3U19A

Crystal structure of acylenzyme intermediate of de novo designed cysteine esterase ech13, northeast structural genomics consortium target or51
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
195
structure length
194
Chain Sequence
b'GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKAEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords artificial protein OR51
publication title CRYSTAL STRUCTURE OF ACYLENZYME INTERMEDIATE OF DE NOVO DESIGNED CYSTEINE ESTERASE ECH13, Northeast Structural Genomics Consortium Target OR51
rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 62
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3u19A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u19A01
1Q92A 3I6BA 3SKYA 4HGPA 4L6CA 1T5SA 2FI1A 1RRCA 1RDFA 1IWOA 1S8OA 1Z4JA 2B8EA 3M9LA 2DQSA 2P69A 2ZG6A 1WZCA 1RQNA 2FPUA 2HX1A 3CZ4A 2YJ6A 3IJ5A 2I6XA 4QJBA 3AR8A 2FPXA 2ZXEA 5AI4A 4DW8A 4ZEVA 2C9MA 1Z4OA 4UU0A 5AW3A 3L8HA 2CFTA 3KD3A 4YGYA 3AR5A 3ZWKA 5ALTA 3CNHA 2CFRA 1ZJJA 1NNLA 2W4MA 3A1EA 2BDUA 2P11A 3OCXA 5AM2A 5ALRA 3E84A 1ZS9A 2HHLA 3IB6A 3S6JA 2R8XA 3WK5A 1FEZA 3ZTWA 3PGLA 3K1ZA 3D6JA 1RLTA 3U26A 4RETA 3ZWDA 2FPSA 2O9JA 3WKDA 5AI5A 4UW9A 2VKQA 5AW5A 3B9RA 4AS2A 4J03A 1AQ6A 2D2VA 3ONNA 2ZOSA 2BY4A 1Z88A 2BDEA 2HDOA 3I28A 3QU7A 5AKXA 5AI9A 1XVIA 5AVXA 1RKVA 3MC1A 2WM8A 2YJ4A 4BKMA 2G06A 1ZOLA 3M1YA 5AVVA 5A3QA 3B9BA 3NASA 3TLMA 2FPRA 3UMBA 4JB3A 2GHTA 3OCVA 1X42A 4Y2PA 3WK9A 2WF5A 3DNPA 3ZVLA 3B8EA 3L1UA 2JAWA 2WF8A 5ALXA 1YV9A 3QUTA 4L57A 1ZD4A 1ZD5A 2JARA 3AR6A 5AVUA 3U7HB 5AW8A 1QYIA 3I1YA 5AKKA 3SD7A 2NYVA 3J7TA 5AM0A 2G0AA 4FE3A 4BBJA 3WGUA 4I9GA 2GFHA 3BA6A 1Z4QA 1YJ5A 5AM4A 3NALA 4UMFA 3QLEA 2RARA 5ALZA 1RC8A 5AW6A 1L7PA 4Y2SA 2CN1A 2AMYA 4HYTA 4YCMA 3SHQA 3GYGA 1RMQA 5IS2A 5AI0A 3A3YA 3UM9A 3L8GA 2FPWA 2YJ3A 5AIBA 4I9FA 5AVRA 3WK4A 1Z4PX 4OD0A 2G07A 4BEVA 3DDHA 2OYCA 2MU1A 3A1DA 4YCLA 3WGVA 4YCNA 5AI6A 2HOQA 1TJ5A 5FP0A 3ZW7A 2G80A 2GMWA 3MN1A 4F72A 2PR7A 4UMEA 4KN8A 4CNQA 1J97A 1Y8AA 5AK5A 4F71A 4AS3A 3AR7A 5ALDA 4UAUA 2QYHA 2OBBA 4Y2RA 1N8NA 1T5TA 5AK3A 2YN4A 2EATA 4NWIA 3WKBA 1VJRA 3WK8A 5AKZA 5AW9A 1SU4A 3SF0A 1NRWA 4UMVA 5AESA 3WK6A 4HGOA 5IT4A 2I55A 1Z5UA 5ALQA 2JAOA 2ZBDA 3OCYA 1U02A 1U7PA 1PW5A 1LTQA 3L5KA 4GXTA 5AKGA 4EENA 3OCWA 3QNMA 4DFDA 3R4CA 2I33A 3N07A 1RLMA 4NAVA 1K1EA 3AR4A 1EK1A 2W11A 1RKUA 2YMQA 3FPBA 4Y3UA 1U7OA 2ZBEA 4EELA 1QQ6A 5ALWA 3ZU6A 4BYGA 3P96A 2GO7A 2C8KA 2NO5A 5AHXA 5AKIA 3DAOA 3NAMA 2PKEA 1RQLA 1ZRMA 1XP5A 2R8EA 5ALPA 2C4NA 5AK6A 3OPXA 1RMYA 4KNWA 3SKXA 3F9RA 4HGRA 3HLTA 3N8GA 3EF0A 5ALGA 5ALVA 1U2TA 1TJ3A 1TA0A 4HGNA 2YMMA 3ZI4A 3L8EA 2I34A 5JJBA 1RLOA 4NV0A 5AKJA 2HSZA 3MPOA 4C4RA 3ZVNA 5AK4A 4EZEA 4IG4A 2FUCA 2ZBGA 1ZD3A 2B0CA 4KX3A 5ALOA 3L0CA 4MUMA 1L8LA 3OTQA 4C4SA 4PNHA 5ALSA 2I7DA 4Y2UA 2HO4A 3KDPA 3RF6A 2YFYA 4FFDA 3OCUA 1VJ5A 2Q5EA 5AIAA 3R9KA 3KZXA 5AW2A 1T9ZA 4CF3A 4YIHA 2EAUA 1L7NA 4UM7A 1MH9A 1TJ4A 5AM5A 4KX5A 3E81A 3U7GA 1SWWA 2FDRA 3BWVA 4CF4A 1KYTA 5ALNA 1Z4KA 3N28A 1RKQA 1U2SA 3QU5A 4G63A 5A3SA 2WF6A 1EK2A 1QQ5A 1RPZA 2R8YA 3KBBA 3QX7A 5A3RA 3QGMA 3FPSA 1L6RA 4G9BA 5AKHA 2P9JA 3ZX4A 3QU4A 1XPJA 3AR2A 2FUEA 3L8FA 5AW0A 1WR8A 4BX2A 4YH1A 2IOFA 2JAUA 1RMTA 4KNVA 4JDPA 4EX7A 2YMPA 1ZRNA 4EX6A 5AKYA 4BNDA 5AVZA 2Q4TA 5ALMA 4BX3A 3EF1A 3NANA 2B1QA 1TE2A 5IT0A 1ZD2P 3FGOA 3PGVA 4Y2VA 5AVTA 4C4TA 4H1WA 4O8CA 2HEGA 4FYPA 3WKCA 3W5BA 2O2XA 2B30A 2OM6A 1Q91A 3U7EB 3EPRA 2IA5A 1CQZA 2RAVA 2WHEA 4L6AA 3QYPA 4HGQA 3DV9A 1J8DA 4UATA 3WK7A 3W5DA 5ALJA 4OFZA 2HF7A 4Y2JA 3ZX5A 4UASA 5AICA 2NO4A 4MWOA 4NFLA 2OA0A 2EARA 5AW4A 2WF9A 3WKEA 2WFAA 3PCTA 3QUQA 4EEKA 5ALYA 3HYCA 1F5SA 4BNDB 3NUQA 2HF2A 5AVYA 1Z4LA 4Y2TA 1VFPA 5ALUA 4GIBA 4HAIA 4Y2QA 2YY6A 5AVWA 3FZQA 4UAVA 2W43A 2PQ0A 3U13A 5AI8A 2G09A 2Q4RA 2JGAA 1WVIA 2R8ZA 3L1VA 3QXGA 4BEWA 1Z4MA 5AW7A 1Z4NA 3E8MA 2MSNA 1CR6A 3SLRA 5AKLA 3ED5A 3IRUA 2IOHA 3EWIA 4XE5A 1L8OA 4YIKA 1QH9A 5ALKA 2YBDA 4UARA 4AP9A 2I54A 1WPGA 3WKAA 2RB5A 2B8JA 3NIWA 3A1CA 2IYEA 2B82A 4UM5A 3L7YA 5ALLA 2WF7A 1N9KA 3ET4A 5AKEA 3OCZA 1L7OA 3W5CA 3R09A 3PDWA 2HI0A 1YDFA 2C88A 4QQFA 4XQ0A 4KYTA 3E58A 4B6JA 4DCCA 4RESA 2ZBFA 3ET5A 2P27A 1L7MA 4OHFA 2HCFA 5AM1A 2C8LA 5ALIA 3RFUA 2AUTA 4E88A 1QQ7A 4CF5A 2B1RA 2AGVA 3ZVMA 3FVVA 3QU2A 3ZUPA 3KC2A 2X4DA 5AM3A 3L0YA 4NABA 2G1AA 1SWVA 1LVHA 3U19A 3I76A 4IFTA 3FM9A 1Z4IA 3W5AA 2IOFK 2RBKA 2AH5A 3KOOA 4UMDA 5ALFA 4XPZA 3NRJA 2GHQA 4ZEXA 3UMGA 3L0BA 3QUCA 3SMVA 5E0OA 5T41A 1JUDA 4OCZA 1YS9A 5AVSA 3AR3A 5ALEA 1NF2A 1YMQA 3N5KA 5AVQA 3U7FB 4ZEWA 3MMZA 3AR9A 2YMLA 4UU1A 3N1UA 4Y2YA 3UMCA 4Y2XA 4BX0A 4CE6A 3VAYA 2FEAA 2CFSA 2ODAA 4XOUA 4DWOA 1YNSA 5ALHA 4J2TA 2QLTA 3QU9A 5AW1A 2G08A 3ESQA 3QUBA 3ZTYA 1Z5GA 1O08A 2YJ5A 1S2OA 3ESRA 1O03A
chains in the Genus database with same CATH superfamily
