LA 4WZ6A 3QSGA 4IQ0A 4JH0A 5AJXA 5LDHA 3U0VA 4BNXA 3O0DA 5KDOA 3MJTA 4RY8A 1I1QB 4P4SA 3EXEA 3WIBA 4AECA 4AWAA 2QTFA 3ESCA 3ND7A 2ZBUA 5A05A 1USUA 1DJMA 3DHYA 3KJIA 4Y6OA 2C9ZA 1NPYA 1OH7A 3LSYA 4P4TA 4B4DA 4KACA 4DOMA 4PC1A 5J1SB 2GZ2A 1TKAA 1JVSA 2SKEA 3KTAB 1V4NA 2ZVQX 3HKBB 1L1QA 3Q98A 4QODA 1BRTA 3X2FA 3DHNA 421PA 1DRJA 3GLUA 3KIPA 1OHHA 2G9ZA 3H6HA 4JBWA 4RWEA 4OXRA 1NSYA 2W2KB 2DFVA 4CJXA 3OCEA 1R8JA 2YV1A 1QLJA 4ZT3A 3ODPA 4KAJA 3C8UA 3VPHA 1CEYA 2EQ5A 5IHPA 5EXXA 2FZ4A 2AKEA 1FXWF 1XU4A 3E2IA 2F4NA 1HQDA 4FC7A 1Y9JA 3PENA 2X40A 4X63A 3EG9B 1E2QA 3OE5A 4LMBA 3AM5A 2H85A 4DJFC 1YSCA 4V24A 1FRZA 1SAYA 4S0ZA 4D4LA 4X97A 4MR8A 5HPYB 4IM7A 3O6VA 4LJAA 3PZBA 3ESQA 1U98A 4QTUB 5HSGA 2YV3A 4MTCA 3ZQ6A 4GFDA 1O77A 3B1VA 4EEZA 2PK3A 1XWWA 1JJFA 2E9SA 1O9HA 3M1YA 1Y5MA 2OTCA 4M0MA 3MUOA 1Z62A 2J3MA 3O82A 2OORC 1I4EB 3EFEA 4Q0MA 3IQFA 4C4SA 1M6YA 2HA5A 3DPSA 1I5RA 5B3KA 1K68A 4GMFA 4NHOA 1A9YA 1VPEA 5JO9A 4WVLA 4X3CA 4DV7B 4ZU1X 4OQEA 1UBUS 1JLSA 2C95A 1H1TA 1G8PA 3ACBA 1M8JA 5ERYA 3UFXA 1KYQA 2HA7A 5DK6A 2I9PA 4G25A 1JJIA 4N5DA 1XRSB 4OHBA 5ALTA 5HF6A 4A03A 4Q7MB 4BVJA 1OXXK 1R6DA 4I1PA 1NDQA 4NV1A 4ABTA 3ME5A 1EBBA 1YQTA 2VWPA 1DWQA 1LLFA 4LGVA 2XMBA 2XADA 4P84A 3B5IA 2CT8A 1MXFA 3I9V6 1KJ9A 3CUTA 1DCFA 1GCOA 5TIIA 2FPXA 1QO9A 4NZOA 5FOUA 5LP6A 4CTMA 1IMJA 5K4GA 1JVNA 3TRFA 1JECA 3GP8A 3I6MA 3T0IA 5FBWB 1L7NA 3MTBA 2JCSA 4C4PA 2AFHE 1QDUA 1OLXA 3H1AA 4MS1B 5F33A 5B4VA 3J7AC 3EGEA 2O2GA 4AI6A 4EF6A 1VMEA 2OCGA 3G0DA 2VDKB 1Y4UA 4ENTA 1J1UA 1EFCA 4WE3A 3LLVA 5G4LA 2IWRA 2RAFA 3BGIA 3MLAA 1GD1O 4DMRA 3RVQA 2VH2A 5FORA 3JPYA 5FJIA 5K3EA 2HT1A 2XOEA 1ILWA 3Q1LA 5DYTA 2HF7A 1E9FA 4EG8A 1WIWA 4F7DA 2GN9A 3JY6A 1XHLA 3CJQA 3F4LA 3KO8A 4LGYA 4CEHA 2XYGA 4RJKA 2YNMD 4MUXA 5ENVA 4CM9A 1XNJA 2PYDA 3BCRA 3BIOA 3K4PA 1A50B 4MW9A 4ZI2A 2AOXA 1IYZA 3J81k 3IOYA 3BRQA 1HNXB 1PJZA 3B51X 4WADA 2FW0A 5PGMA 5GAJA 1JB1A 1PWZA 2OZKA 3DFFA 4PBSA 4WOKA 4AICA 3B1JA 3SVTA 4F5DA 1FB5A 2WP8J 3G2QA 4V0MA 4KQJA 4C4XA 4I4LA 3FNBA 2IHVA 4FGLA 2GWHA 3ANYB 4ZYLA 4Z4CA 1J5EB 3N8NA 1L4HA 3K9HA 4WDRA 3ZWNA 2ARKA 4HGOA 4OFXA 2Y1XA 1KSJA 5BY2A 2I7CA 2BZGA 4L9WA 4BUJA 5FL7A 5JMOA 1AKUA 1KETA 1NNUA 1L7OA 1NR7A 1TZJA 1YK0A 4MA5A 4N4AA 3RYIB 4BN5A 5C18A 3AJEA 4KPFC 1UFVA 1YJ8A 3QVTA 1VFPA 3E03A 3ZXIA 4NLLA 1TGVA 2PQ2A 5BRAA 3NVKI 3ABIA 4HDSA 2VK2A 1YZ3A 2OGTA 1MEJA 3JQBA 4PE5B 3VYTB 3EC2A 4HWGA 5IUKC 4HZUB 2ERYA 1XX6A 2NU8B 2W2OA 4CMJA 2WI8A 2NVOA 4YALA 1P3DA 3B6ZA 3GEBA 3JWJA 1P44A 5FPQA 3T41A 2ZWAA 2XUGA 2JGNA 4GI2A 3RC2A 4CKEA 1K8ZB 3W90A 3C87A 3I64A 3VQTA 2VJCA 2VTBA 5JZVA 4I5GA 1A9PA 1V1JA 5E38A 4Q4HA 3I58A 1W5FA 3CRVA 2QVCA 4WY5A 3GLVA 1U9ZA 4U39A 2XUFA 3P96A 4URXR 4HDRB 1L7QA 1AT1A 2RBEA 4LDAA 3GCGA 2IEAA 3M33A 2OG1A 4I1VA 1DOHA 2PV7A 3MWKA 4QX6A 1W6UA 5IEBA 3VYWA 2CVZA 2N42A 4H1TA 4UZEA 1Z08A 1H1LA 1SB8A 4YHBA 3M4ZA 5SV2A 3GPIA 5JLAA 3S8EA 2GETA 1VMKA 5BYJA 4BPRA 5L3VA 3IIKA 2W0MA 5L4LA 3AB3A 1UPTA 2ANCA 4RGQA 4QQFA 4TKMA 4XJVA 5EIBC 5BSTA 5M34A 5HTOA 2B1JA 3UZUA 3K70B 4DZTA 3KZMA 1GN8A 1J0BA 2QRHA 3MILA 