3U19A

Crystal structure of acylenzyme intermediate of de novo designed cysteine esterase ech13, northeast structural genomics consortium target or51
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
195
structure length
194
Chain Sequence
GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKAEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords artificial protein OR51
publication title CRYSTAL STRUCTURE OF ACYLENZYME INTERMEDIATE OF DE NOVO DESIGNED CYSTEINE ESTERASE ECH13, Northeast Structural Genomics Consortium Target OR51
rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 62
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3u19A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u19A01
2G06A 4OFZA 4Y2JA 3WKEA 2C88A 5ALKA 4BEWA 4F71A 2GHQA 1RKQA 1RQLA 5AW7A 3UM9A 3NIWA 2FEAA 3L1UA 3SD7A 5AW9A 3MN1A 3ONNA 3A1EA 4UU1A 1RPZA 3HYCA 4YIKA 1IWOA 3U7EB 4UU0A 1VJRA 2I6XA 1LTQA 2HEGA 5ALRA 3ZU6A 4GIBA 4UMVA 1RLOA 1RLMA 2YFYA 3KDPA 1XP5A 1WZCA 3NALA 2JAOA 4NFLA 5AVZA 5ALDA 3KC2A 5AVTA 4KNWA 5AM0A 3L8EA 3U7HB 4Y2QA 3PCTA 3HLTA 3BWVA 2RBKA 4AS2A 1S2OA 2MSNA 4OHFA 1YJ5A 3QU2A 5AKIA 2ZBFA 5ALJA 2ZBDA 4FYPA 3MPOA 2ZBGA 4BKMA 1ZD4A 4EENA 1WR8A 1VJ5A 3B8EA 1RQNA 2I54A 1KYTA 4RETA 3U26A 5AKZA 1TE2A 5AVSA 1U7PA 3NUQA 5IT4A 5ALGA 2DQSA 3QU7A 1L8LA 2EATA 1L7PA 1QQ5A 2YJ6A 3E8MA 3VAYA 4Y2UA 3AR8A 4BEVA 3RFUA 3ET4A 3B9RA 5IS2A 1Z4JA 3QU5A 3QUQA 2IOFA 2FPSA 3I1YA 3QUTA 3ZI4A 2B0CA 5AI0A 2R8XA 4HGOA 3FPBA 2QLTA 3B9BA 4Y3UA 2HDOA 4H1WA 1RC8A 5ALFA 4NWIA 5ALXA 3UMGA 2GFHA 1Z5UA 1L7MA 2YMPA 4AP9A 3L0BA 3AR9A 4HGPA 3WKBA 5AM2A 3E81A 2JGAA 5ALEA 3OPXA 4CE6A 2R8EA 3J7TA 2P69A 5AVVA 3ZVLA 5AKHA 3L1VA 3SKXA 3ZUPA 2HCFA 2EAUA 4UM5A 4B6JA 3ESRA 2HX1A 3OCYA 5ALWA 5AK3A 2VKQA 5AKJA 4DCCA 4G63A 2IOFK 3WK8A 5AESA 2YN4A 1RDFA 3AR2A 5AW6A 4EEKA 4J2TA 2PKEA 3N28A 2P27A 3SKYA 2G09A 3QUCA 5AM5A 2YMMA 1NRWA 3I76A 2HF7A 1U2TA 3KZXA 4Y2SA 2G1AA 1WPGA 3N07A 1Z4KA 2HI0A 2Q4TA 3ZX5A 2CN1A 1RLTA 2WF7A 3ED5A 1ZD3A 1TJ4A 2NYVA 4KX3A 2GHTA 3NANA 2ODAA 3E84A 4I9GA 2OA0A 5AW1A 1SWVA 5AK6A 3W5DA 3U19A 5E0OA 3WKAA 4HGNA 5IT0A 4NAVA 3L8GA 2G80A 1U7OA 3ZX4A 2C8LA 2RB5A 5ALMA 3U7FB 4ZEWA 1Z88A 2CFSA 1O03A 4EX6A 4PNHA 4BYGA 3AR5A 2G0AA 4Y2TA 5ALVA 4ZEXA 3ET5A 3BA6A 3NAMA 2ZBEA 5ALTA 2HO4A 3IRUA 1L8OA 1ZD5A 2I33A 2O9JA 3OCUA 2OM6A 1Z4NA 3F9RA 3DAOA 3D6JA 1EK1A 4XE5A 4L6CA 3ZWDA 1L7OA 4Y2VA 5ALHA 3R9KA 1Z4MA 4CNQA 3QYPA 2GO7A 1RKUA 3SMVA 2GMWA 2WHEA 2YBDA 4G9BA 5A3SA 5ALQA 3K1ZA 4XQ0A 3GYGA 1QH9A 3L7YA 2AMYA 4NV0A 3OCVA 2FUCA 4IG4A 5AVRA 2IA5A 2PQ0A 3OCZA 5AKLA 3IJ5A 5AKKA 4BX2A 4OD0A 4KX5A 3CNHA 5AM1A 3L8FA 1RKVA 4YIHA 3QU9A 2YMQA 4MUMA 3TLMA 2BDEA 3WK7A 5AW0A 2IOHA 5AW5A 5JJBA 2HF2A 3OTQA 3NASA 3IB6A 1CR6A 2YJ5A 2R8ZA 3QUBA 5ALIA 2FUEA 5A3QA 4EZEA 1NF2A 3L8HA 3MC1A 1YMQA 3CZ4A 5AI5A 1YV9A 2OBBA 3A3YA 3QXGA 4UAUA 1ZRMA 1QQ7A 4HAIA 3AR6A 4HYTA 2FDRA 2ZXEA 3FM9A 2WF6A 2Q5EA 3OCXA 1L7NA 4Y2YA 1ZJJA 3L5KA 1Z4IA 3E58A 4YCNA 4QQFA 4E88A 3WGUA 1L6RA 1Y8AA 2B8JA 3SF0A 4ZEVA 4C4RA 5AKXA 5AI4A 2Q4RA 3N1UA 3W5AA 4DW8A 5AI6A 1Q91A 4HGRA 1T5SA 3U13A 1WVIA 5ALYA 2NO4A 4Y2RA 1YDFA 2CFRA 2YMLA 4UW9A 1Z4LA 1U02A 4J03A 4RESA 1JUDA 4I9FA 3ESQA 4FFDA 5AM3A 5AK5A 2W4MA 1LVHA 2G07A 3WKDA 2JARA 5AM4A 5AICA 3KBBA 2OYCA 5AK4A 3L0CA 2RAVA 2FI1A 4JDPA 4UMFA 4BBJA 1VFPA 3I6BA 5ALNA 3QNMA 2I55A 3FGOA 3KOOA 5AIBA 4YCMA 4YH1A 4XPZA 1N9KA 5AIAA 1K1EA 1O08A 3S6JA 2WM8A 5AKEA 1PW5A 5T41A 4EELA 1F5SA 5ALLA 1RMYA 5AW3A 1TJ5A 2NO5A 2R8YA 5AHXA 2QYHA 2D2VA 4KNVA 4C4SA 4Y2XA 3SHQA 4QJBA 1T5TA 3R4CA 3EF0A 5AW4A 3PDWA 4NABA 3WKCA 1SU4A 3ZVNA 3AR3A 3M1YA 4BX0A 5AVUA 4DWOA 3M9LA 2I34A 3MMZA 1Z5GA 2X4DA 2WF9A 2ZOSA 3AR7A 4BNDA 5AW8A 2AUTA 3ZVMA 4IFTA 5AVWA 4KYTA 5AVXA 2EARA 2BDUA 2C4NA 3PGLA 4UM7A 2FPRA 2HHLA 1XVIA 2MU1A 4YGYA 3ZW7A 3FPSA 4FE3A 1ZS9A 3EF1A 3U7GA 4BNDB 1EK2A 3ZWKA 4O8CA 2HOQA 1N8NA 1RRCA 5ALPA 1QQ6A 2AH5A 5AI9A 4C4TA 4YCLA 1FEZA 4HGQA 2C9MA 3R09A 3OCWA 1MH9A 1YNSA 1ZD2P 4L6AA 4XOUA 5AW2A 3WK9A 4UARA 2WF8A 2AGVA 4L57A 2CFTA 3WGVA 2B1QA 5AI8A 3SLRA 2YJ4A 2I7DA 2WFAA 3W5BA 5AVYA 2JAWA 3A1DA 5ALUA 4CF5A 3EWIA 4F72A 1YS9A 1SWWA 2IYEA 4Y2PA 2P11A 1AQ6A 2PR7A 2YJ3A 1ZOLA 3ZTWA 3QX7A 4UMDA 3QLEA 4JB3A 2BY4A 3FZQA 3N5KA 3QGMA 3I28A 2G08A 5AKGA 3QU4A 4KN8A 4MWOA 3DNPA 1S8OA 3FVVA 3PGVA 1J8DA 4UAVA 3DV9A 5AVQA 3WK4A 1TA0A 1ZRNA 3NRJA 5AKYA 2O2XA 4AS3A 1CQZA 1T9ZA 3ZTYA 5ALZA 2HSZA 1RMTA 1Z4OA 2YY6A 4OCZA 3UMCA 4CF4A 4DFDA 1Z4PX 2RARA 2B82A 3WK5A 1U2SA 1Z4QA 1X42A 2B1RA 1RMQA 5ALOA 5A3RA 3KD3A 1QYIA 1TJ3A 2JAUA 4UMEA 3DDHA 3N8GA 3UMBA 2W43A 1NNLA 2W11A 3A1CA 3WK6A 4GXTA 1XPJA 4BX3A 4CF3A 2WF5A 4EX7A 5ALSA 4UATA 3P96A 1J97A 2FPUA 5FP0A 2B8EA 3EPRA 3W5CA 3AR4A 3RF6A 2P9JA 2C8KA 2FPWA 1Q92A 3L0YA 4UASA 2B30A 2ZG6A 2FPXA
chains in the Genus database with same CATH superfamily