3F3YA 2D7DA 1GEGA 3OQIA 3HBLA 3I6BA 3OFNA 1GVNB 1L4FA 3GUHA 4AKSA 4Q6BA 5JZ9A 2HPZA 1ORTA 4JJEA 1VL2A 1A1SA 1E4EB 1G4HA 3KJEA 1E7MA 2NNWB 1QF6A 5GONA 1OXUA 1UMBA 4G07A 5DNEA 1E66A 3JQGB 4WXRA 2V7XA 1QV9A 1DLJA 3V9AA 2XD9A 3CRQA 3SOZA 2N42A 4G89A 5DBOA 1RP1A 5AP9A 4EG1A 5B7PA 4G36A 3ZHSA 3NTQA 5AW3A 2AZXA 3EOAI 1MC8A 2WT9A 4LE1A 3EVNA 1E1KA 2FPGB 3L04A 4YFVA 1Q57A 4UREA 1MRNA 4CLOB 5CG1A 1FFDA 3RYIB 1JVSA 1K2WA 1NR7A 3BWXA 2GXQA 4TSKA 1I8TA 3EEIA 5ALRA 4OQYA 3V8VA 2OZKA 3AETA 4HH1A 4AW9A 5KNCA 1FDTA 3CINA 1EBFA 3TTYA 3WFJA 1J2JA 4FT2A 4RZUA 3ECCA 4NJMA 1TO2E 4CMKA 3K5PA 3ETCA 3X1MA 5IT9A 2Z4TA 1KQFA 3PR2B 1WXWA 1N32B 2C5BA 3N0TA 1X1CA 5FDFA 2BSQA 2B61A 4TLMB 1WXHA 3UQYS 2QRVA 4RY2A 1BWQA 3BD7A 1J2UA 4O63O 4BGUA 2PH3A 3COYA 1YS7A 3VU3A 2AQ8A 3FZNA 1E1QA 2QVZX 2XMPA 3WVNA 5LP6F 3VU0A 4MVJM 3UMSA 3QBPA 3F2VA 3F7MA 1P3Y1 3D2LA 4B7XA 4L5CA 3TS1A 2I6TA 4C2TA 1FLDA 4CU5A 4RD6A 1IH8A 2EP7A 4JI2B 4DLWA 5K2OA 1CY2A 1UZLA 3EIFA 1RTTA 3QF4B 1Z8FA 4HNAB 4KCGA 4BNHA 1H8ED 4EHFA 3ELUA 3MJTA 1BZYA 1KMCA 1FBTA 1FS6A 1QHEA 2Y8EA 3IIJA 1E3TA 3NCHA 4MEBA 4P34A 4XWYA 2PE5A 3ZWBA 1RKVA 1S96A 4WDQA 3SQOA 3UK6A 4E30A 2G06A 3N76A 3REOA 2AHOA 1I4DD 2NG1A 2ZSDA 1O4VA 3UPDA 2HQOA 1OBVA 1ETHA 1XX6A 2H4ZA 2I2WA 2VDRB 2O20A 4JYBA 4KWIA 2FPRA 2H1WA 5KYUB 1N3LA 1X42A 5U9CA 5F9MA 3VR6D 5JRZA 5KOHB 1NM5A 2VP2A 3RFXA 2VRBA 5E6RB 2CLEB 4ZT3A 4E31A 2GPSA 5EA2A 3QEAZ 4BLPA 1TMOA 3HKBB 1ZD4A 5F7XA 3N3BC 1YOVB 3FHLA 1EFLA 2AKAB 5C8XA 5FWAA 3ST7A 3ZV7A 1MP0A 1PKEA 3C48A 3D31A 1R9GA 1XZPA 5KAPA 4BLWA 4EABA 1KPGA 1UZMA 2NYVA 3J7TA 2QTAA 3BMNA 4ISBA 4B4UA 2Q6LA 3HFSA 1JZQA 3AGQA 5CDUA 5J4VA 3ZHRA 4I9GA 1TA9A 4EHHA 1X1SA 1Q19A 3OZBA 1K8XB 3Q3HA 1GTJ1 3LIPA 3NORA 1UC5B 2VZ8A 4YROA 4AO6A 1YUMA 3IT2A 1DTSA 3SHWA 2DHDA 1N0VC 5EAIA 1W93A 4A8JB 4IPTA 4XWWA 5DTMA 1U1DA 1P73A 2CNLA 2ZUFA 1YZ3A 4HYTA 1VSBA 4XDYA 3RASA 5HKKD 4J0EA 1AN9A 5DNUA 1G18A 3NEJA 4N5HX 2WD7A 2DFDA 5BPFA 3G7UA 3DKVA 5ADWA 1WCXA 2XRYA 1JECA 5AIBA 1II8A 1W6RA 2JAXA 1C0PA 3OKCA 3OICA 3V6MA 3VKVA 3WGTA 1TTPB 1I30A 3KE8A 1KP9A 2JFGA 2C2ZA 1IG0A 3I37X 3TWOA 4RQBA 1I0ZA 1A2OA 3WOVA 3AVXA 1LPBB 2P9EA 4OAOA 4R7ZA 2AJDA 1QTQA 1F1BA 1WMDA 2AX3A 1J9GA 2C1XA 1PJCA 2GMWA 4TRNA 3UHOA 1CW2B 4J0JA 3TLXA 4OH7A 1KBQA 3FB1A 3GA7A 4BNZA 1GFZA 4XARA 1LDYA 1URPA 3L7DA 3P20A 3SC2B 5DGIA 4ZREA 3UOGA 3WKBA 3WYNA 1FMCA 4M1EA 1MENA 1KMHA 1T5BA 2CNWD 3WQQA 4HAWA 2VQFB 3K9GA 1XWWA 2GI4A 1NYTA 3FDZA 3Q0IA 5LMUB 1W5AA 2VAMA 2OQIA 2J3HA 2AJ8A 1PGOA 2I80A 1OA0A 5JY6A 2HK6A 3RRFA 2ZJFA 1D9ZA 5J2UF 3BZBA 4BGIA 1L5FA 3NHLA 2JHPA 1EA7A 3A26A 3U3JA 4A27A 5GIOE 1F0PA 1C8BA 1JAXA 1IJFA 1BU5A 3TIFA 1BHO1 3OCWA 4BCDA 2ZZMA 2AN3A 1FNMA 3G1WA 2PL9A 4L16A 1VL0A 1NV9A 5K6RA 3CZRA 1HFEL 2ATVA 3D64A 4R2WA 5HRCA 5J4HA 1T35A 1SUCA 4MMZB 1XD8A 3SYTA 5BUQA 2CFCA 3FPBA 3OIGA 3FOWA 3SF8B 1KETA 2ZBEA 4OLAA 2FRVA 2XTJA 5FPHA 1DWPA 5B53A 1ZC4A 3AW8A 2GKOA 2WFMA 2OENG 4XX0A 3IOMA 4M7PA 2V59A 1HI9A 3WNBA 2E5FA 3UICA 3QY0A 4Z7QB 4LJ9A 5ECYA 1N25A 1JLKA 3I01A 5E9JA 3RSSA 2PZFA 1TOAA 1B15A 3KSDO 4QATA 4TT3A 3COWA 2ENUA 4LISA 2A0UA 4XR9A 4ZVOA 5JR3A 4YRAA 3C41J 1VI6A 4J0HA 3NBKA 3KXDA 2CXSA 1ZM2A 3GLSA 3JSAA 3K2QA 3OIDA 4QXQA 4QDUA 4HNUA 5JCXA 1C3CA 2C82A 3LC2O 4G5YA 1GV1A 3MVEA 3T9AA 4CKCA 4P92A 1IHOA 1JFFB 4Y0VA 4J6EA 1LUAA 5FT9A 3IAFA 8MHTA 4AKIA 4MA4A 1TQ8A 3W79A 3E4CA 4U5XA 1U2TA 4K9QA 4RV5A 1XT6A 1C3JA 4UAJA 1LB1B 1G9TA 2VDPB 1CJSA 1U1CA 3E53A 3CKMA 4HDRB 1E3DA 5AVJA 4C4OA 4EJSC 4EKEA 3R7LA 1UINA 3NOQA 4HEQA 3K6JA 3ZIDA 5ICMA 3HGMA 2UUOA 1TK2A 2CUNA 3CEPB 1P77A 2X4LA 2X8LA 2W37A 3CKKA 1BH6A 1EFTA 1JXAA 1OXVA 3H6KA 1I7LA 1F8XA 2BHRA 3GMDA 1YRYE 4IJ5A 4LGVA 4Q7KA 5EINA 1L7VC 1U0TA 2HPVA 3KDPA 4QBIA 1ECJA 1UODA 3HBNA 5EZYF 2Q6IA 2P77A 1E9SA 4TV9A 1SVWA 3E48A 1E4OA 5IAOA 3M4NA 1F0YA 2Q5EA 1LSJA 3PP8A 3BIXA 5SZKB 3CNOA 3DPIA 4LTDA 1WG8A 1P6QA 2QWXA 3KZXA 3KPUA 3H11B 1G20A 3TH5A 3I4FA 4RH0A 4G0PA 3GJRA 5K3OA 1L7XA 3I39X 1PUIA 2IIQA 4K03A 4X5OA 3VPHA 3PS9A 4Y6RA 7REQB 4NCNA 1U8AA 2PZAA 3HPRA 2P2ZA 4ZO9A 2IEYA 4HH4A 1GDHA 4BPBA 3PNLA 2YWRA 3ESCA 3UW3A 3I61A 2ILTA 1RKQA 3CTMA 1C0IA 3FNIA 1Z6GA 1KY2A 5EWMB 4U7FA 3BX1A 2QLFA 4JMPA 4BVHA 3O8NA 1ABBA 3DF7A 3FZEA 1DUSA 4HDMA 1I13A 2PBFA 3G9QA 3V4VB 5C1DA 3NYWA 4XYGA 3ZHTA 4I50B 2QSYA 3ZXXA 3N7UA 2Z8YA 2XUGA 4G9BA 4MR8A 1SU6A 1YB7A 3QVSA 4U3JA 4F9FA 1U1FA 4E1BA 1ZESA 3C8TA 1IFXA 1K3FA 3P0JA 4ZAYA 4E09A 4X41A 2XB9A 5FBZA 3AHJA 3WSVA 1OF1A 3HUEA 3TRDA 1SIUA 3LCJA 2D59A 2O8CB 4YUWA 5D01A 4D9GA 3OQMA 1R64A 2IX9A 4GKJB 3EZYA 3BRWA 2QHXA 1FFGA 3V8NA 3BXZA 4GM0A 4KRGA 4QA9A 1TUBB 3V4ZA 3FKQA 3ZWVA 4MYRA 3GJ3A 1K8ZB 2DFVA 3VR6H 3I2YX 3IPRA 4MW0A 3RYFB 2QJRA 4K8OA 4Q9AA 2P0AA 4M9XA 3LFUA 4GZMA 4EF6A 4TGLA 5A9RA 1J70A 1ATZA 3G68A 5FORA 4O08A 5CVVA 5JD4A 3CVVA 2R62A 2J3JA 5ITVA 2FB9A 1PK7A 2O2XA 1UC4B 3N8HA 3KDAA 1NL3A 1FDWA 2DUNA 2IBTA 4FHDA 2GN9A 3BMQB 4HVLA 5K0BA 4NONA 4KDRA 4IDBA 4X94A 2OXEA 2P5TB 2RGNA 3ESXA 2FG7C 4YLEA 3QPAA 1CJUC 4X97A 4JBNA 4F06A 4GQBA 1AKRA 4F3TA 1IULA 3AWDA 4LY9A 3C15C 2H7CA 2HFJA 3RARA 4OG2A 1RYZA 4PY2A 5G0UA 3U4GA 5LQNA 1R5JA 3L6OO 4JJ4A 4AUEA 1EEHA 2IBSA 3OSZA 1RABA 2JBHA 3H17A 2PS0A 5KKAA 4YS6A 3G6KA 2A78A 2OXRA 4D8WA 2HMTA 4EGAA 4A7PA 3GD5A 2JVIA 2ZBQA 1Z7GA 3SXUA 3RVJA 4KDEA 4R9UC 4ADLA 3WGIA 1YH3A 4OJNA 5CK5A 5ALUA 5IF3A 2Z6QA 2MTBA 3UJNA 4GIBA 3TYXA 1NV8A 5JYCA 3B3JA 2QZZA 1IQ0A 1TYCA 4RJIA 