3W2FA 4ADSG 4BX9A 1F12A 2WNSA 1NMZA 3PDUA 1NDHA 2H08A 2XTZA 2RHHA 3P9ZA 1JVBA 4B0PA 1CQIA 1ZW1A 4OAPA 1WOMA 3W7AA 5LDDC 1VHTA 1XIVA 2VDUE 3DBHA 5J2UB 5FHQA 1EBUA 2JFXA 2K6GA 1X2BA 4KQ1A 2YJZA 1ACJA 4TL6A 2ZXUA 4EPYA 1P1JA 2QD1A 2AFIE 2VTDA 1FXWA 3ANTA 2OXFA 5FOVA 1ZH4A 2DAPA 4EJ2A 1U11A 1UKVY 2OGWA 2ORIA 2CNNA 2PMWB 5K8LA 3QVKA 2ZUDA 4LMAA 5TPZA 3V34A 4F1JA 2GPYA 5CM9C 2XCRB 1BTOA 4URYR 2GM9A 3MOGA 1Z6YA 2DYKA 5E95A 4IICA 4LTMA 4WNIA 2ZI3A 3L0ZA 5AOCA 4X8LA 1U0JA 1WMEA 1RWQA 2FSHA 1JR3E 3CONA 3TO5A 2QBYB 5CDSA 2KWIA 2ZE7A 2YXNA 3KHSA 4DY4A 2B4KA 3O26A 1ZHHA 1W0JD 3P0FA 1JLRA 3N2GB 3AHHA 1LTQA 2R1VA 3SQWA 2VDNB 4FQ5A 2WAYA 3QNUA 4RU1A 5T8KA 2Q7OE 4FD3A 1EE9A 4FOLA 2O8CA 2QG9A 4LYFA 2GNPA 4V03A 2RIPA 3NLLA 4B5LA 3W5AA 3KQNA 3L9WA 5I8PA 4XQ9A 4EB8A 1M2GA 1I3LA 2KB0A 2O1WA 1JSLA 1FCJA 1RQPA 1C7QA 4KZPA 4DQDA 1J7KA 1ACMA 5A5DA 8OHMA 1WXQA 5KB3A 1R12A 4PYMA 4BATA 1S2MA 1KR2A 1WG8A 3GCXA 4ZVNA 2FOLA 4WIAA 1M8GA 3HP7A 1XRJA 4MJ3A 1G16A 3O1JC 2QN9A 1LWOA 1R1DA 1AF7A 3CLRD 1L5GB 3A14A 3COVA 4Y3UA 3V4ZA 1EM8B 2NTVA 2FPRA 3DEYX 4XWWA 1SBIA 3B82A 1EHYA 2NZ8A 3RS0A 1ZUNA 1CB7A 4M9CA 4UXJA 4Y9SA 2P62A 2JVIA 3DKIA 3E4DA 5K0BA 2MTBA 2C7BA 1BA2A 2YMLA 2WUVA 3AP1A 5EP3A 1XVIA 2YMQA 1DBSA 4HRYA 4HX2A 1D6MA 2WU3A 2WABA 1K9SA 3ANLA 3JW8A 1RKQA 4FBLA 5E7QA 5KKAA 3L3BA 3TFQA 3UQZA 2CXTA 2B30A 2R85A 3CPHA 4N5HX 4CL3A 3LO5A 3TCKA 5TQJA 1XTZA 2GBCA 2XI4A 2ATIA 3EGDB 4IJKA 3ROZA 5H8WA 2FK7A 2QAGC 2ZI6A 3W9BA 4BCCA 3LC2O 4H7EA 1KK1A 1VJDA 3P9YA 5J2TB 4M86A 4DLXA 3VI3B 3H86A 4E5DA 4V1CI 1V4VA 1SEPA 5CDGA 3GLHA 4Q3OA 3RO7A 2Z56A 3N0VA 1RM0A 3NYQA 4L07A 2BV3A 2EKZA 5ICSA 5ALSA 3DZHA 2H7YA 1GZUA 3UJPA 4WASA 5HJ2A 1KERA 4K86A 2D1SA 4OXKA 5IF9A 5KWIA 1THMA 4RPIA 3WLMA 4HSEA 3MPOA 1KJJA 1PZXA 2J9RA 2Y99A 4KQMA 4C5AA 4F3YA 1MA0A 3K53A 2C2WA 5EVJA 3DZGA 3L7KA 2J09A 3I2IA 5AVJA 3H97A 4PNEA 3DT8A 4JU8A 3KFXA 2OXTA 3SSMA 2JIQA 1ZOLA 1E5XA 5B58C 3VZRA 1SQ0A 3N53A 2NUPA 3AHDA 4I6GA 4UOQA 5IYZF 3S1LA 1RPZA 1MZPA 1KQGA 3KE9A 4DGQA 3I28A 3P20A 4PLPA 2KJQA 3K0AA 4I5FA 3X2SA 1KEKA 4JEIA 1P17A 2ZXFA 3O91A 3OJXA 4I2VA 4POOA 3T9BA 9ATCA 3EZ6A 6CHYA 5FV4A 3CMMA 1UT5A 2PL9A 3ACCA 4MUJA 4JT2A 4WACA 5JQGA 2B92A 1DJLA 2CFOA 2ZSFA 5EXEA 3B2QA 2C1ZA 3DB2A 3U4GA 3V2IA 3TVTA 3THOA 3HXPA 2J30A 1KZ9A 2X8WA 3BIWA 3QTBA 4KMMA 4BFTA 4RZUA 2PT5A 2QOEA 2R6DA 1NVKA 3DL0A 3CR3C 3DKVA 3H18A 1RAEA 4LHEA 3RS7A 3ZHBA 5JCZA 3MTQA 1TJPB 1V71A 2FPPB 3GUHA 3HBLA 4UBJA 4BASA 3CCCA 2ZYVX 3DE2X 5JSUA 1M76A 3RVSA 5GP1A 2IYTA 2JHFA 4W99A 1FBNA 3EDOA 5AVXA 1E2MA 3IBSA 1V4BA 3ZI4A 3CC8A 3NFRA 1ZAYA 3PL5A 4NG5A 4UVDA 5HRUA 5EXSA 2ZJ1A 1BHQ1 1R6TA 1YKGA 5MDHA 4BC1A 3OP1A 3D4LA 3QI2A 1JU3A 3NORA 1CULC 4HPWA 2FEMA 3EFBA 3K5IA 2XCUA 1JFFA 5L40A 4N7JA 3NJ8A 2PR2A 5BVGA 1KAQA 1DAPA 1VYTA 4YV0A 4FLMA 3NHFA 3ZCRA 5BSHA 2QI9C 1M2VB 1DRKA 1XU7A 3OESA 2YFYA 2V3WA 4Z8YA 4ZCQA 2XA2A 3NRCA 1LLUA 4XGQA 4XTCS 3AY0A 4Q37A 5LQDA 1N1MA 3RK0A 3DVQX 4R9NA 5KI6A 1SUFA 1UPAA 3SXJA 1DX6A 3HDGA 1NNEA 2GTIA 3HB0A 4J6EA 4FEEA 4ZVQA 2V6MA 3OJEA 1EDOA 5HFNA 5G3YA 3BBLA 5C8YF 