3U19A

Crystal structure of acylenzyme intermediate of de novo designed cysteine esterase ech13, northeast structural genomics consortium target or51
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
195
structure length
194
Chain Sequence
GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKAEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF ACYLENZYME INTERMEDIATE OF DE NOVO DESIGNED CYSTEINE ESTERASE ECH13, Northeast Structural Genomics Consortium Target OR51
rcsb
source organism Synthetic construct
molecule tags Hydrolase
molecule keywords artificial protein OR51
total genus 62
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3u19A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u19A01
4XE5A 4FE3A 2FUCA 5AI9A 2GO7A 2RB5A 3WKDA 5A3SA 4FYPA 1Q91A 1EK1A 2HI0A 2MU1A 3DNPA 3WK7A 1L7MA 1LVHA 1VJRA 4Y2RA 2Q4RA 1Z4IA 3WK9A 3EF0A 4IFTA 1O03A 3EPRA 5ALSA 3L5KA 3ZI4A 4YIKA 5AVVA 3ZWDA 4NAVA 1U2TA 3N5KA 1T5SA 1L7PA 2YJ4A 4EZEA 2PKEA 3D6JA 3U7EB 5ALGA 4J03A 4QJBA 3FVVA 5AK4A 3ZTWA 3OCUA 4BEVA 5ALZA 5AKEA 3DAOA 2JAOA 1QQ5A 4J2TA 4BEWA 2QLTA 5AM2A 2EARA 1WPGA 3N8GA 2C88A 2G09A 4UM7A 2R8XA 3OCZA 2ZG6A 3OCWA 1YDFA 4NABA 4CF5A 3ET4A 5AW4A 2YMQA 3L0BA 4IG4A 4AP9A 5ALWA 5AW1A 2EATA 1Z4NA 3QXGA 2WM8A 1WR8A 2P69A 2PR7A 1RLOA 2HF2A 3ZU6A 5AM1A 3AR6A 3IB6A 3W5CA 5IT4A 2NO4A 5ALJA 2HO4A 5AIAA 3ZX5A 3I76A 2YY6A 5AI8A 4EX7A 4HAIA 5AVWA 2O2XA 2C8KA 5AI0A 1J97A 3ZW7A 1ZRNA 4F71A 3WGUA 5AICA 4H1WA 1FEZA 3HYCA 3FZQA 2G1AA 2JAUA 3KBBA 2B0CA 3B9BA 3NALA 2IOFA 1U02A 3SKXA 1J8DA 2Q4TA 4UMDA 1Z4QA 3N1UA 5T41A 4BX2A 4YCMA 1Z5GA 3NAMA 5AK6A 5AKGA 3U13A 5E0OA 1QQ7A 4YGYA 3FM9A 2PQ0A 3QUBA 2I7DA 5AHXA 2Q5EA 1XPJA 5AW8A 4UW9A 1XVIA 5AW6A 5IS2A 5AI6A 3AR9A 1X42A 4YH1A 3S6JA 3WK5A 4DWOA 2O9JA 4CF3A 5A3QA 2CN1A 2GHTA 5ALPA 3NUQA 1NNLA 4C4RA 2ZBGA 4Y3UA 1RMTA 4AS3A 3E58A 2JAWA 4RESA 2BDUA 3QUCA 2ZXEA 4MUMA 4G9BA 5ALTA 4OFZA 5AW5A 4Y2TA 3ZTYA 3WK6A 4BBJA 1Z88A 2WHEA 5AM0A 3U7GA 3BA6A 4Y2PA 4HGNA 3PDWA 4O8CA 5AVUA 3QGMA 4HYTA 1NF2A 3A1EA 3SMVA 5AW9A 1QQ6A 4UU1A 5AKJA 2HDOA 2B82A 2FPRA 3L0CA 2C4NA 5JJBA 2IOFK 3NRJA 3QU2A 1RRCA 4YCLA 3NIWA 3OTQA 2R8YA 3R4CA 2I6XA 2NO5A 4XOUA 4UMEA 4MWOA 2WF8A 1N9KA 2R8EA 3ET5A 4Y2SA 1L7OA 3TLMA 3SLRA 2HOQA 3A3YA 4OD0A 2GMWA 2BDEA 1RMYA 3AR2A 3F9RA 4ZEWA 2FEAA 5ALYA 1T9ZA 2YJ3A 1WZCA 3PCTA 5AKHA 3W5BA 1RC8A 5AVQA 3SHQA 1RMQA 5AIBA 3RFUA 2OM6A 3CNHA 1TJ3A 5ALNA 5AESA 2B8EA 1YV9A 1RKQA 4UASA 5AKLA 4DFDA 3OCVA 3OCYA 2VKQA 3N07A 1ZOLA 2EAUA 2WFAA 2FPSA 3ZVLA 1TJ4A 2GFHA 1RLTA 2W11A 4GXTA 3FPSA 4ZEVA 5IT0A 2MSNA 4Y2QA 4KX5A 4KN8A 1YMQA 5AI5A 3MMZA 1TE2A 4OHFA 3QU9A 4BKMA 1U7OA 4RETA 2HCFA 2JARA 5AKYA 5FP0A 3WKBA 5ALLA 2WF7A 3FGOA 2JGAA 3QUQA 3QYPA 4C4TA 2CFSA 3AR4A 2FPXA 2R8ZA 4NWIA 1VFPA 1RDFA 1L8LA 3DV9A 3AR7A 2WF5A 3IJ5A 3E81A 4Y2VA 2D2VA 3ZX4A 4L6AA 3ED5A 2BY4A 4UMFA 2P11A 2X4DA 1Q92A 3PGLA 4EX6A 2ZBFA 3ONNA 5ALRA 3ESRA 3J7TA 2ZOSA 1Z4PX 5ALQA 3DDHA 1XP5A 2G06A 3A1CA 3I28A 3K1ZA 4OCZA 5AW0A 4UU0A 5AVRA 2ODAA 3IRUA 3WGVA 4EEKA 5ALEA 3UMGA 5AM5A 3ESQA 4UMVA 3HLTA 1QH9A 3L7YA 4EELA 3U7FB 1QYIA 1O08A 3L8GA 1Z4OA 2YMMA 1U2SA 1ZD4A 3B8EA 4B6JA 3WKEA 5AKXA 5AW2A 2YJ6A 3QX7A 3RF6A 1CR6A 3VAYA 5ALHA 3AR8A 2G80A 2IA5A 2AMYA 5ALFA 2AH5A 1KYTA 1T5TA 3I1YA 1RLMA 3SD7A 3AR5A 3ZWKA 2B1RA 3N28A 3E8MA 3KD3A 1VJ5A 2AUTA 2NYVA 1YNSA 2CFRA 5AI4A 2YFYA 3ZUPA 4UAVA 3P96A 4CF4A 5A3RA 1LTQA 1SWWA 3OPXA 2WF6A 3SF0A 4Y2JA 3W5DA 4F72A 4ZEXA 2AGVA 3I6BA 1U7PA 1ZS9A 2G07A 4Y2XA 4JDPA 5ALUA 1IWOA 3QU4A 4CE6A 1ZD3A 1L7NA 3UMCA 1Z4LA 2W4MA 5ALOA 5AVSA 2WF9A 3KOOA 3NASA 4AS2A 4UM5A 3ZVMA 1Z4KA 4YIHA 5AK5A 3EWIA 2YJ5A 3KZXA 3MPOA 4HGPA 1K1EA 5ALVA 4L6CA 1Z4JA 2RARA 3L1VA 2RAVA 3M1YA 4CNQA 4DCCA 1RQNA 1WVIA 1S2OA 3GYGA 3QU7A 4GIBA 3BWVA 1F5SA 2C9MA 2G0AA 3A1DA 4UARA 3R9KA 3UMBA 4BNDA 3WKCA 1JUDA 4YCNA 2IOHA 5AW3A 3PGVA 3QNMA 3WK8A 5AW7A 1AQ6A 4QQFA 5AM4A 2RBKA 2ZBDA 2I34A 5AKIA 5ALMA 1ZRMA 1PW5A 2GHQA 3KC2A 1ZD5A 3L8FA 2FPWA 5AM3A 1RQLA 5AKZA 3U26A 2IYEA 4E88A 4UATA 3MC1A 4BX0A 1RPZA 2W43A 3L1UA 4HGQA 4FFDA 4BX3A 5AVYA 2HSZA 5ALDA 1MH9A 4L57A 1TA0A 3OCXA 2I55A 4I9GA 1NRWA 2OYCA 4JB3A 3U7HB 2B1QA 2I54A 2FUEA 2HF7A 4KNVA 3WKAA 3WK4A 3QUTA 4EENA 5AVXA 1SU4A 2I33A 3FPBA 4HGRA 2YMPA 5AK3A 2C8LA 1S8OA 3ZVNA 1RKVA 2HX1A 4NFLA 2QYHA 5AVTA 2G08A 2OBBA 2YBDA 5ALIA 5ALXA 4BYGA 3U19A 4DW8A 5ALKA 3M9LA 4Y2YA 2P9JA 3W5AA 4UAUA 3B9RA 1ZJJA 1CQZA 4NV0A 2B8JA 4I9FA 1L6RA 1Z4MA 1SWVA 1EK2A 4KNWA 1ZD2P 2FDRA 1YS9A 2YMLA 3L8HA 1Y8AA 4PNHA 3CZ4A 1RKUA 1TJ5A 1YJ5A 2HHLA 4KX3A 3E84A 2P27A 4XQ0A 1Z5UA 3KDPA 3SKYA 2B30A 3QU5A 3UM9A 2FPUA 4BNDB 4XPZA 1L8OA 4C4SA 3NANA 3L0YA 2YN4A 1N8NA 2ZBEA 4Y2UA 3R09A 4G63A 2DQSA 2FI1A 2OA0A 3QLEA 2CFTA 3EF1A 5AKKA 5AVZA 3MN1A 2HEGA 3L8EA 3AR3A 4KYTA 4HGOA
chains in the Genus database with same CATH superfamily