1PJ2A 2BEVA 3TE6A 3MNFA 3V00A 4HWTA 4KI0A 4BUJA 1HL7A 2VUTA 3FFAA 1N1EA 4UDYX 2IUTA 4Q3KA 4RU1A 3WLAA 3SC6A 1EIWA 4FB5A 1THGA 3A2MA 5JFGA 1G5PA 1C30A 1J8VA 5J40A 1R5BA 5CCBA 1HORA 1R4MB 2AT1A 1P77A 5LZ8A 2R87A 1OU4A 1Q0SA 3DEIA 3EBLA 1F14A 3HPQA 5K99A 2EX0A 2OCDA 3GFFA 1LPBB 3EGIA 1SCUB 3GLIA 3IYLW 1K62A 5F5XA 4O1HA 5EKDA 5FKJA 5K8JB 2CC2A 5C81A 4RE5A 4Z4HA 3MMNA 4DA8A 2EGGA 2KE5A 5A3JA 4G0ZA 2PNJA 4MYDA 3SYNA 3HBMA 4IEIA 4HXEB 1XVUA 3HVUA 3HVIA 4RF2A 1YQEA 2GI4A 2PZBA 5L53A 4DJAA 3IIJA 5CA1A 3WWDA 2Y66A 1NN5A 4DQUA 2VBIA 2DUMA 5ALDA 3T5MA 4ZOLB 5F4ZA 2FW8A 5IDQA 1JV2B 1WWKA 3L8EA 3LHDA 2QYSA 3MAJA 3KG2A 5GM1A 5CDYA 2IPXA 2ZU0C 3SK0A 3OI7A 3GGDA 3ZLVA 4G5HA 2MSNA 3EXIB 1MF7A 1RWOA 4PGAA 3RS4A 1L3CA 3P4XA 4W99A 5ENVA 3MPOA 4WOBA 2P68A 1V7CA 2V6IA 3E9QA 4F12A 5GJBA 4X64B 3QVOA 1AGYA 3GJ7A 2CYCA 4JIMA 4PGFA 3BORA 3O90A 1VJ5A 4UD2A 3I8SA 2BH2A 5KDDA 3MIIA 1DJNA 1G8AA 3ETGA 2XCUA 3F96A 1ZESA 3RU3A 3FWPA 3AHDA 3K7EA 1KFEB 4GZ5A 4JOQA 1E1CB 4DJJA 3ZHUA 5KVAA 5JS1A 3QU7A 4R0MA 1EJ6A 1BIFA 3EVDA 1OKKA 1NYRA 2WWIA 2JLUA 1MVLA 3NHAA 2XGSA 3VZPA 4DMMA 2D8AA 2GBIA 1SVNA 2QAGC 3LHFA 1G6Q1 2OHXA 2C2KA 4L4RA 3CN7A 2JFVA 2OCGA 4BE7B 1TTTA 2VH1A 4LC0A 3AR8A 1D7OA 4KAAA 2NU8B 3D7LA 3RFUA 3TBHA 3S0JA 3HLYA 5DNVA 1NJ1A 3NH9A 3V4SA 4CQLB 2DQZA 4BN0A 4WXHA 4L78A 1LRKA 1RVV1 3ISJA 4OXQA 3VM6A 2FN7A 4M3NA 4RKFA 1YHZA 2N46A 4IFEA 1WB9A 1L9KA 2ANBA 3ZU2A 4UXHA 3SYKA 3BAFA 2OOKA 3K6SA 3ZZ1A 5YASA 4B46A 4OHKA 4HGOA 3KLOA 4LGYA 1Q44A 1NXQA 4LRYA 1XWIA 2HDOA 3IP7A 2XY4A 4IV0A 4DIKA 4NWIA 3ZJTA 2HRZA 4H2DA 3U9TA 1YACA 5BNZA 2PQMA 2BGMA 4O59O 5ICSA 3L0SA 3A4IA 1H4TA 4L4UA 4RDIA 3DOIA 5AVKA 2EFYA 3KE9A 4BZQA 1IM2A 4QNMA 5J1SB 4Q24A 4CF7A 1WXFA 1SCDA 3EZYA 1SBZA 3M6XA 2G17A 1X86B 2I66A 4Q6WA 2OGTA 2R8EA 4YQEA 1JYEA 5D01A 1X19A 4PXYA 4ED9A 1RBZA 1WETA 1JIJA 3ZV6A 2NO0A 5A2QA 4BFTA 5KX5F 4IXDA 4L3WA 4RHFA 4JI0B 4P4SA 1IZ0A 2WABA 4BNTA 1L2TA 2BE9A 4J76A 5I7VA 4B6JA 4RPGA 1KORA 1XX6A 4OL9A 2DERA 2JFZA 3HCPA 1FJXA 3P2MA 2HRDA 1CY6A 1JFRA 3EIOA 3GGSA 1ZA2A 3JWGA 4X6LA 3ZDYB 2V6GA 2XLCA 3HY4A 5HZMA 1Q6ZA 1GOTA 2B7LA 3KJGA 4OV6B 2A5FA 1E58A 4EHBA 3NOQA 1RDFA 1KVTA 4F2DA 3PR2B 3N28A 1D2EA 2B34A 2VDVE 4ZCRA 1ZIOA 5BQXA 5JQGA 3G1WA 4PPFA 4WQMA 3NNDA 4W5QA 3DDSA 5IAKA 4HZUA 1GPJA 4CV3A 5F73A 1PJSA 3HVKA 3DDUA 3M4NA 1EKXA 3IO5A 5JV5A 3PPXA 3ELDA 1MEJA 1FOEB 4FFPA 4EI2A 1ZD3A 1TRKA 3E2PA 1CRLA 3PT5A 1O9BA 5CNJA 3IIKA 2WJIA 4MDYA 1EE9A 3QI2A 1P9WA 2OXRA 4IYJA 1PT8A 5KOIA 2OORA 3RTGA 5L3SB 2VAWA 4D9BA 2SBTA 4JITA 1HE2A 3OEHD 5IC5A 5A3VA 4PLWA 4QZVA 5LJIA 4HWSA 2WNSA 2PJRA 1DSSG 4RHCA 4MGZR 4H35A 1WBJB 4I9GA 3EFOA 3N8IA 4R1LA 5E0KB 5GM2A 5EZQA 4O4LA 4G09A 1Z6ZA 2CV1A 1YNOA 3W5DA 2FWAA 3BTOA 4IICA 3TS1A 1JDBB 2BEWB 2FR8A 3KBOA 3REGA 3OPVA 3T7KA 1N2IA 1ZGAA 4TT8A 3EW9A 1KVRA 1O6ZA 1OWMA 3QLUA 4GQIA 1X0VA 3VR4A 1A5BB 1JR4A 3IX7A 1U0BB 4U2GA 5J9FA 3WNZA 2C4KA 2ZYDA 3KDSE 3AL2A 4DRYA 5IJ0B 1NQXA 2NADA 4B45A 1A5SB 4QYIA 2QXYA 4JI6B 3GRPA 5CNKA 1GUZA 2G0AA 4FOTA 3B5IA 3TIVA 2PFMA 3RU7A 1KK2A 1NHGA 2ZIFA 3I34X 4FNOA 5J2TF 2WIGA 1Q2XA 3D7NA 3N8DA 1SBHA 1MR3F 3MD9A 2GERA 5TQJA 3BHMA 1RPAA 2PIDA 4U9IS 2V0GA 1MIOB 4HMPA 3Q8LA 4PG7A 1VHTA 1U7UA 3PIIA 2YXBA 1WCIB 5CB0A 2X2FA 3ASZA 1KAHA 1F2TB 4WK0B 5HDQA 3VR3D 1S3FA 2SKEA 4HNHA 1R5OA 1ZN7A 3FCYA 1E9RA 2OECA 2P1DA 1U8UA 3BHJA 4G9BA 4Q9IA 2GAOA 2I2FA 2Q0HA 1GGHA 3MQ4A 3LNTA 1CXZA 3VHQA 3ZZ0A 2C1ZA 4D79A 4OK5A 7REQA 1BMFA 2UUPA 4YAFA 2CXQA 4M1TA 1IHUA 5E1BA 121PA 1FBNA 2WE8A 2IYSA 2X42A 3G5AA 2QUBA 1JIQA 2HJSA 3H9BA 2J08A 4GKBA 1C3OA 2TMYA 4NV0A 5K3DA 2NU9B 4ZOQI 4DB2A 2OCKA 1RAIA 1Z83A 4CCAA 2KBEA 3FFWA 4FFWA 3IJ5A 5AKKA 3I2JA 3ZNPA 3FYCA 4RD2A 2C4MA 2OPBA 4IS2A 1O5TA 4CTKA 4HX9A 2CLEB 3UO8B 4MUMA 4ARZA 1LWOA 1DXOA 2QR5A 2LIVA 4FLMA 2JAPA 4QC2A 4B3MB 1VJ0A 3DMGA 2OE2A 3CBGA 4C2TA 4YRCA 5CA0A 3T41A 1Y6FA 2QLFA 4RW0A 3FNHA 1RKXA 4IIGA 4AY2A 2AWNA 2QEQA 2VYND 4IIJF 4KXUA 4TLMB 4V0RA 3F90A 1B43A 2Z9CA 3WQSB 4JA0A 3OZFA 2NV6A 3P9XA 5EXDA 1HDGO 4LHXA 4E31A 3TECE 1DBSA 5E38A 2Z9DA 3LI2A 3CURA 3D59A 3MC1A 4X1YA 2HA0A 4AJNA 4DADA 4CKBA 4D57A 4IV8A 3ESYA 2BRUA 4HAIA 2GJKA 2ZVPX 5FD8A 3OOSA 4DOMA 2IXBA 3A31A 4KFRA 1WSDA 3AF2A 3SXUA 1DUVG 3LT0A 2OV8A 3DFZA 1T3HA 1D09A 1UBUS 1Z5NA 3C45A 2ZRGA 3EARA 6REQB 4D46A 3KQKA 2ZJ3A 1R15A 4I5EA 1K68A 2ZUBA 2IPLA 5H81A 4ECEA 5IAAA 1Z2PX 1DCNA 1K8QA 1XU9A 4W8GA 1NBMD 2X2EA 1KR5A 1E32A 2NXEA 3SF0A 1JHXA 2CLSA 1XAJA 3PXUA 1X92A 2R79A 4LHEA 3DKVA 3BB4A 5J4LA 1CQIB 2H7CA 4A2QA 5B55A 3PPVA 3VO9A 1U7ZA 1DBWA 4DSUA 1O54A 3KTAB 5K45A 2NQ8A 2OHGA 3GEMA 1NVTA 1JRLA 4J0CA 1YZLA 1FK8A 1V3UA 2QSJA 3O94A 1G8MA 4IILA 1YDFA 1BEEA 1Y6RA 2ZR7A 5E4JA 5H4HA 4K05A 4KFCA 4UBOA 3LOQA 2FZGA 1B0AA 3KU4A 3G8CA 3UT6A 3VH4A 2A1IA 5EJAA 2FR1A 2BCGY 3IPRA 4CV2A 5HQJA 4HN2A 4F5ZA 1IHOA 1Z2EA 2OQ2A 4JYMA 4MJ3A 1LVHA 4QGHA 4YVFA 2QX4A 3OESA 3R0IA 3TTTA 3KYJB 5AM4A 4MVYA 1KZ6A 1LS6A 1NGSA 1T5HX 1TK9A 1YS1X 2UZ1A 3O75A 1KE2A 1VYHA 5LBUA 2G9VA 3X43A 3JARB 3L6EA 4AWXA 3GUYA 1DZ3A 2B9VA 3L05A 2FI1A 4HWGA 5DHPA 4KDCA 4DLNA 2XYRA 4FZJA 5AP9A 1JU9A 2RB4A 3DPSA 4JFRA 2H1FA 5U1PA 4YMHA 5JNVA 2CJWA 1ZJWA 1X7ZA 5H02A 3HJTA 5EP1A 3S6JA 1NLYA 3A6EA 2IYZA 4KB5A 1FDRA 4EELA 4KR7A 2IU6A 2QUIA 3TNJA 1IN8A 1XC7A 2Y68A 1EXDA 1QZUA 3A04A 3G5LA 3UPTA 2IS1A 3SOZA 2A5JA 4PICA 3VKGA 1H8ED 1YZQA 2ATCA 4HQOA 5IAGA 1U2GA 2WU3A 3JQCA 1IY9A 1ZK4A 2A0YA 2LBPA 4NC9A 