3DYIA 3HB9A 4YAJA 3P2JA 1P7WA 3TLEA 4F1WA 2XXJA 2ACKA 3C15C 3C7TA 1FUIA 2ZQ5A 3DFUA 3VVMA 2FH5B 2F7SA 1TU0A 1KGDA 2J46A 3EQZA 4Q7LA 1UBRS 1E3WA 1TT5B 3MT7A 4Q4DA 1XKQA 3U7IA 3KR9A 4FN4A 1BKDR 1ENYA 4OV6B 3SFVA 3X2EA 2IOYA 5C0OE 1NVTA 4KQWA 4WLEA 3D02A 1TVKB 3I12A 1JPNA 3A37A 1HMYA 4MIOA 4PG6A 3QKRB 4UUMA 3GMTA 5CYPA 1I7QB 3AEXA 2D4AA 3AF6A 4LX0A 5B7GA 1I2DA 5KHLB 2PS0A 4YFYA 5EC8A 1UK9A 1QV6A 5A9RA 2PH5A 4MVWA 5EJ9A 2G9UA 4ZEXA 4M60A 1V8PA 4UFPA 2X0JA 1YRLA 1KP3A 1QP8A 4ANFA 4OF4A 4C4RA 4BL5A 1OWNA 1I13A 2M32A 3OEEA 4TKUB 4L74A 1TFUA 3N76A 3FDIA 5C3UA 1O94A 2NUAB 2IL1A 3HYNA 2GZ1A 3GCWA 1QM5A 1HE2A 3H2ZA 3V4FA 4EJMA 5A03A 3FVVA 1A97A 3VU0A 1FSFA 2I1QA 1PS8A 2RHLA 3JQAD 1SQ6A 3NRJA 2HGZA 4GM1A 1TCVA 2FWAA 3TAHA 3TQQA 1UFQA 2PNJA 3ZKAA 3I52A 4O2AB 1QRUA 4EBBA 3PYMA 3CW9A 2BM9A 4AN0A 3FIJA 4YLYA 1UC5B 1G6OA 1MAVA 1SCBA 4X90A 3SX4A 1JHVA 3PGA1 5CA0F 4GEKA 5KNCD 5CEFA 4OUKX 1Y4ZA 3C3DA 4F5WA 3IHWA 4ZRNA 5ARCA 3AB7A 5FUWA 2CDRA 2VP9A 5L6MB 4MMXB 4A4DA 1LLCA 3DXZA 4KR6A 3T12A 4IF4A 4F4CA 4I5DA 2IIPA 3PUXA 2XB6A 3FMFA 2XCSB 4NXMB 2EIXA 4YI5A 5KSOA 3D3WB 3VTFA 5G0VA 1VE7A 3GJSA 4MI3A 2V6BA 1E1RD 2WK1A 1V8ZA 3P9CA 2QJWA 4BKUA 5ALZA 4TTQA 4YCLA 2LRHA 1R0RE 2JEZA 3LGAA 4E94A 3LQKA 2JHPA 1Z4OA 4GPEA 4C3OB 1PQPA 1QLHA 2JIOA 1GCAA 2WP0A 4WKNA 1R15A 2PTRA 3WGQA 3HJTA 1ISFA 1DEKA 4ZVTA 2FMFA 1QAMA 1O6CA 2DFPA 2HMYB 1V5GA 4I1UA 3C5CA 1QWSA 1Z88A 4G2TA 2HEIA 2IUFA 5DE3A 4PQGA 4ZT6A 5FTNA 5HQJA 1NIPA 1J1IA 2P9FA 3E53A 2D3WA 1SRQA 3LUPA 2IK8A 4L6IA 3WHIA 3ZNPA 4BGIA 1LX7A 4H0NA 4LVCA 3WFZA 4DRZA 1H42A 4Y1RB 3E1GA 2BDEA 4P3PA 5B2EA 1WP9A 2QEQA 3L7OA 2DUNA 4FHGA 3OLCX 4GVPA 4TMKA 2M6SA 2TS1A 1U8ZA 4JKIA 3O75A 2IIBA 3GRAA 3QPWA 2D5IA 5FI5A 1ODSA 3BSYA 3HKCA 5KNBD 3PS9A 4G2NA 2G06A 5IYZA 1VG0B 3VDXA 3QMVA 2D06A 1P1HA 4AIIA 4H60A 3ZBPA 2EYUA 1V11A 4XZ3A 3VOSA 4QPZA 1YB7A 3IMFA 3PHBE 2BR3A 1KA9H 3DPUA 1P18A 3B6IA 3PGXA 4UMDA 4XVQA 5CIWA 5LZ8A 1TK2A 3WK9A 4FFPA 5IANA 4DM7A 4FLFA 1W73A 3F6EX 2DHRA 4PSUA 4MW2A 3ZBTA 3F5DA 3OQBA 2OUKA 4K6KA 3Q7EA 1LW6E 5A3VA 1Z06A 1EP1B 3F6BX 3MHPA 1OZHA 3K0SA 5LA6F 5EESA 2C5SA 4ZYXA 1ADBA 1JKFA 2BTQB 2P4UA 4A0QA 2JGKA 3VTAA 1PTJA 3IERA 5BOSB 5I01A 4NS1A 3ZWCA 1N92A 2UZ1B 4MQ6A 1PAUA 4LJ5A 1R66A 3HCCA 2HMVA 3AWIA 4NOJA 3C8ZA 3TSZA 2FLWA 5I3CA 2BMJA 1EFKA 3WB2A 2ZR8A 5C1DA 1C1XA 1O6GA 2H2AA 7GPBA 5JMWA 1VCNA 1X7XA 5CA1F 3QOFA 1U7UA 3D5EA 1YZQA 3RREA 3D3QA 3V4PB 2R62A 3WYNA 3U7GA 1A5BB 2CLKB 1WUJS 3O83A 4MK4A 4YJ3B 2XSZD 3EHDA 4LK3A 1JSZA 3BF7A 1Y1KE 3P8ZA 2GTHA 2WYWA 3AEKA 1RCUA 4I1SA 4CV1A 5BN3B 5LVAA 1CZHA 2GARA 1COWA 2DR0A 1O58A 1DPFA 2RHTA 4XGIA 4BRWA 3AU8A 1KBOA 1EWKA 1L7DA 1RAIA 2BAGA 4KGZA 3GLQA 2PKYX 3WLKX 1W2GA 2VRBA 4BO1A 2EKQA 2NADA 5AK3A 4PGGA 3ZY3A 4MI6A 2ZWVA 3AR6A 3FKSA 4E33A 2J7PD 3F4RA 1XPUA 3GJXC 3A10A 4FBGA 1CK4A 2EBFX 4FT4A 4LNUB 4BDTA 4E5MA 1CUEA 3UT5B 2WZBA 2QGFA 2BH2A 5CVDA 3FJ1A 2EX4A 1STOA 1RWWA 1MV8A 3MWLA 3NP7A 3U31A 4K28A 3RG2A 2C5AA 3DMFA 1TADA 1CUXA 1E9BA 1RWVA 4EMBA 2HBZA 2XD9A 1ODCA 4FEYA 2R8XA 4GHWA 3UMFA 1LPSA 2HNAA 2YXPX 2ZB2A 