3DLTA 4B2IA 3QQ5A 4HQNA 2FUCA 2H4XA 1U2GA 4H0NA 5BSWA 3O95A 4ZI2A 3WYDA 2RJNA 3OOYA 5HHTA 3G8DA 4LKOA 1Y3CE 4M1SA 1A96A 4EYQA 3S27A 2DFLA 3ED1A 5K3DA 3M6LA 4KZPA 4DJDC 3DM9B 1VTKA 1C29B 4Y2RA 3STWA 1W4ZA 1J8VA 5GVRA 2VSQA 2C84A 5J43A 1SO8A 4IFTA 5FTWA 1R88A 4MVXA 5CJ2A 2X41A 1Y8RB 2VUUA 5ALSA 3ZI4A 2WA1A 4Z0TA 3AY6A 1KYIA 3GNSA 2PQMA 2Z95A 1JBEA 3MTJA 4FSHA 3FSEA 1Q95A 2JS7A 4QBKA 5LD2B 1K7SN 3S1SA 1TD9A 3C7KA 1ONSA 4YRQA 1GPLA 4E2YA 3AHHA 4PLTA 3WSTA 3OCUA 2TECE 2H1LA 4BO3A 1IN6A 2CWWA 4KEAA 5DLPA 3O93A 2OBYA 4X7MA 1S3FA 4NU5A 4B7CA 3B9QA 3GDHA 1QGZA 2PL9A 1WHSB 4E5DA 1FX1A 1A5BB 3ZDBA 3JD2A 4C0WA 4MPPA 1N7GA 4DA6A 1Q0TA 3LQKA 4CF5A 4YJDA 1L5RA 4BQIA 4AF7A 1BHJA 2GEFA 3G59A 4GMKA 1LQTA 1CDDA 4D8WA 4E51A 1UPXA 3K9HA 1XRNA 4RVGA 2VAVA 4BQSA 3LKVA 3QH4A 1WHTB 3JR7A 4LXXA 5LR6A 2Q0XA 2VYVD 3KPWA 1SCKA 4LZOA 2GBGA 4IV0A 5IAKA 4LGYA 1NPDA 1RHRA 3A05A 4CFZA 3HU5A 3B3FA 2NV0A 3D43A 1PP4A 4I1SA 5B6PA 3UGKA 4BNVA 4OA5A 2W8BA 5CT9A 2GAIA 2OTCA 1GPAA 3R41A 4H3SA 4HAIA 5BURA 1BX3A 4Q1CA 4BFSA 4GPZA 4WY2A 4ZCMA 4XCQA 5AI0A 3F90A 1YL7A 2P35A 3O4HA 3NP7A 3QFCA 4H0FA 4RELA 5KVVA 5L3VA 1KWGA 2VQFB 1LTKA 1T3LA 1DC6A 4C0KA 4DF3A 2CVZA 3N76A 5JNSA 5D6NA 4EABA 1A72A 2ZEJA 4CV3A 4WN3A 3GB9A 4ZAYA 2XBLA 5CP8A 2QU7A 3P9XA 3Q2KA 4MVWA 1NG9A 5K3AA 2PX2A 1EFPB 2R84A 3F71A 3DMTC 5E3JA 2F48A 4OL0A 4IIGA 2WJPA 2VQEB 5DH9A 4W5TA 4EATA 3TTYA 3NALA 1WEKA 4BRZA 2X0FA 1P3Y1 2J32A 3GU3A 1OBVA 2Q3MA 3AF0A 4NFSA 5SY4A 4DDWA 5CW2A 4UCFA 4BX9A 1FPQA 1YIDA 1M2OB 1ZH4A 2Y1LA 3DW3X 3WL6A 5EJ7A 3GRYA 4HN9A 3IVAA 1KDRA 3JTEA 5HTKA 3KS9A 4U00A 3KP1A 2R4QA 4LY6A 5E4TA 3WHKA 1NA5A 4K0KB 4DEVA 4AO6A 4W5HA 5B1YA 2QA5A 3CBGA 1N6NA 1OI3A 1EBFA 4DCVA 4AN4A 3B3QA 5AJWA 1WO8A 3RRPA 4CM8A 4NMLA 4RHTA 1XZ8A 4BLTA 1HQYE 1YT5A 3OQNA 4MUIA 1L9XA 2W2OA 4L78A 1VDZA 4OB7A 1J9ZA 3NWOA 5JYDA 4R2HA 4WOPA 5IFLA 1EP1B 1DC4A 1NX6A 8MHTA 4J7AA 1ABBA 3MRSA 2FG5A 4NF2A 2WSYB 3MWGA 3TR0A 4D9IA 4ENRA 4XR9A 1COZA 4K1XA 1W6UA 1WOMA 2O2SA 3RFVA 2ZUFA 5AYVA 1IHPA 1TU4A 3WHIA 3EXG2 2WV7A 3AW9A 1X42A 2O5RA 3VZRA 5I7AA 2W2MA 1ES9A 3ABIA 3AUKA 5TPWB 4CV2A 3K0SA 1W94A 2CN1A 2GA9A 3D59A 4B47A 2IIVA 2X0NA 4PVDA 5I9SA 3UAXA 4CCWA 3U7IA 3ZD6A 5NLLA 1DVRA 2H8KA 5ERGB 4YJ2A 5DYNA 1DPFA 2PH5A 3O1HB 5F2OA 2VF5X 3UJ3X 3U60B 1P5RA 3W5UA 2PJUA 1DELA 3F6BX 4B46A 5AMXA 5ICCA 2YXPX 3ZWVA 2G82A 3IAM1 1EP2B 2AR7A 3TEJA 3N7TA 1XZCA 1WUTA 3RUPA 1I0LA 3QBJA 3SSOA 2H5LA 3OOSA 1Z68A 3BD9A 5E9QA 4DUPA 3K2IA 4J0EA 3E15A 4EAAA 1F8UA 5AVUA 4RWZA 4R2WA 4H7PA 1W49A 3UICA 2OFOA 1DFHA 4BGEA 5DCLA 3EEOA 1G5PA 3HSKA 3JVDA 4AJLA 5A9SB 2ZIUB 4BNUA 5ADVA 2CC2A 4HLQB 3NBMA 4RFSB 4WUTA 3QLUC 1GTG1 3JTMA 3O0TA 2OK7A 3O75A 1OXTA 3E18A 3ONDA 4ZYTA 4CGZA 4UNPA 1A7JA 1JE1A 4CYMA 1NKTA 2XDYA 3GQBB 3Q2OA 4FDMA 3N86A 1AF4A 5K45A 1NLFA 3K94A 2NO5A 3PNBA 4ECEA 1GDHA 1V9SA 3RVSA 2IH2A 3QRWA 1TM2A 1R4NB 3LY9A 4Q3AA 1NW5A 3AVPA 1SUBA 3SLRA 2Y71A 2FSVC 1XALA 2X2EA 3O90A 2FJPA 1NN0A 1V6AA 2GKSA 2H9IA 2Q6IA 3AR2A 4OI1A 4YXFA 1Q5NA 1JLLB 2IX3A 4WZAA 1ZM2A 5ALYA 3RLFA 4Q3EA 4CCSA 1OA0A 3UTCA 5TS2A 1LJLA 4GLBA 3B2EA 1Z74A 2FEOA 5GV8A 1ZXBA 1FVOA 2O1EA 3T9AA 5AVQA 3DAHA 1P4GA 2JC3A 4OGGA 3SHQA 4ZHSA 1NV8A 3KSMA 1H4TA 4G0QA 4DA7A 4F1KA 4QTTB 4F2WA 1WSBA 1FDVA 2ZT7A 4D9JA 1NHWA 2XYHA 3EXIA 3L40A 3RRYA 1J0XO 4LI3X 4YXWA 2FETA 1I7SB 3I62A 2AHRA 1X8JA 3OCYA 4J91A 4K6KA 5FUBA 3PA8A 1AHNA 5I7OA 3VHRA 3WL8A 4BFLA 3AUAA 3ANLA 2Q3DA 2W5UA 2WKRA 3AJEA 3R3XA 4FI3F 3QTLA 2GFHA 1IUPA 1M3SA 2A1UA 2ZDGA 1S7GA 2AJ8A 3KR2A 3QFTA 4B6GA 1YMVA 5MDHA 2DR2A 3AVXA 1AD2A 3MWDA 1XHLA 1FXWF 3LT1A 4IIXA 4CG2A 4CEJA 2XYRA 5YASA 5IT0A 2COKA 1NU8A 2EWMA 2VWHA 4HZIA 2EFJA 2Q28A 5DULA 4QDOA 1GYRA 2EJUA 3H7AA 4TVBA 3STXA 5DOZA 4BUJA 1M72A 1PW7A 2XEXA 3EWAA 2XOKA 4RETA 4EJ6A 3UQYS 2DBRA 5IM4A 1AU9A 1YJQA 3KT0A 4FGSA 1SVWA 1YQ9A 1GFZA 4GYJA 1UDWA 2WF7A 4U7PB 3KFLA 4LWOA 1SC4A 1PJSA 3K4HA 5LA6F 1TAQA 2G4CA 5DX0A 2HBZA 5FOTA 4N3GA 1HK7A 3HRKA 3VNAA 5A05A 1IOZA 2JIQA 4DGSA 4N0EA 2PS0A 3UW1A 4M1WA 4P9NA 3DV9A 1E3DA 3A0UA 3R0ZA 4YDSA 2OP0A 5FI5A 5GOZA 4FILA 3II6X 1HOXA 3UC9A 1H2WA 4L8GA 3SYKA 4JC5A 3E7DA 2P2ZA 4YUYA 5CVUA 1DEHA 1BYIA 3CZRA 2HCJB 3ED5A 3C6QA 3EGXB 2BY4A 4RKFA 4X1KB 4KQ2A 4G84A 1UJ2A 4EX6A 1K8QA 4D4LA 4HG2A 2BGWA 5G0UA 1KH1A 3KAJA 4XVQA 5FPPA 1Y8ZA 1MAWA 4XX1A 4AW9A 4ZT3A 1ZYUA 2OBLA 3H1TA 4JODA 1KYZA 4DAOA 4LMAA 4V0QA 1I33A 1L1EA 4JSRA 1ZM4A 4FHEA 4WINA 3ZE0B 5HWSA 1R6AA 4GM1A 2QRPA 3GNQA 2HNAA 3ZDCA 2EYUA 5AM5A 1OGJA 3B3GA 3IQEA 4TWZA 4TQGA 3TR6A 1Q77A 4UMVA 4C4YA 3HFJA 1QWSA 5JUWA 1OLSB 3BFKA 3RUIA 2NXNA 3UK7A 4AN1A 4RHCA 4ZEMA 4TWJA 3AKCA 2O2IA 5BWNA 3KAKA 1KBOA 3B7PA 4RK0A 1S1MA 2GUGA 2Q6TA 4Y6QA 6GPBA 1R6DA 1M0TA 2X1VA 3HBLA 2XCRB 5HPYB 1W19A 3QUSA 1HFJA 1LBIA 3UHPA 3G6WA 5AO9A 4B3TB 1KA9H 1P8JA 4I1VA 4WMLA 4O4JA 5GPBA 3WKEA 3TQSA 2C54A 4DCPA 3EUFA 3PHGA 2GTHA 3L6EA 3WB1A 2VYND 5JC1A 3ETNA 1C1XA 2IHVA 4XGNA 1UBEA 4MW6A 1RZRD 5IYZA 2BEUA 1Y1RA 1YU9A 2JIDA 3LOPA 3PWKA 1NGSA 1NNUA 2OB1A 2OQ2A 3BBPA 4HPWA 2M32A 4DV1B 4KUEA 1LY1A 1BJKA 3KXPA 4M7OA 1IVSA 4DNOA 4PYLA 4H1UA 1PZMA 2BEJA 3SG0A 3ZDDA 3N28A 1E1RD 2WK1A 5CH8A 3EA4A 2AUTA 1KFKB 2PAAA 3ZE8A 3U4MA 4OL9A 2RH8A 4G1MB 4ZRMA 3OIWA 3H5AA 1PFYA 1G7SA 5F64A 2N47A 5K0CA 1DUIA 5MFPA 3DLCA 4BCCA 1F6DA 1MEOA 1MV8A 1AGXA 2Y1XA 4ARCA 4QEZA 4PY2A 1HLFA 2ZRGA 4M9QA 4ZI7B 1E59A 3PSAA 5BV1A 2JI4A 3TSZA 3ZWPA 3KPUA 3WWYA 3FOFC 3HA7A 4OJQA 