3U19A

Crystal structure of acylenzyme intermediate of de novo designed cysteine esterase ech13, northeast structural genomics consortium target or51
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
195
structure length
194
Chain Sequence
GRALRVLVDMDGVLADVEGGLLRKFRARFPDQPFIALEDRRGYKAEQYGRLRPGLSEKARSIAESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPHKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF ACYLENZYME INTERMEDIATE OF DE NOVO DESIGNED CYSTEINE ESTERASE ECH13, Northeast Structural Genomics Consortium Target OR51
rcsb
source organism Synthetic construct
molecule tags Hydrolase
molecule keywords artificial protein OR51
total genus 62
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 3u19A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u19A01
3L5KA 4NABA 1RDFA 2IOHA 3EF1A 3QX7A 4EX7A 2CFTA 2G09A 3QUTA 4HGPA 1ZD2P 4NV0A 1NNLA 4QJBA 3I6BA 5AW0A 3FPSA 2RB5A 4YIHA 3RFUA 3KBBA 1YS9A 2B82A 2NYVA 3L8EA 3QNMA 3N28A 3QXGA 3WK4A 4AP9A 1Z4OA 2WF5A 4HGQA 2FUEA 3DV9A 1QYIA 3L1UA 3WK9A 3UMBA 1ZRMA 1KYTA 4XQ0A 4OD0A 4HGNA 5AW4A 2C4NA 2IA5A 3E81A 3EPRA 4G9BA 3ESQA 1VFPA 3FM9A 1LTQA 2RARA 2RBKA 1Z5UA 3IB6A 5AM4A 4E88A 4J2TA 3U13A 1Z5GA 3CNHA 2IOFK 2YMPA 2YJ5A 3ED5A 3I28A 2ZBFA 3E84A 2YMMA 4OHFA 3ZX5A 4KN8A 2O9JA 4Y2RA 2FI1A 2FPUA 5ALPA 3OCZA 4CNQA 3TLMA 3I76A 3SHQA 2AUTA 4MUMA 1XP5A 3L0CA 5AK4A 1RLTA 5AI4A 4OFZA 1S8OA 1RPZA 4YCMA 5IT0A 2WF8A 4BX0A 4EELA 1TA0A 3NASA 4UAVA 1N8NA 3SKYA 2FEAA 4NAVA 3ZTWA 3AR8A 2C8KA 3KC2A 2NO5A 1NF2A 2WF6A 3L1VA 4F72A 1X42A 2HX1A 5AW1A 4UAUA 1XVIA 3OCYA 3FVVA 2GHQA 2HI0A 1Q91A 5AI8A 3L8FA 3EF0A 1RLOA 2ZBEA 4EX6A 4L57A 4EEKA 5AW7A 3BA6A 4IG4A 1EK1A 4XE5A 1N9KA 5ALNA 5AK6A 3WK5A 2EAUA 1RKUA 2X4DA 1IWOA 2I34A 2HCFA 2MSNA 4HYTA 4UM7A 1SWVA 5AW5A 1F5SA 4ZEWA 2C88A 2CFSA 4YCLA 2HF2A 4BYGA 5AKJA 3EWIA 4B6JA 4FE3A 3R9KA 1QQ5A 4CE6A 4ZEXA 3OPXA 4I9FA 2BDUA 5ALHA 4YCNA 2DQSA 3N8GA 5AM0A 2I54A 2P11A 5ALRA 4QQFA 5AM5A 4DWOA 2Q4TA 2W4MA 3AR2A 1T5SA 3U26A 3L0BA 5IS2A 3QU5A 1YDFA 3QLEA 2ZOSA 5AKKA 3DNPA 2PKEA 2P69A 2VKQA 3ZVLA 1LVHA 4MWOA 5JJBA 1L7PA 3L8HA 4F71A 1YNSA 3QU9A 4KYTA 2OA0A 4EENA 3NUQA 2OM6A 3OCVA 3R4CA 1U2TA 2FPXA 3QU4A 1MH9A 3NANA 3MPOA 4UMFA 1CQZA 2B8EA 3U7HB 3FGOA 5AICA 5ALMA 3ZI4A 2JARA 1Z4KA 2FPWA 2Q4RA 4UARA 3WGVA 4C4RA 1ZD5A 3HYCA 3UM9A 4Y2PA 3FZQA 3ZW7A 3ZWKA 4J03A 3QGMA 3L8GA 4UMDA 3SLRA 3WKDA 3ESRA 2JAWA 4RESA 3QUQA 1QH9A 5AKEA 5AVSA 4UW9A 5AKZA 2C8LA 2P27A 5A3QA 5AW3A 1U7PA 3UMGA 4KX5A 5ALTA 3VAYA 3PDWA 5AIBA 1ZOLA 3MN1A 2EARA 4NFLA 1TJ5A 1VJ5A 2WF7A 2GFHA 4Y3UA 5AW2A 2G0AA 4BX3A 3DDHA 4KNVA 1EK2A 4UMVA 4Y2UA 4Y2JA 4BBJA 3ZVMA 1ZD4A 5ALKA 4GIBA 2GO7A 2O2XA 1Z4MA 4Y2QA 2G1AA 1Z4NA 3D6JA 4C4TA 4JDPA 5AVYA 2ZG6A 5AKYA 3B9BA 3PGLA 4XOUA 1RQNA 2EATA 3WKBA 3U7EB 4FFDA 3KD3A 2G80A 2OYCA 3P96A 2QLTA 5AKGA 2I6XA 3K1ZA 1O08A 2B8JA 5ALYA 3IJ5A 2HOQA 1K1EA 4L6AA 1RMYA 4YGYA 2G07A 3J7TA 1ZRNA 3AR5A 2WHEA 3A1EA 3BWVA 3AR6A 3KOOA 1WPGA 3I1YA 3SKXA 3L0YA 1WZCA 2R8YA 3NAMA 5AM3A 3E58A 4NWIA 5AW9A 2D2VA 2R8XA 1Y8AA 3U7FB 3KDPA 4G63A 4DFDA 3B8EA 1JUDA 2MU1A 5A3SA 1TJ4A 5AVXA 3NRJA 2B0CA 2YN4A 2W11A 1WVIA 1XPJA 4HAIA 4RETA 4AS2A 5AKHA 2I33A 1RMTA 5AI5A 5AIAA 2CN1A 2JAUA 1NRWA 1RRCA 3B9RA 3ZX4A 3WK7A 4BNDB 2FPRA 3L7YA 4BEVA 3QUCA 5ALVA 3W5AA 1YV9A 4CF3A 3QU2A 3AR3A 3SMVA 1SWWA 5AVRA 5AKXA 4KNWA 2WM8A 1Q92A 3IRUA 1Z4QA 5ALJA 5AW8A 4KX3A 3U7GA 5ALZA 4HGOA 3WK6A 2G08A 5AI6A 3W5DA 2QYHA 5ALGA 5ALOA 2WFAA 5ALLA 1FEZA 4IFTA 1TE2A 1YJ5A 3WK8A 4XPZA 3OCUA 2WF9A 1S2OA 2RAVA 5AESA 5IT4A 2YMLA 4AS3A 3R09A 1Z4IA 2YMQA 4YH1A 4DW8A 1L8OA 3A1DA 2YBDA 5AK5A 5E0OA 1RKQA 5AVTA 1Z4PX 2C9MA 2R8ZA 2YJ4A 5ALSA 3WKAA 3ONNA 4FYPA 2ZBDA 3N5KA 2BDEA 5ALWA 2PQ0A 4Y2TA 2FUCA 4UASA 4BKMA 1TJ3A 4UM5A 2YJ3A 1O03A 1VJRA 4UU0A 3AR9A 3NALA 4UU1A 1ZJJA 1QQ6A 4Y2SA 5AI9A 1U2SA 3MC1A 3OTQA 1RLMA 1L7MA 2CFRA 4UATA 3QU7A 2HHLA 2HO4A 2HEGA 1YMQA 2HF7A 1Z4LA 4OCZA 2HSZA 3DAOA 5AVWA 5AM1A 2AMYA 4O8CA 3ZUPA 3OCXA 1RC8A 2IOFA 5AM2A 2HDOA 4I9GA 2ODAA 5ALFA 4EZEA 3ET5A 3ZVNA 1PW5A 2IYEA 3RF6A 4C4SA 4YIKA 3ZWDA 2GHTA 3S6JA 4H1WA 1AQ6A 2JGAA 2GMWA 4HGRA 1RKVA 4DCCA 1RMQA 5AVVA 1WR8A 3N07A 3W5CA 2PR7A 3OCWA 2ZXEA 2AH5A 3U19A 3SD7A 2ZBGA 2B1QA 1J97A 3QUBA 2YFYA 3AR7A 1QQ7A 1RQLA 2W43A 3A3YA 4Y2XA 4BNDA 1Z88A 2I7DA 5AK3A 2OBBA 4CF4A 4BX2A 1T9ZA 2FDRA 2B30A 2NO4A 2AGVA 2R8EA 2YJ6A 5ALDA 1SU4A 2FPSA 4BEWA 3WKEA 2Q5EA 4JB3A 3ZU6A 4CF5A 5ALEA 3WKCA 5T41A 5AI0A 2YY6A 5AKLA 1L6RA 1ZS9A 5ALIA 1L7OA 3HLTA 1CR6A 2BY4A 3ET4A 3PGVA 3SF0A 3WGUA 5AW6A 1ZD3A 3A1CA 2P9JA 5AVUA 3KZXA 1U7OA 1T5TA 5ALQA 3CZ4A 5A3RA 5AVQA 3W5BA 5ALXA 2I55A 1L8LA 3MMZA 5AKIA 3E8MA 3FPBA 4UMEA 3N1UA 1U02A 3M9LA 5FP0A 3UMCA 4L6CA 1J8DA 3M1YA 3QYPA 3PCTA 4GXTA 4Y2YA 2G06A 5ALUA 5AHXA 3ZTYA 3F9RA 2B1RA 4PNHA 4Y2VA 5AVZA 3GYGA 1L7NA 1Z4JA 3NIWA 3AR4A 4ZEVA 2JAOA