1IVNA 2NZJA 4KRXA 4RW0A 1HKHA 2JKZA 5KWEA 3A32A 2Y71A 5K3FA 3O3NB 4I55A 4O4LF 3CZ5A 3DBOB 3L93A 3TQRA 3K2EA 5LOVF 2OFXA 1L8OA 1SK8A 2QP9X 2WPNA 3I61A 3WLHA 3L79A 1E7QA 1GTZA 4OXQA 4EWLA 2EFEB 4CM9D 5KTYA 2CHVA 1P73A 3DBLB 3U3MA 4MO2A 4TWAA 3EODA 3R9XA 4R2LA 2PAAA 1JA9A 3KXKA 4YMUA 3WGLA 2CWDA 4ESOA 1Q12A 2JLBA 4Q6BA 2ZFUA 1WTCA 3DE7X 5AFSA 4IIUA 1PYOA 3C4QA 1X19A 4RA6B 3L0PA 5AXAA 4FE4A 3THXB 3QIVA 1WU8A 3IP1A 4L02A 5E0KB 2GJ8A 3LRPA 3CVWA 1F06A 5T7BA 1ZW6A 2BPOA 1VJTA 2EXXA 2BP7B 3AEUB 3SMVA 3WI7A 4KVGA 3I34X 4IGIA 4EYGA 2WF6A 2QSJA 2GAFA 3FKQA 4FWBA 3OVMA 1YZNA 1BS1A 2BEUB 2ZYIA 3HPQA 2PVCA 4WH0A 3RTAA 3UK7A 5CFNA 2ZUFA 5CA0A 3N2KA 2HMUA 2G5TA 3VC3A 1BMQA 4OXXA 4FGWA 8MHTA 5EP2A 3L18A 1IHDA 3V42A 5IDWA 5B6PA 1CLEA 1AXRA 1TIBA 4YUZA 2R8EA 4BFXA 4WOCA 4E88A 3KK0A 4HAVA 3FFWA 5KEIA 5KQGA 5KUTA 1TCCA 3UA4A 2HJVA 5JPCA 2AN5A 4D25A 2ZR7A 1TJ3A 1U0TA 3QLVA 1SJ9A 5CTJA 3MLBA 3RBAA 2GH1A 4AZSA 1ZH6A 1A4UA 3PFGA 2L2QA 3IUSA 1U8EA 3LHSA 5KU1A 5LBUA 1KORA 2WF5A 3EXIA 1EK0A 3OBBA 4LF8B 1P74A 1SHKA 1KXZA 1CYEA 2PSJA 3WOVA 1P0QA 1PR9A 5F9FA 3HA2A 3MJEA 1IN5A 2ADFA 2PSHA 3EK2A 3KPVA 1UANA 1XTPA 3EZXA 1VGRA 2WNIA 1KVRA 2WDZA 1A5TA 2H0QA 3F8TA 3FZYA 4IILA 4MV8A 3MFQA 1DWOA 5TXGA 7MDHA 1K7YA 5KMGB 1KY2A 4ZI7A 2QL7A 2VJNA 2Y1FA 3ONWA 4WK4B 4D79A 4F12A 3U19A 1PJ4A 1P5FA 1ZJZA 4P5DA 1GKKA 1Z6PA 2M1ZA 4RVSA 2WA2A 4G5GA 5JD5A 4IDGA 5F51A 5KTTA 3QVJA 5JWRA 1CU1A 1RWXA 3OMXA 4RTKA 3QGMA 3DDWA 4RA9A 2R8PA 1R74A 1A9QA 3R40A 4WL0A 1GZHB 2CNWD 3H2SA 2O8FB 4JQZA 3ZY4A 1JDBC 2Z1MA 2QX7A 4BEVA 2E3JA 3ZDAA 3E9MA 2FR0A 4EVSA 4MA0A 2NV0A 5FOXA 1Q17A 4HAZA 5FUXA 4AMBA 2C9MA 3HZHA 4CKWA 1J99A 1KR5A 1O5IA 3I0ZA 1JR2A 5K8CA 1M2JA 4BLVA 1XR3A 1QQ5A 1OBHA 4RK0A 1XTQA 3SDZA 5CBPA 5EEHA 2R44A 2OM6A 3UUFA 2ZR9A 1ECLA 1USIA 3QV2A 3NOOA 5K0NA 4DW8A 1P0PA 3AR7A 4ZTUB 3WQHA 1BGVA 1SZCA 2DUMA 4W8OA 3FTCA 2RDMA 5KZMB 5EGNA 4QPDA 5LA6A 1K27A 1E9VA 2EF1A 4JT8A 3OLYA 4GC9A 4OP3A 4O63O 1XXHE 5HQTA 3WLJA 3DMRA 2G80A 3EF0A 1U8TA 1KIMA 3K6RA 1QOZA 4KC0A 4NYJR 4LDNA 2G1AA 4BB5A 1QE0A 3LSTA 1KMHB 3I5AA 2O0HA 3ZIAD 3JATB 1JYSA 1NNLA 2ERXA 3I9KA 3QPVA 5LZ5A 3TSOA 2YWCA 3NGXA 3VHQA 1P61B 3EGIA 3I23A 2JCVA 1CPYA 3Q3HA 4DIEA 1YV9A 1AZWA 1UM9A 2HPHA 2B2CA 2O07A 2PXXA 1QO0D 2V7XA 1B6TA 5H1YA 3JZAA 5CA1A 3GLGA 3LCMA 1GR1A 4NRDA 3LUDA 3AESB 2RJ3A 1D2MA 2WF9A 1NV8A 1H6AA 3ZZMA 5F98A 3NKLA 4IIYA 1WZNA 1M0WA 1UOPA 1XJ0A 4XI9A 3JXEA 1LS6A 4QGGA 3LXXA 2C5FA 4QUHA 4QLBA 2WSLA 3MQ4A 4H16A 1JP7A 1GNRA 4CGZA 1QHSA 4NESA 1WDWB 3LYHA 4KIWA 4YAEA 2VJAA 1AG9A 2ZU6A 3I4LA 3VU1A 3O4IA 5IN5A 2VDOB 5ARDA 2X8LA 1GNQA 2G7MC 2XCIA 3IPAA 3I0NA 3T5MA 2PUWA 2QVXX 2Q4RA 1JQDA 4Z49A 2X5KO 3PEWA 4KO1S 2YASA 3FHCB 4JBIA 4A73A 4HGNA 3SBOA 5EUMA 4ZMSA 4YP7A 3I4CA 3MSCA 4W5QA 1GTRA 4Z3DA 4NABA 3TZQA 2I2CA 2XRZA 1R7RA 4GRDA 2QAGB 4J7CA 3FRHA 4L15A 4TZ0A 2BFFA 4KXQA 4RK5A 3ZV7A 1A2BA 2AQIA 2HJHA 1O0SA 1IU9A 1OYVA 3MPUA 2O1EA 5KX5B 2FZGA 5CURA 3OTQA 2IPNA 2ZPAA 4F5ZA 5C5CA 3T1YB 5I7FA 4ZAFA 4MPJA 2EHDA 2ZM6B 3NIWA 1F14A 1E7RA 4O4LA 4M8IA 3WB0A 4JU9A 2Q9CA 2ODWA 