4FE7A 1NXXA 2H5JA 1MIOA 3WTCA 1C0LA 1Y9EA 2AC2A 4KSCA 1HGXA 4BDSA 3H3FA 1JAIA 2W6JD 2YV5A 1QV6A 1R0LA 4U7TB 5DBGA 5B2ZA 3N0TA 4C06A 2PKYX 2C7RA 3EGDB 1T1EA 4FYWA 1JXAA 3DW1X 3DF7A 3K6KA 2PUDA 1GLVA 4NC9A 1EVKA 3EWIA 3M34A 3MMXA 1G6HA 5K0EA 1JDZA 3CW2A 2QX7A 1P6QA 1USKA 2B6HA 4CNQA 3K1YA 4YO8A 3R6VA 3SZUA 4DCCA 1KMMA 2ALJA 1EFAA 3M6FA 4BUCA 1K8XB 3VKWA 1DAHA 2NQ8A 3PCXA 1EJ6A 1S2OA 5KWSA 1A8SA 5ETJA 3FGNA 3D2LA 2D54A 2X8WA 5TMEA 3CT6A 3PR2B 4FPXA 4DMFA 5J4YA 1AIPA 4CLXA 4QBFA 3U4CA 1W36C 1QRRA 4MK4A 4BV8A 4KGVA 5I5GA 4AQ7A 1BMFA 5T5QA 2QDXA 4PBSA 3O4RA 4YJ2F 4MMYB 4S1WA 1YS1X 2VYQA 3KR9A 1CZNA 4HWGA 1AGPA 2JGDA 3B1JA 5BOVA 4RHYA 2OC9A 3FWKA 4MVJP 2LDBA 4KB5A 5AUNB 3GLIA 2MYPA 2GXSA 4IZHA 3V33A 2P4EA 5FOVA 2L18A 2XQKA 4QSHA 1UPBA 4ZJYA 3BAFA 4N3BA 1R15A 2FUNB 3NVMB 4R2IA 4B84A 3DOCA 4PSDA 1H5UA 2FPWA 2CF6A 3PQ7A 3OX3A 2W2KB 1YI0A 2GBLA 3IOBA 4F9EA 5KHLB 1KHHA 3UMYA 1BDHA 2OMKA 3MQ2A 2G1KA 3BTVA 4FGWA 2IT1A 4P1ZA 1J5PA 4UBOA 4X1IB 5H59A 5SV2A 4Y9TA 1QIKA 2HSZA 5KJEA 3AL3A 2Q2WA 2FSFA 4A0FA 3FJ1A 5IDWA 5IUNC 3N7AA 4LOJA 2I55A 4EO7A 3V1YA 1M66A 1OKKD 1HZJA 1OBCA 1SM4A 2ON6A 4FS3A 4GI2A 2HPAA 3R7LA 4BUZA 4ZHQA 3H8WA 2DETA 5F3DA 1F51E 1CEXA 1XD2B 2P6MA 3U5TA 3IPAA 2W6CX 3OUTA 5BN4A 2YZNA 3PNQA 3FPBA 1P0PA 2CCKA 4FT2A 3QKTA 4QDUA 1S8OA 4ZQGA 5JNVA 1F3LA 5CRIA 4NCXA 1PGOA 3IPLA 1JIUA 1EDEA 2B1GA 2J59A 1IJEA 3EUEA 3RSZA 3R7DA 1K6XA 2VJPA 2A2ZA 4BTVA 2HC9A 5CD9A 2C61A 2Z2YA 2BBWA 4IOMA 4QLAA 3B9RA 3PI7A 2I2AA 2FN3A 2RHGB 2EERA 3F6YA 1JDPA 3ZBQA 1K3FA 4IZIA 5DYYA 1PI3A 2RH9B 2AKAB 3DYIA 4IO0A 1JU9A 3NHFA 3IOCA 1R74A 5AHRA 1ZIOA 1ZGCA 1G8MA 2O0JA 2FXIA 2TMDA 1GZDA 3T61A 3UJ7A 3VVLA 3O8BA 2QMUA 3QEJA 2YMLA 2PT9A 1PR4A 4MHTA 2JGLA 1GQYA 2V7TA 2ZBRA 1Q1AA 4NJEB 4HRVA 4OOFA 1T29A 2ZWPA 5J4VA 1HDGO 5D87A 2XLCA 5AJVB 3CKYA 3ADKA 1TOAA 3CTPA 2CMFA 4QE3A 3S0JA 2DE0X 4CUKA 5KYTA 1WXXA 2FJUA 2Q8PA 4LYGA 4XPZA 1X1TA 4S05A 1C1DB 4MHSA 5LDGA 3OZSA 2XJ9A 3CI0K 4CV0A 4FR2A 2EKPA 1RAAA 1SQFA 5B3JC 2H9YA 3B9PA 5K4GA 4HVCA 1YS2X 1LZKA 3QXJA 2WT8A 3C70A 1NQ5A 1E7YA 5AOAA 1FNDA 3ELWA 4A8HA 2DQSA 4A2CA 1T1IA 3M2PA 4I0WB 3GJ7A 4GMDA 4BMXA 5BNFA 4CLRA 1A3CA 2R6HA 3CH5A 4JIGA 5E8RA 1V8OA 5L6MB 4MMXB 2FPLA 3CZMA 3M4NA 4BB6A 4F46A 5E0KB 1THTA 2JI7A 3HNPA 1VHQA 5FUYA 1KI9A 5EWLB 1CNMA 3TWOA 4IGAA 4EW1A 3AESA 2EHDA 1CDEA 3G89A 5KNBD 1PS9A 3OP4A 1ZEMA 5AI9A 4MDHA 5TY0A 3I2FA 2ZJ8A 4B3CA 4BWGA 3B36A 1SXJC 4NLLA 2HRQA 1T8SA 4PANA 2WSSD 3VH2A 2VJMB 1NVVQ 4R41A 2EWVA 1NBIA 3R9IA 4ZMBA 2FWRA 4A15A 1MZPA 3I9NA 1XMJA 2CUKA 2RIPA 4BJ5A 4JLNA 4HDOB 2HSEA 1RKBA 1KI7A 3L5KA 3V4OA 2H1OA 2G25A 4NBLA 3DWGA 2DM6A 1IXRC 1V37A 4QRIA 4GUAA 4XYBA 2FTKE 9ATCA 4YK7A 5KYYB 4MW1A 3SXJA 4YRZA 1QRUA 3DUFA 1KJJA 3H5IA 4NE7A 5K3FA 1EGHA 1Q50A 1YB5A 4UZFA 2MHCA 4W6QA 5BSMA 3BHGA 2QTCA 3I6QA 3PFWO 3DVRX 2AW3A 5FLEX 5CEFA 2AEFA 3IL2A 3FVVA 1MU0A 1WDWB 1IZZA 2P79A 3ABZA 3N0WA 1NRIA 3R5KA 5D01A 2GJSA 1RTKA 4TTVA 4OQEA 4XLTA 2BI7A 2XNCA 2HWXA 3HU2A 3DCIA 3QBPA 3PL1A 4JVOA 5TJHA 4WHMA 1G291 2WTAA 5IAGA 5JZVA 4C6HA 2RGCA 1O6FA 1NY5A 1YMUA 1ENPA 5EIEA 2DGDA 4C5CA 1GZ6A 2AOXA 1VP3A 3GJ5A 2BM9A 3RABA 5AXDA 4A2PA 4LXUA 1WXFA 4Q34A 4RK4A 3QXGA 2KMLA 4XD7A 3I04M 3G6KA 4JKOA 3HYTA 2ZRJA 3IDZA 3SOPA 1K3TA 4KPUA 5DBEX 3TBHA 2CYAA 2DWOA 2RHOA 1P2VA 1MFZA 1RXYA 3IAFA 3IMEA 3LLVA 3OBBA 2ISCA 2O3TA 1GSOA 4Q66C 2Q2VA 3O26A 4PSVA 4E94A 5B7QA 1LRKA 5KTKA 4YMVA 2V6JA 4N03A 5JXIA 4WESB 3SBEA 4XVRA 1PL8A 3Q4GA 3NLLA 1E5VA 3I6MA 4DA9A 3EFOA 3O03A 2RGDA 2UVDA 1N9GA 4II2A 4X3CA 4EX7A 3OIYA 4JBGA 1KU6A 5KYXB 1L4FA 2O3RA 3AH8A 4I9NA 3UFXB 4MX8A 2IH5A 3RGWS 3ZWAA 2FRDC 4QGGA 2II6A 1A5ZA 2JHPA 1RPAA 4DR2B 5G3YA 4JJZA 4GLOA 5I47A 1IY0A 1LW6E 5G1OA 1CUWA 4YWHA 2YS6A 1GUYA 4QPPA 3LSYA 1I3KA 3X3HA 1E2DA 5DT2A 4YRIA 4LXTA 1TO2E 4AX4A 2O19A 5C8DA 1EJ0A 2X42A 2P0EA 3RYHA 3HYCA 4UVEA 1Z63A 1CVLA 4HB2A 3B51X 3TTTA 1VDMA 3S3TA 3B48A 3AVQA 3HHPA 2JH8A 2YQ4A 2YWHA 4LY0A 1TAHA 5T3UA 1SVMA 1M2HA 4U5XA 3PEYA 1FP2A 3CGWA 3I4FA 3KYJB 4L72A 4ICIA 1EFLA 4JXKA 4HFRA 4TOIA 1KI6A 3BXPA 3GMTA 4LTNA 5H0IA 2BJVA 1T3ZA 5C1BA 2ZVDA 2GZAA 4IUCS 4L9WA 2C9DA 1KH3A 4P4NA 2LW7A 4BE9A 4BVLA 3N2EA 2XUIA 3W5VA 1E1NA 1Z2NX 4ZTBA 5PNTA 3DH0A 3JQGA 1W6RA 2OXTA 2UVPB 2WHPB 3DFFA 4AIRA 4OB6A 3F7MA 2VTBB 3HCBA 2QXTA 3FM9A 3QVSA 1TLTA 2OV8A 4LNUB 3DUFB 1UAYA 4WBXC 2XB6A 3UMSA 1SG9A 2JFBA 3WLFA 3F8SA 3ND6A 3DHVA 1A27A 1E7SA 4JV5B 4RPHA 1KZ7B 2CKDA 5J47A 1U63A 1POWA 1WAMA 4XYEA 3S6JA 2VDPB 4Q37A 3TL6A 2WWFA 5ILOA 1CUZA 2ONYA 2PZMA 4PCUA 3MJ4A 4QTUB 4RK7A 5DW0A 1C3CA 5KHAA 4LXHA 5CH3A 1ZVMA 2J3EA 3A06A 5IJWA 1ULUA 1CUIA 1F0NA 2CXPA 2UYOA 4RFSA 3RKSA 1XEXA 2ZRFA 4DE5A 5LSAA 1N4AA 3KKZA 1MQ8B 3H6KA 3KZNA 3FYHA 4X3PA 1NI4A 3ELYA 1X2EA 4MI6A 1HA3A 2NPOA 3TFQA 4RD2A 3RYFB 3ROTA 4K9QA 4HVLA 3WLIA 2NZXA 2BHSA 4LHSA 1FXSA 4PLPA 1G8PA 1RJGA 4RORA 4Y2TA 5AK0A 5H83A 1F20A 1NJ1A 5E38A 1OZFA 3BA6A 1X92A 4JSYA 2O8BB 3MPUA 3VR4D 4PQRA 5CPFA 2H7XA 4G37A 4FYXA 4XWTA 2Y92A 3PEFA 3KU1A 3IUNA 1HDCA 1TT5B 3NTVA 4DR1B 5LMZA 3RAFC 1L1RA 3B89A 1UPFA 4U7WA 2R47A 3DFIA 2BCGY 1KFCB 5I01A 1D6MA 3UTDA 1KS2A 5AUPB 2RE8A 4DRXA 