chains in the Genus database with same CATH superfamily
3ZNPA 3IIJA 4LBYA 3EF1A 3HDVA 1L4HA 3QX7A 4XVHA 5SV2A 6Q21A 5H8WA 4OQLA 2SECE 4ZAWA 1Z29A 3IP1A 1XZNA 3W2IA 1T2VA 1Q7RA 4WCFB 3RAGA 4KXMA 3W7AA 4LMBA 1GPDG 4WJLA 1JJAA 1KOLA 4ABTA 3T5GA 1XZLA 2YC4C 4MW0A 4ZOLF 3FBWA 3Q3CA 4TS1A 1BX1A 1W88A 3SR4A 4EUHA 1YS9A 2B82A 1GSAA 1UFOA 3RUDA 3AHDA 3GCWA 3VR3D 3L8YA 3T1VA 1FVHA 2WF5A 4MV8A 1JTVA 2C77A 5FWYA 1ZESA 3PJEA 1G3IA 3UWKA 3HKEB 1RFLA 4FR5A 4UREA 4YALA 5C7IO 1MV5A 2FFJA 3L05A 1W85A 1XALA 3WYEA 5DI9A 3LY8A 1H93A 4HLDA 2D1TA 3R6LA 5IEBA 2FCRA 4GLBA 1A27A 5EKXA 3HB7A 3KCQA 1SRRA 3LQ1A 3UXYA 3WWCA 2ECKA 1W36B 4DXAA 1PZNA 1Z12A 1G21A 1IG0A 5KSWB 1B7GO 3P9XA 4RKRA 3WYNA 1MTOA 3QVTA 5KSOA 2CLEB 1IC6A 3LY5A 3A27A 4G5RA 4E30A 3ORSA 2ZIWB 1K68A 2MYNA 4ZVKA 2QVGA 1AQNA 1E61A 2ILVA 3TQFA 3RO7A 1U2EA 2BGKA 3KE8A 3U40A 2JEYA 3VZBA 2O2SA 4AT1A 1T25A 4JYBA 1Q7EA 1YB5A 4B3FX 4O2AF 4OI1A 3B85A 4P3NA 3DEKA 4OJMX 4KQFA 1RVV1 4UE6A 2YMMA 1BEUB 4DEVA 3PR2B 5BW8A 1TPZA 4Y1RB 3IQXA 2G9ZA 3I9NA 4DXDA 1Z0SA 5JVDB 3T5TA 2ZRJA 2LDXA 4MDYA 1MZVA 2D62A 3GX1A 1H0RA 2YZNA 3CKMA 4CNQA 2AFIE 3HKEA 4KCGA 1JEAA 4OJKA 4UNRA 1U9CA 1BCSA 1OGIA 5JH7F 4NJEB 1BD4A 2YIVX 4RD0A 5EUBA 2RHHA 3KOYA 3KQLA 2HXYA 4EP1A 2Z6VA 2ET6A 3W79A 1LTHR 1Q12A 4NOLA 1ULUA 2ZYGA 4LKRA 1H2FA 2GH1A 2HQSA 1FMTA 5EPUA 1S2LA 5AUPB 4OK3A 3BFJA 1QS0A 4DRXB 4Z4FA 1W5BA 1SBTA 4YQZA 3X1ZA 4CNBA 2C5SA 2OO7A 4EELA 3GVPA 1U1DA 3GNTA 5DYIA 1JIKA 3BZWA 3SP1A 2IE0A 1U28A 3FSJX 1RWXA 3G2QA 3S1AA 4YRLA 3SWWA 1H94A 1K4MA 3KC2A 2CJFA 3K16A 1U90A 4HH4A 3G0BA 4YHBA 1TMYA 2VPYA 1YAHA 2NGRA 2E87A 2XE7A 2WU1A 4Q48A 4NTZA 4ZN6A 5FFNA 3TFOA 3OWOA 3DL7A 4RIIA 4E0BA 5CA0B 2VJMA 1STOA 3RARA 4L74A 4LHZA 3P0EA 3ROGA 4M1MA 3PR1A 4BLQA 3WMEA 5DP2A 2XCSB 4LF8B 2IVZA 1U0OC 4ZDKA 1WJGA 3ZGLA 3C3MA 4M6WA 4RJKA 5EHXA 1NMZA 1RP7A 1KI6B 2MTBA 2B1JA 2QR3A 4LDQA 1HTWA 3PC8C 2OLEA 4MYCA 1A71A 1VHWA 3CEJA 4XB1A 4EHJA 4F6RB 2HYIC 1N8SA 4RA9A 5TQ2B 1EIZA 4QOJA 4YDSA 1IZ8A 1IWOA 1NJ8A 3IAUA 3UN1A 9MHTA 2IDKA 3OLZA 4TMZA 2M2IA 4WA7A 3T4PA 1YWGO 1F5SA 3RAPR 4MWDA 3OX2A 1UM8A 2GFIA 4YLEA 2PXHA 3S5JA 2CNKA 1E3QA 4JITA 4OB7A 1GGNA 1T4CB 4M37A 2POQX 3JZFA 3TQQA 4Q1BA 3ZDCA 4Q9DA 4DUGD 4ZK6A 3I58A 4IO1A 4TM7A 5A3JA 4MAMA 3IAS6 2Q3LA 2UUOA 1HY1A 1FY2A 4YJDA 4B4OA 2W42A 1FFDA 1VE5A 4RK4A 5DCLA 4NXNB 2H4FA 1I10A 2Z09A 5EEGA 5G1PA 2XDQA 3EBPA 3E3AA 1ULHA 3F1KA 3M4NA 1PI3A 1LRLA 2AJCA 1K92A 4D0NA 1SVLA 3PJDA 3FNRA 2QUHA 3OOJA 4OXNA 3CJRA 4RBNA 4WHMA 1GWNA 3UOAB 3UIEA 4PO1A 3TLBA 2R8RA 1ORDA 2J0SA 3WWOA 1XZCA 3HABA 4PCUA 4Q66C 3DAHA 4IKPA 4BBAA 1W2GA 1JJIA 3FF4A 3FFAA 3JATB 1Y82A 2GTPA 1NP6A 5E1OA 2CFOA 4FYYA 2YS7A 3C5EA 3HVKA 1G1AA 2RE8A 3BICA 3L8HA 4KK3A 4AZVA 4QHTA 3LK6A 2IUFA 4JDUA 3ZE8A 1ZISA 2CL0X 2CNWD 3NEYA 2DY1A 3UMSA 4WCFC 2HRZA 1KOFA 3R5KA 2A58A 5CW1A 5THXA 3DYVA 4EABA 3KQVA 4L4YA 1P8AA 2X8LA 3RDPA 3RYHB 1K06A 3VYVA 4Y6OA 3ED1A 1T0IA 1L4FA 2JIMA 3G82C 5GM1A 3R8FA 1ZAYA 4ALNA 2ZUUA 3EDCA 1PZHA 1ULSA 3NTUA 2L19A 5JDIC 5IHPA 4XA8A 5F2NA 1MN6A 4NCJA 5DXFA 1DBWA 3DWIA 5DW0A 1US8A 1W4ZA 2PVCA 3GI1A 2H4HA 4GPEA 3MAAC 1PWXA 4KFSA 3RS5A 3OVMA 5F78A 3VR6H 3ZS9A 1XPRA 2VHEA 3WGVA 4C4RA 3WLHA 5B3KA 1NZFA 4YN3A 2VSOA 3K72B 2SKEA 1L7BA 3FZQA 4B3IA 2HT1A 2R62A 1WXHA 4D6PA 4UMDA 1WY5A 1Y1SA 3FWHA 2JC3A 3P20A 4UNNA 2W4IA 3TSCA 3KEFA 4C4AA 3O1LA 4EHLA 1PVVA 4L9RA 5AVSA 1GQFA 4M21A 1S4MA 3VV2A 1SZPA 2ACKA 1LPOA 3GEEA 5T6BA 3PRJA 1L9KA 2FFHA 4LKOA 3UMRA 4X9XA 1RYFA 2D8AA 2UZ1B 3REGA 1WQ1R 2HBRA 2P27A 4ZCIA 3MCZA 1G4HA 4C6SA 5JWRA 1ICEA 3ACBA 1WPRA 3VAYA 4B6GA 2VF7A 1YQ9A 1G8YA 2E5WA 1W4LA 2YV2A 2P4QA 2ZU0C 3RRYA 2EERA 2OB2A 3FZGA 4BQRA 2A1IA 4L3VA 2XYQA 1RT9A 2CK3D 2P9HA 3F49S 3L7DA 4M8KA 3TNJA 3UWMA 3PDJA 4TV8A 2WR8A 3A4VA 1FUEA 4K26A 121PA 4L2IA 1D9XA 1GJRA 5FWNA 1CW2B 3NKLA 1ABBA 1CUSA 1SURA 3OFVA 3CUKA 2FRDC 1CUGA 2WKWA 1FVOA 1SCDA 4Z99A 5CLLA 1OZ0A 3WP1B 4YT2A 1EAMA 1W35A 5IKOA 1R8QA 3WGHA 1ZMTA 1UP7A 2FN9A 3IPRA 