2VAXA 3RE1A 2BFDB 3I0MA 5NLLA 2ZTSA 3TW8A 5FLXA 2J5KA 2I4RA 1S9HA 3M9WA 1FFYA 2OQIA 3AZPA 3UXHA 3IE1A 1JX6A 2Y0DA 3I05A 1CVLA 4GLBA 3L7DA 2WJAA 4DBVO 1HT3A 1U5BA 1YRWA 3OURA 1T0BA 4M9XA 5M5BA 1P77A 1VMAA 4NEQA 2WYOA 1IJKA 1SVNA 4EDHA 3JU3A 4ZV7A 4D4KA 3RS4A 3CRRA 4BPBA 1SN7A 3T9EA 2YOHA 4IY1A 3LZ6A 4RQBA 3ZDYB 3RT9A 1OGJA 1P2UA 3NKVA 4YCAA 1MJHA 2CEAA 4P58A 1ZP6A 4U6NA 5TE9A 3VRHA 2G40A 1GUYA 3HI4A 3QU4A 4IUDS 4MRPA 1X1DA 2J5QA 2H63A 2A1UB 4DR1B 2BEWB 2OZEA 5C9ZA 1WPXA 1BE1A 4HDKB 1Z2PX 5TARA 4MQEB 1UFOA 3MIIA 3O74A 3UAGA 4YP6A 1Q6YA 5JCXA 1B15A 1WRBA 3ASUA 3EZLA 3H1TA 3GGJA 4HDMA 1F9EA 2JZCA 2OYCA 1Q7RA 1RE1A 3MMPA 3R09A 4JMPA 4CI0B 5FWXB 1ZR4A 4H6WA 3HL0A 3KZ1E 1CQWA 2XUZA 4A6EA 2FP4A 5FR2A 4UHEA 4YECA 4H3KB 1LLDA 2H5EA 1K2VN 1YS4A 4KP7A 2SICE 1KHHA 1OI4A 2B94A 4QRIA 3ZWAA 3TYXA 3TG2A 2GZMA 1KVQA 1U0GA 4OHCA 5GV8A 3AB8A 2IDMA 5AHRA 2QZJA 4ZEMA 3H17A 5DSZA 1NYRA 2ZRKA 1V16B 1MORA 3DOOA 3O3OB 2EX0A 2V45A 4J1TC 4N49A 4GI7A 1O9BA 3HKDA 1T9ZA 3AM4A 3BMOA 2MWMA 1V41E 3CB4A 1FUOA 2EJCA 4RMHA 2BGIA 1AHNA 1LPBB 1A7AA 3VR3D 1CSEE 3JQ7A 5K7SA 1FDUA 3WRVA 5D84A 5SY4A 1FDIA 5SYNA 2OLEA 2WA1A 1WF3A 3A0UA 5I7AA 3WAGA 1BZYA 1RU3A 3ZCXA 2PUEA 5EHQA 1SBYA 3CN7A 4J2TA 3MS7A 3LKZA 4DV0B 1U7TA 4E09A 4J7AA 1YR7A 4EENA 1XVAA 1L5KA 3VFDA 4EKEA 5E6UB 2V4UA 2EP7A 4Y9UA 4A2CA 2VYFA 4TLEA 4OHRA 3UFBA 1K6EA 2CXRA 3NBXX 4UHCA 3RCBA 2JEYA 1ZX1A 2G82A 1U9IA 3GPBA 3R24A 4JT4A 4P7GA 3V4OA 5KOIA 5FUYA 1Y63A 1QP4A 4IS2A 4TTTS 3UMBA 1CUVA 1WOYA 2PX6A 3VPCA 1AGYA 2QW1A 1D03A 1MQAA 1L8AA 3N0WA 1XG5A 3GJRA 1MO6A 2OHGA 3BL8A 4TS3A 3TQHA 2PX0A 4UHFA 1IIRA 3P9XA 4JDUA 1LVGA 3W5DA 1RYHA 4DL9A 1T2NA 1VJGA 3BWCA 2EAUA 4F3NA 1PO7A 5CEJA 4EY6A 1PLKA 5LZ2A 4F8YA 4J4BA 3B9PA 3TUIC 1HY3A 1EFVA 3CVYA 1C7EA 4H59A 4R1QA 3CVVA 2JH3A 2H1SA 2OO3A 3GEGA 2X9LA 3GEHA 2FWPA 2WKRA 5FR1A 3HJRA 2ZIAA 4JLOA 1CE8A 1XU9A 5BUQA 3KJZA 1JDUA 2VHWA 3DF7A 3M5CA 2NG1A 2YICA 2CYCA 2VKQA 3LECA 1EKXA 3MCWA 2VDRB 3ODGA 3RRJA 4FCTA 2IQIA 4H17A 4BB6A 3R8CA 1UL1X 4IWYA 2GQ0A 3PPXA 1KO1A 1G64A 3DMNA 4K7JA 1EQ2A 1II8A 5M29A 1V3QE 3FCEA 1OIXA 3GZ4A 2ZRCA 3D81A 1ZL0A 3EWAA 3M9LA 4IDOA 2O1SA 3PIRA 1NZFA 4MKFA 3KD3A 2Q9UA 2WSSD 2PUAA 7REQB 3HLKA 4IYJA 4YT2A 2FR1A 1KRHA 4JMLA 1E9EA 3AF4A 4GUDA 1CRLA 1VE6A 3TL3A 1NJFA 1WF6A 1UMBA 2REBA 3H9JA 1JS1X 4CM7A 2DBRA 1TCAA 4RDIA 3PNPA 4BU1A 2N3ZA 4V0NA 2A5GA 3T3DA 2IEIA 2BMFA 3SS9X 4HX9A 1K4MA 2GESA 2GK4A 3PQFA 4P35A 4Q7EA 3I2FA 1GPDG 3PDJA 5FUVA 4LTDA 2CE2X 2O0LA 3ROKA 2E6KA 3VR6D 4F97A 2ZBRA 3GVIA 3QUTA 3SXUB 5JC1A 2WTUA 1DAHA 4LHZA 2OP0A 4UUOA 1LW7A 3EULA 4ZVLA 1J25A 3ZU5A 3PGLA 4IIEA 2UVDA 2D8AA 5DT9A 3W5IA 4CF3A 4G5HA 1DLIA 2ACVA 2VHJA 1I9CA 3OX3A 2OD7A 4MRMA 2ZBDA 3FVTA 3GR6A 3BXZA 4DKXA 2ZXEA 4F85A 1RXWA 5K3BA 3C3YA 1UMCB 2Z9DA 2KLBA 1Q50A 2YIDA 3T0FA 3AP2A 4ZHSA 2TRSB 1YFMA 5SZIA 4CF7A 1GZVA 5IAOA 1GAQA 2HW8A 3A25A 4GM4A 4XFDA 3BXOA 1M6VA 3G6KA 1DT3A 3H8VA 2ZI4A 4IAOA 4PU0A 2IPMA 4II3A 3DUFB 3V48A 4BO8A 1GNPA 3MJVA 2FQ1A 4Y1EA 4DMKA 1MC8A 1VGQA 3QMPA 1WXGA 2XNKA 3SPXA 2XW6A 3TUZC 1LB1B 3BSSA 3SF0A 