1NNI1 5BN1A 1X1EA 4LOKA 5B7PA 4II3A 4RVHA 4II2A 5DCWA 1T3ZA 2FVYA 1RJFA 1RM4A 2HFKA 2WM3A 2ZB7A 1DL5A 3B1FA 3BUSA 3KTDA 3KUKA 4X91A 2C77A 1PT5A 2CDNA 1NVWQ 4FBMA 4UHEA 3HYNA 1TZMA 2P8JA 3MWYW 4X45A 4DIUA 4YJFB 1VMIA 1EFDN 3MSXA 4PZLA 3AZQA 3KZOA 3SZ3A 2YZ2A 3K73O 4EVQA 4PNEA 4OP3A 4MQLA 2VT3A 1AKTA 4N4AA 4P84A 1JN0A 3BFJA 4DSAA 1AO0A 3TG8A 3CCBA 4ZJZA 5AVXA 1P4RA 3MT7A 4CUJA 5L7YA 4MS4A 4WIAA 4AP6A 4N03A 2V7XA 2BR4A 2OD9A 1A76A 2Z2YA 4XUGB 4BU0A 1RVDA 1KERA 2H4WA 2QM3A 3FJ1A 4D7AA 1GQYA 3Q2OA 2XZDA 1QVAA 3LL4A 1VHJA 4JP3A 1KRHA 3WDSA 3OEEA 1YU9A 2JH9A 1YS6A 3GJTA 2WLTA 4ER6A 2CD9A 3LC7O 3MWDB 5ENDA 3SY8A 5BPFA 2X6RA 2GF2A 1XQ6A 5GADl 3L7NA 3KQTA 5F3WB 1SCIA 1MOPA 1VA5A 3RTBA 2ICAA 3A3NA 1L5LA 3B5JA 4MRAA 5KYTA 4ZFNA 1EWYA 3EGEA 2J7PD 2JCXA 2VN8A 3CY6A 1DOFA 2ZUWA 3H7AA 1PW7A 4WNAB 2GJ8A 2EGUA 4G0OA 4O2BA 3DZFA 1GZ6A 1LSSA 4WFKA 3GI1A 2O8BA 4BP9A 3GRYA 5F78A 1EGHA 1H0SA 1F4LA 1W5SA 1GGFA 1PJ4A 2B1QA 2H8GA 4ZTZB 3DBHA 3KHTA 1DG1G 1NBHA 1H65A 3AL3A 4WKNA 2O50A 3RSSA 2JAWA 1QP4A 1VOTA 3EWIA 1JDUA 2XSZD 1YS9A 4FQ5A 4HB4A 5LZ5A 3VMFA 5FUVA 2G82A 4IM7A 3QTBA 1FIUA 4NH4A 5BRNA 3D8NA 3ZYCA 4YO8A 4MA0A 3SQNA 3BPSA 3R6LA 4TUYA 3K1TA 2DB3A 5EAIA 1QHFA 3CO5A 3HNPA 3QWIA 5EMKA 2Z09A 1PUXA 2VWGA 5L45A 1XG5A 5BYAA 2VLBA 1KH1A 1NVMB 5H4GA 3E9DA 2G0TA 4CL3A 3C3KA 3RLFA 4ZQBA 4EMSA 1N2BA 2B3TA 3FOEC 2VPIA 4IMPA 4Q1AA 4Q9DA 1P72A 2GM9A 2PTHA 3ANXA 1TF2A 4XR4A 5JR3A 4A8JB 1E8NA 3ZPXA 1NIJA 1EBFA 3ETCA 3EEQA 1SC3A 4DFDA 1E9VA 1U8FO 3P27A 1HC7A 4TSFA 1L7EA 3T5DA 5CFNA 4MWEA 2E85A 1USGA 2RGAA 3GLQA 1JHOA 1PFYA 4M98A 1OBVA 1BWSA 1CB0A 4IZ6A 3SSOA 1KMCA 2AN5A 2QLNA 3JZMA 5A7GA 2IV7A 4O02B 8GPBA 2D0OB 3HSKA 4HAWA 1IEQA 1ZN2A 2D3TA 2V5AA 2R6GA 3TW8A 4WK2B 4S0XA 4UQOA 4F06A 1NRJB 4IIHA 5BRAA 1CQPA 2D4HA 2F9FA 2Q3MA 1JDZA 4BO2A 2FP4A 3PENA 3MJFA 2ZULA 4DXAA 3F4BA 2YIJA 5AVOA 2ZCUA 1L7AA 4TLAA 1Z75A 1E1LA 2QBYA 1W88B 2PAFA 1EVEA 1FUYB 3O4HA 5I47A 1SO8A 1Q92A 5U4XA 3EA4A 3OJCA 1QS0B 3G2NA 5J59A 3K0FB 1G42A 4RF5A 1Y6JA 2Q6TA 5CFLA 1ORTA 1ZWKA 1RCFA 1SAYA 1R0SA 2AN3A 2I6GA 5CT6A 1TJ7A 2A4KA 4JLPA 3ROGA 4HDMB 2FEPA 3V1NA 1VMKA 3WZ2A 4EJSC 1PQPA 1N36B 3BWMA 3KLPX 1VPLA 2J0UB 4NJOA 4D0GA 5LN1A 3HCFA 5AW9A 1YULA 5K0EA 3AFIA 2J5BA 4CLOA 2AEFA 2W71A 2XQVA 3OZGA 1IQRA 4E7PA 3U5TA 1T8YA 3U7JA 2A84A 2AJTA 4E5SA 2VDMB 1E9DA 4TTVA 4XKJA 2HEGA 4QDUA 1KHHA 1YHNA 4IRUB 3PNPA 5ALRA 5K3EA 4O3MA 2ZJYA 1RLMA 5ESRA 3TZHA 4DNPA 3P4YA 1QANA 3DEYX 1ZMTA 3UBTA 1ZIXA 3AV3A 5DISB 2PG3A 4CI9A 3T9FA 4CEIA 2PZKA 2JAOA 2CXTA 3VGJA 5CT9A 4GECA 2P62A 2JLSA 3DOJA 4XDHA 2COUA 5BV1A 2V1UA 3QJYA 2PMKA 3AOGA 3VU1A 2MSCB 2QE7A 5G1OA 4MSUA 5AVTA 3FSRA 1XUOA 5J43A 1VPVA 3ENNA 3BULA 3UKDA 2Z5VA 4WBXC 3OP1A 3PNQA 3K2QA 1BMQA 1VRWA 2X7JA 2QKYA 2BWJA 2HRCA 2W2MA 2ZR9A 3C3WA 1PYGA 3NKFA 1JLSA 1WPQA 4HAUA 4EJFA 1XKQA 3QSYA 3BIFA 4QGGA 1STOA 2H4XA 1RWNA 4I14A 4RJJA 3TRJA 4NCAA 2P2LA 1N0HA 4R1QA 3JASA 4EENA 2QOEA 3G68A 4ZVVA 3FSEA 3WNBA 3OQHA 4NBVA 2QLMA 2YHIB 2YHUA 3INNA 4OXIA 3IEKA 1E59A 2FPOA 4C30A 3RNOA 2X13A 3RAEC 2FPMA 4HWPA 3TSAA 4GX2A 3HDVA 2RAPA 2ZI3A 1V8DA 3MLBA 2C2GA 4HHEA 4MB0A 5KCMA 5TXGA 1Y5IA 3N8HA 5BR4A 1LX7A 1ZD8A 3M34A 2XR1A 2Z2IA 3JXEA 3CR8A 4MZXA 3RHSA 3CBQA 1Z6QA 4NZZA 4OYLA 4PINA 1LH0A 1XOIA 3LTEA 1I32A 5E6RB 1L1FA 3IVGA 3EGCA 5ESWA 5CITA 9LDBA 3N0TA 4MW1A 5THKA 1RJWA 2OAQ1 3B9RA 1JI3A 4I9UA 5IS2A 3NR2A 4N0EA 1Z4JA 3WL3A 2BHSA 4LG1A 2FQ1A 4KR9A 5G4KA 1MV8A 4C22A 1QUEA 1SKBA 1YC5A 2CXRA 3K5IA 4FGUA 4OQZA 4WZ6A 4HNVA 2OHJA 4UE2A 1JDTA 1KEKA 4LZPA 3P9YA 3WIBA 4CIVA 3OWXA 1ULZA 4XGKA 2HA6A 1XXHA 3DBRA 2DPGA 2AR9A 3D3EA 4TYNA 1YKGA 2GZ2A 1SELA 1O97C 1YZNA 2Y8EA 3JYOA 4G5QA 4H7JA 1LK7A 4IKPA 1MFZA 4KN9S 5CTAA 5ALXA 4NHEA 5HJ7A 1C3EA 4ZAGA 3Q1KA 2HAEA 1U31A 4INJA 5KU7A 1KQGA 3KSAC 4EJMA 3OICA 2G77B 2JHCA 2QL7A 3TFWA 3GWZA 2CEAA 1FUUA 3FNRA 3MOSA 3WYCA 3CKYA 5LP1A 5JS6A 1N7HA 4KITB 1BGWA 2O1EA 5LQNA 4M9UA 2QZPA 1GUFA 2ZJ1A 2HWXA 1U99A 4PAGA 3LYLA 4RFVA 1UZMA 5FLKA 1VE5A 1DT3A 4BGEA 4YRPA 2QW8A 4E3WA 1QMGA 1V96A 2RGNC 3SEQA 1SRQA 3JVIA 1UMCA 5ALWA 2RJOA 1AF7A 5BSWA 1HMYA 3T9BA 2JB9A 5AKJA 1E18A 4QEZA 5KDLA 3VPHA 3WBKA 4EPRA 1XTSA 2QENA 4W9NA 3RS5A 3Q9NA 4ZHQF 1E4OA 2IOFK 5LB2A 2O8CA 1E9EA 4TS3A 1EFPA 4RTMA 1PR9A 2MT9A 3A06A 4TMZA 5TF0A 2QLLA 4D81A 1LQUA 3WJAA 1ZAKA 1K27A 3LFUA 1CUBA 4I0WB 2QTCA 1Z39A 2Q99A 4RTRA 5F2NA 1XLTC 2ZJ0A 4NCXA 2YMMA 3FLEA 3VKVA 3IUYA 4OHCA 3WJ1A 4DA4A 1JJAA 1CTQA 2GDJA 3KZXA 5C51B 2PLAA 5BVHA 1FFXA 2JBAA 1AU9A 3E7FA 4E11A 2FG7C 4LYEA 2CN1A 4F9TA 1WXQA 1EFKA 1N0IA 2WF7A 4B40A 3TRFA 4CIWA 2TSYB 1H93A 4TTIA 3RUCA 3ORHA 4CN9A 1EG2A 2ODBA 3M33A 3Q7PA 4RXUA 1N7JA 1EA7A 2DHDA 3E03A 1Y3FE 3KPJA 3H4MA 4H1TA 3L01A 4IINA 2HQRA 4QAJA 5G0WA 4CF6A 2BMJA 2WTUA 1SK8A 2IP4A 3FDFA 4AYTA 2HDWA 3FPKA 4MP6A 4NENA 1P44A 1POWA 3F5FA 2PCJA 2QIOA 4EATA 2OA0A 1Z0AA 2B99A 4LK3A 5H3CA 3FUUA 1SWVA 3GVCA 4F4IA 3O73A 4PS1A 4NQRA 4MGYR 2BMVA 4RVNA 2C5EA 5T8KC 2TMKA 2D0IA 1Z5VA 3HKCB 4MARA 3E27A 1V6AA 1IJFA 2ZXFA 2EKDA 4ZO8A 2VP3A 1Y48E 4DSNA 5CDTA 3K96A 4PN3A 4MAAA 5CAEA 5FWYA 2DXIA 2CSXA 4M1MA 3RJZA 5EJEA 1DAEA 4YJHA 1T4MA 5IK2A 