3K0FB 1RAIA 2AOUB 3MGBA 4G4JA 4EFKA 1A9TA 5IVHA 2XDYA 3VKGA 2XJ9A 2B98A 1XQYA 2CDNA 3WKBA 4BMDA 4JJZA 1X9GA 1FUUA 4X6LA 2RI0A 3EPPA 2YHAA 3DMNA 4X63A 4TSFD 4QKQA 1IZ7A 2P0EA 2QAGC 4GZ6A 4P4UA 5AKGA 2I6XA 1R37A 1GAQA 2QVXX 2VH1A 1Y1LA 3LIPA 3O03A 5IM5A 3UWSA 3JCZA 1VECA 2B34A 4P53A 4AF7A 5I48A 4LEIA 1M34B 1USKA 3G8YA 3RC9A 4ENPA 2E7ZA 3T7JA 1MO6A 1Q84A 5I7OA 3UAOA 4RKFA 1CFZA 4WXPA 4OQQA 3MILA 4IDFA 1FRQA 1PR9A 1R4NB 4RADA 4WH0A 5TF4A 1OX4A 4H1WA 3AJEA 2GGSA 1N3YA 3Q7SA 4GD3Q 4MK4A 3T5DA 3VVBA 4ZYZA 5LZ7A 4BP9A 4EYQA 1B0PA 3TQHA 2FLWA 1G20B 2Q5OA 2EFCB 1OV4A 2R8XA 3HYRA 3R77A 2AJLI 4G24A 3RYCA 3UAWA 1MOSA 5CK5A 2XXBA 3RK0A 3FF1A 1DAOA 4B6OA 4PTLA 5JSHA 4KDRA 4TS4A 4QAQA 3WL8A 7YASA 2WT8A 1OFGA 1C8BA 1VG1A 5EUMA 3GRRA 3OHSX 3UUFA 4YJGB 5HFAA 3I30X 3WLKX 2J9XB 4R1OA 1G8HA 2ZULA 2D54A 3G8CA 2C8VA 3QVKA 3LS2A 3EH2A 1FYEA 3OFJA 3T3DA 3L5OA 3ITDA 4KFRA 5K3BA 1Z6AA 2POCA 1SQ6A 3VVCA 1KR2A 3LMKA 4NYIR 1T9KA 3KSRA 2I3BA 4QBHA 2JLUA 1AZSC 4YRKA 2PX4A 3DAYA 3FLAA 1LI4A 1RKBA 2NAPA 1ESMA 4Z6KA 4ZHQF 4ZICA 3DWGA 3OEYA 1UKEA 5GADl 1G8MA 2J7KA 3AVVA 4O2AA 1G5QA 1KEEB 3V9PA 3NNNA 3SGLA 4LRWA 4BTVA 1IWBB 3AHGA 1KFJB 1U0JA 2WM8A 2JF0A 2Y99A 1CG6A 3CG0A 3EFHA 4NBLA 2GRUA 4Z0PA 4IMRA 4D8UA 4Z3KA 3LQFA 3U7JA 5ALJA 2ICAA 4BFTA 3T12A 5A5VA 4INOA 3WMGA 3BXPA 3FVTA 3DUFA 5CM2Z 1V71A 4D97A 3GIDA 1MJNA 3AI3A 3SR3A 1K6EA 4FSHA 3ID6C 3TRHA 3D2CA 3M89A 4MKGA 1Y5LA 4J3FA 4WFKA 2ZSKA 2FG7C 4O63O 3ER9A 4F38A 3RVLA 3ENZA 3TBFA 2G7ZA 2OZVA 1HX7A 2D27A 1E7WA 1G8GA 3A4MA 4NJMA 2NVWA 4CG0A 4C1BA 2QTVA 6ABPA 1EBBA 2J3IA 1UKAA 4XEHA 3AY6A 4KMMA 2JIQA 3K73O 4KQEA 1WHSB 3FFWA 2ZPUA 3PHBE 4QECA 1Y3BE 4MMXB 4NAHA 2YCBA 4LXXA 2DR2A 1NLMA 3GDGA 3ZWAA 3OOEA 4W6QA 4MHTA 3JQEA 4U2EA 2EZ8A 1JXAA 1RKQA 2C9MA 4NMHA 4PFJA 5ESXA 4F85A 5JC8A 5CJJA 2JK1A 3HXLA 3LWZA 3TNLA 1J1IA 5FD8A 1EVLA 3CH6A 4DMRA 5KVSA 3ZLVA 2PWAA 3PUHA 3Q6MA 1HE5A 2JDID 2ZBRA 3KP1A 5TSDA 1FMLA 4POAA 4UU1A 2ATVA 3EY4A 4C9BA 2CMDA 4Z86A 2ZREA 2NAFA 2FW9A 3PE4A 5LQNA 1QDUA 5JCZA 1XD2B 2XDAA 3OTGA 2XEXA 4M0FA 4OXKA 4UPDA 4V1CI 3JAMA 2WJIA 4B3HA 2WMNB 2YX1A 4C5BA 3ZE9A 4R54A 3M9WA 3MF4A 1OLOA 4RPCA 2AJBA 2VDWB 2OFPA 5AUNB 2DAPA 4QBFA 5TY0A 3ZI0A 5C8YA 5AM1A 3O9ZA 1EUDA 1P72A 1XMSA 5B7GA 2FGKA 4B35A 3F97A 1CVLA 1Y8RB 2X7JA 2XTAA 4RYDA 1KAMA 1Y7TA 2ZXFA 4MWCA 3UF0A 3QXJA 3PHJA 3BGSA 3FAKA 5IH3A 5K3FB 1OFUA 3ET5A 4EJ0A 1G9TA 3JD1A 4K6HA 2E1RA 3ZJ5A 1G8SA 4NYMQ 5LXTF 5D8DA 1CY4A 3G0DA 5K2OA 1OX6A 5HKKA 3DHEA 3GXBA 3ZY6A 4EQ6A 1FF9A 4I50A 2D59A 4KHPB 1R8JA 3NKFA 1GXSB 2PANA 2WQ7A 3PC4A 4RZ2A 2Y2VA 1Z68A 1ZQ9A 1T15A 3PKIA 1YNOA 5I9TA 5I3CA 3PDHA 4YJHB 2XQKA 4IPTA 2XTNA 4X45A 2VIIA 3QPCA 1H4SA 5BT8A 4P34A 3BHNA 2FETA 3DBLB 1XDUA 4Q3AA 4J3NA 4B87A 3QKWA 5HXAA 2YWCA 4IGKA 3Q85A 2QSYA 3CXUA 1AKYA 3HWWA 3WBBA 2F1IA 5EHGA 2B37A 2GAIA 2BFAA 4TTAA 4DXHA 1SA0B 3I0ZA 3M6IA 5KSYA 3GZ4A 2GVDC 3AFHA 3AR7A 4U2KA 4C7MA 4LBZA 2UU9B 1QQ7A 3AILA 1US8B 1ZFNA 4I1OA 1XNQB 4IH4A 4BNDA 3JQ9C 3MB8A 4EVQA 3QKTA 5SZIA 3RG2A 4QM6A 2ZBUA 1YH3A 2MCFA 1S2IA 3R6DA 5FR1A 3WB1A 3G1UA 4UVEA 2IU0A 1C2YA 1MX5A 2YVUA 4IDHA 1R8YA 1X86B 5K5EA 1PG0A 2ZAIA 1MLDA 3C74A 3IO5A 5DGXA 3V1UA 3TOZA 1Y0BA 1JG6A 4OMDA 2D2XA 1Q6YA 3VISA 5L3ZA 5BVHB 5EJ6A 3COZA 4U00A 3V4RA 5FF9A 1AN0A 5JYEA 2D74A 1QFMA 4KIFA 2D1RA 3CGGA 1ZQ1A 4QGBA 4UQPA 1EZZA 1NSYA 5E4JA 2YHBA 3BWCA 4M1QA 1DPGA 2LVBA 4MMYB 3GJSA 1AS2A 4FDTA 3V6MA 1X92A 1P44A 1YT5A 2HJVA 4JZYA 1TF2A 3OZCA 5AKIA 1KH1A 2JW5A 1EUYA 1HKUA 4TWZA 1WXGA 3RB8A 2QQ0A 3P0RA 3PX7A 4TOIA 3U4DA 3KLBA 5FAKA 2NZVG 2R6GA 3DBIA 3LI2A 3SAJA 4AJKA 1NE7A 1T35A 1Z7BA 2DVMA 3C6YA 4WAUA 4YMVA 4UCQA 1UBJS 2FF7A 4Y2VA 3GWZA 5IDYA 2IYFA 1QQBA 3LBYA 4XDYA 3SVZA 4C0WA 4X1KA 1T4CA 4BX9A 5EIFA 4EG8A 1U3GA 3RD8A 3IHKA 4RZ3A 1BU8A 2GCEA 1COZA 2QGZA 3OY2A 3A9WA 3D0QA 3WS7A 2YV5A 1RYNA 1RXYA 1R6XA 2B8WA 3NWPA 5HX7A 2ORIA 3KR9A 5DTEA 2ONJA 4Q7MB 1EDBA 4V24A 5JNLA 4CLXA 2VWQA 3B6KA 1XU4A 3AGQA 3KTAB 4QJBA 1JIJA 1OAOC 2DKOA 5JEEA 3EXG2 3TOVA 2CHQA 1PWEA 2XIJA 4Y2HA 2Z4RA 2HMWA 1ENOA 1UJ4A 4YEDA 3ND7A 5IP5A 2QVCA 2O5RA 5K3FA 2FF5A 1IN5A 2CC2A 1XMVA 1NMYA 1XZEA 3NCTA 1CUYA 4IHJA 5HKAA 3ZV5A 2XCIA 4B45A 4EJ2A 4QOEA 2VJPA 4R2HA 1RXVA 1J90A 3OQIA 4GPD1 2G6BA 1KYTA 2J9ZB 3H16A 1P3JA 1N6OA 3WO1A 2PTHA 1NW5A 1UBCA 2G28A 1FDTA 2ZAYA 3KPYA 3L02A 3M4XA 4FSXA 4RA6B 5KPDA 1ZGZA 2JI9A 3DD5A 5TIIA 1X87A 3HPQA 4R1TA 2EL7A 3K9NA 4AN4A 3HEMA 