5IJXA 4EHLA 1JT9A 1UJBA 1WSAA 3E70C 1GZUA 4X7PA 4N9WA 3TRFA 1FYDA 4W63A 3ZHOA 4EF4A 2CLMB 4RKWA 4ZCQA 4WKPA 2Z3WA 3GEDA 4FOOA 4UTXA 4N49A 4Y9RA 4IVQA 4R1QA 5HJ7A 3FDFA 5DGIA 4RZUA 2BGNA 4GSYA 3BFJA 1WXGA 3ZXXA 4BBPA 1HQKA 5CA0F 4RMJA 1A4XA 1SHTX 3NIWA 4YCLA 5LN1A 1ANKA 4UU8A 4U9UA 1O97C 2C1EA 1MC5A 1GKKA 3EQZA 4RGYA 4ALKA 2NOAA 2YNMC 1M6YA 3KL2A 4DLYA 1Y8RA 1SUDA 8AT1A 4JI7B 3J7AC 4KQCA 5FF9A 1V1JA 1JSZA 3L7IA 4QUAA 3A70A 3RI3A 1PT8A 2QMZA 2VTEA 4D4HA 1GRRA 1EUCB 1V96A 3JWPA 1WXEA 5DRTA 3KUDA 4ZEWA 4AAYA 3INYA 5BN3A 3EYWA 5JV5A 2XXBA 3T3GA 3ZIDA 3GJ0A 3U5ZB 4UDXX 4CMHA 2XWQA 3PEEA 4PHFA 2CLEB 1RXIA 4YAFA 4BVBA 3ZBTA 3TQIA 4K5QA 3V46A 4JP1A 4N54A 1PHPA 2PG3A 4II3A 3KUXA 4BZPA 3CVYA 3VC7A 2IYYA 4JUFA 4IDHA 4INZA 3TNDA 3U81A 5EJ6A 1WMDA 1XTRA 1VSQA 5G4LA 1DC8A 1JXMA 1XVTA 5AJTA 3GLGB 4GU5A 2DKNA 4N6OA 2G5CA 3OICA 3RT1A 4B79A 1EFVA 1ODJA 3PIRA 3N07A 2NU7B 3MINA 1GEGA 1GQFA 2GJ8A 3W77A 3HCRA 4ZMRA 4INOA 2OC4A 3FDXA 3OURA 1Q0SA 2NVOA 5JS1A 3E1KA 3EGXA 4P4TA 2J3QA 3STTA 3AVUA 4WOJA 2W11A 1KIMA 3OE4A 4ZEVA 5FWYA 3ULKA 1Z6PA 1Q74A 2X9LA 3OPVA 5LWQA 3ZWOA 2EGHA 5T8KC 2CMGA 2VG8A 3TPZA 4K9RA 4YLEA 4GZLA 4KI0A 4RVNA 1QNLA 1E94E 1G2PA 2X3YA 4L3VA 1EUYA 3OJFA 4TTTS 2X6TA 1WKBA 2V6MA 2YV1A 1ESZA 2AI1A 4V1CA 4G5HA 4EW6A 3SQMA 4WLUA 4FX2A 5KSOA 3SYTA 3FG9A 3T3OA 1BVRA 1DAFA 3PXXA 3S2FA 2GWHA 3I37X 4NXNB 1V8DA 3FZYA 3JQEA 4DDKA 3OM8A 4D96A 4CKEB 4IIUA 4OOEA 1XTQA 2DP4E 3M81A 1XTUA 3A9TA 1E5LA 1H9CA 1YQGA 3MERA 4N3NA 5JDCA 3WGJA 4EKDA 1NVWQ 3DKKA 4KE7A 4QRDA 1JHMA 1RQXA 4YMTA 5BQXA 1E58A 3TW8B 2JDIA 1GRVA 1C3JA 4TXNA 3EOZA 1TEZA 1J0BA 4O8ZA 1Y42X 5SZHB 2GK4A 2QTLA 3IE2A 4QGAA 4U7DA 1CU1A 5ALEA 5DTMA 1TKAA 4UXHA 5TMBA 3THXB 3EGCA 1KJQA 1RWKA 1JAHA 3EDOA 1GNLA 3HLTA 3RAJA 3SZLA 3ICPA 3WFIA 3U7FB 4M9SA 4D81A 3RC9A 2PFGA 3DO6A 4RZXA 1EUCA 3THRA 2QGNA 4E4TA 4C4ZA 4G5FA 1GRCA 1D03A 1N7HA 2QL5A 3IAEA 5EOVA 5FTLA 5JAMA 2B98A 2CBGA 4AY5A 3EVNA 4NENB 3DHEA 4PSCA 3FAZA 4YAOA 4RF2A 4LYEA 3P94A 3GZTB 4QPNA 2C7OA 2ZE7A 3OPYB 5A6VA 2VHVA 2GBCA 2LRHA 1FMFA 4NAUA 3ZVKA 1V9LA 1QRDA 3MRTA 3NKFA 1ZC4A 4ZT4A 5LQRA 2FXVA 4WBSA 2Y4OA 3TNJA 2PD3A 3NAGA 5T4EA 1H6BA 1ZN8A 1G20A 3NWJA 3LLSA 4LRQA 5ILGA 1Q6YA 2GRJA 3KV1A 1UF9A 2QHXA 1EH5A 2IITA 2AL7A 1YNSA 1ZH8A 2RHJA 3G5UA 1T9KA 2VHXA 2OO5A 2OBMA 3PJDA 2NPFA 3U56A 4CCYA 5DHPA 5BRAA 4MS4A 2VJKA 2BFDA 1CEEA 5H16A 4WXEA 2BHNA 1PL0A 4DCMA 3STVA 1W8DA 2W6PA 1TA4A 3STUA 4EMSA 3ACDA 4BO1A 2C9CA 4FSXA 1XZHA 2BL4A 3R7WB 1OI2A 1C5KA 1T2AA 2NSHA 4FP9A 1B8OA 1ZJZA 1OWOA 2OBFA 2IYAA 4GP6A 4QX6A 5LDHA 3NO9A 3RSCA 3D3WA 4MR8B 3ZVMA 4QQRA 3OSZA 1G5HA 5L4NA 1QMGA 2PSEA 2YJ5A 3K0FA 1X70A 5ENDA 1E18A 1QHNA 4ZV4A 1TGVA 4HDRA 4OBEA 4TMYA 4TYPA 3H18A 4YC7A 3KB2A 2AEMA 3VNUA 1R9NA 2A9QA 1QG0A 2EQ5A 3TQFA 3NNNA 3O8CA 1EE1A 4H16A 3K1JA 4X1IA 1L7QA 2C98A 1GGJA 1X7XB 2C9MA 2J4DA 3QJYA 3TBKA 3ZWCA 4BNZA 3C8UA 1JUDA 3DFZA 3R3JA 3NG1A 5DI3A 2A4MA 5GWXA 3BK2A 1MJNA 2O8EA 2J33A 5FQOA 3V48A 1A9SA 1JR2A 2E5WA 3AUFA 4I4LA 1RAIA 1E98A 4GOND 4CMAA 1YDGA 1L4KA 4MARA 2BFEB 3LKBA 2I34A 3QPDA 1O1YA 1N5JA 1GYQA 2WJGA 2BE9A 5F4ZA 5KWEA 1VZ3A 4RYLA 4WY8A 1W47A 4NS4A 2GHQA 5IJ0A 3G85A 4U9HS 2AMFA 3M5PA 4G0OA 1QXSA 4KMOA 3UKOA 3FKSD 1VPVA 4NENA 4J3NA 4C6SA 4EWLA 4M7RA 4E88A 3EZGA 4PRYA 5A4MS 3EX7C 1UAAA 3LC2O 2Z58A 4Q9AA 3TAHA 4RA9B 4FYIA 6Q21A 1PNRA 2HWWA 4NQZA 4RM3A 3RM3A 1WHSA 5D3KA 4XD2A 1P44A 1Z12A 3FPGA 2Z56A 4OHRA 5BQPA 2WJWA 1TA0A 3T3EA 2O5CA 1T9DA 5C1OA 1ECCA 1WSDA 2NSYA 1CUHA 2IU3A 4ZT7A 2ZULA 4AKEA 2HF7A 2RHDA 1J0CA 1QFJA 3WKAA 1U2QA 4EY4A 3WNVA 3VPGA 3H5TA 1GPNA 2QRNA 4I1RA 4I4CA 5HFAA 3LZ6A 3UYLA 2ZJ7A 2UXCB 2GPTA 1T1JA 5DJ5A 5CGQB 3QELB 2WMYA 5HCNA 1MO3A 4EGFA 2O59A 3NHBA 4JBNA 1J4AA 2NU9A 1ULBA 5A4KA 1N2ZA 2P6NA 1M1YE 3K16A 4KIJA 5J63A 4Z4FA 3UH1A 1EESA 1Z22A 2X22A 3OEWA 1OLUA 4UAUA 1ZJJA 5JH7B 2NVUB 2WWHA 1V43A 1U7WA 4RXMA 5DGCA 3QQPA 3L8YA 1JMVA 1U94A 5CM2Z 3FYUB 4AJ2A 3K72B 4PLGA 1HDRA 4WZBA 4BO9A 1CQIA 3N74A 5BN5B 1ZD2P 3D8HA 2V7WA 3TZKA 2FDRA 1W8IA 1DO2A 4BGVA 2XJ4A 5TQVA 4IVRA 2X40A 3WGMA 1PKXA 2NZVG 1XLUA 1LV7A 4YNBA 3VUFA 4PS1A 4XFDA 3U1BA 2NTVA 2AF3C 1WZNA 2GBPA 3MSCA 2JAQA 1S4QA 4S2EA 2FPUA 4QJ3A 2P9FA 3U37A 1VCNA 2EFHB 3A2MA 1OZGA 1MQ9A 3GZ4A 3WGHA 3WLOA 3DZ8A 5TXGA 1NV9A 3PD1A 1NSFA 1H1LB 1JQLB 2PIDA 4DSOA 2WM3A 2X2PA 4GI7A 2ILTA 5J40A 3E3OA 2VXOA 3LDUA 1VLMA 2W71A 2FR8C 4L16A 5FB3A 1IPFA 5GONA 4G0XA 1IJFA 2EYQA 4OP2A 1CP2A 1TTQB 3BYZA 2BBTA 3T99A 2E5FA 1PJTA 4JYBA 3IDAA 2IHBA 4WADA 3ZS8A 4EZIA 1S9DA 3KB8A 5COAA 4NXMB 5K0JA 4NDZA 4KXFB 3H5VA 5HTOA 5JI3E 4DXDA 1ZGZA 2BTQA 2E89A 3MS2A 1ZN9A 3RE1A 1HEIA 4U7JA 4ZGWA 1ILEA 3FHTA 4NPAA 1VE3A 1VJRA 4ND2A 3GA0A 5LYYA 3I9MA 4CM5A 1Q20A 3WK9A 3LTNC 3DXFA 1FFEA 2PGLA 2AA3A 1WB6A 3PFNA 3UMVA 2IIPA 4NSNA 4CKZA 1FX0B 4RIIA 1QG6A 2HJGA 2E87A 4UREA 1Q57A 1BFDA 4R40A 4E22A 1BRMA 1U28C 1XI2A 2HQRA 4LXQA 1J8YF 3AEKA 3JQBC 4WIAA 2D8MA 3P8ZA 3OQ6A 2QE7A 1KF0A 4YMLA 2CVHA 3N53A 2YJ4A 1VXOA 1LVUA 2NXCA 3F2IA 3UG6A 3NDBB 2C5LA 2IY7A 2L69A 2UYQA 3FMIA 3P97A 1EUQA 2JI8A 2XYGA 4M0UA 5FTNA 4H1HA 1XL1A 4MUNA 4OMCA 2JJYA 1NJ2A 3COWA 5L3ZA 4DLTA 3O3OB 