4BVKA 3BWDD 3VKHA 2XBMA 2XTNA 4DE5A 3P5SA 3IEIA 4G41A 4TYMA 4A6XA 4Z86A 3UWMA 5J5CA 4LDJA 1K3UB 2JRCA 2X0RA 3DXYA 3GLFB 3GDFA 4HD8A 2AXEA 1QIJA 2O8VA 2Y68A 2Z2XA 3IKMB 5EFOA 1ESEA 1S4MA 3A6DA 5EZYA 2DWPA 4S2UA 1G3RA 4C0AC 3G1UA 5DYYA 3B2NA 4XD7D 5ULLA 3N39C 3TIFA 1XQ9A 3P0RA 4L8FA 3WKBA 3NW9A 1E92A 1RD4A 3OFSA 2AKAB 1DWUA 2X15A 5B1EA 4YT5A 1PFQA 1Y33E 4HQ0A 3B2EA 3IUBA 1G18A 1Y3AA 3DD5A 3PI6A 3BKWA 3IDZA 5EKSA 4FDUA 2EOAA 3NAGA 5FI0B 3EOBI 3NDBB 1ODJA 1N1EA 1X14A 3UHPA 1KP9A 2QTAA 2ZAMA 2YXDA 2O52A 3AKDA 3NXKA 4AQ7A 1PG2A 1JE0A 1GY8A 2FTKE 2PZ8A 2B1GA 2LKDA 2ALJA 4JR2A 4XDZA 4TL7A 4A82A 1EDEA 4DG5A 2QZZA 1KYWA 5JJKA 4Q19A 1D1QA 3RU9A 3RYTC 1Z2DA 3AFOA 4HLCA 4L27A 4INJA 1NVUQ 4X54A 5BMVF 3JVEA 3TRKA 1MEEA 1BQ3A 1X8JA 2PIAA 1QNFA 3HXTA 5JS8A 4CT0A 3KTDA 2C9CA 4FK8A 5C7YA 1TEZA 3RJTA 5COAA 4R1PA 4A3SA 1I0ZA 1GM5A 4OQZA 3BEOA 4G0YA 2GCIA 1Z0DA 3DMHA 4RIGA 3MGCA 3H5OA 4U2GA 5EIHA 2DUWA 1D6SA 1KE2A 3L0CA 1NF2A 3PPWA 5K09A 3AEZA 2LIPA 4BV3A 4FYWA 2OPHA 2WJWA 2UZ0A 4D3ZA 2I2XB 1LPOA 3TR0A 2BSAA 3C6QA 4QEZA 4WFJA 3RUEA 4MS4B 1LC0A 1NRWA 4JP8A 4EJSC 1JQEA 4F3KA 5B7NA 2AL7A 2C42A 1PJSA 4EUNA 5ALRA 5CTAA 1R27A 1GT6A 1W4BA 4TVOA 2R68A 1BDJA 3PE3A 1W9MA 2O3UA 4XLTA 4V0SA 4BLRA 4DR6B 1YGYA 1DJQA 4CFSA 4R2XA 1SUAA 5E2IA 4LJ7A 2AV6A 2AQHA 3A6LA 3ABOB 2GMWA 1RM3A 1GR0A 3I42A 2J3KA 1XALA 3RSFA 2ZVDA 1U3VA 1OXTA 1F6WA 3OZFA 4MRAA 3TLGA 3UBTA 1ZN2A 4E2FA 5CLGA 5L3SA 5TQ2A 4XJTA 4XRRA 4J0GA 2XCTB 4O59O 5LQRA 5EQJB 1BOOA 1PE0A 1YDWA 3HV2A 4ZRDA 4QT4A 4JEHA 4QOJA 4OJMX 5E2BA 5CDHA 3A06A 5JT1A 4X41A 4YV2A 4KR7A 1KO7A 3IP9A 5JUWA 1OZAA 2OK7A 4LF6B 4UXHA 3EC7A 2B7CA 3FTDA 2AQ8A 4CIDA 2CB0A 3TTUA 2Z95A 1YQ9A 2BFNA 4OREX 5KJCA 4KXNA 5CVCA 2HFKA 2AFHA 4MVJF 4PHCA 1KTVA 4N40A 3EPKA 2CFIA 3QPCA 2H5JA 3B6KA 3WTBA 4D46A 3UUGA 5B36A 1X6VA 3TG8A 1B16A 1E99A 2V6FA 2F8MA 3O3MB 4QXOA 5EE9A 3P97A 4G3XA 3RVMA 2D7CA 3B3QA 1Y8RB 2A58A 3L1HA 3KXDA 3O8RA 4K6OA 2A6PA 1SXPA 2OT3B 3R20A 1UXOA 2Y9MB 3F3MA 1N5IA 4L0DA 4MV3A 4TN1A 5D3QA 3CRW1 1E3DA 5BXYA 4GX5A 5AW5A 5A6VA 3MLEA 4R0NA 1YCHA 1J42A 3AR8A 1YIAA 2GCOA 4TXNA 3AOGA 3CY6A 5DXAA 1V0JA 3TTWA 1R8QA 3KOZA 3RDPA 5B55A 1YVRA 1GVNB 4AKGA 3HM2A 5KYKA 3VNVA 1P1FA 1TJ5A 3EPRA 5HE8A 4IIVA 5BYAA 3SFTA 2Q46A 3HB4X 1WD7A 2BGLA 1LPMA 1YI1A 1ZMRA 3KM0A 1Q0SA 3N7UA 4BZZA 4HEQA 2QY9A 5IAGA 3VPSA 3ZDRA 4U3JA 3PDIB 1WS6A 2H5LA 1KDOA 1Q11A 3KFLA 2ORVA 4G4GA 3F0TA 4AJ2A 4C7JA 1PV2A 1IBRA 2QD5A 2W42A 1P9LA 4II2A 4IRXA 3D43A 3BH7A 3WAKA 1E9CA 1LSUA 2P0AA 5EWLA 2BEVA 3V8RA 2XCLA 2IDKA 2IZ1A 4C76A 3ONDA 1IK4A 5AM2A 2ASEA 1M54A 4MW6A 1V6AA 4QQNA 2PU7A 2Q1XA 3EEBA 3S1AA 5DNYB 3AKZA 7ADHA 3NWEA 3HA5A 1X1BA 4YJGB 4B17A 4BMOB 3M1IA 2JGFA 1AX9A 2BYTA 2CL6X 3UEOA 5B5SA 5DP1A 1HLGA 5DBEX 2QVYX 2GWRA 6AT1A 4GKAA 2PWAA 2GRAA 2V7BA 3E18A 4O4HB 4YACA 3H11A 2J45A 4HAOA 1EM6A 3L2OB 2O54A 4AXBA 3U7FB 2X2FA 3R5SA 2A5YB 3SC2A 1VJ0A 1OYYA 1JDBB 2ZT5A 4TTVA 2YYZA 8ATCA 3WQBA 2O8BA 4ETWA 3C3PA 2GBIA 4G5YA 4I08A 4CM4B 1HYQA 1VPVA 2CFCA 4NYMR 4M1MA 5JARA 5HXAA 2XB8A 4PYOA 5D3ZA 1SVIA 3VUFA 2YFQA 3PK0A 