2CFIA 3G8CA 5FI5A 1KKUA 3SN6A 3P52A 3DXZA 1H6DA 4F9EA 1D7AA 2Q4RA 2R7LA 2R8ZA 3B13B 4RGVA 3DG9A 4RH1A 2ZI9A 5D5HA 4ALKA 4S12A 4C4PA 5T64A 2KYRA 5AW7A 5EJ8A 2JJQA 1P74A 4F04A 3KELA 4AX8A 3CRNA 3MLAA 4Q1DA 4BBPA 2VHWA 4AI6A 1QH8A 1G8KA 3GFPA 3O26A 3CZQA 4YDQA 3CUWA 1WZ2A 4QQRA 3QWHA 4PX2A 3AP1A 2RJ3A 3EGDB 3GA5A 4MYHA 4MV4A 2DWOA 4OQMA 1ABFA 4XDGA 4XPIB 2WG1A 1WPRA 2XKJE 1OFIA 2XBLA 3LLSA 3NC4A 4M21A 1GGFA 4YRLA 2IHBA 2OPHA 3ZE9A 5IABA 3VU8A 9LDBA 1DAEA 2HRDA 3HDGA 4DGSA 2ZI3A 5J40A 2OQ2A 3GT3A 1E3JA 1Y1TA 5JTTA 3O8CA 4I5FA 4R54A 4PFKA 4CRWB 3DDOA 4J2HA 1E5XA 5F2OA 4JITA 1K97A 4UM5A 2P3LA 2XMGA 1N5JA 2WNSA 1N9KA 1DBVO 3LY8A 1UBCA 4G8DA 4HPJB 4HTFA 1KY3A 5C32A 2OR3A 1EWQA 3U3DA 1EM6A 2J5BA 4C08A 4MJLA 1DUVG 1I94B 4NI5A 1RXVA 2NVUA 5F52A 2BR3A 4P8RA 4DVJA 3RSOA 1VLHA 3GXBA 4KWCA 4CMJA 1E6CA 4YUVA 2DUWA 4TOIA 1V5EA 1DC4A 3KAKA 2IDKA 3E58A 3GGOA 3TW4A 2AD1A 4I50F 2JZCA 3Q9UA 4KXQA 3WLMA 5A9SB 2BCGY 3KLOA 1O89A 1L7MA 3E9DA 1LBIA 1ZCZA 1TLTA 1PJLA 1UXOA 1XRPA 2AJCA 3FPFA 3L8DA 3OSUA 4MVYA 2FMKA 1CUFA 2KI5A 5DBFA 3PIIA 1I3KA 1RP7A 3VPAA 4JR1A 1I36A 1XELA 1HDCA 4PIMA 1J07A 4E1AA 3BFXA 1UDXA 5KYNA 1XAJA 3TTWA 2WFLB 3TSYA 3QU2A 3S27A 3W4KA 3CNLA 2GZAA 4KB5A 2A84A 1V25A 3E9QA 3ITNA 4KPFC 3R7FA 4A8JA 1GTZA 4MSUA 4YXFA 1D8TA 1GUAA 2G67A 2QTNA 2H5LA 4B7CA 3G5MA 5CW1A 3CF6R 1Q77A 1ONSA 3IAS1 1IY0A 3I3OA 4ZJPA 3LRXA 3OX3A 3PITA 1E6LA 2ZPAA 2E4UA 3L1HA 4BX8A 4YUXA 2C00A 3EOZA 4H16A 1JIXA 4Q3EA 4ND8A 3Q72A 2PAAA 4AMBA 1WOYA 1JPVA 5I5EA 1TZ2A 2X8BA 3OCFA 1YZHA 2QTCA 2FETA 4I6JA 4RZSA 2ICAA 4US0R 5F4BA 4DMFA 3NDBB 4MUKA 2B9VA 4BP9A 2NZ8A 2ZBUA 2P3OA 3GFBA 2VRNA 2W2MA 2FW0A 4YRJA 3AR9A 3ZEIA 4Z51A 1FF9A 3VBCA 3A4NA 2IPNA 3UMCA 5LB2A 4DTIA 4FHEA 2LP4Y 2FUNB 4HEA1 2H65A 1I0AA 4IIYA 1A71A 1KHTA 2ZSAA 1XTTA 2H3EA 3G0OA 5LOVA 3TUZC 1PJRA 3MT7A 4G0ZA 5K8VA 1VE5A 3ITEA 3I2FA 4G97A 1H2BA 2GZ1A 4RFSB 4DWOA 1KMQA 1AKUA 1OWNA 4J2TA 1RIFA 5EPUA 3H3XA 4NF2A 1QK4A 1QP8A 2TMKA 1D6JA 1YZKA 3GWGA 4LJSA 5ENDA 1EK0A 1WU8A 2FMIA 2ZANA 4HO1X 2BFEB 4UEWA 1EI9A 3NRCA 5HUJA 3GLHA 1LTKA 2Y4OA 3OI7A 4PG8A 2BI4A 1QTNA 1R18A 2COUA 1JSXA 4REOA 3VMMA 5K8UA 4P22A 4CMCA 3A9CA 1TZCA 2H4JA 4PRYA 1XJ0A 4J4TA 2IW1A 3RGGA 4R7TA 1ZR4A 4CMAA 4XCQA 2J9FA 4OM7A 1E5TA 1QRDA 1MNAA 1GJRA 2JH8A 3T9EA 3R6VA 1MEEA 3ZIAD 4C76A 1S2LA 2CMHA 2IQIA 3I04A 5IAJA 4BE7B 4DADA 4EYKA 2I6XA 2Q99A 2Z8YM 3AP2A 5FTKA 3UOWA 4KV9A 1C7FA 1QMPA 3E9NA 4FCWA 4UPDA 2SCUA 3WL4A 3EC7A 3TJMA 2NV0A 1QWSA 1PSDA 1MJNA 4F97A 1U1GA 3L8HA 3IT3A 5BORA 4LZPA 4MTCA 2YQZA 5BSVA 5I4IA 1JEYB 3DOOA 3FTDA 3KRTA 3B5JA 2R8RA 3ZWKA 3NPAA 3JQQA 1AMOA 5L4SA 1EAMA 5FR2A 1USWA 3VKGA 1XD2A 2XQFA 2VT2A 3AMVA 3S6JA 1T4DA 4OREX 1OLSA 4WZZA 5IJ9A 4IXWA 2PFMA 1B6GA 1XRQA 1RU3A 5LP6A 1JT9A 4EIWA 1J1UA 1V3TA 2QG4A 4C3VA 1H8EA 1PR0A 2XWPA 3I9OA 1WA5A 2DH6A 2XF2A 3AFIA 5CDHA 4JWTA 3HCRA 1GPKA 4RETA 1VHLA 2E4YA 3A9VA 2DPHA 5AK0A 1JSWA 1D2HA 1CY4A 1U0EA 2EIHA 2JCXA 2R6R1 4X71A 1NLUA 4EFMA 5JIBA 2XMCA 4B4DA 1V7PC 1KEVA 1EVYA 2POCA 4J3NA 1D5CA 2F3PA 1EP1B 1Q0SA 3AKEA 3I92A 3G2QA 3IC5A 3W8NA 1TADA 2A92A 3LL4A 3ILVA 1WULS 2P8SA 3R6GA 4Y0NA 1C1HA 3D8UA 2KW5A 3HJNA 4KMSA 4WOCA 2HVGA 3E7DA 4JR2A 5CVEA 3PEWA 4R1UA 2BY4A 3B1VA 4BLSA 3QX3A 2PUGA 4BQPA 5AKXA 2ZSEA 3FBWA 4BEBA 3EQ7A 5LXTA 2ZXUA 4Q47A 4BBZA 2IUEA 5A9TA 3DOJA 4X1OA 3HJUA 1UFOA 4M1YA 4TVBA 3RF7A 3SSNA 2XODA 2HBQA 3MWEB 4Y2PA 1U2RA 4JJ8A 4ENQA 2Q3DA 1G8AA 3GN1A 5JAPA 2IHVA 2CVZA 2BT4A 3KZOA 1EBBA 1YQXA 3ENKA 4P7GA 4TKVB 3X43A 4CKBB 1ZD5A 4ADMA 1JB9A 1HF3A 3FWPA 4OMUA 5GJCA 1S02A 1Y8CA 4L07A 3RYHB 1JZTA 2SKDA 4FMPA 4F2DA 4Y7DA 1GT6A 2V7VA 3B6JA 1W73A 3ZDYB 4XQEA 4XJXA 1FUPA 3OQJA 1Z0FA 3CIFA 5DHAA 3T7JA 3QEJA 2AF3C 3KV1A 1QV6A 3K6RA 1G64A 3QLEA 3H7AA 4IIDA 3U7QA 4AN0A 2DERA 5IW8A 3HS3A 3WIDA 1G63A 3NJ4A 4KIWA 1B2RA 1SUIA 1DAMA 5JI2E 4U2BA 5EKXA 2Z8ZA 3SHQA 2X9LA 3ZJVA 1E4EA 1G6OA 1U2DA 4NJOA 5AI0A 4F1JA 2H7XA 4UPEA 2FCAA 5IJAA 4EJ0A 3T3DA 1PNVA 5DT9A 5J63A 3WICA 3DFUA 2CNWA 2ID7A 2ZRQA 4UZSA 3WK4A 3I12A 4PRZA 4CCWA 4DR7B 3K6SB 1C14A 2QRUA 3B6KA 4O5AA 4C0XA 1QNLA 4GXQA 3ZJYA 1XZNA 1E5LA 2FPGA 5G53C 4JP8A 1G6KA 4MUFA 4WADA 4V0LA 4AZ3B 4YA6A 3RRZA 3RYIA 4DBVO 3P2JA 5LSAA 5CT4A 3SHOA 4QPPA 2INGX 5AK5A 2QZSA 5E2BA 3PYXA 4L4YA 2AS0A 1T2DA 1R8QA 1Z0UA 2EW2A 4GE3A 4XB2A 3NBFA 5B5SA 5J2UA 1YMUA 4RVSA 3NHAA 1QKKA 1FXSA 2Q5CA 4F91B 2JKYA 3A2MA 1DO0A 3VJLA 2HHJA 1YHNA 3V7UA 3RRJA 3DBOB 1A8HA 1SIBE 5J47A 5L3ZA 3JVDA 1KDPA 1VQ1A 3CCFA 2LR0A 1NVBA 4WBSA 4ZTBA 2VT6A 2RHGB 4WN9B 4W8HA 1G5TA 4GX5A 3TIIA 4BLUA 2OORA 2DHQA 3A70A 1SM4A 2J7PD 1JQLB 4PHFA 2XTZA 3WWEA 1Z47A 2XUPA 4GT1A 3SYMA 4IAOA 3QF4A 2MYUA 4HNAA 4QNNA 4BXOB 3H5OA 1A2BA 2RD2A 3D54D 2X0IA 3UA4A 3K09C 3PPWA 3AF2A 3A7EA 4RA9A 3WRXC 3NHJA 3QI7A 4RVNA 2YMQA 4PGMA 4OP3A 1MGPA 1YJBA 2PSEA 4HWOA 4Y3UA 2QQ5A 1EE9A 3T3PB 3UUWA 4LDRA 3S8YA 1G3IA 2CNBA 3D8NA 3S44A 2OK7A 4NFYA 2C4VA 1FU8A 1KYZA 5ALWA 3NAZA 5BRNA 5KYUA 3KLBA 2D8AA 5KOHA 2D13A 1L5GB 1RI1A 3CNQS 5AHXA 1QB7A 5E6RA 3ASZA 3LP8A 5KVSA 1TT7A 2GBIA 2OBNA 1JIKA 4PYNA 2O5EA 4GC5A 1J8FA 1U9CA 3EVEA 3HKBA 2WBLC 1PYOA 1VSUA 3LC7O 1YOVA 5TV2A 3UMRA 