3CNOA 3UANA 3JD4A 1UF9A 1O03A 3IOMA 5J63A 2OWDA 2KHZA 3BXHA 3H1AA 3JD2A 5ALVA 2R9VA 4J0HA 5K05A 1OOEA 5DTQA 3RRZA 6ABPA 3FCUB 5JRDS 4PZCA 5K0JA 2D2XA 4RANA 1E6UA 1J2TA 4N6NA 2J3IA 2FRVA 3KSZO 2UVDA 2W8BA 3BJIC 5LXTF 3F9RA 5LUBA 5C32A 3INTA 3V7UA 2QX6A 4IHQA 4FFMA 4G0PA 1XRQA 4V0MA 2NUPB 2IZ5A 2PRYA 4R69A 3FMGA 1Q3KA 4Y2VA 3D4NA 1FUEA 4O4IB 2OZLB 2XYGA 2WKPA 3WK4A 4AP5A 4TV8A 4RIEA 5ITZB 5B7NA 4RH1A 4BE4A 2XZLA 1G3QA 3KWJA 3GZNB 4QUIA 3HTXA 4H3SA 2BTOA 4IIXA 3KXKA 4MVJA 2AUNA 5HFJA 3T1VA 4EY3A 5MGNA 1K88A 5LLDA 2IIVA 2H85A 3K1ZA 1MT3A 3PA8A 3FTPA 4RA9A 5JZOA 1GNSA 5COAA 3ICEA 1AQJA 1NU8A 5DTRA 1UPAA 5A1JA 8AT1A 2ZB2A 5C5IA 1KQOA 1GLGA 2F62A 2GAIA 4HYQA 2PQ0A 1QYWA 3RVMA 1FFGA 5KYVA 4GC5A 4C4YA 2NYRA 4Y6SA 1MU0A 2ZRCA 5E7MA 4EQ6A 4RPKA 3AMVA 1SXHA 4WMLA 3L79A 1PN3A 3X1KA 1YONA 4WVLA 1QAQA 1E62A 1H22A 1KY2A 4A2WA 1UBMS 4RKWA 2BSAA 1Z28A 4F7WA 4RDHA 3BMNB 3QOWA 2MIIA 4AZ3B 4BO7A 2YJ5A 3H0KA 3WQHA 4ZO4A 2H2IA 2WV7A 3LAWA 3WHLA 3X2SA 3SC2A 5EP4A 3GQBB 4UPDA 1NC1A 1T0UA 3T0GA 4EZEA 4XVCA 4B2YA 3MIZA 5DBFA 4X97A 2XUGA 3VSEA 3AP1A 3GA0A 5ERGB 3TV2A 4XWYA 3OD1A 1FFYA 1YBVA 1EJ2A 2YXEA 4GG1A 4Y7CA 3T4PA 1W48A 3AG5A 4RFLA 2JNWA 1O6FA 1PGPA 1VCIA 1VE7A 2WF6A 3AKCA 5FYDA 3WYFA 4UHHA 3ABIA 3M4YA 4Y2YA 1DX6A 2HU8A 3T3DA 4YLYA 3OMXA 1X94A 3S29A 1BKYA 2AZXA 2ERYA 4E1BA 5BSVA 2IEDA 1M5RA 4QOJA 4A0FA 1TVKA 1EVJA 2GKOA 1Q12A 2B8JA 1AN0A 4IH9A 5H16A 4F3TA 1NMZA 1RWMA 4HAVA 4XM1A 2CLIB 1UQRA 4LRXA 3WXBA 1C8BA 5KVVA 1Z2CA 4DR2B 1WUYA 2GPWA 1JILA 4B7XA 4D98A 5D6NA 1ZDMA 2CK3A 2E49A 1GXSB 3C3JA 3NT4A 5J2UB 1F9EA 1Z0UA 3D9QX 3H5IA 3ORRA 5CDGA 5IVKA 4HEA6 1TL7C 1H1LA 1QC5B 4WZAA 1Y8RB 1UC5B 3DEFA 2ZTVA 2I2DA 4UCFA 1B26A 3WP1B 5IDXA 3SXPA 5BWMA 4J03A 1PGOA 2KBFA 5BWNA 5A02A 1T9BA 3RJ5A 1C7QA 1ODTC 4L5IA 1EVQA 1YB6A 2GN1A 3WKDA 2O2ZA 3UHAA 1QBGA 1N3IA 1G5QA 1UH5A 2HN9A 4C87A 1JT9A 2AHRA 4A1FA 3ROXA 3BFVA 5KQLA 5AK4A 3DMNA 4L5BA 3Q10A 3CJRA 5JAZA 2CLMB 1OLUB 2GPAA 1SUSA 3OECA 1X1CA 2IS2A 3MJ4A 4PG4A 5CJPA 1IBCA 2FV8A 8MHTA 1F20A 4B82A 2ZJ5A 5EWLA 3TH5A 5C8YA 1TZBA 2XB8A 5CLJA 3FI9A 1MOSA 1ECGA 2Q3CA 5IF9A 2Q3DA 1L4LA 4I1PA 5T41A 4IVQA 5EIHA 3K1AB 1KY3A 1KQPA 3AGQA 4QYTA 1KK1A 1TB4A 1V5GA 3KLBA 1GQFA 4MWDA 1JHQA 3ENVA 3GG2A 3LC0A 1QFZA 4RSRA 4GOOD 5C8VA 2JIZA 2C5SA 1OTXA 2JLVA 3SHQA 4QFDA 2IWRA 4R8KA 1RJ9B 3N8KA 2J87A 1FUKA 5IANA 1RZRA 2VJKA 4B84A 1CY0A 1LGYA 5IMBA 3DE3X 3C7KA 1Q20A 4ZGWA 2C3PA 3WSTA 1G21B 2ONJA 1SKYB 2H4ZA 1IH8A 3UMVA 4FQ8A 1BEZA 3AR3A 3SNKA 3WOHA 1MAUA 4XWGA 2G9RA 1WMFA 4DCJA 2OWEA 1MBZA 2Y4OA 5JSHA 3OZVA 4RK1A 3VXKA 3K9GA 4WJZA 2WF9A 3ACDA 3TE7A 1JTFA 3VH2A 4CWAA 1UBKS 3CC8A 2C31A 3O4RA 1PFGA 1O58A 2C3YA 2AG6A 3ENKA 4LYGA 1C9EA 3F7OA 4ZGBA 3NW9A 2G9QA 5JBQA 2ZE6A 2O0KA 2CUKA 2HHLA 2R00A 2V54A 3AO0B 4TN1A 4KIUA 4YGYA 2C9YA 1ID1A 1E5TA 1Z6GA 4FE3A 3PQCA 1ZS9A 5WRFA 3MUNA 2GEVA 3JD3A 3PXAA 2F7SA 2XTAA 4R71A 1NL3A 5HF9A 5BSFA 5B1HA 3EC7A 3T0IA 4WTOA 1QQ6A 4NJEA 4UUOA 3V4LA 4D8TA 1O0SA 4G0WA 3H2KA 2PR2A 3E3LA 1P8AA 3C6ZA 4LC9A 5I7UA 1F60A 3OIVA 4PXSA 3VPFA 3FG9A 5IM5A 1MH9A 4HEA1 3RSLA 4YLEA 3I5XA 2IHNA 4BWFB 5HKLA 3DHYA 3KKEA 3DTVD 3WHPA 2X5OA 2CV2A 2BONA 3FCSB 3DF7A 2J8ZA 4TKUB 5IVPA 4EGSA 1DAHA 5SZKB 4W82A 5C7OO 5KKAA 2QRZA 4NYIR 5EVJA 1UL1X 3DONA 3O9MA 5KQRA 2BIFA 4J07A 3EOBI 1O94D 5AVYA 2G67A 3TLXA 1I6MA 3BQNB 4XM2A 2HPVA 4WGGA 3LQRA 2YW9A 1Z82A 2ISQA 1G8FA 2M32A 4MJLA 3U3KA 5I8WA 4UU8A 2PTQA 3VYWA 4MLCA 4XIJA 2HZ7A 2PX3A 2AYXA 4QNRA 4R6XA 1U3TA 1UBCA 4EY7A 1CS4C 3W9SA 1K7SN 3ADPA 3EEIA 2LCQA 3HWX1 1ORWA 4MR8B 1XLVA 2VF8A 2YIDA 3M1LA 4IMIB 3R3ZA 3BEDA 3RTCA 5C34B 8ATCA 5TC4A 3OX4A 4DCUA 4LF4B 4PN7A 1JQLB 3DV9A 2NSJA 4L9RA 4RZQA 1H2WA 1P7ZA 1N2SA 3QNUA 4AF8A 5JH7B 2BGKA 1PIWA 3WLHA 2VHYA 2R3SA 3TM4A 3VNUA 1CRPA 5BP7A 5CDHA 3OHPA 4HLDA 2GD0A 4OCZA 3SM9A 3ZKAA 1QGYA 4JROA 4A1OA 1E9AA 1KOLA 1U0RA 2AMVA 5ADUS 1VA4A 1CC1S 1RRGA 5KOJB 3FUXA 3AUJB 1ECBA 1Z4QA 2EP8A 3FNBA 2HREA 4C0WA 1WG8A 4L0DA 1Q21A 4OLHA 3TAUA 2R4TA 3VHXA 1NW8A 4C7OA 1HPLA 2VJCA 3AOEA 3N2GB 4OQMA 5AHOA 2DEUA 2QP9X 4LNUB 3U7RA 4UXIA 3KQVA 4HB0A 3QBTA 3L7BA 1NNLA 2WAXA 3CLRC 1UIRA 1R0KA 4YRQA 4IV5A 2GGSA 4U02A 1K7YA 5DBGA 2Q6VA 421PA 3KSMA 3ZLUA 4F7DA 4HWKA 2YWFA 3AVUA 4RZ3A 2CY0A 3ZCVA 2EWWA 5HRAA 3MD0A 2CNNA 1UDCA 3P96A 3PX7A 1PYDA 4FYVA 2P9JA 2GPJA 2IVFA 3NBYC 3QFFA 4KO3S 4LUCA 3BJRA 4MQFA 4WKOA 4AKIA 5HR5A 1EVKA 2I9PA 3RQSA 4OFZA 5K0ZA 2C61A 3IAAA 1NR1A 4GICA 3C1AA 3TD6A 1WEKA 1ZN8A 2V3WA 2ABWA 1LB1B 2YWGA 3ETLA 1Y80A 1JVNA 2VHQA 1TM1E 2IXFA 3R40A 2QAJA 4DR3B 1LQ2A 1ZUIA 4W1SA 2HMAA 4PHTA 5MDHA 1AX9A 2WIKA 2NYUA 1S2NA 3OETA 1SURA 3ZCUA 4BKRA 1E6CA 2GN4A 3H9UA 2OK7A 3ZI0A 3IAS6 3WO1A 4YRMA 1J99A 3FE2A 1VKNA 1J2EA 2OBXA 1OMOA 1Y1QA 3EZLA 3JVVA 5E2AA 2ID7A 1JNYA 2V7TA 4DEYA 9GPBA 4K7JA 4NBSA 4YJ2B 3LUKA 4DVGA 4IVPA 4N3CA 3KLNA 3OLZA 4MV1A 1PFVA 4JUAA 4BRZA 4U3JB 1SZCA 2A5YB 1TADA 3ELBA 3SJUA 4PM4A 3SHWA 3T4XA 4JUFA 1JZQA 1XDDA 1ENOA 4DCMA 4HZIA 1G0NA 2EBUA 2PSHA 3PWZA 3WV5A 4KXXA 3OBBA 1AKUA 3R41A 4PPGA 3TTUA 1ILEA 4MV9A 4S1OA 1LQTA 1ZRHA 3FB4A 1G4HA 5B1DA 1HWYA 2HPZA 1PSWA 1P2TA 1YQTA 2UYQA 4ZV9A 4DLXA 