4JD5A 1ZCBA 5FI0B 1DFIA 2FMFA 5GV8A 1JEQA 3JR7A 1DV2A 2GZ2A 4DPMA 4WXRA 3ZXXA 3ZVRA 2LCQA 1JB1A 2AFVA 2BF4A 2IBTA 1GARA 1DDGA 2QE7A 3A4NA 3CLUC 3LCMA 1U9YA 1XNGA 3QXCA 4OGWA 3SJCA 4CBVA 5J4KA 1QORA 1T5OA 3HCBA 5CVEA 1T29A 5HDQA 2W48A 1EFKA 1ECLA 3TSZA 4K8RB 3F7OA 2YWDA 4P83A 1IZ9A 2IU6A 5KNBH 2HM7A 2IZ0A 3GZNA 4LI3X 2WSLA 4MV0A 4QBIA 4YCJA 1PHRA 5BOSB 4OO3A 1YJ8A 1NX9A 3OZWA 1YS1X 2HA4A 3CVVA 3N0TA 5C8DA 4W5TA 2O8CA 1XTRA 4WEOA 1D6MA 3LBFA 3QE9Y 4JU8A 2C98A 4H3KB 3EJ6A 2A0UA 3HUDA 3O95A 1P6QA 2OQIA 4QRHA 2CSXA 1XK6A 3IR6A 1Y42X 1N0VC 2Q1XA 2WVJA 4JBYA 4ZOQI 3I2KA 5A62A 2G88A 3NHZA 4GG1A 3PNYA 1K3FA 2VZ8A 1M2VB 2H31A 1SOUA 2F48A 3MIZA 4OK6A 4JFRA 1KZ6A 4PFSA 1GDHA 1ZNWA 5CDHA 2A3RA 1KP3A 1KRHA 1LI7A 1ND6A 2NO5A 1PJBA 3GQBA 3LPCA 4DDTA 1OOEA 1VTKA 4MDFA 5MHTA 1SOVA 4O5AA 2NVBA 1RKXA 4PLYA 2AYXA 1C3OB 3BCHA 5A4DA 3H4TA 1N7IA 4PHGA 3JQBC 4G1CA 3QPUA 2B8NA 5EJGA 2C0PA 2XDQB 2VT3A 1Z7EA 2JFVA 1M6VB 1JBEA 1QIJA 3WBJA 1JU9A 2WSSA 1KETA 3DBRA 3IQIX 3IQZA 2J31A 2EG9A 1CR4A 1KL7A 1DCMA 2R5FA 6GPBA 5F2EA 1NI4B 4QUKA 1E9VA 3DGEC 4DB4A 3DO8A 2QZZA 4O4IA 1G7SA 4K6KA 1O0CA 1BO6A 4BUCA 3E04A 3G0OA 3N6XA 4I08A 4I46A 2F9LA 4LJ7A 4PSKA 2DR0A 1EGVB 4RL6A 5JUWA 3T7DA 4EW3A 2Q6KA 5CD1A 4A0HA 4LF7B 4F7WA 2VEOA 5LP6B 2P1RA 3H4MA 4RS3A 2Z2IA 1WHSA 2PHZA 1HT3A 3N0RA 4HTFA 2HDHA 2FWMX 3WHIA 4JXJA 2DT8A 4JN6B 3U4AA 2UV8A 4KK4A 4OFXA 4W1QA 3M0EA 4RE5A 3RANA 3RJZA 4US1R 2JZNA 2YWRA 4RKWA 1ZZEA 2XAAA 2ZYAA 4LZPA 3CN7A 5EZYB 2WHPA 2A7XA 3X2EA 4D42A 2BDUA 3V97A 5HPYB 2O1SA 4DUZB 2Q5FA 4KQMA 2C2KA 4G8DA 3SCZA 2OGUA 2ZS7A 1TZMA 1TZBA 3OLQA 1AIPA 5CHEA 4PAOA 2ZSFA 3PXGA 2HMVA 4XDHA 2C9BA 2A5GA 3LDAA 4ILEA 3WA7A 2JAPA 3V33A 2DFLA 3DDZX 2WSIA 3EZXA 1N6IA 1QHXA 2FW8A 1LVHA 4PZUA 2NQTA 5EERA 1G8KA 3TGWA 1RXEA 1UK9A 5KQSA 5MFPA 1H69A 2XTJA 1V16A 2XNDD 4LYYA 3NUQA 2E0IA 2XUGA 4LJLA 2JLRA 2V8OA 2HSWA 1PTJC 3FNEA 4M1ZA 3TTSA 1C9KA 1U8FO 1DAEA 4RHYA 3UQZA 2FPXA 3TWOA 1XU9A 2F1HA 3CKKA 1XMJA 2FZEA 3AIOA 1Z38A 1Y5IA 4G4GA 4FTWA 4US0R 4RV9A 2OVBA 2UVPA 3O0TA 3W34A 1ZNQO 4HDAA 1URPA 4D9FA 4KVFA 3WSWA 3CHYA 3R76A 5B1HA 1IQPA 2O7SA 3SYMA 1VIDA 1WBJB 2PAFA 2BJWA 2V65A 5LDDC 4GKJB 3EAGA 3WFIA 1P4GA 2B7CA 2CB9A 3DYIA 4AB1A 1RM3A 2FPIB 2PMKA 3PYMA 3UJ6A 3AEZA 2PBFA 4FCWA 4IS2A 3ZEIA 1SCJA 2BEWA 3B1JA 3PT5A 5EQTA 2NXWA 3AVPA 4FI3F 4B74A 2BEVB 3R3HA 4G9GA 5CITA 3GVCA 2O2DA 2QRZA 3G7NA 1D7OA 2P5UA 4KQHA 2HU8A 1Z2AA 2Q4OA 3HHPA 1Q0UA 1SHTX 4IW3B 5D6NA 3CG4A 4RLSA 1OBHA 1T3GA 5DYWA 4J1TA 3VHXA 2PCJA 4E1AA 1UOEA 2QRLA 4LOIA 5GINE 1CEXA 1D2NA 1P2VA 4NHEA 3GVHA 3GGGA 3SFVA 2DHDA 2J8ZA 4HDNB 1IBLB 1WZEA 2XB9A 3GTDA 2IXDA 3K30A 4YNBA 2F8MA 2OD7A 3PB3A 1E8DA 8GPBA 1XRJA 3RRBA 2YASA 4N3NA 1ZOLA 2TMKA 3CUYA 4P7FA 4MJLA 4IFIA 4BMOB 2ZJ8A 5I7FA 2WF7A 5H83A 5KDDA 3T3OA 3LFHA 3E9RA 1IEXA 1DUSA 3D3KA 3F5SA 4UUPA 2G0AA 1Y37A 1HDYA 4ZXFA 4ZI3A 5DLYA 3T7IA 2HK6A 3B7GA 4Y2UA 4V1CA 2REQA 3GFRA 1LNZA 4BMNA 5ALKA 1LK5A 3VHLB 3FLBA 3RTBA 4H3HB 3WRXA 4C3UA 4HMPA 1IE3A 1FRVA 1MJGM 2OV4A 1CQXA 4YYZA 3D6JA 1ONNA 3UT5B 4O4JA 2LKCA 5AVJA 3SYRA 3V8QA 1JA9A 4ARIA 1PVOA 1GCGA 3PGLA 2RHTA 4X6YA 4UUMA 5DBHX 4LPKA 2ZTVA 3O3OB 2WUGA 5L6MB 4B6QA 1HDXA 3ROFA 3ZWCA 4OBEA 3LVBA 4H18A 4CIVA 1UJNA 1ILEA 3KAJA 1UCFA 2MOKA 1P39A 2XITA 1M5TA 3MINB 3PQ6A 5DNYB 2PFMA 3HR4A 1YR3A 5E7JA 4N5HX 3RHFA 2A0YA 2XF8A 4L6AA 1N5DA 3E53A 3EVCA 3FPAA 5EMMA 2G07A 3EFOA 5KQRA 1K9VF 1ZRNA 2CJXA 3GRFA 4ZV9A 4E14A 2GEUA 2RIRA 2EJUA 3BMQB 2I2FA 3CGWA 3DA8A 3KB8A 4IDOA 5ESWA 5FWAA 5FBZA 1JR4A 2HV9A 5P8WA 2Y9PB 2BOVA 2GXUA 3CRMA 5DIZA 2ZRAA 4H7DA 3N2IA 3TKAA 4CV3A 4JI5B 5CB8A 3LQKA 3R5SA 3Q2IA 2CLFB 4LJ6A 1LW6E 4DA8A 4KPUB 3PGJA 1JVNA 4FYHA 2RKWA 1V6AA 1L4UA 1T5HX 4JC8A 4PYIA 3EISA 1M75A 3CJQA 2DCMA 2OV2A 2DULA 2W11A 4RETA 2W8ZA 4XFJA 1LDBA 4CN9A 3OM0A 2QNBA 3GMIA 4JHXA 4QXQA 2PH3A 1B14A 3IAAA 1CUJA 2R65A 2YVAA 4C4YA 1CUFA 3OQ1A 2IEYA 4IQGA 1K2VN 4ZDIA 1F8FA 3K9QO 1VJDA 3OZ7A 4GLLA 3OHMA 5FTNA 1C7RA 2CWDA 4HXGA 4BFLA 1UADA 4EG3A 3HJFA 3I23A 4O4LB 1KI6A 2Z4TA 5C8ZA 2AR9A 2QD1A 1D4OA 2JASA 4LGVA 3TNYA 1N32B 1C14A 3V00A 4U9HS 3FNFA 3OAAA 3LBAA 4HVTA 5FOSA 4ZHQB 4MW2A 3UFXB 4ESVA 3QOFA 3QEOA 7ABPA 3OLVA 3MJSA 3GCXA 3EIOA 3PQCA 2ZUSA 5DIFA 1KPHA 4D9HA 1K8XB 4D92A 2V4ZA 4H3VA 3TLEA 1FNDA 3C15C 2PXAA 4AROA 3N2ZB 3ZU5A 3A9VA 4CRWB 4WY8A 2O7NA 3SDSA 5A6SB 5AI6A 1QG6A 3IBSA 2VCHA 3NO9A 1YK0A 3NXKA 2V9ZA 3I0NA 2DE0X 1PR0A 3FWPA 