2XXAB 5C4IA 5H1YA 4XDZA 3WTCA 2N9UA 1U8CB 4NG4A 5E9AA 1W19A 4RMIA 2X5NA 1R66A 3GHHA 1KZHA 3I0MA 3R5SA 5IXSA 3WIVA 4AKGA 2G1PA 2BJHA 1RJFA 1XTVA 2ZUDA 5EGNA 2E9FA 1W35A 2XT0A 3NTOA 4PSKA 4QXRA 4ZVTA 5TQ0A 4JOSA 8OHMA 2GYVA 3MIIA 3EODA 2Z8XA 2GCOB 1F8UA 2YMMA 2Y1CA 1OC2A 3K70D 4G3XA 4NY1A 1HT0A 4HFJA 1RI2A 4HS4A 4XRRA 4C88A 1Q3HA 4YALA 2NPOA 3ANYB 1DEOA 3B9QA 3GT7A 3T3EA 2O1SA 3OTHA 3KNZA 4RF4A 3UOAB 1HY1A 5EZYA 4O4HF 4EAAA 1P5JA 4AFNA 1W52X 2JIRA 2NUAA 2NVOA 2VK4A 1XK7A 3B5IA 1IZ9A 3EY9A 1AVTA 3OESA 3OZAA 2PGLA 3PT9A 2VTBB 1DC8A 3ZHZA 2YINC 4FYYA 3FNFA 4R71A 3WLJA 4TRJA 2HO4A 3HE3A 4RPKA 3GT0A 4KK4A 3KUUA 1MB2A 2OXFA 4CIDA 1WLSA 2NQ2C 4OIMA 4IV8A 3HJGA 4B0PA 3T1TA 4HYEA 1OBOA 1SBQA 2JK0A 2QVLA 2HEIA 1BS2A 2FSHA 4V3CA 5GVSA 2AG5A 2VSNA 1QC5B 4KLRA 5KSZA 4XH9B 2C78A 1DWOA 3BSYA 3MBIA 3ONWA 3RG8A 4BATA 3NNDA 5B3JC 5IVHA 5CGZA 3ME5A 1OAOC 3X44A 3QV1A 1SWWA 3BH6A 5CM9C 5EE5B 4DIKA 4NYJQ 1T1SA 1UCFA 2RHDA 3M6WA 5L3VA 3MCZA 3CMMA 1Z4KA 3ABSB 3OJXA 4RPHA 1M0WA 3PC8C 5EWJA 3CCCA 3U9LA 1P7ZA 4C1BA 3A05A 4PAMA 1M2OB 5EUCA 4EQ6B 3QE2A 1JJBA 3WIEA 1ORDA 3ETNA 4FHFA 2J07A 4INJA 1WKVA 4RPGA 4A2WA 4WBNB 1HTBA 3KXPA 3RBXA 5IXJA 1E1RD 2IYOA 4XIIA 3R7WB 2VNHA 3GMSA 2E49A 3H13A 2ECOA 4DOMA 4C7JA 3LWZA 5EJ7A 5TT0A 1M33A 1DOZA 4IEFB 1R6DA 1F5NA 3RW9A 4CQJA 3DWFA 1GU7A 3HKEB 3HDHA 1Y3AA 2VOJA 1DX9A 4FFBB 1RHJA 4WACA 5DDIP 2EBWA 2XBUA 1YL7A 1U3DA 4YQEA 1WCIA 5K05A 1Z73A 2NVWA 2XGGA 4L9SA 3K16A 3GPBA 4LIPD 1TFUA 3SBOA 4AS1A 3R6QA 5EHGA 2DUUA 2EC5A 1MDFA 1IZ8A 2FQWA 5DHFA 4F1KA 2M6LA 1QK3A 3IQGX 5IK2D 1YQEA 1VG1A 3LX5A 2WMDA 3WNDA 2NLOA 2JIBA 3KXLA 4M55A 5C31A 3AQ4A 3RWOA 2OFOA 5HOEA 1AGRA 3U7EB 4EB3A 4N8EA 3ADCA 1KVSA 2IU3A 3L7OA 1M72A 2ZRJA 3G6WA 4L9RA 1DP4A 1JKMA 1GA6A 1CUBA 1QHNA 1XEXB 2ESRA 4YP6A 4BWVA 4KQFA 4ER6A 4XWOA 3SU8A 2BPOA 1DAHA 3KYCA 4AF7A 1EH5A 2IXEA 4COOA 4LE0A 1LF5A 2CJWA 3CSDA 3KT6A 1E0JA 3GRCA 1C7ZA 4LSWA 3B6IA 4LUCA 4B45A 3NT2A 4AJEA 3BM5A 3PFHA 4D9FA 1QYXA 2YHAA 4HWTA 3TOZA 4K6KA 4QJ3A 2C5SA 2ZM6B 3WFZA 2AYYA 4HDRA 2FGJA 2O3UA 1OI3A 2FW6A 1XA0A 3FUVA 5KQRA 2EFDB 2FW8A 3FTPA 1DUIA 4H77A 3OEHD 4UUQA 4UTPA 2EV9A 1E7SA 5FI3A 1RXIA 4WRRA 2AC2A 5J2TB 4IWXA 4N0MA 3TPZA 1AX9A 1TDJA 1ZK4A 2CLLB 4PIPA 1ZDMA 3VU9B 4AG6A 3FZQA 1JDUA 1KOGA 2PQ0A 4R8MA 3QXGA 4PRLA 4RKWA 4NOJA 3UQZA 1GL7A 3DE0X 5E38A 2V6MA 1Z4NA 2I66A 3B1KA 1OVGA 2Q6KA 1GSHA 3IKJA 3LF1A 1E2LA 3N8NA 5HQTA 2H1LA 3H11A 1XZGA 3ETGA 1WF3A 2OVFA 3EBOA 2IOHA 3TRIA 1ZRHA 5ERGB 3GH1A 3HKCB 3QOWA 4MLZA 3VVMA 1VE7A 3JQCA 5WRFA 3EAFA 3ZBQA 3B70A 1NI4B 3GEHA 4PHHA 5D1HA 5DRYA 4YPOA 5K4GA 2CMDA 3JY6A 5KINB 4IYJA 4N8DA 3PNPA 1WW8A 2YC2C 3G8AA 3ROZA 1K6MA 4EO9A 1HZJA 4G41A 4IFBA 4OHPA 1Y3IA 2WB4A 1R2QA 4ZRNA 3QRWA 5BSUA 5ALLA 1N5IA 2D1QA 4LZJA 1GZDA 1SGWA 1TLFA 2E6KA 3A6LA 2OFXA 3IALA 2OHXA 2H1RA 3NTRA 3ONEA 4Q4AA 3CN9A 4I50A 1M2NA 2F1HA 2IYAA 4LYFA 1SCQA 3OBBA 4KQHA 1VMKA 4Z3DA 2VPTA 2R87A 1K3UB 4WY5A 1U5AA 4UOEA 5KEIA 1WB6A 4YUYA 5K8CA 3GRYA 2EF1A 3OP4A 1M1YE 1MABB 3PTZA 2HHCA 5G3ZA 2QRPA 4WBNF 2O8CA 2OGWA 4D5EA 3C14C 3USZA 5P8WA 3OQVA 5CIQA 3LBHA 2Q0QA 2JGKA 1PFQA 4YJGB 1TUBA 3VSAA 4H7EA 4KQXA 4GMGA 2GNOA 4IGIA 1DC3A 3IJEB 4FKBA 2O2HA 4TZ0A 3K0BA 3RYFA 3QUSA 3I8SA 3LDGA 2GARA 1OE0A 4IGEA 4M60A 4OJQA 4W8OA 5TT1A 5A6VA 3VNQA 2P6RA 3BC1A 4BO1A 5HW2A 5CDYA 5JANA 1VPVA 3QFHA 1G66A 4NABA 1L4LA 5JYBA 2GK3A 2I4LA 2BTQA 1A77A 4NG5A 3GLIB 4IFTA 1G2QA 4MH0R 1XZ8A 4YP7A 3WHLA 1JG1A 1MAVA 3S29A 2Q7OE 4IX9A 3S2ZA 4AZSA 4DEYA 3FHTA 4KDFA 3ELWA 4FD2A 4TMFA 2WA1A 3AXSA 2BCJQ 2N3ZA 5CCBA 2FX3A 1YJCA 4ASUD 5FHRA 2HA6A 2XNHA 3QPBA 2HNAA 3M4XA 1C4KA 1NYQA 3U09A 4EJSB 4B3RB 3BIJA 2PKWA 3C8UA 1MD9A 3GRAA 4DABA 1TX4B 2PGOA 2BKXA 2JLBA 5DYWA 4WKGA 5SZHB 1JT2A 2V9CA 3HDTA 3U61B 2HFKA 3NC0C 3T3MB 3COSA 3A4LA 5BWOA 1EP2B 4O4JF 2GAAA 3LXMA 4NATA 4UHEA 1JE0A 4M9SA 5FUQA 4JHLA 4UJ5A 1JHUA 3T4EA 1UAAA 1NNUA 3PZBA 3D59A 5FPSA 1QVRA 2JZOA 2Q2VA 3A4MA 3KUXA 1V71A 2IDJA 3CPEA 5A6SB 1JMKC 1GCAA 1RAEA 1YNSA 3BKWA 2Y99A 3FUCA 1FP1D 1L9KA 2FSIA 4Y0AA 1N7HA 1YB4A 3CN7A 3JTEA 4MRMB 4BMZA 2PEZA 1QHXA 5AW1A 4DBLE 4C07A 5J2TF 4ZU6X 2WT4A 1GTL1 2W6ID 2PUVA 2EKPA 4L02A 2O19A 1KI6A 3LS2A 3C87A 4JLUA 1AF4A 3TLAA 4D4GA 1KEZA 4RFVA 3ZR4B 4P80A 4HZUB 5C80A 1ESEA 2J5QA 4ND5A 4REMA 5F77A 5JSKA 1B8UA 1IUPA 2P6PA 3EGDA 1MC5A 1PWEA 4ACAA 4XPIA 1FQKA 1H2XA 1UBMS 3BEDA 4Z4IA 3KP1A 1SKYB 2C7VA 2X9GA 3GLTA 4PE5B 4CF6A 2CD7A 1OOEA 5J5AA 5F1PA 3BHNA 2ZT8A 4L0DA 4PYJA 4U0KA 1ZBQA 1FFSA 3VR4D 1TB4A 3M6FA 5HQ3A 3R8CA 2XHZA 2ZB4A 4A2PA 1M1ZA 4LQDA 4R40A 2TSYB 3HQ4O 4OBBA 4O6VA 4XFDA 1L7QA 1HRDA 1LPNA 2ZXEA 5JE8A 4NDNE 2D0PB 3DMYA 4PWYA 4YJ2B 5AI4A 4COKA 4RJKA 3GJ8A 1INLA 1UJ4A 3ANSA 2DPXA 1N2GA 2P78A 5BXYA 4TLAA 1LV7A 1ISSA 2NPFA 2YCLA 1LNZA 2ZWVA 3FKJA 2CVHA 3OCXA 4GOJA 2P7IA 4MKIA 4QBFA 5EFZA 4ARAA 5A9SA 3VPFA 1JDZA 3EZ2A 2GCGA 4QICA 3WK5A 4B9EA 1GPDG 3JWJA 5CFNA 2V0CA 2ZYVX 1MJ5A 1ZFNA 5K51A 3WGHA 1M6EX 3CO5A 3IO3A 4JNKA 2IL1A 1W5TA 4W5NA 3TR0A 3UK0A 3AHIA 2BFPA 3BMOB 1C9NA 2WFLA 1T3HA 3JALB 2C42A 3C16C 2BUCA 1YAHA 3IELA 2WICA 3D6AA 1IEQA 1XBTA 4RS4A 5B1YA 5LVAA 1J8QA 3JQ8A 1KJ8A 