3SVLA 1YFMA 3R9WA 2R6ZA 3T4PA 4FCCA 3V8MA 5JXHA 1X2BA 1OX4A 4CLRB 4GL4A 2RONA 1I10A 4N5LA 2A5DA 5HOEA 4ADLA 2YFQA 2D0IA 3KXLA 5CITA 1GP2A 5GIOE 4W82A 4LF6B 3ET4A 1NW6A 3HP1A 1F6WA 4R01A 4AP9A 1CDZA 4NYJR 3GN2A 5CLHA 2X1MA 2B5VA 1DFGA 1MG0A 2J31A 3LGXA 2R60A 4HNAB 3EQ8A 4L75A 4OGFA 2QTNA 2FE1A 4RGVA 2VZ8A 4LQ4A 5EEGA 3QPVA 3ZXIA 4BVAA 3LPLA 3KQUA 1YHNA 2E55A 3LFUA 3K4PA 1XJWA 2ANBA 2WI8A 5ITZA 5KOJA 4DPLA 3Q15C 2VSXA 2PZKA 3AYZB 1PJ2A 3C3PA 2VQDA 3NQ41 3ZX5A 2I87A 4ZVVA 1GPJA 1OFTA 2D0PB 3RWOA 3ZQ6A 3PHBE 4LMRA 3X43A 4ZDKA 5FOWA 2VZLA 5REQB 3T1QA 3TLBA 4EYGA 3LXUX 4PV7A 5EWMB 4Z4IA 4TVSA 5L7TA 4G24A 2IC5A 2HAEA 3ZIAA 2QX9A 1HE8B 2WQZA 1H2AS 1C2TA 3RRMA 3HGMA 3RC7A 3SAJA 5AICA 4EECA 1HKHA 3OT1B 5LXTB 1SKMA 5GONB 3TLZA 2JLCA 5A5FA 4CEHA 2XITA 2LIVA 2TMYA 2V6FA 4XUGB 3LM8A 3PP8A 1M2EA 1IULA 4QXQA 4Y6GB 3LBAA 1J2UA 4FD2A 1B1AA 5BSUA 4YPOA 3K6SB 2DEUA 1OROA 3TEMA 3HUDA 2EV9A 2BTQB 1QLWA 2FOXA 5KC9A 1Z34A 3TLEA 1JWLA 4NAHA 3KT3A 4ZHQB 3F4KA 3PFCA 1F5NA 3PV0A 1B6SA 2LCFA 5C4IA 3DZFA 3AVWA 4EPWA 3FW1A 4L0DA 4R98A 4MKRA 4KLNA 2J9RA 2YYAA 3MT0A 4R2JA 4TTAA 4YGYA 3U1VA 5EJ4A 1E3TA 1VHLA 3KJNA 1MV5A 2IZ7A 1S2GA 2IUUA 5KNDD 1YNOA 4E15A 1KAQA 2QTVA 4Z4HA 2MOKA 5EZ5A 3VYTB 2Q4DA 4C87A 5DYIA 1ZMRA 3ADDA 4HUTA 2V7EA 1PBTA 5FPYA 3UJCA 1UM8A 2O9JA 3P0HA 4BB0A 3EZLA 2HHHB 1JILA 1EFRA 1PYOA 3TQRA 3ORFA 5HRCA 3KYBA 3EEBA 3PUIA 3BB4A 3MWFA 4AJKA 5BNZA 2XEDA 2IHJA 4LRYA 1E61A 1VBKA 2XE7A 3LPCA 4AS3A 1JZSA 5A1TA 3T0GA 4X62B 3P0EA 3U09A 5LKRA 1ODFA 3K0CA 3IXQA 2GM5A 3L41A 4IKOA 3ZLTA 3KVNA 5IJZA 5K7SA 3PEWA 5M3BA 3HEAA 4M83A 5BUZA 5C9ZA 3NAQA 5ENZA 3ZDZB 3J80A 3O9VA 1GSIA 4PLWA 2VZEA 3WWOA 3D31A 4WEOA 2N1BA 2C2OA 2JI6A 3TOVA 4QDZA 1GPDG 1EWVA 3GLQA 4DPKA 2J6CA 1M6VB 4FUQA 1SELA 1VECA 3FMFA 1MX5A 2A33A 2C0PA 2LIPA 3WWCA 4DILA 4XFKA 2C4NA 1KHTA 4G4JA 4TRMA 4MI1A 1UPAA 1YQUA 1Y7TA 1A5TA 4UPVA 4TV8F 3OT1A 5LNK1 5EWJB 2BIFA 4F5DA 1BMFD 4Q12A 2ZS9A 3T6KA 3O1IC 1XELA 3I72A 3K8OE 4F4HA 5I5EA 1RRGA 1W5TA 2FLVA 2HN9A 2PEYA 2QPTA 1AQJA 3I5XA 3NC4A 2H63A 2YHAA 3B78A 4TV8B 3RVBA 3WGLA 4N41A 3GHYA 2XUGA 3CH6A 5T8KA 1L7OA 3HY3A 2GLTA 2Q3JA 4S35A 4WWHA 1NI3A 1QO0D 2I78A 1XPUA 4URXR 3MZ0A 2J4FA 1J2EA 2Z8XA 4Y18A 1WL8A 2Z5FA 3EJ6A 2QPAA 2CSUA 3H2SA 3VDRA 2XA2A 1E9CA 1JLRA 1TZKA 1W4BA 1Z6YA 3ND7A 4F7WA 1UZAA 5TV2A 1VCOA 4MWGA 1OFIA 3ZLUA 2IYFA 5CNMA 5FOUA 4UD6A 1I30A 2AEEA 3NPAA 1JHPA 5D51S 3EDCA 4KXNA 3ZE6A 1JG4A 3CNHA 3HV2A 3AHFA 3P71T 1TJYA 1IRIA 3C87A 4K6GA 4P4UA 4R7TA 3K71B 1KEKA 4JR1A 1YV9A 2BELA 1N2HA 4J9VA 2XECA 1KJYA 2PHZA 2PYZA 3DR3A 3ELUA 3WMFA 1I7QB 1QP0A 3U7JA 5KOIA 3U6BA 1JZQA 1MZVA 1AKEA 4RX1A 4TXLA 4NFHA 1TJ4A 3TX6A 4HDSA 1RYNA 3VR0A 4IDAA 1XAJA 3OMWA 3DD1A 4PLFA 2AYZA 2PX3A 3ZE2B 1Q3HA 5A03A 4MDFA 3L6UA 3DL4A 1PQ4A 3MOSA 5F12A 3ANXA 1NOKA 1GFWA 4MX2A 1R8YA 4JLSA 1OWMA 4KN8A 3TW6A 1XJCA 4D4GA 5T4HA 2BUAA 1I2MA 2WAAA 3OTIA 4P80A 3VNVA 4AURA 4LRTB 2AX4A 5AKYA 4S12A 1TQ6A 3K2BA 2HNBA 3O1LA 5ALLA 2QJRA 3OEED 2WTMA 4DV0B 1U8YA 2QN7A 4L6IA 4NWIA 1PFUA 1RC1A 1Y4ZA 3X1WA 3A2NA 2DPMA 1JEQB 1Q5PA 3E81A 3F1LA 4TT3D 4PF1A 3ECSA 2IJGX 2D2VA 4MWTA 3M6IA 2QLMA 4DC9A 1X1AA 2H59A 4L2IA 4MR9B 5IHXA 2QVCA 2ODNA 4KLRA 3Q8WA 3HJFA 4Q4HA 4HDMA 2XT0A 1YL5A 1EXNA 3KQLA 1MRNA 1QWOA 1WNFA 2P3LA 3EG9A 3GLHE 4ZYWA 2FGJA 3HU1A 1QVZA 3ESRA 1JYSA 4I14A 3VSCA 1H0HA 2DWCA 2UXDB 2W2KA 4I4NA 5CNKA 2G70A 3RYTC 2YHBA 3KHKA 2YWCA 3UV7A 4E5SA 2O8CA 2PL5A 3NW9A 1M2VB 1WXHA 1SXJD 2EHJA 2H1HA 2ID8A 2XBUA 4CR6A 2R1ZA 1LNQA 3HDJA 3T1YB 5E9JA 3IPXA 4H15A 2OGTA 3GROA 4M9ZA 4CQJA 3NB0A 1GU0A 2GZSA 2R5FA 4BMSA 4LSGA 5BRJA 1FTSA 1M6NA 1TQ2A 1Z7GA 3O2NA 2CCJA 1ZVQA 2C29D 5LIRA 1FPMA 3R0VA 1ZPDA 3OKPA 2JFOA 1Q0UA 1JKJB 4R3WA 1Q12A 4FK8A 4HAZA 2ZZMA 3E35A 1XRQA 3M4JA 1ADJA 3PCRB 1Q1NA 4Q19A 1AHHA 4E6EA 3AEUB 4PBRA 5FL7D 4DN6A 3M6WA 2R5NA 5HKLA 4ZK6A 1IG0A 1KK0A 3DMFA 3OO1A 1RE0A 4J3JA 5IW8A 3AR8A 3RYIB 5IZCC 3D4PA 3FTNA 2Z2KA 1LEHA 1XA4A 4J1SA 4C05A 2VN8A 3OLYA 2M1ZA 1NC1A 2KE5A 3QHQA 3SD7A 4QNRA 2FFAA 2VJMA 3AEXA 3AONB 3BWEA 4MV0A 2C2XA 3I04A 5KQPA 2AFHA 4PFSA 1SN7A 2Z9DA 1PTKA 3MHPA 4Y9DA 3H17A 4P58A 1LNZA 1X19A 2HBRA 2NSDA 4XUDA 2P2DA 1KC1A 1WD7A 4EHBA 5A9RA 3GLFB 1C3UA 3P26A 1T4BA 3VFDA 3FAKA 3U44A 4TM8A 3OJEA 3MGKA 1QQTA 4WXRA 5C4GB 2Q5HA 4D3DA 4EQ6A 1Q7BA 3OZVA 4G5RA 4BMPB 3M82A 4MRVA 1JU3A 1U1IA 4HP8A 4WCVA 1NW8A 2IZ6A 5KYKA 1AHPA 5BVHA 2BFAA 3D0RA 3VNQA 1BDIA 2ODTX 2V7UA 5AH0A 3VOSA 3IEVA 4QGHA 4X85A 2C3OA 3RS3A 4UUQA 4B74A 3BWMA 4EL0A 4UUBA 3UNXA 2AZXA 1M2WA 3IDOA 1MJGM 1BW9B 2ZJ0A 3KWJA 1HLGA 1W52X 4B3IA 1S2DA 4ETIA 1W7AA 1N1GA 3G2PA 4Z8XA 3WC4A 5GONF 4AJPA 3NHSA 4J75A 4C78A 3ACCA 2DX7A 3PUJA 3F5SA 1UDRA 2Z43A 1Q14A 3DMNA 2MINA 3KXIA 3NC0C 5FWAA 3IBGA 5CBPA 1PZFA 1MO2A 3ZZUA 3IAS1 2FF7A 3VOAA 3Q8LA 3BCUA 1Q1ZA 3OBIA 2LE0A 1NW4A 2CVQA 5IVDA 3LYHA 2R4TA 3HUEA 3MIIA 5KPJA 2I2DA 4R3NA 1KQNA 1CW2B 2WIFA 1TVKB 4F0JA 1L5KA 3GT0A 2HFJA 4WK0B 2HFKA 4EB6B 1KEEA 1IW7D 5IP5A 2E0IA 1C8LA 2SHKA 2VPXA 1OLXA 3TIVA 5KAMA 2VQ6A 3RC8A 2ZCVA 1M34B 3W4JA 1T3GA 3F47A 2I6QA 1VIYA 521PA 1K5GA 3L8FA 1EB9A 4IDOA 4NMHA 3EFEA 3JQRA 3UXHA 1L4EA 2O48X 