3DQQA 5ALOA 3VBCA 1QHIA 1YC5A 3T1QA 5LLTA 2Z3ZA 3FY4A 3ZNQA 4PGMA 1NPYA 2X8JB 1RWPA 2DH6A 2QL5A 3DMYA 1DOFA 3FDJA 4DLUA 4MSUA 4C88A 1GPH1 4R8LA 1Y7HA 1XAIA 2C03A 2LIPA 2M6KA 3MMXA 3OA2A 4AS3A 4JBNA 4B7AA 1E66A 1ECPA 1GKKA 4XCQA 4QDOA 2WFLB 3D6MA 4XQCA 4MRAA 4V02A 1TJUA 1JG4A 3PXCX 3W6UA 3HACA 3CLVA 4X5OA 5F5LA 5BURA 5F5NA 1I4EB 1FZTA 2AVNA 1M2NA 4JP2A 2D00A 2QMZA 1RTKA 4OLHA 4J4TA 1TRKA 3QEJA 5J4YA 3VU9B 1GUBA 1O0BA 1I2ZA 4B5LA 3O1JC 1Y9DA 1UAAA 3NCHA 4AIIA 1SVWA 4N7MA 4O1MA 3MC1A 3PGKA 3UAZA 4CUZA 4MQFA 2RG7A 4YMUA 5BSFA 1RJDA 4JOBA 2ZB8A 1U9JA 4BBPA 4Y9DA 5EZSA 1AXGA 1BIFA 1D1QA 2PH7A 4OHZA 3U17A 1DZIA 5BN5B 2HPAA 1FLVA 4HFMA 1U7ZA 3WRWA 1M0EA 3HA7A 3SKVA 2ENUA 2BH2A 4IRUB 1CY0A 4TL7A 3DAOA 2AEJA 3WIOA 5G0WA 5KYGA 1XKLA 2FSVA 2JK0A 4J7AA 4TS3A 2XWSA 3M5DA 5BR8B 2KS6A 4C7XA 1RHUA 2HLPA 1WW8A 3WQQA 3RU7A 3PQFA 5KNDA 2ADMA 4Z8XA 3PFNA 2X2FA 1FLAA 3EOAI 1TO1E 4WINA 4DKXA 2VHTA 2VPTA 5B6IA 3Q6NA 2ZJBA 4HWPA 1BVUA 2GD1O 3IB3A 1WUTA 2IPLA 5L4SA 4X7PA 4LRUA 5CAEB 4QU0A 4X6UA 3KKOA 4C4SA 3LP5A 1GTL1 1XI2A 2YN0A 1E2PA 4M1WA 3LVRE 2PJDA 4HVAA 1B23P 1EI9A 1XQ6A 1PK8A 4HXEB 5L7YA 4WEQA 2O2YA 2C5GA 2ZETA 4YACA 3TQOA 1N5JA 1DKRA 4OHXA 4UVDA 2ERXA 1KI4A 4Y9UA 1D2MA 2ZPTX 3C3KA 3UPDA 5DLPA 4BKRA 2PGLA 3IDZA 1ZWLA 3OX4A 4BRUA 4EJFA 3IILA 4YO7A 5A7FA 2IRWA 2VK4A 3ORFA 2DMRA 2HHCA 1KBOA 1QLWA 3CNLA 5DM0A 5JMTA 2QF7A 2XXAA 1XZJA 1ADFA 3MMNA 1M0SA 3WJ1A 5TQVA 1NRXA 1OASA 4QIHA 3ND5A 2RGXA 5KVQA 1EE9A 1A97A 1CVRA 1QXSA 4ZO8A 5TT0A 3WMRA 1E1MA 1AKVA 2XA2A 4CW7A 2BMVA 2ASEA 5EZYA 1KKUA 3W7BA 4MYDA 2H59A 3V6LA 1PO7A 4MZDA 1HYHA 1Z88A 3OIGA 4FCVA 3DP9A 3PVZA 3GCDA 4BEBA 5F9FA 3R5FA 1DKNA 4JGIA 1Z5WA 4LK3A 2G1KA 4D81A 1REQA 4MW6A 2KHZA 1EFRA 3JALA 4BO6A 1E9SA 3B1VA 1ZJYA 2I29A 3BWEA 3D3JA 2H54A 4OB8A 2YNMD 4JB3A 4M9CA 4NDZA 3X1KA 2ID7A 3WKCA 3GJ7A 4MCAA 1O9HA 4JQOA 2WT9A 2AKEA 4HVLA 1I1HA 1Y5RA 1ZNXA 2GASA 4C0BA 4IIDA 2X1MA 3TZCA 4AS1A 3MPUA 2YZ7A 2PUJA 3EXFA 3BUSA 2B5OA 2P9JA 1CWUA 5AVUA 2WFLA 5K3OA 3KZXA 2OGZA 3ROTA 2G5PA 1XEXA 3LLCA 1TGVA 3THWB 1LDNA 4KKVA 4FILA 1ZVKA 2PUWA 1L8LA 1PL8A 3HFSA 3VU1A 2OCDA 2BZ0A 3CLTD 4NJOA 2D7DA 3NC4A 5CFZA 3DOCA 2BMDA 3BHJA 3FPBA 3OJ0A 4FZ5A 2WE8A 4QYTA 4COOA 4KXYA 1E79A 1TCBA 4DLWA 3U44B 2DWQA 1VZ2A 3JAWB 5KCMA 4BP3A 2I99A 3OUUA 4GNKA 1SZCA 3FGNA 4U7HA 1WUIS 4MVJI 3QVXA 3QYPA 4GX1A 4FR0A 4LDZA 2H9AA 4MWGA 2XLBA 3PQ4A 3H9UA 3QWAA 2NADA 4RENA 4LBVA 5IF9A 4XUEA 1GDDA 3T0FA 1D2HA 1L7NA 5GJBA 1XZHA 4AW9A 3AR4A 2BIFA 3DVSX 1TQ4A 1PJTA 2CL5A 1K8QA 3RC2A 4MH0R 1JDPA 4HZGA 1PEKE 3QUTA 4CKCB 1QHYA 2P1DA 4MKIA 1LRJA 3DTNA 1R10A 3AINA 5AYVA 2CLDX 3RRFA 1WO8A 2XHZA 1MA3A 1QLHA 2Q2QA 5ITZA 2MIIA 2ZRLA 5B3JA 3CX4A 2AXNA 3HJTA 5KJ1A 4G0ZA 4XB2A 4UHJA 1FNSA 1RR6A 2OP1A 3C6QA 1BDMA 5AXAA 3N8DA 4B6RA 1FFXA 1K6XA 1QG4A 4I50B 1I4DD 4HQRA 5K20A 5MFZA 3E22A 3PJGA 2WUDA 3CZMA 3H9BA 2EQAA 2FUNB 1OFTA 3WSVA 4OH1A 3EZ7A 1A72A 4CUKA 1FTQA 1VDMA 2VYND 3NJ4A 1W48A 1TF7A 2FWJA 2ZWOA 1V5FA 5ICCA 1L7QA 3AF5A 1EFDN 4WXMA 1LTQA 3JPYA 2CEKA 3M6XA 1IBCA 4KO1S 4TMWA 3DM9B 4YMIA 1DJMA 4MS1A 3R3WA 1CUVA 2A88A 2YINC 3RBZA 3EGCA 3HM2A 5JD4A 5DNCA 3GLFB 3EAFA 4J2TA 5D2CA 1Z5GA 3JQGB 2ATXA 1PIWA 4K9DA 4BLTA 2WZBA 3AF2A 3QY9A 2C84A 1P81A 1R6TA 2ZBFA 4MZXA 3SS9X 4E7OA 3DE6X 1JDZA 1X1RA 4ITUA 4YMHA 5J2UA 2VP5A 1MIOA 2QD3A 2JLVA 3WNCA 1YR8A 2LDBA 5AXBA 1U2GC 1GILA 5B5SA 2ECQA 2NYUA 4L9WA 1GAXA 4GZMA 5BXYA 3U2QA 1WU8A 2QLJA 1BFKA 1Z45A 3FN4A 3RHSA 1JU4A 4CQNA 8MHTA 4TX1A 1HURA 2UVDA 4B3RB 5M2QA 3JWJA 1DJPA 3H2IA 5LMUB 4QULA 3LVFO 2VYFA 5T4BA 1ONSA 3K7EA 1ZN8A 2FFRA 3G8DA 1VL2A 4FLFA 2WUWE 3S1LA 5EQJB 4M0CA 2LV8A 3CH5A 1E69A 2ZJ5A 4FKZA 4ZI7A 3X3HA 1N8NA 1BVYF 1BXZA 2XVXA 3ND8A 4NAVA 2XQFA 3D1VA 1H42A 1O8BA 2JZOA 4J7XA 1THZA 4DJJA 1GFSA 4MP8A 1WBBA 1YONA 1BDJA 5B3AA 2NACA 2QJOA 4BZPA 1MJFA 4F11A 3P0JA 5JSYA 1AE1A 3AT1A 3ZWWA 2QTHA 1CEEA 5F7JA 3NYIA 4LY3A 5EZ5A 1N2IA 1XU7A 1JFVA 3ADKA 5CBPB 4GMKA 3WLIA 4EA7A 1FP2A 2O52A 3FBGA 4V0QA 4FWTA 1TJWA 3PUIA 2Q3BA 3UKDA 1PUIA 1ECBA 4IG4A 1OC4A 3L77A 1CU1A 4JXKA 4JU9A 4GLJA 3CO0S 4JVLA 4WBNA 5IF3A 3CM0A 3AF6A 1G0NA 4C3ZA 1UC4B 4EGFA 5JRDS 1ORTA 3OIVA 1GEGA 4MVCA 3WGKA 5JXGA 4PPFA 4WERA 4L0DA 2CV0A 3RT7A 5EAIA 3EDYA 4CIBA 4BB6A 4FT4A 8ATCA 2CFSA 2JBHA 2RGBA 2X86A 4BNTA 3D2AA 3LHIA 2WRZA 3A7DA 5LNK6 4I1RA 1N0IA 3TTYA 1KC3A 1NNUA 3K96A 2O7VA 4FE3A 4PHFA 3IAS1 1LX6A 1TU4A 3R9KA 1ZL2A 1LVGA 3SHOA 3L4JA 