5TIIA 1OD6A 5AI5A 4O59O 1SCKA 3SLKA 4MX8A 3UGKA 3FJOA 3W5IA 4ZCSA 2M1ZA 4F1WA 2O7QA 4CCAA 3L7BA 1SZDA 1NT2A 4WY8A 1KMIY 2D5CA 4XD7D 1K62A 3UY4A 4J91A 3PLRA 3FCSB 4OSEA 2PKQP 3DF9A 3DOIA 3UFBA 4KAXA 1ZXLA 4UULA 2NT3A 3RU3A 3KLNA 4DARA 2Q0HA 2YJ4A 4TTSA 4PYKA 1J7KA 3TAXA 4MRNA 2IZ0A 2QMZA 3SJUA 1EPUA 1T9DA 4L3OA 4RK7A 4NMWA 3S7TA 1T2CA 2V0NA 1XLWA 4N9WA 4R1MA 3GGCA 3FRIA 4JB3A 5KYTA 2A14A 3DMTC 1RWBA 2RMKA 4KHZA 1JE1A 4JUIA 1GUBA 3D0RA 1Z36A 2G5TA 2HJSA 3BD6A 4JQCA 4FNGA 2A58A 5DB4A 3ZH9B 1A95A 2FP3A 3AUTA 4CUJA 1KK2A 3QX8A 1CP3A 2ZTSA 3VJKA 1DX4A 2XHEA 1I2BA 3PNQA 2BSXA 1NDUA 5KNBD 3AR6A 2WJYA 3KVOA 2PMKA 1JU4A 1CVIA 1Y7PA 1Z0AA 1XL0A 2FUG1 3ZBTA 3G9ZA 1QYIA 4K28A 2EOAA 1GAEO 3GG2A 1GYPA 2DKNA 1HNXB 1NVUQ 4BBJA 4KLAA 1SA0B 3T9CA 2BFEA 5KVCA 4KFCA 3HHEA 4CG0A 1BO6A 3HZRA 1E63A 3NKFA 4MRSA 3UK1A 1T0BA 1Y7TA 4U7TB 1AJEA 1BGXT 1Z75A 3DBLA 3O03A 2E4ZA 2G9VA 5CRIA 5ALZA 1JR3D 2EBUA 1XWOA 4GPBA 1NXWA 3UHAA 3HXMA 3E0QA 1EK5A 5LNK1 1W581 2CN1A 3NCTA 3WLKX 1W36B 3FTEA 3W1VA 4EITA 4B6QA 5C51B 4EEZA 3A3YA 3H19A 4ND7A 1L1RA 2Y1DA 3WV4A 4M2LA 1TM2A 1NVDA 3QJ5A 5SYNA 3IGFA 2QTVB 2G6BA 1DARA 1Z4PX 3JYLA 3LUFA 4OD0A 3R40A 4L8VA 1GADO 5ETJA 3WL3A 1R8XA 5T7BA 3F9IA 1NNI1 2NQ8A 2GXUA 3ZHVA 2Z2ZA 3BCHA 1EXDA 1FFEA 1LGYA 3D2BA 3PDCA 1W96A 1EE1A 1KAEA 2XNDD 5HSGA 2WE7A 4UVEA 1ADJA 1JEYA 2H0RA 4U9HS 4PS0A 1VRWA 4BLRA 1TAHA 2PR7A 5KTRA 3CSUA 2AK2A 1JEDA 1P31A 3GFGA 3LW7A 2G7MC 4V24A 4EYGA 3GEMA 1JU3A 1MAHA 4LSGA 4YJ2F 1QHFA 4G2TA 4WKCA 3NO9A 4W5HA 5J3JA 2FG5A 3C70A 4O2RA 4CIBA 1CUVA 3EXFB 2EATA 2JGRA 5IX8A 2JAHA 3HZHA 4F5YA 2H17A 3DA8A 2ZIWB 4ND1A 4JSTA 4FIDA 5CITA 5EMLA 1DC7A 1JPJA 1NRWA 4OHBA 5AESA 2A5JA 3OEWA 1XTPA 1YMVA 4GUDA 4R2IA 4B2LA 2PWZA 3N59A 4IXNA 3HRKA 1SHZA 1KS2A 2JAOA 3IP1A 4Y2HA 3LE8A 1GR1A 2HLNA 2HC9A 2PU7A 3L7KA 4IEEA 2RGYA 2A0WA 5ALKA 4D6XA 4APBA 2FSVA 5AXAA 1PWXA 4OLJA 5JSZB 3O8OB 1QFXA 3ZCQA 1HXHA 4IRMA 4MR9B 3TNFA 3IL2A 4ER5A 1OZGA 1JWBB 2BFWA 3VO1A 4FQ7A 2AW5A 2AEFA 4TTJA 2ALJA 1ETUA 3NUZA 5BQFA 4TYNA 2ZB3A 4RF3A 4GMFA 3MWEA 4ID3A 4FW9A 5E8JA 4ZVMA 1G7TA 5G3YA 1MU0A 1MF7A 2F8TA 5FRDA 3ZCPA 3CUKA 3HR8A 4PO8A 1PT8A 4G8BA 4HX2A 4WESB 4MQ4A 2W71A 3F5MA 5F64A 1GNRA 4QXPA 4EA6A 3EXG2 1RAIA 1CZNA 1EGVB 3OJWA 4TKVA 3OEYA 4E07A 4M1KA 3RYHA 2JI4A 2DWQA 2FF5A 3BVPA 3DEYX 3MQ2A 2X8WA 4R1TA 3I9V6 4C78A 2WWIA 1CUEA 2C4NA 2VS1A 1EFKA 1VLMA 3GEGA 3ITKA 3PGKA 4FDMA 4ZJZA 5KWVA 3OX4A 3TTSA 2CW5A 1O87A 3RIGA 1DVRA 4ZHSA 1XQWA 1XKXA 1FVFA 2QMQA 3EF0A 1FJ2A 3FYUA 4O4HA 4RL6A 1AK2A 3KPWA 1XTRA 1IY8A 2XUQA 3WB0A 3K30A 3OFKA 1RYNA 4EVIA 4ALLA 3D6NB 1RBZA 3KBOA 2ZB2A 3W1WA 4BEJA 5BWBA 1QUEA 1IVSA 1I7QB 4YGXB 3FPKA 1DHRA 2I4TA 4LG1A 2VRWA 3VOTA 4FMCB 5CT8A 4LKOA 5DSZA 2DY1A 1DKMA 2ZYSA 4BO3A 3ZDAA 3FD8A 4RKFA 5CH5A 4LBVA 1NR1A 3DP7A 5D5PA 5K0ZA 5JJKA 4HOYA 3AESB 1DIHA 4S0XA 4DPLA 3QTTA 4HEA6 2AYZA 4DV0B 3R2JA 4MV7A 2CL6X 5CHYA 4LOLA 1THTA 4NIMA 3RHSA 4PGFA 3ROMA 4EFDA 3VVCA 4FQ8A 1LZKA 5BUZA 5CLJA 3OCUA 2Q1SA 2K4MA 4JT4A 1NLFA 3UJ9A 4L4RA 4NENB 4UNSA 3UV7A 4DAOA 4IXTA 4GS5A 1N6RA 3RG2A 4DRXA 1ANKA 2HYDA 4QJ4A 4INZA 2PO7A 1BMTA 4EFNA 1A9RA 4BVJA 3NH6A 1TCUA 1CE8B 1SC4A 3CEHA 5F76A 1NKTA 5B2ZA 3TNJA 4B80A 2RHOA 3ABIA 3VDMA 3DV0B 4CIWA 1QHSA 3BMXA 4M76B 5BUCA 1AK9A 3KKOA 1D4FA 5CFZA 1BCSB 1U2SA 1Q7RA 5H4GA 3E1KA 4B3SB 4PTLA 5DGHA 1IUKA 1Y34E 4IUDS 4WE3A 3OC0A 3BTSA 4PLTA 1DG1G 1LLDA 1QDEA 3X1YA 1PZNA 1IMOA 3NWEA 5EMMA 1B74A 1N1EA 4Q1EA 4XYEA 4BVEA 4GQIA 5IK2A 5H9WA 5MDHA 3E7WA 3FZGA 2VDQB 1XPJA 3QU4A 2N46A 4RNCA 1PJTA 2FUEA 4XSGA 3DHYA 3GLVA 4DV6B 1ECGA 2Z2XA 1T26A 1Y81A 3E9ZA 1E64A 1GKKA 1WRBA 3QIAA 3SP1A 2HLPA 3DYVA 5CYGA 1WPXA 1HPLA 3AH8A 4YRGA 1VPLA 4BXOA 2B21A 4NU5A 1BJTA 4BX2A 1KEKA 5DFAA 3NVAA 2FQ1A 3CKYA 3NR2A 1KNXA 4W5QA 1BVRA 1H2FA 4QTXA 1P0MA 3L05A 2ZWMA 4JROA 1XFAA 4EX7A 3ADDA 1FUUA 3A4TA 2XE4A 5AVZA 2BMWA 1O0SA 4KH1A 2BZ1A 4A0HA 1D2MA 1DBSA 2B1QA 5IT0A 3JVEA 4H08A 3GRKA 1HY3A 4GKKB 4KN9S 2ZITA 2EJVA 3WWZA 5DI9A 4MDFA 3FMOB 5KNBH 1OROA 1USGA 3LWDA 3EVTA 4DZTA 5DYIA 2SECE 1Q1NA 3MWGA 3O1HB 1XJWA 3F6RA 5AUQA 4MAFA 3OEHA 4KBYA 3RJ9A 3SVZA 4KXXA 4D9BA 1Y37A 2KS6A 2P8JA 1J8DA 3DB2A 3GDGA 3MUEA 3EGEA 1V7ZA 1TC1A 4FXPA 4IVQA 3D43A 4UBMA 5DEIA 3WGOA 4E6EA 4NSLA 4TVSA 1XZLA 3BIOA 3JAKB 4WNAB 3KQUA 2WB2A 2A2ZA 3KQKA 4ON9A 4DNFA 3IIKA 3SHFA 2DSTA 2GCOA 2PMEA 2C57A 1NBMA 4PBTA 4Q9IA 4GEKA 3VPBA 2EARA 3H5WA 1GPLA 3F4KA 4DLPA 1VL1A 3DZCA 2I0FA 1YVDA 3BUSA 5JSHA 4BNDB 4N41A 1LI5A 2O8VA 2WM9B 1WB5A 2V7WA 3F4SA 1ODLA 2REBA 1MOSA 2FWBA 5DCWA 3EZLA 1SRQA 2J59A 4DCOA 2ZRFA 1EFVB 4QG3A 1U94A 3R8FA 3FOBA 4R7GA 2A9VA 5B4TA 1R9JA 3VRHA 3ZOKA 3EXIA 2B69A 2FEKA 5F23A 4W9NA 3U13A 1H2WA 4FCCA 4IHKA 4LAFA 3HBAA 3H8VA 5LQJA 3HXKA 4BNVA 2BV3A 1DI0A 1DXYA 4RWZA 1ODJA 1QC5A 3RRXA 1Z28A 2W2PA 3W7BA 1JILA 4EPRA 1GHTA 1H5QA 4IFIA 4ND2A 2BW0A 3R6TA 3HJFA 1NU8A 1NR5A 3WGKA 1B76A 4WVLA 4CKXA 5JV5A 2R6GA 1PG0A 1UWCA 3CEJA 3FDIA 4ZCRA 2QNBA 3VKWA 1NASA 1ZH6A 1PNRA 2V96A 4CLRA 1FVHA 4JODA 4HBGA 4EF5A 5JQWA 1N1DA 1TM7E 2GTPA 2GEKA 1Z74A 2WAOA 3MB5A 1JMYA 3O47A 4RE5A 3T1QA 3PTAA 2I3BA 4IILA 2O2CA 3N7AA 3OQ1A 4G1MB 3ET4A 