2JVKA 4LFBB 1KIFA 1YRWA 2ZBDA 2B35A 3F3KA 2WDZA 1HH4A 1V8ZA 1Z33A 2HFJA 4PIMA 4RABA 3NYWA 1AQUA 2OFFA 4DM7A 2O2GA 3U44B 3WB0A 3VPAA 1A0OA 4D9NA 4Q1DA 1GFZA 4NDZA 2YZ7A 4XRGA 1HFJA 3ED1A 4D43A 3CVJA 4ZQHA 4ZYXA 2AFIE 5AVSA 2G5PA 2R66A 3P9RA 1WXXA 2P8SA 2RSLA 1L8LA 1U0FA 4UOZA 2G5TA 1NP7A 3OZWA 4R5MA 1NMQA 3ANTA 3JTMA 4BO0A 3H2IA 4W8HA 2VDJA 2RHDA 2AI1A 2ZVJA 3ASYA 3VAYA 3OP4A 1Z17A 3O8QB 5T4HA 1GGEA 4PY2A 2DOKA 3F1LA 2JDID 2WLSA 4LX8A 4ND1A 4Z3OA 2VKTA 3C6BA 4M49A 3ZIAA 5JUWA 1U2PA 4WN9B 2JCBA 4FHFA 2FPIA 2FU5C 4NBKA 3BHNA 1EDOA 2SHKA 4LXXA 5J5VA 1EJ0A 2VVTA 3P2KA 4XX0B 3C7CB 1OV4A 5ENZA 4ARIA 1QONA 2IYAA 3W8RA 4L95C 2AEJA 1E1RD 1QIEA 2G1JA 1TGVA 1FNSA 2XW6A 3F5SA 2P41A 1ZIDA 1RC8A 1QLJA 3M6LA 2NWQA 3TOXA 5TF4A 3LPLA 3BM5A 4CTOA 4UHKA 4XEUA 3T15A 3KYDA 4HJRA 4UEQA 3ICPA 1IOZA 1H4SA 3Q8XB 2ZI7A 1E4EA 4RKQA 2IKSA 3P9ZA 4AJHA 1W93A 3IP8A 1M5TA 4GW3A 3UWSA 2QVGA 3CE6A 1G2IA 4MVJP 4BYMA 4F6RB 2XGGA 3VR3A 3PEEA 5BNWA 3GLHA 5HDBB 1VTKA 3UYKA 7MHTA 3E23A 1QNLA 3ZLTA 1TA9A 1BTOA 3RGGA 3TN7A 4YS6A 2I8LA 1OHHD 3I04M 3KM0A 4M7PA 1OZAA 4TS9A 3IKJA 2GFQA 3E6AA 4J0KA 4MNTA 5GAJA 3SZGA 4DCTA 3LCUA 3TB6A 1Q19A 3THYA 2JJ1D 3MCTA 4IH1A 4CR7A 1X74A 5KX5B 1UBOS 4L8GA 3RUIA 3HJGA 3RI3A 2VIIA 5GONB 1FXSA 2VJQA 3ONFA 4N5DA 2Q7OE 1P19A 3VZSA 1Q7BA 1AUQA 2JGEA 3GEGA 4HAZA 4G63A 2PMDA 1ENZA 4X7PA 1V4VA 3DR3A 5AESA 1G2QA 1RXEA 1M2HA 3GRKA 5J47A 3OQIB 3C7AA 3DVAA 2PGXA 2FSSA 1F2UB 3C8UA 1CRWG 3GLUA 1KETA 5IASA 5D8DA 3LD9A 1VSVA 3KCNA 1DUIA 2R6ZA 4GI7A 3CHYA 3ZNOA 4F3RA 3O38A 4F8YA 2C03A 2COEA 1YOVA 1M7HA 3E3MA 3Q2IA 4K9QA 4BC1A 1NLUA 4G0VA 4RV5A 2DBRA 5DYWA 2WG0A 1IEXA 1CVRA 1LW7A 1DVRA 2DE0X 1ZXXA 2RAFA 3E22B 1N2CA 1V9CA 1DKNA 3N2IA 3MUOA 5M3BA 1VG8A 1M83A 2VYNA 3FRHA 1G8JA 2QTMA 2ZE5A 2II6A 1P9OA 1ZCZA 5KWIA 3LUDA 1NYQA 4B2LA 4JEIA 4DUYB 1QCYA 1UBLS 1U15A 2GEJA 4ZAVA 3GLGB 1MZPA 1NT4A 1RP7A 1HOXA 4XDYA 3NNNA 4PCUA 4WCVA 2WJZB 3GT3A 1HT0A 1E5QA 2OD7A 3KB2A 3IURA 1QRTA 3Q6MA 3R9WA 3R5KA 1JG7A 3IQDB 2PS0A 2ORWA 4RMJA 1DG3A 3COVA 1PNVA 3SYLA 4WFIA 1L8AA 1COWA 2HA7A 4IHAA 4KLRA 3EQ6A 4AJ1A 3KEQA 2IHJA 2PSDA 1ELOA 2V9CA 3IPYA 4FJ2A 1FXWA 4ARUA 4GEKA 4DNOA 3BDVA 4HVCA 3VC7A 4NZPA 3LDGA 2BSXA 1UDRA 2IZOA 2B6HA 3HSYA 4EHNA 4QDTA 4OF4A 4OI0A 4ASUD 4LGVA 3BCUA 5BSTA 3T52A 3KVNA 5FA5A 1N2JA 2ADFA 2AN1A 3H84A 1I3KA 5IH3A 1ST2A 3RV4A 5GVRA 3S5UA 3SBDA 4EDFA 1P0FA 2DYKA 4LOLA 1NKSA 5I9TA 4QYSA 2E7ZA 3WWPA 1S2IA 5IUKC 1UDAA 2BV3A 1D03A 3HEMA 4FX2A 4V0QA 1O6GA 5EJ2A 3SEFA 2BFWA 4US0R 3R7SA 3WMGA 4HFMA 1M2JA 1CZRA 3EIEA 4QU0A 1RHUA 4JR0A 5FBQB 3W6NA 2X4GA 4UNIA 4E5PA 4UPEA 1ZSNA 4GKKB 2RD2A 1DOHA 1T9CA 2W83A 4IDCA 3UOWA 3JRWA 1D2AA 3V32A 3RRXA 2K5UA 2ZATA 2OC9A 3EX7C 4X7MA 1L7OA 2PTSA 1XFDA 3LPDA 4M2LA 4KO1S 2PMEA 2NIPA 1JFSA 4TL7A 4F86A 2J9YB 1D1TA 2GLTA 1ZM7A 3UK0A 3BBPA 4OJMX 1T6ZA 1UQUA 2ZWOA 3LUAA 1Z37A 3ZWAA 1AUXA 5BNFA 3CIFA 4N48A 3FPHA 4I50A 3V2IA 4QARA 1PG0A 3P0EA 1JDBC 2BGJA 2AZMA 5F92A 4DIEA 1RI5A 1ISSA 1AUOA 1WTCA 2NUTB 2ZYAA 3E2IA 3EXHA 2QS9A 1F6WA 1Q14A 4AECA 2XKKA 1GFIA 2R7NA 4REQB 1SBIA 3COSA 4CMJA 1MT0A 3L77A 4OHMA 1G9SA 4R54A 5D3MB 5EJIA 2AQHA 3GZJA 5FPQA 1X1RA 3O6VA 3SP1A 3C3EA 4NOJA 1ZUNA 4MO9A 1Y1LA 3N2KA 2GH1A 4JJFA 4M9RA 5FB3A 1USUA 1JHVA 5JPIA 1SKQA 1V5FA 1YUBA 3NTLA 2FJ0A 2DVMA 2NQTA 1IY2A 5ES3A 4BGIA 3QUBA 5ALIA 1G38A 3WGLA 1M2VA 2I2BA 4KNYA 5DHSA 2PPVA 4D6PA 3H18A 2ZQ5A 3IIIA 3TZEA 3VR6A 2RMKA 2E21A 2XF2A 1FUOA 2O7QA 4D3SA 1A2KC 3T3MB 1NXPA 1M6VA 4CMIB 2VP2A 3F9CA 2CE7A 1M0EA 5AD1A 1TU3A 4WD3A 2RGUA 3JQRA 1LI4A 1TVCA 4Q9AA 2DKFA 3EWAA 1L7NA 1SQ5A 2RIRA 3BMCB 5BR7A 4K6FA 1XZMA 2YYAA 4DSZA 1EAMA 1P9RA 3IMFA 3BVPA 1XEFA 2D4AA 2XUPA 3H9GA 2GTIA 2GCOA 3RS0A 2AG1A 2JGNA 1E0JA 3HH8A 3LY8A 4BRUA 1ESEA 3V46A 2VPXA 2X5KO 1K6MA 1TCVA 1GL6A 3DMDA 4KQCA 6PFKA 3D8BA 3CNBA 3D6TB 1Y6GA 4U5QA 1LK5A 4I4TA 2FSIA 3AFMA 5JLJA 3W3ZB 3HU3A 1TIPA 3HZRA 4EMUA 4FYYA 4JLMA 4B71A 1A04A 4D56A 1Q91A 2F4VB 5LPNA 3JQ9A 2O8FA 2WUDA 4HDNB 1XZLA 5HS4A 2MDTA 5JYDA 4BNNA 3RIXA 4UW9A 2C57A 5ETJA 5F7ZA 2NTVA 2VHZA 4MQBA 4JWKA 2BHRA 2CVFA 2ZEJA 2JG3A 1Z8HA 3KR0A 5AM3A 1UKZA 1T3GA 1Y5RA 2Z6VA 1CY7A 3WNVA 4HDRA 4RADA 3SQLA 3ZHCA 3AVOA 4KVFA 1APBA 3WLLA 2QW1A 1JFVA 4H7KA 1OY1A 4UOQA 1JG3A 2NU6B 3G2LA 1RI3A 2OYCA 4BWVA 4PSUA 4DCSA 5MN4A 1TKCA 1A4XA 2XODA 3MWFA 1K5GA 4JKOA 4XDGA 5I9MA 1T5LA 1MLDA 3RODA 3V6MA 4EGCB 3DQPA 3U3DA 2P79A 3TCXB 1JQ5A 2MSWA 4IRXA 1YJCA 3CH4B 4AJPA 5K7SA 3DZKA 2GTPA 4UFOA 4PX2A 1ZHHA 2H7YA 3A4LA 3DZCA 1FLNA 4IGEA 4D0LB 4BAUA 3MSCA 2HJ9A 2P3LA 2R1TA 4TSKA 1OREA 1WSWA 2EX4A 3KUXA 4TQ9A 3TLYA 1DKLA 2PAAA 1MP0A 2ACVA 2IIQA 1JLLB 1L7XA 1CULC 4PC6A 5BN4B 3RBXA 1SUCA 3RYIA 3EDOA 4FMDB 2BGWA 3SXUB 1L1EA 4XUCA 2QMHA 1YH3A 4GAEA 4A26A 2VT2A 1K98A 1SUPA 2FJPA 2C4VA 3LM8A 3LQYA 3Q5GA 4PGGA 4WZBA 4D97A 3WKCA 4DREA 4URXR 3FTEA 3DZJA 5CVJA 4WJLA 3TDMA 3VC2A 2F43A 3LRPA 3NBAA 1JW9B 5CRIA 1NVVQ 5DIFA 2KM1A 1QK3A 2QD1A 3VO1A 3M6FA 1V6SA 5KNCH 2IHBA 3R20A 4HLCA 4NEHB 3C5EA 3CYFA 2G0NA 4OQEA 1CE8A 1MUUA 2OO7A 4RC9A 5KKCA 4NNOA 3HQ4O 4HGZA 4IY1A 4LDAA 2BEKA 4PC2A 2QRVB 3FXAA 3C5VA 3PS9A 3BWYA 5EFOA 4HDKA 3COWA 2FZEA 