1T9DA 2I76A 3RROA 4DZTA 1OVMA 5EMHA 4LTDA 1NQOA 1N0UA 3WL6A 3PLAE 5AM0A 4CMEA 1HLFA 3CW9A 1DQPA 2I3DA 2QMOA 1FQWA 3IS3A 1B6TA 3L0ZA 3NJ8A 4LX8A 1IB0A 3E6AA 3VR1A 4DT1A 3R3SA 1NFFA 3COPA 3HNPA 3AI1A 1U7UA 3LU1A 4N54A 1ZEJA 2WWIA 3O94A 4XIJA 4B3XA 1BS1A 1XNRB 1UOOA 2ZOSA 2QAGA 3H5AA 5D3MA 3SF8B 5IDVA 4CKXA 1FP4B 1L3BA 4GRIA 2JPDA 1R4MA 4FFBA 3D6HA 5KDOA 4JJKA 2PU5A 2O7RA 2N1MA 2WV9A 4QGFA 5FI5A 4HRYA 1OH5A 3FPGA 3BM5A 3COVA 2H7VA 4YQYA 5L3RA 2XEDA 1OVGA 4AIRA 2H07A 1PT9A 2OXRA 3O73A 4RK6A 5CA1B 3TLGB 1AB5A 1EQ2A 1E1YA 1HRKA 3JQFC 1MIOB 5DI3A 3WOHA 4KWEA 4Z5XA 5LQDA 1XG5A 2IYYA 2XTZA 3JTEA 1ZSNA 4OU5A 3LYLA 1N2XA 2B4QA 1AKEA 2O3JA 3OEHD 1BCSB 3MZ0A 3NC0C 2YJZA 1RM0A 1IY9A 3D5EA 3FGOA 3O93A 1OB2A 4XGRA 3Q0EA 5HG0A 1R0CA 4NU5A 3L2OB 4K6CA 5K4GA 1OF1A 1Y3CE 2P79A 4DCPA 3HXPA 5BRAA 3D0RA 4GGMX 1NF8A 5DEIA 3AHEA 1LBEA 1HE2A 2QXUA 3EHDA 3H2ZA 5JAQA 1NTRA 3SZOA 1I30A 3PUWA 3HKBA 2ACVA 2YVKA 3WGNA 3SLRA 4EIWA 1I3KA 2PLWA 4PLGA 3N7TA 4RSHA 1UIRA 1U8YA 3HA3A 3QUQA 4RESA 3WL4A 2Q0XA 3FMIA 3P9RA 3GFPA 3LKZA 2AOTA 3LZ6A 1OI2A 3FPFA 1ZM3A 1T6XA 4QRDA 2GK4A 4MS3A 1O94D 3ZGVA 3TF5A 5GIPE 2WV7A 4CEIA 2AG0A 2O07A 4GBED 3NBYC 4LVNA 2HK9A 3JVDA 1PE0A 4IHJB 3HP1A 4KX5A 1F2TB 4OOFA 3W0LB 5JZMA 3L46A 1W85B 5JARA 2FE4A 1HSOA 1QANA 1K8RA 3UK6A 4NK5A 2VJBA 4ND8B 5FQOA 3PG5A 2H1WA 5BV7A 4H6VA 1M1UA 4HDOB 1CRPA 4WE3A 4K46A 2A0FA 5FPQA 4OTZA 4CKEA 2BGLA 2R68A 4A0FA 4C6TA 6PFKA 2GZ1A 4MJXA 1KGSA 1P2BA 4KNVA 3KFVA 4Y2JA 5J40A 3UV3A 3ZVMA 2BFWA 2HVGA 4G1VA 2V54A 4DRXA 3JVVA 2JH9A 1FTNA 1TDJA 2APJA 3AIIA 3K0AB 3UBMA 1PQWA 2ZJ1A 1NUHA 1JMVA 3B5JA 3UT0A 2IH2A 5K0EA 1A2KC 2UYCA 4C2TA 1XD9A 2O2IA 1SQGA 5TGZA 2WICA 3OI7A 1PW7A 1CUCA 4YAGA 5F3RA 2H00A 4XOUA 3ZXIA 3SYNA 1D0SA 5BPHA 5JSQA 4G8JA 2GCPA 1LPAB 4HDNA 4IJVA 4NFYA 1CEYA 5BOVA 1BFUA 3CX8A 1J2UA 3V1LA 2QLTA 1V48A 3KR2A 5JD6A 4EVSA 1PJZA 4JUBA 2JIRA 4C07A 3MBKA 5HK8A 5JV5A 4Y98A 2VJDA 2AXEA 2QDKA 2Z9BA 3ZHOA 5GONB 4WN9A 4PSCA 4D3ZA 1Y4DE 5B58C 3K2BA 3KUKA 2JGEA 2WIGA 3KOOA 1WPGA 1WX1A 3AJDA 4ROSA 3WQHA 4D2IA 3O3MB 4AO8A 4JOCA 5BNIA 2DFVA 3CLUD 3EOBI 2VSXA 2ATEA 4FYXA 3L9WA 3RS3A 4OHWA 5HIJA 5IJ0B 3RBXA 4OREX 2X9NA 4POOA 1YQEA 2QPAA 1UEJA 2X0NA 2CHVA 1KOGA 9ABPA 4DA4A 2IHBA 2ZRNA 4FFSA 4JT4A 1N0HA 3MUNA 3C3BA 4QUDA 4B8YA 1ECFA 1KJJA 4OQEA 3UG6A 1YFZA 4K05A 4J1NA 5F51A 3RVRA 3S2SA 4HT3B 4YDRA 1XQ9A 1O9GA 4LJ8A 3HBJA 5BQ3A 5FWYB 4EK9A 3FVQA 1L7AA 2FR1A 2H1RA 4I5DA 4P33A 1IK6A 2AXPA 4DYVA 2HRRA 2VOJA 3ANSA 4U7PB 2A33A 2O8BA 1WABA 2C3UA 1EB9A 3DEHA 5D51S 3JARA 4LISA 2PK3A 3AF0A 3JYPA 4MULA 3CF4G 3V8MA 3QE4A 3V2IA 1KH3A 1IPEA 3VPSA 4A8JB 3LW8A 5LBTA 4YMGA 2O0LA 4DRYA 1QGUB 5K2MA 2DP4E 1JSLA 4FFVA 2H4YA 3SC3A 1LWNA 1OWMA 2P90A 3K1AA 4HGZA 3VPHA 4A26A 2FVYA 4A2QA 2ZRGA 4KQ1A 4M49A 1ML4A 4INAA 3B3AA 3PTAA 1JVSA 4JOQA 3EZ9A 5AW8A 1NM5C 1ODIA 3I01M 3LM8A 3RFFA 3SK0A 4RVSA 4AN1A 3HDTA 4YCBA 2Y05A 3WK6A 3ZHRA 3U7GA 1P1CA 5NULA 1ITZA 1QNLA 1RRFA 1K62A 2HIMA 3IERA 4EGAA 4CTOA 5ES3A 4MS3B 4W7IA 1GQ2A 1YR1A 2W6IA 2EFGA 3K92A 3PK0A 4ZI7B 4DR1B 3CEPB 1U11A 3BB1A 1L4NA 2JA2A 5ALLA 4U4AA 4DCSA 2JCVA 3BSFA 1Z63A 3HCPA 5ARCA 1QK5A 2CHEA 3DXZA 4JEMA 3W8DA 4XPZA 1RZ3A 2XPCA 3ZH2A 2FXIA 3D02A 1O3YA 2ZZMA 2X2OA 4AKTA 4CL2A 1FJHA 1YUMA 1HDIA 1KDZA 3CKYA 3JD2A 3KL4A 3PUVA 3F6YA 4AQDA 4CKBB 3RC1A 1K75A 1RZVA 4HJXA 1A9YA 2KPOA 3F1LA 4WK0B 4DNPA 3OJOA 1ESNA 1WB4A 2LTAA 1IIRA 4AUNA 2OCBA 1EFLA 5GJWC 4N3AA 2PLAA 1U8AA 1W5FA 4UASA 3VMFA 4OD0A 1T4BA 4GW3A 3K2IA 4WBNB 4Q24A 1T43A 2YJ3A 4NV1A 1GTZA 3IAEA 4E4RA 5GIOE 4HHEA 5LIRA 1PQ4A 1QQ6A 4RIGA 3P2YA 4JBGA 4ZQBA 5B55A 4KREA 3C5CA 2Y27A 1KQPA 4PYRA 3GYBA 1SXIA 1OXVA 2W2VA 1ZSVA 5DWDA 1QX3A 3SX0A 3DG9A 4E07A 3B52X 5CIYA 5BR7A 4QREA 5CTAA 3V34A 2HWXA 1VDKA 3C6ZA 4KXWA 4CL3A 2PCLA 3PC7A 2JFPA 4GT1A 4HQ0A 4Y9SA 2YXLA 1TU3A 3QLJA 4PX9A 3K9BA 2QUIA 5AFSA 1Z33A 2PGXA 4HKTA 1UZAA 3ZR4B 3AP1A 1C4WA 3C4VA 5H4GA 2YWBA 3P2EA 2FY8A 4JBIA 2GAFA 3NTRA 3TDMA 4F1WA 4YLYA 3PQ5A 3IIIA 2QR2A 3TW8B 5EJFA 4ER6A 1BMQA 1IVNA 2H6EA 4IS3A 5EYPB 5GZ1A 3KDSE 4KQ2A 4IUBS 2WM9B 4WNYA 3UMMA 1VIAA 1XDBA 4BNUA 2JGKA 1VPEA 3P0HA 3GLGE 1HDCA 1NQVA 4TLMB 2CXTA 2H2WA 3UTCA 1ZK3A 2XOEA 3IPCA 4M54A 5M29A 2P67A 1M2KA 1S1CA 4DY6A 3RS0A 1L5HB 1JQLB 4JLWA 3D64A 5LP6C 3EEFA 2Z3VA 4QFCA 4R3WA 1H0SA 3RHTA 5E6RA 4R6XA 4EWLA 1WSDA 4C7BA 1PEDA 3J81k 1E6EA 2J0UA 3F78A 1LLFA 2AE1A 2PR7A 1AA9A 4I4CA 4YCDA 5EIXA 5BOSA 