3EGWA 1IK6A 3RTDA 3G9XA 2VH1A 3G9QA 3OIUA 3MINB 4Y6LA 2PLAA 2WBLC 3M6MD 5FL7D 2C99A 3VAAA 4DEYA 3OEWA 1JW9B 2JATA 4NMWA 2H4ZA 1SCKA 2NWQA 2Y9PB 4W9NA 4POAA 4WK2B 1TK9A 3ENVA 2LNDA 2VAWA 5KKCA 2MIIA 2PEZA 3GA7A 3KKLA 1YJBA 3IALA 4GL4A 4PSAA 4TQAA 3UOAB 2P9YA 4I4TF 5BR4A 1UEJA 1J5PA 2OKCA 5COQA 4ZCSA 4HNHA 4U8HA 5C81A 3P9IA 4XDYA 1GILA 4GW3A 1X1TA 2R8YA 2O0JA 1K4YA 4E1AA 2TMDA 2NU7A 3QVSA 3PHHA 4J75A 4PIVA 5ICEA 4RK7A 3GFOA 6ADHA 5BMVA 5E1BA 3R6TA 1ZISA 4UHJA 1SC6A 2H52A 3DWGA 5J63A 3F67A 2Q50A 4X1IB 1NSTA 2OC4A 3AXSA 4L4YA 4YRPA 2GF9A 4HDNA 1PR1A 5KYUA 3UGJA 3W6NA 3G79A 3BWEA 3C1UA 3ZWOA 4FOTA 2WTEA 3BMCA 3ZVRA 2VS1A 3C5HA 2ZK7A 4D9KA 1LBQA 3ZIDA 1FFWA 4RLSA 3OCZA 3IAAA 3G0HA 2OAGA 1UQTA 1V1MB 5EXTA 3IUNA 4CCYA 4YUXA 4O02B 4R6WA 1WZUA 5H3CA 4EFLA 4IBOA 1SQGA 5ELMA 3D4OA 1KAHA 4MOWA 3ECSA 3TNJA 4B4VA 2JD1A 5IJWA 5K0ZA 3ONVA 4X94A 1WVMA 2Q1WA 1SXIA 4IMIB 4JA0A 2HB6A 5CIQA 1NVGA 3USCS 2J5RA 5K01A 1HK7A 1X7ZA 5FWDA 5DP2A 4MVJM 3KTOA 2FSFA 4OHXA 4MAAA 2QD3A 3A1WA 3VNBA 4RD4A 1HYEA 5BNTA 1RP7A 2R751 4HSGA 2XYQA 4XQGA 4BE9A 1BDHA 4UUBA 2P77A 1G2IA 4NVRA 4ZOAA 4PG4A 1KVUA 5FTKA 3QA9A 3CWQA 1XNQB 1IY9A 3M6FA 2C4VA 4X91A 1MUUA 4BNYA 1QYXA 1VHWA 5IAKA 1WTAA 2F1IA 2PL3A 3M0EA 4CMEA 1GZ4A 2EW8A 5EMMA 1XXLA 2ZRFA 3CLTC 2V58A 3GFBA 3HP1A 3KB6A 3M5WA 4R8RA 5CJ2A 1E7YA 5BNFA 2V0GA 4N0EA 2CMGA 5JISA 1I01A 2IY8A 4NATA 2ATVA 3Q7SA 2H0RA 1IM8A 4WBXC 5CH5A 4LMRA 2V8BA 3U80A 2AZDA 1WNTA 1I9GA 1ORIA 4MCJA 3GLFE 5AUNB 4DCPA 2FCRA 1V3TA 4ENQA 3K6SA 1W1WA 3TZCA 4MVJA 2ZBVA 3FBWA 3INRA 3OPYA 3MMXA 4N0QA 2WWVD 2QNRA 4JS0A 4OMUA 4B76A 1TTHA 4CN9A 1YRHA 3F9CA 3NHLA 1VIVA 3QELB 1JUDA 1P91A 1E4VA 3OFVA 1Y6RA 4DMLA 4PFQA 3NOQA 2O8DB 1C29B 2GD1O 4Z6KA 3RRZA 4ENVA 2NO7A 2HSZA 3T1VA 2OCKA 4EW6A 3KR2A 2ZB4A 1TVCA 3DKRA 1XTRA 3GA5A 3IHKA 3KTAA 2GO1A 3HKBA 1FVHA 3A0RB 4KQEA 5AJTA 1XD2B 3WNDA 1X1AA 1YBFA 1QQBA 4FQ7A 5ALDA 1BQEA 2ILTA 4MEJA 1ONBA 2R2AA 3RHSA 1G21B 1GZDA 1UZLA 2QQFA 3BFJA 2ADMA 1IOWA 2PJDA 5HCNA 1IZYA 3COYA 3FCYA 2BDTA 2O1XA 1PQYA 5EIAA 5AXBA 1V8OA 2W11A 5M3BA 3PXBA 4HB2A 4IQFA 5H3HA 5F7XA 4DCUA 2XMCA 4GE0A 2ZBFA 4YCBA 3JZMA 1UWLA 4IFEA 2QT9A 5AK5A 2WICA 1DXYA 4Q66C 2EGUA 3URMA 4AJEA 3V3TA 4RJJA 2DBYA 4BNZA 4DRYA 4UD6A 3AI3A 4F1KA 5EGSA 4ZYZA 4KEAA 5HKLA 1RXSA 3UWPA 4XVRA 4H7HA 4ZMRA 3HUUA 3HJAA 4QFBA 1FFAA 2OG2A 2WM8A 4CL2A 1P4AA 4JLKA 4LYYA 1YL7A 2NO5A 2HU2A 3D1VA 4EX6A 3BMNB 5BQ5A 4YCMA 2YFHA 3BULA 1RKXA 2AK3A 3IR5A 4OU5A 3GIWA 3FTEA 4BFWA 3MTAA 2FXIA 4FNOA 1FL9A 3X1JA 4PBRA 4Q82A 2BE9A 3C1TA 4OGLA 4TSKA 4N47A 2DPHA 1VYHA 3GCDA 4L85A 4ABYA 2Z5LA 4BQQA 2WD7A 2GLUA 1JYEA 2GLTA 2V54A 3L5OA 4REQB 1BW9B 5CFMA 1Z33A 1U6KA 1H94A 1ZIPA 1XDSA 2LDBA 2JFBA 4ES6A 5KNCH 2OLKA 3VTZA 4LOHA 1CIJA 4PO8A 3ROPA 4B4KA 1PTKA 1CZRA 2C2MA 2D1QA 2WYVA 2GXSA 3OCCA 4RJ2A 1U02A 1ZL2A 2Q8QA 1Z5GA 3UVEA 1U1DA 3FYUA 4R01A 4KJZA 1VDKA 3ADKA 1JSRA 2F9LA 5TGTA 3EWNA 3R76A 2VTVA 1VKRA 5DPMA 1V6CA 4MYSA 3PHCA 5CHYA 1QG4A 1DAEA 3PGMA 2BFAA 2OQRA 2WJ4A 3ANMA 3QEBZ 2ZB3A 3NHRA 4PFKA 1R4ZA 3CUUA 3U0BA 5JAMA 3TSWA 5TC4A 4DTIA 