1UDWA 2EIXA 2JI8A 3JPYA 4RZIA 5GIOE 2P2CA 5ELLA 1V3TA 5FOTA 4F46A 3V1KA 4KN6A 4N8DA 2JLYA 3VYSB 4RY2A 1CUFA 3UF0A 1YK1A 3DD5A 1HLGA 2O2CA 3BXXA 4R16A 5ALPA 3RC1A 3O8RA 1SIWA 3DV0B 1CQJA 1QRDA 3LPMA 1KI4A 2FPGB 3OPYA 5NULA 5K0GA 3PQFA 4NOLA 4WVFA 4IDFA 2FKAA 4QVGA 2HBRA 2ZIXB 4OHRA 1CT9A 1XEAA 2O2EA 3TTVA 4E6PA 1P2SA 2AR7A 4Q3LA 5DP1A 4MS3A 1RQ2A 1OW3B 4HQ6A 2QX8A 3IOEA 1EU1A 1D2GA 4JR1A 1CEEA 5JJ5A 1OGIA 2N3ZA 3RW9A 3K0CA 3LP6A 3NHPA 4EWLA 4L7QA 3V1YA 5CFRA 1T2NA 1JECA 2I7TA 4YV1A 4S24A 1E6LA 2ZIEA 2HDNB 3QVKA 3E9NA 3A1DA 4QJ5A 1JHUA 1Y4AE 1XWOA 2NUBA 4IVRA 1AGRA 1FB5A 2FG6C 3CM0A 3I1JA 3M81A 5BN5B 1AZTA 3GVPA 3L7JA 4ZZIA 4AKGA 5K0BA 2C07A 2GLXA 2PR7A 2Y1LA 4NSLA 5FNVF 4LYFA 2PH5A 2C7PA 3N5KA 2ZT6A 4OGLA 1JPUA 1FLVA 2WFLB 4PCLA 1HEUA 2FRDC 2ZQZA 1NMXA 4D74A 3WFJA 4MWOA 1QHHA 1TKBA 5EKXA 3RVKA 2WMOB 4MLDA 3RD8A 2OFWA 2VSXA 5F76A 3CINA 4Q1VA 3MXOA 3C3DA 4IOMA 1ZK1A 1OYYA 1JJIA 1ZRNA 4TLBA 1ENYA 4NRDA 4PZ9A 1TJYA 5T4BA 4EA6A 4NS4A 1MQSA 1T29A 1CQZA 5JO0A 4NATA 3WLJA 3LQ4A 1XCOA 1JHAA 4JI8B 1N7IA 2M2IA 3BGWA 4CKWA 4DV2B 1M2OA 1K86A 4JJ6A 4Z9BA 1BRMA 3VJRA 2YWBA 2ZKLA 2MR6A 1DAOA 1ECFA 3ZZNA 2EFHB 2HWUA 4ESHA 2BCJQ 4WEQA 1POXA 1X8XA 3SFZA 1QG0A 3IRVA 1DXHA 2JAUA 4F4FA 4MVXA 2OHOA 4S3MA 4CKZA 4X6YA 3WIVA 4Q4HA 1Y3BE 5EMJA 1A7UA 3TBFA 5BSKA 1XPJA 2A9JA 2E4AA 1WXDA 2A9KA 2OFXA 1PQYA 2QJWA 3E61A 3L0PA 3QFCA 3X44A 3T3GA 1JAXA 1KJWA 1XKTA 1HYBA 1YL6A 4AVYA 3UUFA 3LCRA 4TWAA 3KEGA 4PQFA 3EA0A 3UJBA 2DF8A 2GM3A 1TKRA 1ZL2A 4RM3A 3AETA 1G21E 5L3VA 1J39A 3V6LA 1G2OA 5KTOA 1BXRA 2FUG6 2B30A 2DUUA 2QD2A 3GVHA 5ARDA 5BMVA 3U6BA 2C88A 2EJWA 4P58A 2KYRA 1IM8A 3GT7A 3IT3A 4LVOA 1GVNB 2OAP1 2FYTA 4EHLA 2G6BA 5AW7A 1SCAA 1F8XA 1XMXA 3B3FA 4MXDA 1TJNA 1FJHA 3L07A 5KSWB 5I4CA 4JX8A 1LWNA 1RRKA 3K9CA 4A8JC 3BJEA 2BOVA 2X9LA 4HATA 4AUEA 1TJWA 2PPLA 4NEQA 5ILQA 1E9CA 2P3OA 1JDVA 1BDBA 4UU0A 1EPUA 2GPYA 2M1XA 2YZMA 4L0CA 2H1SA 3WHIA 1XZKA 4Z1MA 2GZ1A 3OIUA 3JX9A 5HZHA 1OROA 5JXIA 2QVLA 4HNGA 3L92A 1HG1A 5FEMA 4EYSA 2TMDA 4MWTA 4RWEA 1TGYA 4H0NA 4I08A 3GLIB 4ZN6A 3G79A 2REXB 4B8YA 3KJQA 1RI1A 4NFLA 2B8WA 1RWWA 2Z4RA 3IILA 3BHIA 1QUFA 1W52X 2P4QA 4MQ4A 4QG7A 1CIPA 5EIBD 3THSA 3WBBA 1NJ8A 2BISA 5B6JA 3T3NA 4ENQA 1Q1BA 1AS2A 4KNWA 3T5BA 3OLVA 3ZZTA 4X1IA 1J23A 1WXGA 4JGGA 4OUDA 3H3FA 3Q8MA 5JW6A 4F4JA 3PCTA 1O89A 3DOUA 3RO7A 3BWVA 1WD5A 4L73A 3O2JA 2NAPA 2DGDA 2GD1O 2IOYA 4XYBA 1GZDA 2IEYA 1IM5A 2X6TA 4II7A 4RMHA 1HSZA 1MD9A 1BN7A 3TYXA 3NIDB 3JQPA 4NPHA 2OSBA 2NTJA 2FY8A 1QQTA 3R8XA 3W4IA 2FX2A 1CUHA 2CKDA 2EOAA 3PFKA 4LHSA 5DBEX 2XVAA 3S8YA 1S5PA 1B16A 1NDUA 1RYFA 1M73E 5F1KA 5H7XA 1JSXA 4TZ0A 1B15A 3HA7A 1ZI9A 5BYKA 4Y1EA 1J5XA 3D54D 4EPTA 1I51A 1PNQA 3TZLA 3ZWWA 1E63A 1OLSA 4G9EA 2C7GA 4JB2A 1ZW6A 2IHVA 2I3GA 2YWRA 1U6IA 2DUNA 2ZT5A 2JK1A 3D5EA 1Z34A 3E8MA 1KL7A 4GH5A 5CGZA 3OOYA 4M9CA 4DABA 5JOQA 4DLRA 2VLIA 4EW6A 2XMSA 3EXEB 4BNZA 2JLBA 4UZFA 2WYIA 4IQFA 3DZHA 4OHZA 1IMOA 1R1DA 4MYRA 4KEAA 1EK6A 1HNNA 5F9HA 6LDHA 3QFSA 3RE1A 5A9SA 3BL8A 1LLDA 4JKYA 1J70A 1EFTA 4NE2A 4N3AA 2RH4A 1XAGA 2VUHB 4BVHA 3GEEA 1QDEA 4DCOA 1PS8A 3ZIUA 1QHXA 4FWTA 4ZEMA 3DBVO 1A1SA 4X95A 4D8YA 1IRIA 4EYQA 1NVKA 2FZWA 5L4SA 4KHZA 3B9BA 1II8A 1RW4A 4YAKA 5JD4A 4YDHB 3CB2A 4O8ZA 4HB3A 4FE7A 2GFHA 3R6TA 2O2IA 3AIKA 4PHFA 3K6SB 5L6LB 4PC1A 3WA6A 4DMKA 1OASA 3A4YA 5IYZA 1UQTA 4IJVA 5L3RA 3RVDA 1AZSC 1T9AA 3EEBA 3NWBA 2DFDA 3LDHA 4H6VA 4DJEC 1WU7A 1YT5A 1DV2A 3JYQA 1VCMA 2HCFA 1DIAA 1M10A 4O5OA 3S7ZA 4MGIR 5FQNA 4I9HA 1B23P 5J1TB 2WWHA 2XHEA 3I6IA 4EI9A 1KKMA 1E60A 1HBJA 1VKHA 5B36A 1Y9JA 2VHVA 3P20A 3QFTA 4O4HA 3SYRA 1O77A 4X8MA 3WTBA 4DCCA 4P4SB 4LIPD 3TJZA 1S7CA 3TW0A 1DIRA 4ZHQB 4XCQA 5DI3A 2UKDA 1TUGA 2G09A 4YUXA 4D3DA 1LDMA 2RGBA 1ZLYA 2GB4A 2X3YA 3JAKA 3CVUA 1SXGA 1O1YA 1J21A 3JWJA 1IN1A 4R2MA 5EE9A 1A8QA 1NF8A 4EJ6A 2NTEA 4W5WA 4CLRA 1HURA 2UDPA 4X6XA 4N5LA 1UBNA 1J25A 1NI4A 1RCTE 2FEWB 4UEKA 1MC8A 3QHAA 5TPZD 4EIWA 1L8XA 3C5WP 1DWUA 4F2HA 5DB4A 1N6OA 1RRFA 4PANA 5A9TA 3E84A 4BVJA 4V2UA 4YCJA 1DDOA 4GPAA 3KAPA 4RTSA 2RKBA 1HK7A 1UFRA 3F6CA 1DAMA 1MRZA 4JYBA 1YGPA 3WQBA 2B4TO 4KFUA 4LRQA 3OG9A 3VJKA 1AK1A 3UN1A 1Z26A 2YVKA 3HABA 1EZ4A 1F0PA 4MITA 3ZCRA 1Y4SA 1ACMA 3DMRA 4EFMA 5I9BA 2AEEA 2AX3A 5MFPA 2XVYA 1I1HA 3RT1A 3S2UA 2F3TA 3TMYA 3WYBA 2OILA 1IY0A 3EFOB 3Q9LA 3ZDEA 3FZGA 1BE6A 4COKA 4O4LB 3OX2A 3MRSA 4JC5A 4WINA 4FD2A 4F4UA 3ORQA 4LPKA 2HLHA 4CGZA 3VC1A 1B8UA 1D0VA 1G55A 1CNFA 3IR6A 3NORA 4R0VA 3UHOA 3VOBA 4CFSA 4X93A 4PYLA 1OH6A 4Y2TA 4BGUA 1PVDA 4KQMA 4MRPA 4OHUA 2FLKA 2OHFA 1W9MA 1QFXA 1U0NA 2EV9A 3PI6A 5AUPB 1FYEA 4BGVA 2CUZA 4RKRA 3IAHA 2GAFA 1QRAA 1ZEMA 3LYAA 1ONPA 3VNRA 5JZ9A 1L5MA 4H60A 1RYYA 4M0DA 1XJ0A 1NXTA 5FWXA 4IKEA 4KRGA 2ETVA 2MR5A 3KEOA 2BFOA 5E4TA 1UOQA 1RRVA 6AT1A 1A88A 4BVEA 1ACLA 1T2DA 1K92A 4GR4A 4R98A 1MB0A 3P9PA 2I3AA 3UT0A 3M89A 1JAIA 2H1OA 5HIAA 1ZBDA 1MXHA 1OBHA 4RMGA 1O2DA 1JLMA 3ZDFA 3CVOA 3F2VA 5J4VA 1FZTA 4WXMA 2O5VA 3MS4A 1NN1A 1BROA 1V39A 4GP6A 4HVTA 1ORVA 3BTSA 2D0DA 2V98A 4JBYA 5B3LA 2HBQA 2EQBA 1MOQA 2QTBA 1QE0A 2MJLA 4ZT6A 1GNLA 2NXJA 2HJGA 3C8DA 1VL5A 4LRWA 1U81A 