2Y2VA 1RHUA 4JC0A 5MN6A 3FN4A 3VYRB 3X3HA 2I22A 4WBNA 1OXSC 3NWOA 3DT6A 4JCCA 5ESWA 5L6MB 4CKWB 1T4CB 1VLVA 1BX1A 2NYAA 3NHKA 3R7WA 2YVQA 3M34A 3GP3A 4KOEC 2RJNA 2G4CA 2XNCA 4BQOA 4CJXA 4EW3A 4UUAA 5EGSA 2EYQA 4NBKA 1XHLA 5DW3A 5TGTA 5EMNA 1DL5A 1UBFA 3WDLA 4M6WB 2AN4A 3HKEA 4HX5A 4B4KA 1JYEA 2ZIFA 4G24A 4DCPA 4V39A 4TM7A 2C04A 2CLOB 2E85A 2NGRA 3I5MA 4ZCTA 3KKPA 2BCEA 1C81A 2RGBA 3FNHA 4GSYA 3TX2A 2ZRBA 4JB2A 3WBKA 1CUWA 3ENZA 2PRZA 2FOLA 3ECAA 4KBFA 1DTEA 4MJ7A 4DLUA 4NK4A 5FB3A 3RS8A 2C58A 2AGVA 2I6GA 3RSLA 4ASUA 4YT2A 1QO7A 4CI9A 1QQBA 3KC2A 2XGJA 1BJRE 3ZDZB 3I23A 3SJAA 4HAYA 2GDZA 1V43A 2OMKA 1ONBA 3NW9A 3D1VA 4GW3A 3NMUF 1JHXA 1IWBB 2CYAA 1T2AA 1YZYA 3K7EA 3MRTA 4MUYA 3N0RA 5BP7A 1XEXA 2CKMA 3OT4A 1OREA 1U0HC 2IOFK 3VV3A 5IASA 1TCCA 4QBGB 3C0KA 3Q1LA 1W44A 2FHPA 1VC2A 4P54A 2VUIB 4EG8A 3RBVA 4CCYA 1KYIA 4M1SA 3L93A 2BFDB 1BNCA 1SPXA 2GHQA 2ZYDA 3E3LA 4J9VA 4O4JA 2YWEA 5FFNA 3ZU5A 1ODSA 4YJFA 4BPRA 4JJIA 5DM60 2ZAMA 3QNWA 5KWJA 2ZIEA 1E99A 4A0FA 1TF2A 1ZEMA 3L6RA 1KZ6A 3CPJB 3KQQA 1XNGA 3G1TA 2C5HA 2VUHB 4NS1A 3RVSA 3YASA 3MMZA 4RVGA 1K98A 1AM4D 2VDVE 3EDOA 3E27A 4R16A 4G0QA 2GYYA 2UVQA 4Y2YA 4RA6B 2TRSB 5D87A 4YI5A 5E6UA 3WLPA 5J2TA 4BX0A 2VHVA 4KV7A 1I51A 2V6BA 3D2CA 4QQKA 5T4FA 1CWUA 2EQBA 2FEAA 3A27A 1YJ8A 3CCBA 3CX8A 1OBHA 3EUWA 1KFKB 3VU9A 3PUXA 4DCUA 4EI7A 1E2QA 2H5JA 4MWZA 3O74A 2V1XA 4HWPA 4NHEA 4L9AA 5EKDA 1TIPA 3N87A 3RREA 5LYJB 3VR4A 4AZ0A 1KQGA 2JFWA 1RHRA 3KQMA 1YO6A 5CJJA 4Y1FA 3IXMA 3U3ZA 4LOHA 4RM3A 3ZY2A 2Q29A 4LJAA 4B34A 2JIDA 1UMCB 4DHWA 3DMNA 3L6BA 3S8EA 1HFKA 2H4XA 3ESRA 1MV8A 4FGKA 3HKCA 4LCJA 1N5RA 3C5HA 5FTJA 4RHYA 1T9AA 1NI4A 3EQ6A 4D3FA 13PKA 4N6NA 2D5IA 2B6HA 2W5UA 5A7HA 3FA2A 5DASA 1S8OA 1K88A 3E3OA 4G5HA 3CX6A 5JBIA 3KQNA 1YI1A 5T5QA 1XROA 2HJ9A 2HX1A 4JUFA 5DVZA 1EEXB 4EG3A 1ZD8A 2C5FA 3ZZMA 1U9IA 1F38A 1EJ6A 4R6XA 1KYQA 1IZ0A 4DR5B 4Y1RB 4EYQA 1B26A 2RJOA 1QONA 2X8JB 3R7AA 4B6EA 4FIZA 3TO5A 4MUEA 4RTSA 3ORRA 2O0KA 1I2DA 5ALTA 1TI7A 2H2DA 4R9RA 3D3EA 1NNLA 2NTEA 3GT4A 4EB6B 4A36A 3A1UA 1TM4E 1KGDA 4MWCA 5JXWA 1QHYA 3BB1A 2OWDA 2Q1UA 2ZDQA 3LRPA 4YJGA 5GM1A 5B36A 5ED4A 1OH7A 2F1JA 5YASA 3PGLA 4FLFA 4XD7A 1R12A 2IYQA 4EYEA 5B12A 3RVBA 3QOFA 1BFUA 3GR6A 3R3XA 2WDPA 3GB9A 1JA9A 3W8EA 4DYHA 4Q24A 2ZXFA 621PA 4HPWA 3VPXA 3QUAA 2FR1A 5AYVA 2IJGX 1LF0A 1YS4A 1PS8A 2YHSA 3BE6A 4YASA 2R9VA 3NHPA 1XEAA 4ENVA 2CDCA 4CIVA 1AOXA 2BMDA 2YUTA 3BEOA 2PUBA 1V5GA 3IA7A 3IV9A 2Q3MA 1PNTA 1WO8A 3IR7A 4CZ2A 3KKKA 1G1MA 3IQDB 3NHFA 4R98A 4KN5A 4C29A 1RYBA 3CV3A 4J7CA 2E82A 2J3QA 3K4HA 1I4EB 5TJ9A 2GD2A 2XMZA 3WJ7A 3PDIB 4IQ4A 5B1DA 4L5YA 3QBDA 1FTSA 2BDEA 3SZLA 1GG8A 1J4AA 1NSTA 4LYAA 1T0JB 5IVDA 3AB7A 2XCUA 3Q1KA 3FVTA 4Y7CA 1TQ6A 2R2AA 4AC9A 4OKIA 4EJSA 5A3QA 3R5JA 4URUR 5IU6A 5FD8A 5B37A 1D2RA 1G4UR 3F7NA 3NVDA 1J20A 3J80A 2A9QA 3ZU4A 4MAMA 1KAQA 3C8HA 3O75A 5TEWA 2JVJA 3WWCA 4D0NA 2WAMA 3WGQA 1ZHOA 2ZULA 2W90A 3CH6A 1JAZA 2D2EA 4G5FA 4N3NA 1YV9A 1ULSA 3QUTA 4NQRA 4EFCA 2QTTA 2C07A 2PY6A 4NJEB 3TZQA 2HIGA 4Z1MD 1Y4DE 4IDHA 2GCNA 3GUUA 2HWXA 2ZREA 1L4BA 5PNTA 5A6SA 1Y6GA 4BZQA 5ANRB 1UPAA 4YO7A 1U0JA 5B7GA 2BGGA 3HB0A 3IFSA 4C1NA 1TZMA 1H2HA 3QX9A 3MWFA 4E70A 2WWTA 3CLHA 2OP0A 2ODNA 2XQVA 1G16A 1H2YA 1WSBA 3GZNA 4F85A 1DQNA 5GIPE 2AEEA 2DCMA 1E4VA 4ZYWA 4PEVA 1NOJA 1ORVA 4TKUB 4B2YA 4BFCA 4Z7JA 3EMVA 2ODWA 3D6HA 4KIGA 1FUOA 3BFKA 1OB5A 2ZAIA 1S3GA 1LPPA 1PDVA 5A3VA 3RU9A 1F2VA 1SQ0A 4DR1B 3TLGB 4J0GA 2W6CX 2UZ4A 4ILEA 4UTRA 4US2R 2WMNB 4UCQA 1PGJA 4QG7A 5HFNA 4WA8A 3KT0A 5L4LA 1T29A 3GDOA 4G56A 4WFKA 1FDRA 2IYYA 1GXSA 4I9FA 4GP6A 2IXFA 1L1FA 1RYEA 5FPKA 1X0VA 5U4XA 2G70A 4YJ2A 3DDHA 4IDNA 2EKQA 4L4ZA 2WJZB 3MINB 2UZAA 1J09A 5G4KB 3S68A 4YCLA 5FULA 1M9NA 1MVLA 4MCHA 2XLBA 2GSDA 4TKLA 4YAEA 4M0MA 2PFKA 5DCLA 1UADA 2YN2A 2LDBA 1X15A 1BXKA 2J4CA 4KZPA 2PD6A 1GVHA 4F71A 1H94A 3K0AA 4C7XA 2C4HA 3MCVA 5TS3A 4Y2RA 3H7IA 1PGQA 5AOAA 4J3FA 3V7NA 4BLVA 1Y4SA 1SUWA 2WMYA 3GL9A 1BCRA 4ZDWA 3PEYA 4UZEA 3ZW8A 2AQIA 3FOFC 2QYTA 2GCEA 3SFZA 1ND6A 2V65A 2GXAA 4ESVA 4DMRA 3BMOA 1TVKA 5BYBA 3JALA 5GQSA 4AK9A 3SQWA 4FZVA 1W36D 3FCXA 3TCKA 1PQ4A 2XX3A 5CD9A 3G0IA 4XVHA 2OQVA 4D42A 2C8VA 1N6KA 4MRAA 4OHZA 4DS3A 1YA4A 4IXMA 1KFEB 4UBKA 5JLAA 4B09A 3STYA 4EKNB 3I2JA 3I6ZA 2W2TA 2I2DA 2QOEA 3OE4A 1ES9A 3NHZA 4DFDA 1JLSA 1RQRA 3FWZA 3OEEA 3OLYA 5TY0A 4AYTA 2GM9A 3HBFA 3JRNA 1L5RA 4FNAA 1NVVQ 1N2JA 3E1GA 4NCJA 2D7JA 4UM9B 1SKMA 4UHCA 2ZB8A 1OGIA 3E5RA 5GJVC 1MC4A 2QTBA 4PX5A 3EMBA 1M0EA 2FW7A 5CIYA 4C7MA 4CMEC 1DBPA 3SZUA 3DL4A 3QW4B 2CXNA 1HYEA 3GJ5A 4HNHA 4BYGA 4K5QA 3C2QA 1YHYA 4R81A 3GLRA 1ONOA 3WZLA 1NVGA 4MQUA 1XPUA 3CUUA 3GFVA 1IONA 3H9BA 1GZ5A 3BK7A 1A2KC 1PS0A 1S1MA 1RQLA 3DP9A 3H9UA 5CT9A 1CB7A 1P1KA 2VJKA 2YY7A 4YACA 4M8LA 2HMAA 1FIUA 3C5WP 1XRRA 2HT1A 5FJIA 1U0SY 2NUPB 3MJCA 4ZXFA 3WV5A 4D97A 4CNBA 4GE0A 4MPPA 3GRUA 4R2KA 1RWWA 4PSDA 4W5JA 2VK2A 4H7PA 3M5WA 1QCDA 1A5ZA 1F3OA 2I34A 3W9UA 3O94A 4EK9A 2GLXA 3NLLA 1KDVA 1QR6A 1ULZA 1E61A 4NMXB 3NKLA 2ZJ1A 1X1AA 4RMGA 4L78A 4W6ZA 2C2GA 3ZZ1A 3LL7A 3NEAA 2Q21A 4XYBA 2I7DA 3SFTA 4G0UA 3WE7A 4E03A 3OZEA 2JA2A 