1E3JA 4M0LA 3W3AH 5REQB 1PL0A 3K32A 1LNSA 2AMLA 4BWYA 5I3ZA 1GGJA 1JQJC 5HIAA 2PQ2A 3K1AB 4FYWA 4J9UE 3Q7EA 2X0FA 5I9NA 3CE6A 2GF0A 3Q41A 3S2ZA 5BNTA 1UJCA 5L6LB 5IBRA 3EGOA 4LXIA 3QEMA 3JWHA 3L7BA 1NXOA 2WABA 5C31A 5KZMB 4YCSA 4FFRA 3TJZA 1VG8A 1E1RD 1A50B 1H5NA 1Z39A 2H2DA 4WPGA 2WYWA 3Q40A 3U31A 4EG1A 2ZJZA 5J1SB 2UYGA 1I2MA 4FONA 4MWEA 2DTXA 1BX3A 3NHAA 5IAEA 1AKWA 1OI7A 5ALEA 4YVFA 1V95A 4ENRA 1UR5A 3GLQA 3L7NA 4JENA 1PX2A 3ORQA 1MG0A 3O9MA 3PEFA 1OB5A 2DWOA 4PNZA 1SXPA 1LY1A 1ZS9A 2G40A 1ZOPA 2QTTA 3GO4A 3PIDA 4GX0A 2XVMA 3WXBA 4EG6A 4Z49A 3MTDA 3ET4A 3OO1A 3PE6A 4YRRA 5BWBA 5M7EA 5BSMA 2NU8A 5ENDA 3WRYC 2DCUA 1JR3D 1TT7A 2PGAA 1NLFA 2QS9A 3AZPA 3EGEA 2X5JO 4M6WB 3F6SA 1R00A 3W5BA 5ALXA 2FQYA 2X4IA 3GRCA 1L1FA 3D8UA 1D1PA 1FJXA 4W5NA 2Y0BA 1BEEA 1ORRA 1UJ6A 1R15A 4KGXA 1J2YA 1WM1A 4IOMA 5C46F 1L7RA 1U02A 4BVGA 1H1LA 2QRPA 4GU5A 2A9VA 2IYXA 1NURA 1DNPA 1QIDA 1H5UA 1PP4A 1V35A 4LSGA 1FJGB 3W9BA 2HMSA 1KEVA 3ZJVA 4J0CA 4U02A 1I1NA 4HWTA 5LWHA 3T7RA 4EGJA 4INPA 4JQCA 1OH6A 1PLLA 1NP3A 4CMEC 5JS8A 3UW1A 2JIDA 3TSWA 4MVJP 4EX7A 3KDAA 5EWMA 1SG0A 3TPFA 4TV9F 4MKHA 5CD9A 4JGBA 2HRCA 4UXHA 3VJKA 1Z17A 3GV0A 3LL7A 3E9DA 5CHYA 1KDTA 1OZHA 4EO9A 2IHJA 5KVCA 3ZPXA 4D4GA 4LQDA 4F46A 1VPDA 1S3GA 2GBFA 2NYVA 1SGWA 3DNMA 1TQHA 2W2MA 3LOPA 3R44A 1NY6A 3CRW1 4YP5A 5LZ9A 1CQJA 1Z8FA 1G2PA 4NQRA 1W1WA 3T7AA 1AK1A 1QGED 5J47A 2H1CA 3NHRA 5JTUA 3DW3X 3R6QA 4LYDA 5FUBA 5CDUA 1J8MF 3TR5A 1CT9A 1SC4A 3GMSA 1VYVA 3T95A 2ZUFA 4CQLA 3RRJA 4FBMA 4G9BA 1DTWB 2QG9A 3DLPX 4EAQA 1YFKA 1ZI9A 1OAAA 2FP4B 1KY3A 1OTXA 2QJFA 4EY3A 2FNAA 5JZBA 3K8QA 2LGJA 3BZUA 3LP8A 1IONA 5E1DA 1C3EA 1TEXA 2BSXA 3QM1A 4IXDA 4K9KA 4RJJA 4XR9A 3U1TA 3O8CA 2H8KA 4L27A 4ZPJA 1Y81A 3O8QB 4LJ4A 2IOFK 1G42A 2Q7DA 4IH9A 1OGJA 2AZ4A 4BVLA 2V0GA 1THTA 3U9LA 3IEMA 4D43A 2GBGA 3PWKA 3HRIA 4Z0HO 3AVUA 1VE7A 2DFNA 5ITVA 4LPSA 3IQDB 4D4IA 2C5LA 3ZX5A 4KO2S 3EOZA 4EQ6B 2QW0X 2BHNA 3RBAA 1NVMB 4HPXB 2ZUWA 1BA2A 5DBIA 4DOMA 4C7KA 4G0YA 2FK7A 2R9VA 4AC9A 2HQ1A 3DFUA 3LE8A 3OD5A 3OZVA 5D87A 3SZGA 4YT4A 1MX3A 2GM4A 1NDHA 2CF6A 1BE6A 1BMFD 4HVCA 3ME5A 4DR3B 2VKTA 3UPUA 3NHPA 5AK4A 1CVIA 5ECWA 4P81A 3U7QA 2EBWA 5DLDA 3OICA 2O48X 3EUFA 2P62A 1UDAA 4IXTA 2PSSA 2BM9A 4JODA 3G0CA 4R01A 1LDMA 1Z6YA 4F4IA 4YJFA 5I7EA 1RPZA 4TGLA 1MDBA 1Y8RA 2D2IA 2QLFA 3KZNA 2CXRA 4D9BA 2E5LB 1YVUA 3RWMB 2J32A 2ODPA 3M2PA 1Y6QA 4J90A 4AZSA 1HFEL 3IPYA 4E5MA 3H6HA 5B2EA 3IQHX 2ZAGA 4WD3A 3PTZA 2W6ZA 3FTDA 1BQ4A 1TA4A 4X61A 2I6TA 3V55A 3IDQA 2JLQA 1G6KA 3LVQE 5DTQA 2NUAB 4E11A 2VF2A 4KLRA 1WWKA 1J0BA 1Q91A 4LWPA 4PW0A 1DMSA 3WHLA 4I8XA 4HO1X 4J1QA 2AZDA 4I6EA 5HQ3A 1RLOA 2DQZA 3IXMA 1TYBE 1U0BB 1II8B 4YP0A 3NHLA 3M6MD 1MG5A 1B1AA 2G77B 5DM2A 5KREA 3WK5A 3NONA 3IP6A 4BWGA 1AKTA 2JKYA 1QDLB 1P5FA 1NVBA 4HLUA 2YICA 1CUWA 1CZLA 2UVPB 1FTYA 3MJHA 4ZVTA 2WAMA 3GEMA 4TTQA 5FL3A 2REOA 2QYSA 2QRMA 1MB0A 4E33A 5IXYA 1T8SA 1N33B 4LECA 5HS4A 4N40A 4NG5A 3OZAA 3TFWA 3W5IA 1DELA 4GI2A 2P4UA 3OCEA 2PWBA 1VPLA 2ZTUA 3HRHA 1D09A 4LYAA 4BRZA 1XTVA 4BTLA 2A84A 1HE4A 3JPWA 1GKLA 4HY3A 4OQNA 4TSFA 3RI3A 1ZD8A 3RREA 3WJ7A 2CBZA 4FN4A 3T9EA 3H13A 1NKVA 1T3ZA 4G0MA 4P08A 1GNQA 2GTHA 3N0XA 1SK9A 4TTIA 5BV1A 1CDOA 3H2SA 2PL3A 3GW8A 4K0KB 1XOIA 5JJLA 2A57A 1BGXT 1JG7A 1RBZA 3LIIA 4HWRA 1LDGA 5AH0A 3CWCA 3QE2A 3TW0A 2ZJ0A 3ZHCA 2I4LA 5AKKA 4D9EA 4BFYA 1ZCJA 1CBUA 1XLVA 2GAAA 3SE7A 3GNSA 2J3MA 1Q0SA 4OHPA 5CB4F 2NYAA 1GAWA 2RK6A 1GPJA 1VC2A 4N1AA 5CXXA 1X1TA 5JJBA 2RD2A 4M38A 3WRVA 1DT3A 4MUYA 2OBLA 4WA8A 4CMIA 3HJUA 5A5DA 3D8BA 1Q7CA 4JK3A 3HZHA 1J2EA 1BXRA 2QIPA 5K6RA 1RVDA 4CG1A 5DK4A 1MH9A 5KTMA 5FV4A 1LV8A 1PSZA 1TUIA 1YVEI 5TF0A 1GTMA 1O97C 4B46A 3CPJB 3SLKA 4BCDA 2OV8A 1SQSA 1P0CA 1Y6ZA 1TADA 2BTQA 3GIWA 3JASA 4UEJA 5C53B 2F9MA 2CNLA 5ITSA 2EFDB 2QVZX 2WJVA 3I6MA 1E8NA 4PYLA 2SICE 1TKCA 5IAOA 3PICA 4NYMR 3ZY2A 2PQMA 2C2WA 4TYMA 2OD2A 1PFVA 4KJZA 2BI8A 1Y63A 3A4LA 3FW1A 1CCWA 1CQIB 3JQAA 4MKRA 4Y2PA 2XODA 1Z8HA 3E9YA 1Q1EA 2VJAA 4D8TA 1SELA 1IN8A 4ZAZA 2LXNA 5EGSA 2F1KA 4AMVA 4WQMA 3V8BA 2X0RA 2GOYA 2O3QA 4QEDA 4JVSB 5DHSA 4D79A 3BMQA 1D3AA 5A9SB 2XIQA 4Q05A 5JS6A 3TAXA 1ZMRA 4QXRA 5KVAA 2X9VA 4MUGA 3ZBQA 5AW3A 4N0MA 1GKIA 1M2FA 2YVLA 4G41A 4EW2A 5K8IA 3QOXA 3GLFA 3PDWA 3ZD6A 1VSTA 3A36A 4X91A 1P9OA 3OD1A 4C14A 4BVEA 4OATA 4BGIA 3AKEA 4K40A 2FW7A 5BORA 3MCUA 4JELA 5G53C 4BNWA 4ITRC 4GR9A 1X1EA 2P4EA 1Y98A 4RTJA 