3JRNA 1XZQA 1JB9A 2EKZA 3QIVA 4LPSA 4XDGA 2P67A 1RPZA 2Q0HA 2B4RO 1X0XA 2R6AA 3I1JA 3NEPX 8GPBA 2AXEA 1RI2A 4UTPA 5CFMA 2XMSA 3JWIA 3NIBA 3JQ9A 5GGXA 3WV5A 4UZEA 3VR3D 2ZRNA 3AY0A 4OYRA 1KSHA 2V98A 3AJAA 5LWHA 1NUSA 2Y0DA 3ZGVA 5DZSA 3NHMA 4EA8A 3F2VA 3C7AA 4N0DA 2OYCA 3DO8A 5LYJF 1Z62A 1JHQA 1P5ZB 2C04A 4TL8A 3RDPA 4FOTA 1SOVA 3ZDXB 1U4SA 2SCUB 5A1JA 5B1EA 1B3BA 2QU8A 2F1HA 1CZUA 4KAAA 3PT5A 3BMQB 4QYIA 1DNPA 2OWDA 2QRGA 4L27A 5DNAA 1YQDA 3T52A 2E1RA 4BFZA 1EXMA 3RCBA 1DRVA 2W0SA 4GP9A 1NZJA 2OD7A 1PJAA 3D8RA 3A27A 3PD7A 1VPTA 3QMMA 1QTIA 2C82A 3VA7A 3FNQA 1WD5A 4GVLA 1JDBC 2VHZA 3WIOA 4DQ0A 1WBDA 4E5VA 2ZXUA 4P0TA 3HUUA 2P9TA 1COWD 1OIVA 2QF7A 4BTEA 2VNJA 4TZ6A 4O4HB 3TRDA 4DLWA 3NT4A 4JT4A 2W2VA 1BCRA 5U1PA 5HGXA 5I7UA 4FWTA 2PMDA 5LQSA 2I3GA 2V03A 5E2IA 1M2NA 3VRHA 3T5CA 2FX5A 2YWEA 2V65A 3IPCA 4B76A 2XSZA 3FOAA 1F06A 4KX3A 1BSVA 2OMEA 4NP6A 4RULA 4RJLA 1D6SA 3GPDG 1DG1G 3HNOA 2CT8A 1N5OX 4QXAA 1GILA 2JCVA 4PZPA 4IJUA 3EAFA 5HQJA 4G97A 1ORWA 4ONEA 3PE6A 5CDTA 1YB2A 3KNZA 2DQZA 4JQOA 4AXBA 4JFAA 2DT8A 4HXEB 2YY5A 3K0AB 1XRRA 1XNQB 4RFVA 2YNMA 1MW8X 1DRKA 2ZE6A 1B1CA 1JL3A 1G4UR 5LQNA 1SVNA 2PX0A 2QJTA 3IOYA 4AZ0A 1QU3A 3V6MA 3LECA 1DKUA 2C2ZA 2R87A 3EF1A 4WCFC 4WERA 4YV7A 1AUWA 4URHA 1G5IA 3RFXA 2QRVA 2XODA 3ETCA 4HWOA 2PTHA 5L7YA 2VPZA 4IGIA 4IXWA 2W42A 1XR3A 1OVGA 4B7UA 3NDJA 1OU4A 3FTDA 2XXAA 2Z2XA 3WIDA 2B0JA 4DLZA 2ZUBA 1X7HA 1NQUA 2H2WA 1KJNA 2BGGA 3QOYA 1T0IA 1YE8A 2UZIR 4I5FA 2PD6A 3ROXA 3VVMA 4RCYA 1QCZA 2M1XA 4TLLB 3BILA 1TFRA 3FWYA 3NTRA 1BXKA 3EUWA 1NONA 1VIDA 1YDHA 3EPRA 1M75A 4RNDB 3UW3A 2O7NA 3L18A 3MT7A 3CSSA 3TZ6A 2J07A 5L3RA 4QU5A 4DNQA 3DLBA 3F78A 1CUUA 1X80B 4MV7A 5A4DA 1D8AA 1BD4A 1AZWA 4MQEA 4DWJA 4XGIA 3O47A 2VYFA 2WIJA 5B36A 4QM6A 3EBLA 5BUQA 1L5OA 1IN1A 3VSAA 2JD2A 4GGMX 3TXYA 3THYB 4PPQA 1XVUA 4G2TA 3R0IA 4OKSA 3PUXA 4ZI7F 2B83A 5CX1B 3IUYA 4A1OA 4XIJA 1PUXA 2R6DA 5M7EA 3KZCA 2ECPA 4LBVA 2ORED 2Z98A 4JJKA 3RVQA 3E1GA 3C3XA 1RRPA 3ESCA 5EAIA 3IDQA 1FTYA 3WDKA 5I6DA 1FVFA 3WIUA 2G5GX 1XMPA 2R6R1 3S1AB 2YXDA 1QF7A 2C42A 1E77A 1RFGE 3B12A 1W30A 3IAHA 3RB8A 3P0FA 4CWAA 2G9RA 3KJIA 1KVQA 1IQPA 4XB6B 1JHYA 3ACBA 2YV2A 3D0KA 4FS8A 5D86A 1DHTA 5FWXB 2XBMA 3BJIC 4O3MA 1KEPA 1VLZA 1LBSA 2X0RA 3BVPA 3TZBA 3K6SA 3GZHA 5EIBC 1BWQA 1K4KA 4KWHA 3WLEA 2OILA 3M70A 1IY1A 5TT0A 4BWVA 4E0BA 5EGNA 1C3XA 2DLNA 2GDZA 1SD1A 2XTAA 1OHHA 2O4UX 5HIJA 2A4KA 4GEKA 2ZJAA 3LHSA 2ZBPA 4A5SA 5AUQA 1S1CA 3ZCXA 1UJCA 3LKDA 4NYIR 1A4IA 2EQAA 2IYQA 5DXFA 4FDVA 3VZBA 3ZY6A 4BZXA 3DTVD 2QQ0A 3G5TA 4XIFA 4GYKA 1NLYA 1W85B 3LYUA 3VDXA 1GZVA 1P4HA 1DWQA 2QRVB 4QAQA 2G1AA 4N0MA 1WCIB 2QVLA 2J3JA 1Y0BA 1IQUA 2P77A 3PEUA 4C21A 4H7KA 1U02A 3C8HA 2QN2A 1Y1QA 3E2IA 1V7QA 3KOWA 4JBIA 4NR0A 5BPHA 5BSTA 2ZRHA 1MO5A 4D4MA 4DV2B 1LSSA 2IE8A 1N25A 1NTRA 4I50A 2AW5A 5E1OA 1HL7A 1M8GA 2A5LA 1HR0B 1C0PA 1XBTA 5AKGA 1UK6A 2REQA 3AOEC 3JQGB 2FHPA 1FX0A 1IN7A 3U13A 1N7JA 3OLCX 1KP2A 1UWCA 1UC9A 5K9ZA 4F8JA 4HT3B 1T5IA 4Z2YA 2QRQA 1A7KA 3V1TC 2O3QA 3E7XA 3L6RA 3P2OA 1PQYA 4BLQA 4D1YA 2Q5EA 4EPTA 4YV0A 5KTSA 2WFZA 3UCEA 4KW7A 3ZZMA 4NSLA 5EZQA 1PR0A 1XJQA 3JD1A 5NULA 2ARKA 5G0TA 5HF6A 4RMHA 5C8XA 1TK2A 4PAMA 3R74A 4MZDA 1PTJA 2GCGA 3BRQA 4OXIA 1D6JA 4G8JA 3HCEA 4DWOA 1TIKA 2A1UB 1N3LA 1M6VA 3WGIA 3LYAA 2GHTA 2FW9A 5ALPA 3IQDB 3QFRA 3REOA 3V32A 5HKAA 2B7LA 1GU1A 3NYIA 3P1JA 4MDYA 3TOXA 1WXWA 4H2DA 2R7AA 4Y3UA 5ARDA 4DREA 3UUEA 4DR7B 1DIOB 2P2SA 1TJPB 4R9RA 4KMRA 1CB7A 5ECYA 3S2UA 2GEDA 3HSSA 4OQNA 3X1ZA 4DADA 1RCFA 1UIRA 1MXHA 2Q1WA 4WA7A 1TYBE 5ARBA 2C2HA 1T2VA 3KKMA 4PPYA 1P45A 5IVPA 3WK6A 3IMKA 2DPLA 1BCSA 1M7BA 1Z88A 3QVOA 5AM0A 3LDHA 2H2HA 1MXFA 4IV5A 4QU8A 5E4JA 3AIMA 3N0VA 2P30A 4Z0HO 1QYWA 1ENZA 1P4AA 1P33A 3HCNA 3JVVA 4GQIA 4L4ZA 4M9CA 4ZU3A 1VSTA 1Z15A 2VDOB 3WYGA 3F4SA 2UYHA 5CA0A 4CLOB 1C9MA 1ST3A 4NRDA 3JZIA 4G89A 4ZVUA 1IBRA 4TX1A 1J3UA 1AK9A 1T1SA 1DKRA 1GVHA 3EMVA 3KT8A 4QGBA 3USES 3VTAA 1ITZA 1PHRA 3T3IA 1G5TA 2BHRA 4QELA 1GQRA 5CA1F 1DLIA 2RGAA 4CLHA 3P9IA 2FQXA 4P22A 1D1TA 3HVUA 1XTZA 3AM5A 5J4KA 3KKLA 2GJAA 3UATA 2R6JA 3GZNB 1GL3A 3BRWA 1YBAA 2BFFA 1UZUA 3QF4B 2X2OA 1NE7A 3FFAA 4QXPA 5T57A 1RLIA 1QC5A 2JKVA 2WSSA 3HI6A 3ROEA 1B0PA 1SUEA 4B6QA 4I36A 4ZCRA 2V6BA 2ZYSA 4FEYA 4NYMQ 1P60A 3RRBA 2CJWB 2GCEA 4GBED 2IZ1A 2Q6LA 3C5EA 1EIZA 2DBZA 2VTKA 3DE5X 3PCTA 3M3DA 5IABA 4C7OB 3S29A 4L95C 3TKAA 4B4WA 2B7CA 1W4RA 1ZCFA 3INNA 3GJ3A 2BF7A 2F67A 2KYRA 1RMQA 2ODBA 5G0VA 1TJ7A 1VE9A 1C3VA 2F9MA 4I7EA 4J0JA 3GEBA 3QLTA 1TJ3A 3VR5H 2W2XA 1J0AA 5K8TA 3W7BA 3IFSA 2AVDA 2I7TA 5BW4A 2JIPA 1DCKA 1ZAKA 5JRJA 1M67A 3FVQA 1CWUA 1F2DA 4YT8A 3MGAA 4CMKA 2IHTA 3VV3A 5B7PA 2NUTA 4C1NA 5FA6A 4HMOA 5C4MA 5JALA 1YQEA 4XTCS 5ICFA 4EITA 2IH4A 2A5JA 1T10A 4TXMA 4B7AA 2YZGA 2JLAA 1S3GA 1M73E 2MSNA 3EASA 1R0ZA 4PYOA 4DQDA 1Q1QA 1IONA 2AD1A 2PZBA 4JP8A 1E0JA 4L15A 1JQAA 2FZCA 4FE4A 2CEKA 5L4LA 1ULHA 2K5UA 3PWSA 4IEEA 4OHFA 4X1OA 5IJAA 2P2LA 4LZJA 4MGYR 3HNRA 5CLLA 1XNRB 2UDPA 1U3GA 4WV3A 1DU4A 1SCAA 3PZBA 4JJIA 3IP9A 3TL2A 4D9KA 4IKEA 4EB8A 1OZHA 3GLFA 5C0OE 5CTJA 4FFRA 5LLSA 2CKMA 3VKHA 1ZMBA 2JCSA 