2QTVA 4G5QA 3NDRA 3Q7EA 2PM8A 4PLPA 3TFQA 3THRA 3WGGA 3E22B 1NI5A 2V45A 3OFSA 1ULTA 2O48X 1NQUA 1VJ1A 3BHJA 3NGMA 1EDEA 2R2GA 3CX4A 3LHKA 3OC6A 1X7GA 3LNTA 3ZXYA 1JVNA 5AIAA 3E05A 4Q48A 2YOGA 3RAJA 1H2EA 1BXGB 3GPIA 4I1VA 3SEFA 1TTTA 1PZGA 1FL9A 1GO2A 1NONA 1YVEI 4MIYA 2C0CA 4DDKA 1XLVA 3EF3A 2Q2OA 5T57A 5DM1A 1M6YA 2R6ZA 3E18A 4NH0A 1C3VA 3K1AB 4V2IA 4D3YA 2IYLD 2O8EA 3A06A 4OM8A 1XDUA 3AP3A 4QYMA 5FUVA 3K0CC 1WVMA 1SJ9A 1UEIA 1W4RA 3MM4A 4BGDA 1YASA 2QUHA 4TMWA 1KZ9A 2H1SA 1FYFA 1KJZA 2Q1XA 4O1IA 1YJQA 1E3LA 3MTQA 3WGYA 1EVJA 3NOXA 1SUEA 3AIKA 1OTHA 1E2KA 1UFKA 5A3SA 3QVGA 1E5VA 3C6QA 3D8BA 3LYAA 4ENWA 3ADPA 1Z07A 2PCJA 2X3FA 5CMLA 5DGCA 4BY9E 2AFVA 1GD1O 1UFQA 3W2TA 5A3RA 2V5UA 2VZLA 1L6RA 2C77A 3CEAA 2R60A 4UVDA 2DVMA 3IP6A 5F3RA 2ASEA 3CGGA 3CZ9A 1M5TA 1QH1B 2GN4A 2XQKA 2ATXA 3JQ7A 5TXGA 1HNZB 4RDCA 5FPTA 1A4RA 1O95C 2HQSA 5JSZA 3EG9B 3O8OA 2FEWB 1Y7IA 2J45A 3N2GA 4NMMA 2JAUA 3EDYA 3ABQB 1LRLA 4CDRA 4F46A 4G26A 5F21A 4DPMA 1O8BA 4QFCA 4RGQA 5C1OA 5KU1A 3K0FB 5ARCA 4EB8A 1NYLA 1DINA 4W1SA 1BS9A 3F74A 4QGFA 3CR3C 1QHHA 2EFJA 3ER6A 4WESA 3W8RA 2HEGA 4JQSA 5EEGA 4NPHA 2YJTD 3CVOA 1TU4A 4M1WA 1JL3A 2CY0A 2HO5A 3K0EA 4HH0A 5A3JA 5M04A 3WHKA 2QL5A 4V0SA 2GRUA 4L6AA 4F7WA 1UDBA 3O8QB 4POOA 1X1BA 2EEZA 4EHBA 2OXTA 1NOIA 2QQGA 4FFLA 5LA6F 4ZZ3A 1YS2X 4IIGA 3Q2OA 1GGMA 2O54A 2PH1A 4LWQA 2W2OA 3VZBA 1GQFA 2HXYA 4FYVA 4M83A 5ESXA 4G6ZA 4MVXA 5IBQA 4F5WA 4Q01A 1GNTA 2IVZA 1X13A 4YCBA 4P4SA 5KYKA 3OE5A 2HR1A 2ORYA 2VQDA 1Y33E 1N1MA 1CUXA 3K0KA 1FMTA 1HDXA 2PVCA 4PR3A 3F5SA 1JPNA 1JQ5A 2ZTUA 5FBKA 4C04A 5KTMA 1K9VF 4MP6A 4Q18A 2CXRA 3AIMA 2AZDA 2HWUA 3KOYA 3I53A 3CLUC 5EP3A 4CV1A 4Q4LA 5FBLB 1HLFA 4KMMA 1NTRA 1AQLA 1HZZC 5H7XA 4D80A 3JD2A 3OZCA 2Q3EA 4CF4A 4BVBA 3S1AA 1FP6A 4XIGS 1ENZA 2PIAA 1X6VA 2QF7A 1H4TA 2RCNA 1NFRA 3K5IA 4XM1A 4FR5A 3D4NA 3IPCA 2FUG6 3LQKA 1WVIA 4A82A 3KTDA 5ILQA 2C61A 4BRWA 1FP4A 4BLOA 4MJXA 4L5BA 4UUNA 1PR6A 2WKPA 1ZKMA 4NKRA 1H42A 3PEVA 3M1IA 4D0RA 2OB2A 1AQYA 1I7PA 1BS1A 2EGUA 3EWIA 1V16B 3CUVA 4FONA 1XRJA 1FXWF 1CE8A 2Q2WA 3BOSA 4X8LA 4I5IA 3VNVA 3ICEA 2LPMA 3OQOA 4WZBE 2Y4NA 1KYYA 2AFIE 4BYMA 1F0NA 4RJLA 1NUAA 1R8SA 4ZKDA 5LNK6 1BDJA 2FRDC 2PJDA 2HL6A 3TM5A 1Z18A 2F1IA 3G2KA 2ONJA 1BCSA 2RB5A 3AXTA 3C24A 1CFJA 5JU6A 1ISRA 1ZIDA 4QQNA 3AUKA 2Z2JA 4LWZA 4AZTA 2L18A 4PSAA 4E5KA 1N5LA 1Z63A 1XO1A 2WOJA 4AJ9A 5HJEA 2JS7A 1RJ9B 1JG4A 5G40A 1C9JA 1XZAA 3KM0A 1D0VA 4JP3A 2JANA 4W4TA 5AUPB 2OV3A 1OU0A 1QS0A 3MXTA 3VOBA 1M75A 1WLYA 2NU7B 3HWSA 1K3TA 1UXKA 2ZJ5A 5CD1A 4ED9A 4PPFA 2ZI4A 3CXUA 3DHEA 5KDLA 1IEVA 1Z3CA 2XA9A 5TPWA 2B5WA 3L6UA 4MKRA 2PUEA 1WXDA 1CF9A 1NF9A 4QYXA 4YP0A 2E7ZA 4N8SA 3T1OA 3B6ZA 3LT4A 1NHGA 1QAMA 3V2IA 2P27A 2B0JA 1G3MA 2ORVA 4RSRA 4FSHA 4I7EA 1OYVA 1IYZA 1IB6A 1L7BA 3A4YA 4PS1A 1EWVA 1J3UA 3VR1A 3UF0A 1W2HA 1O54A 1V48A 3ESYA 1RT9A 2QN3A 4FXOA 5JNLA 1H2RS 1MGOA 3TLBA 1B43A 1IJKA 3DONA 4A0QA 2HK7A 4G1UC 3ZUPA 5FH9A 3S99A 4ESOA 4WCVA 5CPBA 3EXEB 1R27A 1NJ6A 1DKLA 3HL0A 2TECE 4HAUA 5FWYB 3DMFA 3D7KA 5L3QB 4FGWA 4M46A 4BMPB 1L8XA 2GDJA 1N2IA 1U3UA 3HSKA 4O4LB 2H8GA 1FMFA 3WMRA 2IHUA 4JGIA 4DT1B 1ZXBA 2HJWA 2YV3A 1EVEA 4AF6A 1PD0A 4JGGA 4FI3C 5FFFA 2P67A 1BMFA 4ND3A 4DJAA 3LA8A 3JAKA 1O94D 4PM4A 3E4DA 2YX1A 1PZFA 1U1EA 1ZL2A 2B9EA 1SC6A 1U3CA 4JU9A 1MG5A 1OZ0A 2EIXA 4U5QA 2TMGA 5DGXA 1U0GA 4ER0A 1XRSB 3CY6A 3PNOA 4JYZA 2R5FA 1RRVA 2H5IA 3A3PA 3EVZA 5EMKA 3N5KA 4XUCA 4R1SA 4WKOA 4YP1A 1RPJA 4X0EA 2OGZA 3VU1A 4LJRA 3DOUA 3LYLA 3LKZA 5L6LB 4F0JA 2FJ0A 1K06A 2PQ2A 2QUBA 3AI1A 4A6DA 1PIWA 1B2LA 4L15A 3AERB 4TTAA 5JVDB 4XX1A 2O7NA 4AJKA 3IPYA 2XYVA 4DV3B 2R84A 1FNBA 4WY2A 1BX3A 2ZSUA 4RQAA 1CUYA 1TF5A 1SBIA 4ZQGA 1Z5GA 3RKRA 1B1AA 1P4GA 1GPWB 2O2JA 2RIPA 1DAFA 3GRVA 3O5AA 3DFKA 4CEIB 4BN5A 3WRYC 2W6MA 1OYOA 1LW7A 1IIRA 2PBZA 1X7DA 3F49S 3IAM1 3NONA 4KE9A 3IULA 4HK4A 4YJKA 1TW2A 3H9EO 3S2EA 1ZIXA 3E6AA 4GOKA 3DXFA 1QRRA 1OX5A 2PX5A 4RANA 2HBZA 2FI1A 1FDIA 3RFCA 5JATA 3RSZA 3T9DA 4ZOQI 1WBJB 2D0OB 1S2MA 2X8AA 4ZOCA 4FWBA 1WEKA 2A5YB 1J2TA 2X2EA 4QJBA 3UZUA 2O5CA 3C6MA 3N2IA 4Q4HB 4EUNA 1H6CA 3HCDA 3CZPA 3PX7A 1XEFA 4I4IA 1SXJB 3AILA 1ZIYA 5HKAA 2QD2A 5ISMA 1LBQA 1IM2A 4CKWA 2ZE5A 1EHYA 2IUSA 3EWAA 3LX8A 2P0EA 2CFTA 3NG1A 4BV8A 4WGFA 2F3TA 2XVAA 2ZK7A 3C3YA 3OLCX 2TMDA 5CURA 5SY6A 4XR4A 2FZ5A 4RHEA 3R75A 3AHDA 5F4ZA 4QU5A 1F8GA 2EYUA 5G0SA 1GUFA 2P11A 2QAIA 1P44A 2DBQA 3LOPA 4GC9A 3F1LA 3K09A 4MV6A 2AE1A 3FAZA 1DT5A 1MEJA 1O5TA 5IFLA 4QD3A 4QSMA 3COPA 3HB4X 4AMGA 3GFFA 3GUYA 2BRUC 1A0OA 3HYNA 3KB1A 4KZKA 4TTRA 1E69A 2QM0A 3PBKA 5D5QA 3RUCA 1T2NA 1CZHA 1KSHA 1T9GR 3H87A 3F8SA 3K71B 1VP9A 2Y1GA 5M3BA 3WSWA 1VYHA 2PUHA 1K7EB 2X58A 4R1NA 3SEZA 3UK2A 1OGYA 3G2HA 4BNNA 3HLKA 1NDHA 2I4MA 3UGQA 3W2IA 4LF6B 1JDTA 1V26A 3D2AA 1REQB 1GNPA 4LMAA 1UXIA 3LD9A 1EMDA 3KAPA 3Q3JB 5IUNC 1YFKA 4CIYA 3W3ZB 3RC7A 1EESA 1R0BA 2CCKA 2WUDA 2ZAOA 3G2PA 4RHFA 4MQEB 1ARZA 2ADFA 2EX1A 2DR3A 3H3JA 2JD1A 3HVHA 3WBJA 3R9IA 4JLJA 4Z1MA 2BFDA 1QIFA 1XCJA 4I66A 3V1LA 2JATA 3G2OA 3H97A 1E9AA 4W5OA 3QU7A 4M1TA 2JRLA 4OU5A 5FUYA 4YRZA 4II7A 3MC1A 3H2IA 4FX2A 2LDXA 4PLYA 