2X2EA 4Z9AA 4OX9Y 1UBHS 2RH8A 1F2UB 3C0KA 3BA1A 3KWFA 4MAFA 2YRWA 1E79A 1L4FA 2FUCA 3AUXA 3PDHA 4FIZA 4IJWA 5ESWA 5CEEA 4KHPB 3DMPA 5DBHX 4KPUA 1ZGAA 3WICA 4RKFA 3ZBUA 5IT0A 2CV1A 2IH4A 3AOEC 3UCEA 1M2HA 1ONNA 1G5QA 3ENKA 3G9ZA 4BIIA 4B6SA 1RLOA 5HFJA 3HU2A 3HU1A 1RNLA 5IFLA 3L7LA 1GPLA 4QYIA 1N34B 3SXPA 1UDBA 3OPXA 3N8HA 1K7FB 2ABWA 1DOAA 3LBFA 2QX6A 1VPTA 3E0QA 3VU9A 3VU3A 3WHLA 5K03A 1CY0A 1VLHA 2E4XA 2LW7A 3X1KA 3GUCA 1C9MA 4Y1GA 4BP9A 3SIPA 2IKSA 1GU7A 3BGOS 3OZDA 5EPUA 3EY9A 5JROA 3GLIB 3MS2A 1KI4A 1A95A 2YWEA 5KNBH 1JDVA 2B3DA 3EMBA 1E4EA 3BHNA 4X64B 4YAOA 2FPKA 1SXJC 1XMSA 1SCJA 2J9XB 3EYAA 4C6TA 1DI0A 4J94A 4XEUA 1NC1A 1NXQA 1B8VA 2WTNA 3QMMA 4NYIQ 4Y1FA 5EWJB 4J1SA 5AM0A 1YB4A 3EZ9A 2WY2D 3IUMA 3T1HB 2ANBA 1HUQA 4MR7A 3TSCA 3E8MA 4U9UA 5BQ3A 2ZT8A 3LK6A 4PC7A 2CHEA 2IH2A 1IM5A 2VRCD 1U9CA 2Z4RA 4RHXA 3EGOA 2XMQA 4NF2A 4O4JF 4ERXA 1OLUB 2HMWA 4UU1A 1KIAA 2Z3VA 3C3EA 5D3KA 3DOIA 3SD7A 4F86A 5A0TA 2I7TA 4UU8A 3QFRA 3L49A 1MQSA 2YWBA 4UQOA 4UTPA 5K0LA 4ZO7A 1H3NA 5HQ3B 1MW8X 5LU8A 1Z6TA 3DVRX 4XEHA 2F43A 1JQ5A 1OZ0A 1Z12A 2GSDA 3JQCA 4DM3A 2Z6AA 1BC5A 4NBUA 1FFDA 3OFJA 4KL8S 3ZKWA 4DA9A 4BP1A 3KETA 2LP4Y 1OWMA 2CN1A 3B5JA 5D5PA 2HCFA 3CXUA 1QR2A 5I9LA 1IXZA 1UINA 3M1LA 4V0RA 1P7PA 3RRPA 4LZLA 1X77A 2I4TA 3G7SA 3W34A 3JQFC 5CXXA 1AUOA 2P5YA 2SKDA 3FYCA 4HUTA 2KBFA 3PXAA 3OEED 4DMMA 2Q1TA 4YJ2B 1YI8A 1RRMA 1RACA 5AOAA 4LV5B 4M1KA 1VHJA 1SEVA 1M10A 1PK9A 2B6HA 2GZHA 4B35A 4ID3A 1WB5A 1PFYA 2W2XA 3PT9A 3M70A 1IOZA 2YHIA 1RZRA 2FSGA 1L4LA 1E4OA 3OD5A 4HWRA 4P7FA 3TW0A 3SKYA 4ACBA 1X39A 5JYCA 5K0EA 2ZYTX 1NWCA 3PGJA 2BT4A 2Z3WA 3PIDA 2CKMA 3R7FA 5IC5A 2V8OA 2WWHA 3BCSA 1AS2A 4L8YA 3OX2A 1TYZA 2EYQA 1RQ7A 2GUWA 3PNBA 4FZ3A 2HK7A 4LDRA 1RP1A 2CV2A 4JC4A 2INGX 5E4FA 5J2UA 1ENZA 4KYTA 4FR2A 2EJBA 1EX6A 4U2KA 1FX0B 1XI2A 4EFCA 3LVBA 2W6OA 1KDRA 3OZCA 2VXBA 1U8CB 3ZZTA 1VL1A 3IUPA 4MW4A 3KQTA 3HS3A 1RI4A 1WCXA 1XK6A 3C4VA 4UBIA 2LR0A 3GGPA 3WNBA 4PZUA 2J0QA 1T0HB 2WWFA 1ZVKA 4NJMB 2AG6A 2QR5A 3QJ5A 4DJEC 1N3BA 1T13A 3RAFC 1JFSA 4NSLA 1Z8HA 1KQ7A 3Q88A 1ZGJA 3CW8X 3WRWA 4ESHA 8AT1A 2Q45A 1EFHA 2ONKA 4XGRA 5E8JA 4K88A 3DM9B 5TQ0A 1I4WA 4YP1A 4BRUA 1H3EA 4GSLA 2HSDA 3ETGA 4P0PB 1B41A 3ESAA 3Q7IA 2XKJE 4ZXFA 4BMPB 3N2GA 1Y9EA 5LUBA 4TVKA 3GAFA 1E8NA 3AERB 1XDBA 4BAGA 1M2NA 5I7UA 5C4IA 4MVCA 5DM60 1BX1A 3ETDA 2BWJA 4MMYB 1JTFA 4YRAA 5K6AC 4M9ZA 4RAOA 4NP6A 5H3LA 1AZLA 4I36A 4GXQA 2RI0A 1CETA 3FCAA 1BD3A 2EP5A 2OD9A 3E2MA 2XOKD 5E7IA 2WVGA 5LKAA 2OAEA 4F45A 4B47A 2QA5A 2COEA 4MAMA 4F0JA 2B5VA 2FFBA 1ANKA 1PK8A 1XROA 4JEUA 4XFKA 3FN4A 4LF9B 2OBYA 2NACA 3R5KA 2O2EA 4I50B 3FFBA 3QE2A 4MEAA 4II7A 1MB3A 3ZDFA 1FLNA 1Y89A 4UOEA 5M2QA 2QLLA 1W9HA 1W75A 4I5EA 2UXDB 2HJWA 4XTRA 1CUDA 3HCRA 1EM8A 1R0CA 3R9IA 3AIOA 3GP5A 4HDOB 5EE5B 1DBWA 5BSUA 1L5NA 4OKSA 5I9NA 3HFSA 4FHEA 4B87A 3R77A 4R3UC 5B6JA 3LIPA 1QIDA 4HB4A 2BFOA 3C5WP 3FOZA 1F17A 1HG1A 2EW2A 4GICA 4B31A 2PGXA 4RAQA 1M66A 3WIOA 3LHFA 2GN1A 2PLNA 5D86A 3EQ8A 1Z26A 2BHTA 3OTWA 3TVYA 1A69A 3KOXA 2P1ZA 4TYPA 1E3QA 1YK1A 5AHKA 2HHJA