2PPLA 1C3OA 1VL6A 1OFUA 2GR9A 2PY6A 4JY7A 1TAUA 4EKGA 3GPBA 3IUPA 3HB7A 3VKVA 2LKDA 3GVHA 3X1JA 3D02A 2X4DA 4MEBA 5IUKC 3SQNA 3NBAA 4F3RA 3WRVA 4J2HA 4ZAXA 4Z7QB 2PH3A 1VBNA 3GRCA 3I8SA 3OCCA 4TQUS 4QXMA 3PNVA 4JI1B 4CMEC 4KLZA 4ARAA 4V1CI 4D92A 1IIRA 3WP1B 1Z4PX 4Q4DA 4AROA 5C7LO 2H1RA 4OLFA 3UJHA 1J9EA 4LZPA 2WDPA 2QP9X 3I28A 3O3NB 4WKOA 3UK1A 8ATCA 5TQ0B 3ZN2A 2IEBA 3GJ6A 3MB5A 3RQSA 5FUQA 2N75A 4RIGA 4CUJA 4RCVA 1QR2A 3JX9A 4D98A 4RTKA 3BSSA 1E1CA 1IMOA 2VEDA 4LNHA 4EUEA 2DLCX 4CEIB 1JKIA 2ZRCA 1NM5A 2A5YB 3H42B 2YWDA 3EVDA 5KDOA 2I1WA 2HTEA 2IU6A 1B93A 2VQSA 3EXFB 4V2IA 1YUNA 4G4SP 4ZU1X 1QG4A 5LUAA 2X0KA 4M8KA 2IIQA 1VG8A 4O2BF 4UFNA 3INTA 4ECAA 4MUYA 4F97A 4UEOA 2FWJA 2RI0A 5D7NA 2UAGA 2SNIE 2WJZB 4BL5A 2AS0A 3BS4A 2E18A 1JTVA 1TW2A 1TU3A 1A95A 1J56A 3WRYA 5F2KA 4AP6A 4XGQA 5B37A 4C3OB 1ACJA 1DI0A 1RYMA 3EZ6A 3K15A 3MJHA 4LZAA 2BKXA 4NY1A 2O8DB 1KQ3A 3GOQA 1H42A 3RSSA 5AR1A 4TXHA 4AY2A 1NPYA 4TV8A 1HY3A 1KY4A 4JA0A 4JJ6A 2B36A 3KD3A 2QSYA 1ODLA 2JJ1A 3HA5A 3KO8A 4QYMA 1D0IA 2VP5A 5C53B 1TU0A 1V6SA 2HGSA 3I61A 3IVMA 5ARCA 4KN9S 5JJLA 4RPLA 2RAFA 4HK4A 2FFHA 4X20A 4MPJA 1K2WA 2BDTA 2JFQA 4FBMA 5HA5A 3EPKA 1E5XA 2Y6VA 2Q5LA 1Z5VA 5EE3A 3RSLA 1Y8QA 5MFZA 4N40A 2RGEA 2G67A 2GVNA 1T9BA 2R62A 4BPRA 5JCJD 1G1MA 1L5LA 3ZNPA 3BG5A 2IXGA 4BTLA 4D42A 1FTGA 4F6RA 5JCZA 1M6EX 4F2PA 4GZ5A 4Q16A 2HK7A 2OKGA 4EGSA 5C1PA 3C15C 1AM4D 5IZCA 4W5OA 3TGWA 3MILA 1V11A 2BBOA 1FF9A 3H3JA 4JU8A 1C4XA 2ODQA 3FLMA 1UQUA 4ILEA 4PG6A 1HG0A 3VH3A 5ALVA 4AZ3A 3GCDA 4NZOA 5I7HA 3K20A 5HR5A 1A7UA 1ZUIA 4QLBA 4Z9BA 3PQ5A 5CXSA 4Z3DA 1K7EB 1KR5A 3AM4A 2JVKA 3COPA 4KFCA 1QIEA 1ULAA 2UZ0A 4RIHA 3NHKA 1MNQA 2JJ1D 2DY1A 3IHKA 5KWIA 4YCSA 2OCIA 2WPDA 3BQ9A 3PNSA 4US1R 4HSEA 2W98A 3R9KA 1TMKA 3DOIA 1Q7RA 3H9CA 1K4YA 5AXAA 1AXRA 3B6KA 3E3AA 1G0NA 4XLLA 5CVEA 1KVUA 3MUOA 5F7XA 1OZ0A 2VHUA 2QD5A 4O33A 1TO1E 1JHDA 3EQ9A 2PUEA 2CFIA 1EVJA 4K46A 4GYWA 1DKQA 4MUJA 2J3KA 4MUGA 1DQPA 4B83A 4RBNA 3ZWMA 2O23A 5JADA 2Q7OE 4U6SA 1RAEA 2JD1A 5C2JB 4FNMA 1S2MA 4EHKA 4CMIA 3AHIA 3HDHA 1JRLA 5F3WB 5J3JA 2W83A 4M2LA 2ZYWX 2Y68A 1TFUA 1LC0A 4JBYA 3GLGE 5EMMA 2UZ4A 2ZJFA 4FW9A 1H69A 4RVUA 5IT9A 5BN1A 1D2NA 3FPHA 1K08A 3K31A 2ZT6A 3FUXA 3RYIA 3B1FA 1ZDMA 3VDNB 2PUFA 1T0BA 4HFNA 5DHAA 3FOZA 1UEIA 1CYDA 4L57A 3H86A 4PE5B 4WCFA 2HK8A 1YFLA 1NRWA 1HDIA 4KQWA 4LQCA 2C5GA 4KNVA 5F3RA 3OZ7A 4BKPA 4E14A 4MVJE 4GM0A 1V8BA 3B1WA 3E9YA 2FJ0A 2XQFA 1KK2A 1VKZA 1JEAA 2G36A 2GCNA 2GN1A 2TS1A 2JRCA 4ZO9A 2AN3A 1YR2A 2P7IA 1DCNA 3QVMA 4GZMA 4RUKA 5DGDA 1JKXA 5U4XA 1MRZA 2AE1A 3QK7A 5FBQB 1I0IA 2XDWA 2ZIWB 2Q5OA 2QY6A 2R3SA 4NFLA 1PGQA 1SUAA 2BMVA 2P5YA 3GAFA 3G2JA 3OT4A 4IJ6A 5CEJA 3T4XA 3R4VA 5CEEA 4PXYA 1E2PA 1P7PA 3TSCA 2J6IA 4RD4A 4ZO4A 4BNGA 2A7XA 5EWMA 5JXGA 1EM8A 2B8JA 3KLNA 3ITNA 3N75A 1JWAB 1NPTO 1OJLA 1RM0A 1Z6QA 2X8LA 3OESA 4W7IA 5DHFA 4EI9A 3MD0A 4XWYA 1PLJA 5K20A 1YS9A 3WZLA 3T94A 3R1IA 3OA2A 4LISA 4YLYA 2DVMA 1J9GA 4MVJG 4OYYA 4C04A 1E1QA 2IS2A 3EJWA 3QPWA 4CHGA 1J2TA 2HM7A 4XSGA 5JAPA 1WULS 4REMA 4X0EA 4XQ0A 1MR3F 1UR5A 3SF8A 3S28A 4FYKA 3M4ZA 3ESZA 4OQLA 5CJPA 2YVLA 1CR0A 2RGWA 2CXRA 1XSEA 1T8PA 1YK0A 1GPUA 3P9SA 3VPBA 3WSWA 3ZK7A 1UANA 4MINA 4OSEA 4C7JA 4Q4LA 5FR2A 2W6ID 1XQYA 2OV1A 4ED9A 1W93A 4I50F 4YCJA 4AC9A 2O8FB 1DEOA 1VSVA 1TVMA 1T6XA 2C3MA 1R8XA 2NU8A 5CFQA 4W9NC 1SCQA 2VYVA 3OSUA 4HNTA 3K9GA 4V0ME 3TUIC 1FUKA 1HYGA 3SDZA 1GCUA 2PDAA 4HVTA 3L8EA 3GLVA 1R1DA 3T9CA 5EIOA 1SQ6A 5GOTA 1Q7CA 3WLPA 2DTDA 4CCAA 1JEJA 1KYXA 1TCUA 3GXBA 2FOIA 4P7FA 1N33B 1OYVA 1N2OA 1CQJA 3SX2A 4F93B 5LQDA 2PTSA 1U5AA 3CZQA 1LX7A 1NASA 3DE7X 2D1QA 1S6YA 4HEHA 4M6WB 4PQEA 4B09A 1LVHA 1GPKA 1G20B 3VR2A 1BJTA 1FMTA 1Z4IA 1W5EA 4JVLA 4UXIA 4RIEA 2GK3A 3AUUA 3FTCA 5CA1B 2P4HX 4K8RB 4RVSA 1DEAA 3EISA 2QX8A 2D2FA 4OHYA 2BSXA 2PS1A 3K5WA 5EHQA 3O38A 1THMA 5IH3A 3DDUA 2X86A 4DRYA 1KMQA 2KS6A 1R0RE 2IDKA 1O6ZA 1F17A 1DIAA 3R2JA 2QPLA 4UNQA 1N0UA 4YP7A 4LJ7A 2CXHA 1A5AB 5DWVA 1R2QA 1QYDA 2PNFA 3EHDA 3PQFA 3Q3JB 2BOVA 5JO9A 2X6RA 3CUUA 2JIZA 4BB5A 2C5FA 5D3QA 4EY3A 1QDUA 4QRHA 1XTIA 2OXCA 1RM4A 2FZ4A 2WAMA 4DVGA 3ZYCA 5LFAA 2YIJA 3I8XA 4QBGB 4W5JA 4BYMA 4DC1A 5FBKA 3WMXA 3BC1A 4YJ3F 1U9CA 3SYLA 4ES6A 2C88A 3C45A 3VO9A 3M4XA 3GIWA 3MWJA 1I6MA 4CM3A 1AUXA 2JGIA 2ZUVA 2V55B 2CHEA 2ZG6A 3NOXA 1YDFA 4UTVA 3LFTA 2Y76A 1UXHA 1P1KA 3C6YA 3ETHA 2Q8NA 4RSMA 4YS6A 5AVJA 3W90A 4FQ5A 4M7PA 2EX1A 1W4AA 4Z49A 3BF8A 4N65A 4PYNA 5CM9C 3UGTA 2JCBA 4MUFA 2AKYA 4RDIA 4I6JA 3MMSA 1CFZA 3W5CA 4HGZA 4ID9A 2NO4A 4LXYA 4M60A 2I4RA 4GPD1 4RTQA 1P9RA 1FDWA 2R8PA 3USZA 5K5EA 4F9FA 5KYUB 3KU4A 2O8BA 4MKIA 4BGUA 1RQ2A 1PR1A 5HF5A 2YKGA 4ZQFA 3LD9A 1N2SA 4S3MA 3B20A 2NZYA 4ALLA 2BLNA 1T91A 2IVZA 2EZ4A 3CEHA 1MMFB 3E9NA 2QMEA 3GGGA 4GOLD 2XT9A 4ZTZB 4GC5A 2AHOA 1IXKA 1T8TA 2HT6A 1H1TA 3GGCA 4HYQA 2OZVA 3U9TA 5IVKA 4IAOA 4AIIA 1OT3A 2CXSA 3MCZA 4L4XA 4F1WA 1ZJ6A 3KAPA 4Q1DA 4L2IB 4MR9A 1TM7E 5IJ0B 5IVHA 1V45E 1G60A 3KSUA 3BDAA 1FEZA 4OAQA 4KRGA 5JWOA 3F73A 1YIOA 5SYNA 2DJIA 3UB2A 1Z06A 2ZREA 1DWPA 1XU7A 1OV4A 3H0EA 1F38A 3H0CA 4TYQA 2I1QA 2VHYA 5ERYA 4QG3A 1S0UA 2VBGA 4HBZA 