1A9SA 2FUCA 2QYTA 4RVOA 3B1JA 5K0CA 3AJ9A 3GRAA 2X8WA 5FBHA 3OT1A 3QVWA 1EUZA 4BX2A 2I99A 3DKRA 4HL6A 4MEAA 2FUSA 4J0GA 3ZJVA 1M2WA 1XEWY 2XOXA 3GJSA 4LJ7A 3TLMA 3HG7A 1U5BA 2WSSD 5IT5A 1YFKA 2XXBA 1ZR2A 1G8SA 1N25A 2H9YA 3I9LA 3S70A 4K0KB 2WHPA 3HKBA 1E7SA 3VKFA 2BM1A 3WE7A 1QZTA 1RYHA 4FSHA 3ON5A 5E7IA 2I1VB 3PUHA 4JL6A 3T5TA 3O0DA 4ARZB 2HTEA 5B57C 4KIFA 4JGIA 1NF2A 5AHRA 5K0LA 1S2LA 2ONCA 3BOSA 1IN5A 2V6BA 3H7IA 2BVNA 2R1VB 5CA0B 2AG8A 5K3OA 3SJAA 1ZSYA 4P5EA 4WESB 3TLBA 5D86A 1Y6ZA 2YV3A 2AUMA 1EHIA 2WSMA 4FOSA 3WGQA 2HW8A 1C8LA 3KPUA 1PQWA 2XCLA 2FN8A 3VNSA 3GLKA 3RC7A 5A4DA 4YBRA 2ID9A 1VIYA 4H0CA 4E88A 3A28A 4M0KA 3WGUA 4EVRA 2Q6IA 3CPSA 1Y33E 2R11A 1WUIS 3AESA 2VR1A 5CLIA 1ZOPA 3EEYA 1XZDA 3H87A 3I9V6 4JY7A 1B6TA 1Z38A 2HA5A 3T9DA 4BNWA 4ZI7A 1XI2A 4HUTA 3GLGE 2REQA 1KH3A 1QV7A 1A4IA 2JHFA 1C80A 1E2KA 2CWWA 1M5UA 2FW1A 1TXGA 2IBTA 1ZH0A 4WI1A 4P92A 3TJRA 1N6RA 2YBEA 1JA1A 3DTVA 1SHZA 3JQ7A 2PA0A 2WR8A 2XUHA 3UHFA 4GR9A 3V80A 1N77A 5F33A 2FAXA 4TXLA 1A7JA 5L95A 2XDQB 1NONA 4YRAA 1Q5NA 3FSGD 1OIXA 2PX6A 3NWPA 4OB6A 3ROQA 3FUCA 3KQHA 5EE0A 2AC4A 1KFKB 2D2IA 2PL5A 3QIAA 4GOLD 4QWMA 1O94A 2J5QA 2H0AA 2CLOB 4P35A 3W77A 1TCCA 2J85A 2ZAOA 4GDMA 4G8BA 3OKAA 3KCQA 1G8YA 2QVYX 2OL4A 3CF0A 3HMQA 2ZB4A 2VF5X 3A11A 4R2HA 3TOSA 3ANNA 2PIAA 2GVDC 3EGDB 4UVDA 1T5IA 5CG2A 5KJFA 1M3SA 1JKJA 2FGKA 3QNMA 3OO1A 1I4EB 5KOHA 4C05A 1PJAA 5CIYA 5DULA 3D2CA 2AD5A 3DR5A 1V5IA 2UZ1B 2OXFA 4HNRA 1QLWA 3KKMA 1FS5A 4GZ6A 4JD5A 2GCEA 5JYCA 3DEHA 1ZONA 1IN7A 1KDOA 2ECQA 4M8LA 4FGWA 4AJIA 2JIQA 4R51A 4KYIB 2H6EA 3FWZA 5AHXA 1XZ8A 3HGTA 3IBTA 2CNLA 1JHRA 3HYLA 2YZKA 3QEBZ 1X7ZB 1Z18A 3ORSA 3KJHA 3Q11A 3V55A 1L9XA 2AFHB 5SICE 5M5BA 1U11A 4ZAWA 5IXYA 2YN2A 4RPLA 3TGLA 3K8ZA 1LDNA 2QMOA 5B53A 4QT4A 1SU4A 3C14C 3P94A 2V8OA 1T6XA 3FMIA 1NUSA 4ZQEA 4EPXA 4KPUB 1D5CA 1NXOA 1H1DA 1Y3AA 5DYGA 4RL6A 4HRXA 2WV9A 3ES9A 4WK6A 1P39A 1WSAA 4L0MA 2YZNA 2WKRA 3R3VA 1N33B 2VTBA 4ZU3A 2X4DA 5D1NA 1GPUA 3VDMA 2AFRA 1W0JA 3TQIA 2FSVA 4QUBA 3UJ8A 1NBAA 4R9VA 3GP3A 4KTTE 4YN3A 2XJ9A 4YV0A 3PEWA 3T1HB 4IFTA 3CEJA 4BTVA 3PGLA 2C1XA 4YXWA 2CDBA 3KO8A 1H2FA 2Z5GA 3WOVA 1CJUC 4RUKA 1XZFA 4EPWA 3TVYA 3PFHA 3I9V1 2WG1A 1G1MA 4C6TA 1U28C 1ZH4A 1Z62A 1TO2E 2DHEA 4IIBA 4ND7A 5CT5A 4V1CA 3RCBA 4Q7MB 5PNTA 5JEEA 2WC1A 4C21A 2HSDA 2V7WA 1FRNA 4DL9A 2YQ5A 4UE6A 1FEZA 3HVHA 4ZKEA 3ZU4A 1IY8A 5G53C 3CZMA 2R8PA 2F1KA 2QTWB 5LC1A 3G2PA 3V4RA 1WKVA 2C8VA 4U6SA 2HMYB 4BE9A 1AH2A 3DUFA 5CLHA 3NPMA 1QE5A 4I1IA 1GUAA 1ZZGA 2R6FA 3O03A 4GM0A 4RPJA 3WG9A 4BJ5A 2ZRKA 3WFZA 3WGVA 2Q27A 1EJBA 3BYZA 2ZUTA 5CGQB 1E69A 4CUKA 2PGJA 4XJXA 5EPOA 4FDTA 2CDAA 1E92A 2NZWA 2R84A 4O2BB 3TL2A 3TTSA 4ER3A 3THXA 4FNAA 3I9JA 2O8BB 2P11A 1AQ6A 4U2DA 4P7KA 4WH0A 2XA9A 1V5EA 3AU8A 3DBHB 5BV8A 2C99A 4EAAA 5CFQA 4F0JA 2UU9B 3LSTA 5DNAA 1SQSA 3B6JA 2WK1A 3RKSA 3LF2A 3IUBA 1GM5A 4E1VA 1X1SA 2A9RA 3PQ6A 3EZXA 3QSGA 4N5HX 4Q12A 3OM8A 3L7DA 1XTUA 3DFMA 4NFYA 4QYWA 3R74A 2QE6A 4UBLA 1C41A 2GN9A 2HCBA 2DPXA 5AKYA 1E2MA 3MCUA 3QV2A 4KACA 1KMHA 4XQ9A 3TXYA 1SPXA 5EUQB 2I8AA 5B6IA 2XBMA 1Q0PA 1P60A 5TPWB 2WM2A 2G1KA 2VZ8A 4XIIA 3VBEA 5JSZA 5EE1A 5HP4A 5EVCA 4X71A 1T1JA 3BCRA 521PA 3K1JA 1Q1GA 1T4CA 4ZCIA 2B1RA 3OZDA 4MVJH 3IEIA 3C7DB 1B1CA 3U0BA 1VMEA 1TPYA 4RENA 1Y7TA 1L4MA 3DDHA 2Q6LA 4IIVA 3IAFA 2JDIA 1VMDA 2IGTA 2EQAA 4ZIRA 1JSZA 3JQBC 3SE0A 2L2QA 2NU7B 4MJXA 3WY9A 4AJOA 4D9GA 1GLVA 5I4BA 3A1UA 4BTEA 3IDAA 3PD1A 2WBLC 4KMMA 3W2HA 4E08A 5JALA 2WSYB 1IQ0A 1JJ7A 1QG4A 4YALA 5F5LA 3BD6A 4I4NA 2X0EA 5KYKA 3LQQA 4L74A 4BMZA 1X80A 2ODEA 2XEXA 3TW8B 5HVNA 1VSTA 3VU8A 4M38A 3AR4A 3WFIA 1BAPA 1R0CA 5LYJA 1E1RA 2FP4B 3NAQA 2M6KA 1KBOA 1QAMA 2Q8NA 4YDRA 3TRKA 3PNKA 2GZAA 4NK4A 4Y2JA 4ZC8A 3ZV7A 4PTYA 2OCXA 3NRCA 4DLWA 1YVPA 1VPWA 3EQ9A 4YP1A 1K6IA 1AKRA 3NB0A 5F9MA 4P8RA 3HGMA 4P4LA 1PWXA 2FEAA 4OI2A 4TXMA 2DWPA 1TA4A 4WKCA 5LL6P 1N2GA 4TKVA 1BEUB 1R00A 1XU4A 3T61A 1T9GS 2XGOA 5L3QA 1YA4A 1IU9A 3Q7EA 4HNAB 1Q77A 2A3NA 2I6QA 2TYSB 2ZJOA 3CRRA 3WWYA 1TZ2A 4OXXA 1OHHA 2H17A 4GIBA 1LA2A 2X1MA 2W37A 3O8DA 3QVJA 4JQCA 1JX6A 2YWHA 4IG9A 3ZY3A 4N18A 3HI4A 1YBMA 1MQ8B 2VJBA 4CLOB 2YFYA 1DS6A 1R8QA 2A0WA 3A6HA 3ZVRA 1RLUA 1LPMA 1RI4A 1WZCA 2QV7A 4EKIA 3KR1A 3JQFA 2PV0A 2PZJA 4GM4A 4G1BA 2Z2XA 1YS4A 1I2DA 2AJCA 2O07A 3GNTA 3LBYA 3ABRB 3C3AA 4V38A 3V4ZA 1C1YA 5KTNA 3DOEA 4N0DA 2BFBA 3BG5A 4JVOA 3KKZA 3UJPA 3M4XA 3LXXA 2JATA 2RI6A 4DQLA 2ZJFA 1V8BA 4K9NA 4CEIB 1EXWA 2G1UA 1TFRA 2Y0BA 5KMGB 3THYB 4ZAYA 1JTEA 3MGBA 1S2OA 4JU9A 2YXLA 5C53B 4E6EA 1L4UA 4KOAA 1ZHFA 3QP9A 3L8DA 4I5DA 1LPSA 3N75A 2PFGA 1RQ7A 2NZVG 3ILHA 1A7AA 2ZWIA 2HQSA 1M8KA 2ZRIA 4NSNA 1FXUA 1BFUA 3EMDA 4PZPA 4FZVA 5IJAA 2H18A 3ND9A 4C0XA 3A9SA 2IYXA 3F2IA 3ROMA 4MV0A 2N75A 3NUQA 4DLVA 5ALGA 1GWNA 2JIRA 2HXYA 1GPKA 2JIDA 3S2FA 4APBA 3JASB 1OVMA 1YZGA 5CVEA 4OHVA 1QQBA 2XH8A 1KRWA 5K2OA 2B94A 3VV2A 3RSZA 4YHHB 3AVVA 3L1IA 5LZ9A 1R6TA 1K6JA 1RABA 2VWQA 2FK8A 1CG6A 3S2SA 3CRNA 2FDXA 3OTOB 1QRSA 3GXOA 2Q2QA 2OV2A 2H0RA 4Q5IA 3G89A 3I6YA 5DMHA 3HXTA 1V41E 2AZDA 4JOBA 3HZHA 5KSOA 5DHRA 1ORHA 2BJWA 2BCEA 4DJTA 4AJLA 1QO9A 