4JQZA 4WXEA 4E94A 1IXYA 1V8OA 3ZXIA 2GILA 3KQYA 2CBZA 2HKIA 2JCGA 1V7CA 1CDOA 3S4YA 4HDAA 2HUNA 2WTEA 4LHZA 4FNOA 3T4UA 5KTTA 1U11A 1MX9A 4QEDA 4WOPA 4RA6A 4DIDA 3MCAA 2WF8A 3EQZA 3ZK7A 4N6OA 3FDFA 3O73A 5E6SB 3HU5A 2D1FA 1KFBB 3TZHA 1F4LA 1Z5PA 4KU4A 3LT2A 4FT4A 1QIDA 1E2FA 4U8HA 3DVRX 4I4TF 2VPIA 1T2FA 2GOYA 2JD0A 2Z5VA 3FJYA 4X00A 1VMDA 1G2IA 3QKWA 4R0VA 4ETWA 4E5SA 5JVDF 2B1GA 4A10A 1VJDA 1Z4QA 4WLFA 1PNOA 5B3JA 3ZNOA 1ZW6A 1QANA 2ZFUA 3UKJA 3HTXA 1Q11A 3G2LA 4ALNA 1R0XA 1IXZA 1L7PA 2IYZA 3LQFA 5JHGB 3KSMA 2NSLA 1OC4A 2FLVA 4N1AA 3HGQA 1E94E 1RMQA 4NV1A 1KORA 2OCIA 5ER6A 1T91A 5IN5A 3W05A 3IKTA 1PK8A 3X1WA 2C99A 5BVHA 1IN8A 1YKGA 2YJ3A 2WTAA 2DECA 3QWIA 4LNHA 4MR7B 1T0IA 4W99A 5CG2A 2PUCA 2I8CA 2I4NA 3DWGA 1KO7A 3RUFA 2XIJA 3F3SA 4Y1RA 1QVAA 3FRJA 4EP1A 3ZCRA 3OHPA 1TYEB 5HRAA 2H18A 3TE7A 3V1UA 2JLVA 4UXJA 1DADA 4X44A 3ZW7A 4LJLA 3RIXA 3A6DA 1IE3A 3CR7A 3W8FA 4HT3B 3HC7A 4D3ZA 1RWQA 1HC7A 1VBNA 3GOQA 3IBSA 1PZEA 1DJQA 1PHRA 5TC4A 2OBBA 4DYDA 4ARCA 3LF2A 1Q2UA 4MULA 4BO7A 2C5EA 1PFYA 3EVAA 3Q7SA 4N12A 3WJ2A 5IZ4A 2ZIZA 2J0UA 5K3FB 1EQAA 1SXJD 4TRRA 1MJHA 3AYXB 3IR6A 3IODA 1TFRA 1J0EA 2ASVA 4I36A 4TWRA 2BYTA 3STWA 5LZ8A 5JXGA 5FV4A 2OBFA 2B4QA 4P4LA 1SU4A 4XVQA 3SF0A 1NYRA 3RC2A 4LF4B 3IDSA 1S3FA 3Q8XB 1EFRD 4N0DA 3WHPA 3QTLA 1B6SA 1TA4A 1KI4A 1TL7C 2O7SA 3GVHA 3DDWA 3PDUA 4L3WA 4Q1AA 4OF4A 2PVSA 5B7QA 5IC5A 5CDTA 5I3CA 5EI5A 5MFPA 3FYCA 3K73O 3ZKAA 1ZWLA 3T3OA 4C7OA 1X3SA 3FWNA 3KEGA 7GPBA 2G83A 4FPXA 4UHHA 3INNA 1J0DA 5A5FA 4UU8A 4ER7A 2OEPA 1RI5A 3R4CA 5IM4F 1CZRA 3PDIA 1E1MA 1RWXA 3KJHA 5FWXA 3UHFA 1QIKA 2H9AA 4Z8YA 1TMKA 5JPDA 3UPUA 3CZMA 2JGJA 3IS3A 3HNRA 4IDDA 1N4DA 1SELA 2D2XA 4NEHB 3CLTD 5EIBD 4H3KB 1RAAA 2PTRA 1S2IA 4K9PA 9GPBA 2Q8PA 1OH5A 1QPBA 4DE5A 3NNNA 4GO1A 4KI0A 4H31A 3GJ0A 4AUMA 1NBWB 5EZ6B 1RSZA 1ZNYA 2PAFA 4L8YA 3TL2A 3LG2A 4G1VA 1JFSA 2NUTB 4KQJA 5KCMA 2DFKB 5AT1A 2ZQ5A 4LF8B 4GWLA 1JQKA 1N6IA 1JDSA 1GCOA 1XXHE 3BYZA 4NJEA 2BEKA 3KR0A 1HRKA 2H9YA 1Y8RB 3NIFB 4A8TA 1J9EA 3GJZA 4OAQA 2WM2A 4UJ3A 3DEAA 1CXZA 3INYA 3DT9A 1A9YA 3AB8A 2F8MA 1XRNA 4L8WB 4X54A 3TD2A 4EKYA 5KU7A 4ZRMA 4ZN6A 1N9GB 1UAYA 3GFRA 1YR7A 3HCOA 3LQRA 4M53A 2C9CA 3DEFA 4LRYA 5AO9A 1C3UA 2H0AA 2MDTA 3C5CA 1TA0A 3DV2A 3RAPR 5C5EA 1X1DA 2H4YA 2A7QA 3ZI4A 3JWHA 3KWLA 4TKUA 4CR6A 2C9ZA 2IZOA 1PL6A 1RLOA 3C3AA 2FRXA 3SIPA 4A0GA 2Y1LA 1SHJA 4DSNA 2QAJA 3TM4A 2Q4OA 3CO0S 3V42A 3QPVA 1WUHS 3K4QA 3TLGA 1SCNE 1FRQA 2C4MA 3BGDA 4KX3A 5JFOA 2BGUA 4KMRA 2VP6A 5J23A 4O2BF 1VYVA 2M32A 3MWJA 4RTOA 1NIPA 5JH7B 3HP1A 1OXBB 4MDYA 1E62A 4YRTA 2W6NA 1ZJYA 2FY8A 4YI3A 3WWPA 2QK4A 1Q1GA 3PFBA 4ONEA 3QKRB 3MINA 1C7QA 4PSVA 3R7DA 5B30A 4XCXA 5G4KA 3RWBA 2D5LA 1AMUA 3W6PA 5JMWA 2VWGA 3UFXA 2GPTA 3I6QA 3NHWA 1KZ1A 3VI3B 3JZAA 4YN3A 5JTUA 1RJGA 3V2GA 5HFAA 1QRSA 2J0QA 4RK1A 4RKEA 1K5GA 4P4UA 1PBNA 4N7BA 1II0A 3KX2A 1UFRA 3OZWA 4TXHA 4EDHA 1NVVR 3IP7A 1AV6A 2JBAB 3KQHA 3E1SA 3EG5A 3LSTA 3TW6A 3F6BX 5ALNA 4E3WA 5CXUA 2IHZA 4V0MA 3RIMA 2QRZA 1Y1SA 1DAPA 4MS4B 2I7TA 3NOOA 1UQRA 3B53X 1ZKDA 5IBPA 3B1JA 3TE6A 4CQMB 3MG9A 1ZNQO 2W42A 2N0SA 1ZUNA 1QGED 4UUPA 4ZVPA 1U3GA 3T5BA 1XMVA 3FF4A 4RVDA 4RZHA 5KKCA 4F6RB 4YRSA 1DV1A 1HMYA 2FFHA 2WW8A 4PZCA 4E14A 3A0UA 1ZI8A 1OH8A 4DC0A 2VNSA 2QLJA 1QB8A 3A9RA 3ZD8A 2Y2UA 2GD0A 2IEGA 4K6FA 1GLNA 3M5DA 4GWKA 4R8SA 4BNFA 2AR0A 3WMXA 4FFPA 4IW3B 2RG7A 5A2GA 4CMIB 3WLOA 2JA1A 3WI7A 2C5GA 4CIXA 2R85A 3AI7A 3VHLB 4BNKA 5THQA 2H1CA 3GNLA 4ZVLA 2WP0A 1TQHA 1CEXA 3H4TA 2R6DA 4MCIA 1RBYA 5HZMA 3KJZA 3PGVA 3Q5DA 4JBYA 4JOCA 5DLDA 3MTEA 1V6CA 5LA6A 3HNOA 5FA6A 1LPOA 1JG7A 4GOOD 3WLSA 4U7HA 3ZU2A 2ZRAA 1LNSA 2Q5LA 3HCNA 3NC1C 3UJ3X 1Q6ZA 2K7ZA 1C3LA 1WAMA 4FMDF 2NZWA 4ZVQA 4KOAA 2QYSA 5IARA 2X0FA 3UUGA 2B7BA 4I99A 4DUGD 1XN1A 3KKNA 4LZNA 1A9SA 1ZMTA 4RZ3A 1N0UA 1Z8HA 4EMSA 1M34E 2J9ZB 3QFCA 3WWYA 4G4GA 3JAWA 1TJPB 1PR1A 1QORA 1Z5WA 3IHLA 1MRSA 3L0PA 1CS4C 1U8FO 1US8B 2BL4A 2NUPA 4HX9A 4RD3A 2QRGA 2C2HA 1N78A 4C87A 3BCRA 4ERNA 3JX9A 1XEWY 3CS3A 1V1RB 3VGPA 1UQTA 2IEDA 2ISQA 3Q41A 5EXSA 1J1ZA 5C8VA 1E9CA 4GPTA 5DI3B 4JL8A 3EIXA 4OLFA 3UJCA 5JSUA 4EEKA 1NQVA 2Z57A 3GX1A 1ZN7A 2OCBA 1E5DA 1IPFA 1DFHA 1Y3CE 3LHDA 1X86B 2I1LA 3EYAA 3MJEA 3ZYCA 4FZ3A 1COWD 1RADA 1Z4LA 3V4LA 2O06A 1E0SA 2HM7A 2XUDA 2XRFA 3HP4A 4M9ZA 1Y6RA 1MO6A 3A3KA 1E3QA 3ZQKA 4DVGA 3ZGZA 4C7KA 1PT7A 4E22A 3E22A 3ZCUA 1S01A 3RVQA 5BVGB 5JAOA 3LBYA 4IL5A 4M86A 1FXWA 2R7KA 4MYCA 3OOJA 4TL9A 1X8JA 5DNAA 1IK6A 5BQOA 4KR9A 4EARA 1WDLA 1KVRA 3LVBA 1LPAB 4ZT6A 1H8HD 5CLLA 3RK4A 4TUYB 3HO8A 4L75A 4BMYA 2NV6A 2VH2A 4X90A 2EKBA 4XE5A 1YQUA 2O0JA 3H2SA 2FLKA 3CE9A 3T3GA 3U4CA 3ZY6A 1EUZA 4PQYA 1MKYA 2VPQA 3DTNA 4Q16A 4JEIA 1NFQA 1RQPA 1XYGA 2PX8A 4CIAA 1TVEA 4RCVA 1AHIA 1WPGA 4TSRA 3RD5A 2B8JA 2FOIA 2BTOA 5THXA 4FE7A 4NE7A 2XQIA 2YV1A 4MYSA 5TEVA 5BRJA 3UWMA 2RHBA 3MTIA 3O93A 2V8OA 4AJOA 4N40A 4ZVUA 1FU7A 1LY1A 2WUEA 1X80A 4HUQA 1SVLA 2E3JA 5DHPA 5J4LA 5A5EA 1TEZA 1YACA 1Q1ZA 4CT0A 3NDPA 4I5EA 3FBTA 5FPPA 2ZQYA 3OTWA 2XV1A 2J1LA 3WG9A 4GVPA 1JR2A 4QECA 4FFNA 3LC0A 4RZ2A 1RE0A 1PFUA 2XGSA 3DQQA 1T6BY 4MW2A 2DRIA 1YDFA 4GNRA 4J90A