4RDXA 2I4IA 1N2CB 1MB2A 4FW8A 4C6TA 3F98A 3QKSB 4BKOA 1W36D 2XXAB 2FEPA 4KREA 5E7IA 3VTZA 4RDCA 1JECA 2YV3A 1N5LA 3G79A 1GHTA 1P0MA 1EFCA 4Q05A 4RLQA 3WY9A 5ESWA 1M0EA 1GO2A 2G1UA 5T41A 3ZV3A 4F92B 2P2GA 3JATB 5ADHA 2NP6A 1FSPA 1II0A 1WX1A 1NXWA 1KOLA 5B1DA 2O7RA 1D2MA 3PJEA 4YAKA 4W99A 3W8EA 4LYAA 4TTQA 1HY0A 4YHBA 2ZQYA 1RXCA 1QQ7A 4LJ9A 5BVGB 3IVXA 4GX2A 4P7GA 2Z6AA 2YFKA 5DCUA 3ZWNA 4N0QA 3F9IA 1K6EA 4ZVPA 3V9PA 5SZIA 3U4AA 2PGOA 2W6JA 3QVGB 4LXIA 4UW9A 5KJFA 3COJA 5I9BA 4FYYA 3UWPA 4APBA 1SEPA 4IJWA 2IODA 5LA6B 3ZY5A 4YCCA 2O52A 3A04A 4QODA 1PX2A 1R0CA 4LWPA 2YYZA 4OYLA 3B70A 3N87A 1QX4A 2JIMA 3VX3A 4D3XA 1T6YA 4F6CA 3QEBZ 2QLNA 4BNJA 2BKUA 1D2GA 4WZBB 4ZC8A 5KNCH 3MUNA 2FFJA 3CRZA 4BP3A 4MR7A 4G1FA 4Q7KA 5DP2A 3A32A 1JGTA 2BONA 2FQ1A 1NUTA 1U8XX 2VDJA 2IEYA 4FFBA 1FYEA 1I4DD 4NIMA 3KZKA 3NBKA 1FFXA 2OBNA 2Q8QA 4Y6OA 5GQSA 3VR6A 1TKCA 1KY2A 5EKDA 2A9KA 3LT0A 1EVLA 1QFXA 1ZSVA 1N2GA 2JAWA 2C95A 4V0LA 2PU7A 3AVTA 5BSVA 2ZIFA 1RNLA 2R86A 4JYMA 4YJ3B 1NAIA 3HKCB 3L07A 5IAOA 4G07A 1ZRSA 3PDJA 1TCVA 4OQMA 3G5AA 3W04A 1WU8A 1AK2A 4IFEA 4NBWA 1FK8A 3EIUA 1VP9A 3DBHB 2G9NA 1E89A 1JHUA 1IBKB 3F4RA 2OG1A 4WUVA 3MK31 1XVVA 2VC2B 4DSZA 4CI9A 4QOJA 1MG5A 2YJZA 2NYAA 1P7YA 2OZPA 3MWEB 1TYAE 3B1XA 2WFLB 5AW9A 3PL5A 2PT5A 4FYMA 2V4ZA 1MA3A 4ZVTA 3RC2A 4ZI3A 2HJRA 3A6LA 2QMYA 3GEPA 4LZNA 1NBHA 1CUFA 3CE6A 3DAYA 4QOHA 5G40A 1HI9A 1G7CA 4BMVA 5DE3A 4ND4A 2NQ2C 4ETWA 1XMIA 2GILA 4RGQA 4IHKA 4RD3A 3FFTA 2VRCD 3NMUF 1JN0A 1KI8A 1XEWY 2Y0BA 1WDMA 2WNHA 1Y3AA 3IIKA 3EVZA 3HUFA 2M98A 3QYJA 1XNJA 1Z38A 3CEMA 3OJCA 5CK4A 1Q0QA 3PHHA 2OCXA 4BBAA 3IEMA 2OECA 1T25A 4UNNA 1P7WA 3W9BA 5D6BA 5A02A 3SVTA 3FGPA 3AVVA 4TWIA 4S1PA 2GN4A 4EJSC 2BEVA 3EDYA 1NFFA 4MQLA 2OYRA 1TK3A 2CJFA 3AV0B 3IIJA 1YVRA 3BSFA 1RW4A 1U80A 3Q3VA 2HHJA 4RMGA 3SPXA 3TIGA 3FJYA 1UT8A 3SQDA 1RMYA 4PX3A 1Y3IA 3ZKWB 1J25A 2REQB 5GJWC 3KXDA 2B78A 2NUPA 1AZLA 1T9ZA 1J20A 3F5DA 1LK0A 3JZAA 3P5SA 1O5IA 1SCJA 4URWR 2ZI3A 2GRAA 2IF0A 4YV1A 3UBMA 1CRWG 3OLXA 4J1TC 3ZJUA 5A4IS 2I6FA 3G2HA 3F3SA 4LDPA 2BFBA 2OM6A 5ALNA 3SIRA 3CNOA 1G3UA 2Q9UA 2DQKA 1RKQA 1WCIA 1FSSA 5AKLA 3U80A 5E4FA 3ZK9A 4J0QA 2VFAA 3PFHA 2VKQA 1IEXA 3DEHA 2R2AA 1DB3A 1Z26A 5I4IA 1CQPA 3Q7QA 1ZH0A 1V4NA 1QGED 2EW2A 5BOSB 3UUFA 4OREX 2E4AA 2CV0A 4PN7A 1RBYA 3A28A 5K03A 4EYOA 4QDTA 3AZPA 3E1SA 1KDZA 1YJ8A 3TO5A 4RNCA 4DDHA 1YMQA 5FWXA 4CG3A 1FW8A 1PSZA 2ORIA 4MRPA 5B5SA 3HXOA 4XD7D 1CPYA 5JYEA 2CNOA 2ICAA 3AGPA 5BSEA 3FCOA 1COWA 2RBEA 1QAOA 3EYAA 4KXVA 4N5DA 1KP9A 2H92A 2Q1XA 2XMCA 3BMOB 4J1TA 5CBKA 4AXXA 1DLJA 1P2BA 4R2KA 2GDJA 1SHLA 3KEFA 3FRHA 2FN4A 1J1ZA 3RRNA 1QGUB 1CUEA 1VKHA 4DMHA 4NYJQ 4LHEA 3RS4A 2ERXA 2PBFA 2FZ5A 4EKEA 4FEEA 1EQ2A 2JH9A 5AJHA 2HIHA 3CPHA 3ISVA 1O89A 2I22A 3C4QA 2DHRA 2PRIA 2KX7A 1X1BA 3D2AA 4IEFB 5FCDA 3RUDA 3EAGA 2HJHA 2YN2A 1E4YA 1FFCA 4ZZ2A 3AYXB 5LP6F 5FYQA 2EFCB 4XYLA 4O29A 2A35A 3OD1A 3FNFA 2OP1A 1NATA 3FBWA 2OCBA 4EUKA 2OWEA 5HZGA 1G3RA 2LV8A 4UE3S 3SSMA 2XGJA 2JPDA 4CM8B 4NCAA 2AI3A 2XV1A 5EHNA 2V3CC 5HEKA 1B6RA 1JJAA 3A4MA 3KKOA 2SICE 4INPA 2H4WA 2QOEA 1FFWA 1G66A 2XNSA 3K53A 2C57A 1OREA 5EESA 3S44A 2X8BA 4PG8A 4UFPA 2WWWA 3ZOKA 3VJRA 1OMOA 1GV0A 6AT1A 1MABB 2B6NA 4FZVA 1R0KA 4D3FA 2ZB8A 5BWBA 4NYMR 3BWCA 1VLJA 1PG2A 1LFDB 1ZNXA 4AZTA 4B6RA 1P7VA 2EP8A 1E1MA 3L8GA 1N6HA 2UUPA 4I4TA 4TYWA 1F0PA 4UBIA 3B8EA 2Y1FA 1ORHA 1XZEA 3IRVA 3K1TA 4TSFD 3ZH9B 1A0OA 1P1HA 2D1RA 2G7ZA 2QI9F 2UZAA 3BX1A 3DEZA 5HOQA 3QX7A 3WJAA 4DR3B 4E5MA 2H5IA 1GXSB 5F5LA 1FJ2A 2AXQA 3CVWA 1DBRA 3M1LA 3Q10A 3H2GA 3C6ZA 5TNXA 2ZR7A 3EVAA 3H16A 2YHUA 2R6FA 3QYAA 4IVNA 3WLHA 3HXQA 2C2GA 1AURA 2PXCA 3QKWA 4LOKA 4FDTA 2GO1A 5JMOA 5KKCA 4U7GA 5LM3A 2FPKA 4NNJA 4HJXA 1QTQA 3W3AD 1O94A 4KIFA 5H68A 4OX9B 2O7QA 2J0QA 3Q5DA 4HXFB 4RD6A 1LTQA 4S1TA 1N78A 2VK4A 5HBRA 4C2BA 2FZVA 2AGVA 1W5BA 3K9NA 4G36A 1GTVA 3VOBA 4Z7JA 1H8HA 1W4LA 2ZCUA 3HI4A 1I0AA 1CRZA 3A6KA 3C2QA 3OF3A 3V3KA 3VR6H 4BP1A 2XHZA 4KRXA 4BLSA 2W6ZA 1SVLA 3TD6A 3UA4A 3FUTA 1UKVY 1HYBA 4FBGA 1U90A 3CG4A 2FSIA 4ZT5A 2W4MA 1AQYA 4ARZB 4JEHA 3VYSB 4ERXA 3LLUA 2WWVD 2X5JO 3R24A 3PLRA 1XT6A 4GGPA 5D5HA 3V8BA 2ZZNA 3CRRA 5JISA 1EWRA 13PKA 3AT1A 1XYVA 4DARA 5LUBA 3ROFA 3TJMA 3V2GA 2O3JA 4NX2A 2QSJA 1IN5A 2YNMD 1QIIA 2H1VA 4NZZA 4R1LA 4W7SA 3SIWA 4G2NA 1GG5A 3HVRA 1FP1D 1XGKA 2AFIE 2AWNA 3GJTA 5LZ8A 4GWLA 5LLTA 4QVGA 5I7SA 4Q4AA 4AO8A 3M2TA 4QYXA 121PA 3CUTA 2J6BA 1QR6A 1LU9A 1WQ3A 5FFFA 1XCBA 3DF9A 4TMWA 1P3JA 2UVQA 3LSTA 5A5EA 5I7VA 4RTRA 2ZRQA 3EGVA 3PPIA 5CLQA 2WJ6A 1L5SA 3X44A 1ZA2A 1E2FA 4TS4A 5K99A 3ESDA 2XIJA 4YJHA 2XSZD 3FDIA 1KPGA 3EC1A 3QNMA 4Y1RB 2ID4A 2W2LD 1P2GA 2ZB4A 2ZWAA 5EHGA 2WIDA 3IKTA 1IXYA 2QZJA 1L7AA 4EG3A 3MHTA 1GR1A 3B53X 1NKVA 3F9CA 3NTOA 2OQRA 1XXLA 2YXBA 3AXSA 2GZRA 3DHWC 3NBYC 3CA8A 2HSJA 3FTPA 3NO4A 3TXAA 5EJEA 5LMCA 3EOBI 3SBOA 1KARA 1ZL0A 5LP1A 5DNEA 2P91A 4K3UA 4M8IA 1TK9A 4ASUA 4I1PA 4BVKA 3RNLA 2IXBA 1OBOA 3VH4A 2EF1A 1N7IA 4BKRA 3P9RA 4IX9A 5E9AA 5TPWA 2D8AA 1NOIA 2RGNA 2JIZD 3AY7A 1H2EA 2QX6A 2F1JA 3OCXA 2M6KA 1NYLA 1US8B 3QLJA 1VRCA 1CY0A 1QUEA 2CXTA 4KXLA 4R5MA 1V5IA 5