5E3HA 2O14A 4RV4A 3HHEA 1KWKA 8LDHA 4OM8A 2H52A 4NBNA 2H51A 5FPYA 1KO4A 4WGFA 5I48A 2HH9A 1SA0A 3DOCA 1P9LA 4K6MA 5T64A 2HYIC 2RBGA 1JE0A 1EXNA 4JP8A 4Y9DA 5CK5A 1YFZA 5G4LA 1XJQA 3COPA 3UMGA 1E3IA 4GPZA 1JEOA 2YMPA 3GCZA 4LXIA 2R7KA 2JAHA 1JMYA 4HGPA 3UWMA 3ZHVA 5AM2A 3L4KA 2LD4A 3FUVA 1H69A 3ADCA 3IJPA 4IDDA 3P2IA 1ESDA 2PUFA 1RJGA 1XXHB 4L02A 1JZTA 3WMFA 1AHPA 1E3WA 1ZGCA 4CE6A 2ID8A 3AHGA 1LZKA 4B1FA 8OHMA 2ZSDA 1D5WA 4DV5B 2PX4A 3WMXA 1LCIA 3NGMA 4MRVA 4J7CA 4TYQA 1O7JA 4YCDA 2Y99A 5IVIA 5BURA 4TWZA 3U5ZB 3DUWA 3PR3A 3NFYA 4IX9A 4PIVA 1P73A 4ZQCB 1ZCFA 4EO4A 4ADMA 1WDMA 1QMPA 1Z6PA 3NVMB 1IPFA 4H31A 4N6GA 3TSCA 5A5EA 3H5AA 2INGX 3HL0A 4MW7A 4AROA 1FDTA 4C5CA 4JX9A 2B8NA 4F97A 3P52A 1Q1QA 3AUUA 1KFCB 4LAFA 3N3BC 4B3FX 4BLRA 3KZKA 1GQ2A 4QUJA 2D28C 1EM8A 4DPKA 5AHKA 3LT1A 1IVSA 1L5OA 1ESNA 4LTDA 3ZKWA 1RHRA 1AXGA 2EZUA 1KVSA 1N2EA 1UMCB 1CUSA 3O2QB 1FU8A 3SR0A 4GLOA 3HL4A 2QRJA 3BEOA 3CLHA 2HLNA 1U8ZA 2GPBA 3EULA 3FDIA 3TLAA 3AFNA 3W79A 2EW8A 4EGQA 3LKBA 3TKAA 1UMDB 3IVCA 3I76A 5IUJC 3VNQA 2YOGA 1O4WA 5E1OA 4Y2SA 4IUYA 1J9ZA 2PO7A 1EFPB 4UM9D 5C0OE 4DMGA 3GLIE 1WPGA 3DHEA 3IQIX 2BGGA 1DLJA 3MHPA 2RHGB 1K6EA 3M5CA 4JUDX 2Q4OA 2XJ4A 2VYVD 3GOQA 3TBKA 1AB5A 3FB1A 1FNCA 5JFTA 3UB3A 2HNKA 2QAGA 4YJGA 1AM4D 4IZOA 2GN0A 4F9EA 1Z0IA 4I4CA 2YUTA 4L8VA 2G9NA 3RHTA 4KIJA 1IVYA 4IIUA 4JBXA 5BWBA 3H04A 1FFXB 2JBAB 5BVHB 1AKYA 1GRNA 2VNSA 3ZGXA 1KZYC 2Q5LA 3TNLA 2PY6A 3VAZA 4PLGA 4B74A 4HPXB 1K5DA 3DHWC 4M8SA 4P22A 2O48X 3ZIDA 1CR0A 1O5IA 2LGJA 3O91A 5C7IO 2GSWA 1LC0A 2GEBA 3AILA 3ETHA 3FPCA 5DK4A 4Z0HO 3WKAA 1OLXA 2BFFA 1X9GA 4IXMA 4CMKA 3WGJA 5ADHA 3R3UA 2I1QA 4ZZ1A 1VE3A 5TJHA 3GFSA 1FMLA 3FOWA 3M8KA 4W5HA 1R3UA 1B8NA 5FPTA 5FPSA 5A4FS 3DWEX 4WPGA 5IAJA 3D6FA 5KCZA 2JLZA 1MB9A 1XCPA 3P2OA 3I5UA 4KQKA 3TR5A 3LUGA 3MWGA 4IO0A 3WVNA 4HEJA 1U2DA 3PNYA 1C81A 3WL8A 2V03A 4XWAA 2PRKA 1TYEB 3L84A 4G67A 4LHWA 3GJQA 4M9ZA 2I7VA 3N0XA 1ZOIA 4DANA 1ODKA 2VHEA 3GO4A 5FWYB 4G4JA 4WY8A 5CAEB 3X1ZA 1ZEJA 2FW0A 3AK4A 5JQWA 3HCAA 1OFTA 4AG6A 5C18A 2O23A 4J1SA 5CB4A 4YJHB 1DGQA 1SOUA 1MKYA 2CLCX 3OQVA 3PC3A 1FX1A 3NONA 1CW2B 2OM6A 4HR7A 4KAJA 5KS2A 3CTMA 4GLLA 1UIMA 2XMBA 3D6JA 3NC4A 2WNIA 4JVLA 4UXJA 2H31A 4KYVA 1EFCA 3U7QA 2QQ0A 3E9RA 5BWLA 2XYQA 3P2EA 3IS3A 4MV4A 2J6HA 3L7OA 5F2EA 1QTRA 4NJMA 1DQRA 1GPBA 2GRUA 4R40A 4EKYA 2N1BA 4B4OA 5DH9A 4RA6B 2W8BB 5IDWA 2G4VA 4Q02A 3C2QA 3KT0A 3RF7A 1YOBA 4BNYA 4DYDA 1KGDA 5TIIA 4QE3A 1ML3A 3BX1A 3RSGA 4A6XA 3UK1A 3OLCX 4LS3A 4Q4LA 1W8DA 3GYGA 1VBKA 2E5LB 1J7JA 4TV8B 2YY5A 1KVUA 3I45A 1JR6A 3VKHA 4TS4A 4INZA 4UREA 3PXEA 1ZWLA 5HKAA 3GV0A 4DLLA 1NIPA 2QG4A 3MUEA 1G6HA 4XB1A 3UH0A 1VCHA 2IA5A 3LCVB 4XQCA 1SXJB 4RA9B 4YUZA 4DRXB 1BHJA 1XB2A 3FAZA 3L7CA 4NECA 4EY4A 3KFLA 3LT5A 4YIHA 3NOVA 1A9QA 4BFLA 3DAFA 3HLKA 2FMIA 4XCVA 3DKKA 1W5TA 4KMOA 1N5OX 5E3JA 3M83A 3VSAA 4EL5A 2ZYHA 4ZVUA 2R60A 1V8PA 2WPDD 4US1R 1RTTA 4JJ8A 1P7VA 4M6WA 3OMWA 3I01M 3JATB 2ANCA 4LMRA 1ZIPA 2D06A 5JAUA 4QIHA 2X4IA 4EQ6B 1GYRA 4XX1A 1KFJB 5KNLA 1U98A 3TPZA 2EX1A 2FPPA 2I3DA 4LE0A 4AG3A 3HEBA 4YMUA 5E9WA 4L51A 5ITVA 1DKRA 1RXWA 1A8SA 2HXSA 3GFRA 2UXDB 1KQ7A 1YV9A 5IJ9A 1YO6A 1XBTA 2QTZA 3B3GA 2W93A 4FNMA 1ZRMA 4L5JA 1SVWA 4MUJA 2OV4A 3H2ZA 4HYTA 4DV0B 2P6PA 4IS3A 3EK2A 1ID8A 4JP5A 1B6RA 4P3NA 1ZITA 2CVZA 3MWLA 1IXSB 1ZBQA 4PVDA 4GI1A 5DYIA 2PEZA 3JR3A 1SHKA 2FZ4A 1F0NA 3V9AA 1Z4IA 3W4JA 4Z54A 1GNRA 2Y67A 3VR1A 5ITSA 1CLUA 4YC7A 1DRJA 2QL5A 3ODPA 3SHOA 1GV0A 3HJRA 3QA3E 2IFTA 4BO6A 5F64A 1DELA 4LTMA 2EFDB 1F2VA 1OXKB 5CH3A 4Z1OA 4V0OA 1P1JA 1A69A 5AKXA 3ZK9A 4C2UA 1NOIA 3QKRA 2YVLA 3V8BA 1SQ0A 3ETEA 4LV8B 2VI5A 3H0EA 2Z58A 5D1HA 4D2IA 1H5NA 1TVKB 2H1LA 2J5RA 1T13A 3PTLA 4Y30A 5JWOA 1HE3A 3RVQA 3WLRA 5A0VA 1WEHA 3LJKA 4GI2A 1A77A 2YMLA 1C3LA 3BA1A 4MRNA 3VNAA 2ASVA 2V5UA 3P0IA 4Q47A 3I0MA 5BQ5A 4ML3A 3GJ4A 1G8HA 4JZYA 3DYBA 5K0FA 3I9OA 3GJ6A 3ZQ4A 1ZMBA 1ZM3A 2O2DA 5FOSA 3NCHA 2CHFA 1OX5A 3VKUA 1H1LB 5IWAB 4P33A 5A9RA 4D5EA 2CBZA 2E9FA 4WZAB 2P90A 1TW2A 3AF6A 2G5GX 4YJ3A 4NESA 3TSYA 2CVHA 3MJDA 4GM1A 3DLCA 3L0CA 4EB0A 4PC3A 3A05A 1OFHA 5ALNA 5AXBA 3KSDO 4EUFA 1H6DA 3TFQA 5KTKA 1YKFA 4U7WA 2I1WA 2QVBA 3QENA 4KAFA 3PLNA 3AJEA 4YH1A 1EK5A 2NM0A 4DDUA 5FDFA 3AEUA 4PHGA 5LDHA 1UXKA 1RLJA 2XVXA 2ZI5A 3H5NA 2ZM5A 2C7RA 2P9HA 3EAFA 1NJ6A 5AKEA 2DUJA 5AXCA 1RWXA 4HLUA 1CU1A 2FMHA 3IDFA 4S1PA 2GYYA 3AY6A 4RWZA 1YSCA 1VSBA 5EWLB 5JSQA 4E5YA 5C8YB 5A5VA 2XNKA 4EO9A 1VLZA 3SZUA 1Q0TA 5CBPA 4LMPA 4TTPA 4EF5A 2H4HA 2VH2A 1DRVA 2IHKA 3I2KA 1XJCA 1O9GA 2VHTA 4DHWA 4Z86A 2PUCA 5H68A 2P6OA 4C3OB 2YKGA 3QKUA 3QW4B 5DXFA 4R0NA 4LJ4A 1ECCA 3KL4A 2WYVA 4ZOLF 3KJIA 4YRSA 5I7WA 1SVMA 1KOFA 5ELXA 1Y3IA 3TNFA 1K5PA 1YBHA 4I5IA 2XB4A 3G13A 1BS2A 4I55A 3TR6A 3UWPA 3W6PA 4M1ZA 5K8VA 3R6GA 1F6DA 1TT5A 2BDUA 3USES 4J7XA 4JLNA 4MQ6A 4EM6A 4M0CA 4P4TA 2CLKB 4URYR 1NFQA 5AJYA 3SX0A 4QTXA 4X1KB 2FDCA 1NPYA 3FTDA 3VBCA 5FEUA 4M8IA 3P45A 4K03A 4ZYUA 1SHUX 1BYUA 1C7EA 2IELA 4RS3A 1IONA 4B31A 5JARA 1F8UA 1XWFA 1I1NA 3NTUA 3U3OA 2CKMA 2DWUA 5BORA 3ABQB 4RQUA 5FAKA 3BMQA 4CQMA 2Z8ZA 5DGCA 1L1QA 1OBFO 1QIJA 1YE5A 4NOKA