2WIFA 1N2CA 4BX3A 3NJRA 1ZXLA 3NETA 2H2HA 4ACAA 5DBGA 2JD2A 4NHOA 3EGDA 4BB9A 1SIUA 3OC0A 4PONA 1OLXB 3SXUB 1ZCAA 2GESA 2OZEA 4ASUA 4B8ZA 4C43A 1GLGA 1EVQA 3NBXX 3UGTA 4F12A 3EHEA 3VH3A 4B7UA 1H8EA 1ZN2A 4FC6A 3S2GA 1C1HA 4UBJA 3NOVA 2C3PA 3VTZA 3BXHA 3C4QA 4NS1A 4RVOA 1KKMA 1IHUA 3EVZA 3NC1C 3I8XA 2QT0A 3P96A 3EVEA 2A4MA 3KSMA 3RVBA 3K1ZA 2VS1A 1YCFA 4QOFA 5E6SB 3IJ5A 4GH5A 1BAPA 5FB3A 5I47A 1E2EA 1NW8A 3L7JA 1DG1G 1OR8A 2BFPA 5A71A 3EZFA 3TTVA 4UEKA 1Y3DE 4FFLA 3I53A 4PX5A 3LUFA 2VK1A 2QR5A 1I7LA 2PUCA 2QTAA 4KVAA 3TRFA 1B8PA 2RH5A 1PLKA 1C50A 2C2HA 1XJWA 4PZAA 4FGUA 3VNUA 3AEUB 3STHA 4BGDA 3E58A 1DTEA 4Q21A 1I7SB 1O57A 2DBYA 4BO3A 4CMIB 1QO7A 3JQ8B 3KQKA 1EUQA 1FP7A 1KO5A 1WVMA 3KDPA 3C1TA 3I1FA 2B5WA 1NPDA 1E2IA 3A06A 1EUCB 5JY6A 1G8PA 3A04A 2LP4Y 1XPJA 5JWOA 5JTTA 2DF8A 2WYOA 1NAHA 1SKUA 4M0KA 4DMMA 4GI3A 3CZCA 5F73A 2XSZD 3H42B 1DB3A 4GC5A 2EP8A 2I3AA 5HJEA 3DOEA 3WL7A 1MD9A 3GPCA 4C3VA 5HZMA 4IEFB 1DX9A 4K7JA 3SM9A 3G49A 4U2FA 1VJTA 2IFTA 1T8PA 4YFYA 4I55B 3FFBA 3WK7A 1RADA 1CDZA 4BNDB 4Q39A 1W4RA 2C07A 2HLNA 1HT0A 2VDUE 3MTBA 2F3PA 3RIEA 5CIWA 4Z4IA 2WYIA 2R1UA 3M2TA 3O21A 2QTRA 3D7MA 4H1UA 4APAA 3LO8A 1ZGGA 1NBMD 2GI4A 3N59A 4C04A 1E2QA 2RHLA 2I66A 2CBXA 3TH5A 4TXJA 4XX1A 3ZI7A 4XD2A 1XT6A 1LS6A 1UPAA 5B6JA 4KNWA 4BN5A 2QM0A 2Y4OA 1JIQA 2UUCB 4OLBA 3GEPA 5LQRA 3RWOA 1II8A 1ORWA 1QIEA 2H4ZA 3CB2A 1CUDA 4U2GA 4WLUA 1M2JA 4H2DA 4C22A 5DX0A 1RYDA 2FRXA 1ULBA 4AY5A 2BONA 3GFBA 4D6YA 4OP1A 2OZPA 4QXAA 3VFDA 2QL9A 4H15A 3WNQA 2WWYA 1N6NA 5KTOA 2H0AA 1XXHB 4FOTA 2OXCA 3L04A 1X7HA 1RP1A 5KWIA 1UT5A 1XMPA 2GPYA 2HJHA 2HXGA 2WPDA 5G1OA 4IFTA 4F9TA 4PWZA 1GM5A 5E4YA 2OBMA 1SQ0A 3DTVD 2FZWA 1E7RA 5I6DA 4R7TA 1U3CA 2NU6B 2RAVA 3EC1A 3EEYA 3NAGA 4LY0A 1P77A 1XDZA 4NATA 5HF6A 2RKOA 5LU9A 4YY3B 1U4SA 3KB6A 1T4MA 1ZJWA 2VH2A 1ABFA 1JDBB 2ZDGA 2J41A 4AKSA 1GA6A 1H22A 2ES4A 1QC5A 1AHPA 5IDWA 1TTTA 3R4VA 3AIMA 4M8LA 4IYJA 2EZ9A 4FYPA 2ZBDA 4MB0A 3KQMA 1AGPA 4ZHSA 1EK5A 3ZGNA 3VKWA 3KYIB 1AGXA 4LTMA 2VPWA 4C2AA 1CZKA 5DK6A 3TAUA 1MP0A 3ZJYA 4UM5A 3MRTA 1Q11A 2QTGA 3J80A 3E1SA 4H17A 1O58A 2GZDA 2RONA 5F12A 5LYJF 3NALA 1KEUA 5G3YA 2UUAB 1WDTA 1GUZA 2XMZA 3ZIAA 3IKLA 3OWHA 3NFYA 3HADA 2GPWA 4IRMA 3DMRA 3FR7A 3OFND 1LBTA 1S9DA 1V8FA 4F9GA 3S81A 1WMFA 4KRGA 5LQUA 1QYVA 3RD5A 1I6LA 2D1FA 4LSWA 4PBSA 5C7OO 1MABB 1EDZA 2SCUB 1YKFA 2A35A 3P1JA 1NMSA 4MPPA 3CO5A 2AC7A 3T6KA 1FUIA 1KU0A 4RHUA 1ECCA 3N75A 3OCXA 3ZUPA 1U2PA 4ENVA 1NQ5A 2BFDB 1WF6A 1U2ZA 1GNVA 3IQFA 3UMYA 3VC3A 1GY8A 4CV2A 9LDTA 2B4YA 1BWRA 1PZMA 5TEVA 3WNVA 1UM9A 3MERA 3OSUA 1I6KA 4GI7A 1LJLA 1UMDB 4MS4B 4G5SA 1CJMA 1FLDA 1Z6XA 3GR6A 4XR4A 3DDOA 1CERA 1C8VB 4E46A 1J0DA 5AVOA 4ZVOA 3T34A 1NVVQ 3NUGA 1L6IA 5IUJC 1DIOB 3V4LA 4GE3A 3U48A 1NUPA 1G9SA 2AMFA 2CYAA 2GMWA 1EGAA 1RKVA 1QYWA 2DHRA 2II6A 3KLMX 3EB9A 4M76B 4ZAFA 3VYWA 5EIEA 2XOKA 4CM1A 3A11A 2F59A 5KX5B 3OEED 1E3SA 3AVYA 1DKMA 1MJGA 2E4WA 3CC8A 4QDZA 4HF7A 2SKCA 1WB5A 2HMTA 4KE6A 4FQ7A 3SEQA 3F8WA 5FTWA 2GAJA 4ZVRA 2GILA 3K0CA 4OP2A 2IS6A 3RQSA 4GYYA 5IAGA 4RC9A 4D80A 1NN0A 2IP4A 2GKGA 3N70A 4YPVA 3HZZA 1X77A 3K6KA 1O94C 1L1EA 2L17A 3F8SA 3HXOA 3KKZA 1VL1A 1G21B 1W46A 2XAUA 3X2FA 2OLKA 3BD6A 3E9CA 2JEOA 2Q46A 3I9MA 3IBYA 5GOZA 3G9XA 3QUSA 1NU6A 1AXRA 1YR7A 4ZCTA 4KH0A 3VR6D 1P3Y1 1UMKA 3HUEA 1NMQA 5LR6A 2XRZA 3RKUA 1ODJA 3ZD7A 1WXIA 3H5NA 1TKRA 3QKUA 1Q5PA 1FUYB 2WKRA 3K2QA 3I0MA 4MLCA 1KEWA 2HBQA 3CH4B 3N2GA 3OZDA 4P54A 3ECCA 2WIJA 3R75A 1C3UA 2E6UX 1QE5A 2QN3A 3ONVA 2ZTSA 3I72A 1RWOA 1C7ZA 4NX2A 4ZU6X 3FDFA 3NDBB 4IJMA 2AI2A 1YC2A 3BRWD 3EQ6A 3HYSA 3THYB 3EXFB 1UZNA 1CR6A 4NENA 4OHVA 2GF9A 4HWOA 3WXMA 4G1FA 1XZPA 5JQGA 3HK2A 4UUOA 2VNIA 3CW8X 3E18A 1MC4A 4R4JA 5EPOA 4G3XA 4BC1A 1X70A 2AMVA 2K4MA 4ZOCA 2AFHA 1XKXA 4LFCB 4Z4CA 1JS1X 2ZWVA 2VRCA 5A3RA 3BRQA 2CD9A 2H2FA 1XEWX 1QX4A 2IEIA 1GA1A 4UBKA 3D0KA 4BQSA 1MKYA 1D9ZA 1QVRA 1U8EA 4MW7A 4TKMA 1VZ3A 1RWBA 4KQXA 1VI5A 3I62A 4YV7A 4IOJA 3ICWA 4PLWA 1IUOA 1Z0KA 1ZK4A 1KFBB 1SD1A 3H17A 3PCTA 4I4TA 4Y2YA 5I4BA 4L4ZA 1ZJZA 3DKVA 3G9UA 3GJYA 4LF9B 2ZB3A 3W2TA 3GLFE 3F9RA 2V7BA 2C2ZA 2GYVA 3OT1B 3S2YA 4D46A 3LTNC 1K6JA 4DQUA 1PJLA 2NG1A 4XTRA 4LDJA 4XGNA 3ZHXA 4LMAA 3C3DA 3LWBA 2BKVA 1NNEA 4MV4A 4U3JA 1D2RA 4IJKA 1N6LA 4OFWA 1ZVJA 3OTOB 1ZGJA 2Q0QA 2R25B 3PX2A 4AJJA 5CXUA 1ODCA 4I1SA 4AMUA 3REOA 1B1CA 1DC5A 1Z6PA 1L5YA 2NM0A 1U9IA 3GOQA 5AD1A 3G8BA 3TECE 1XMQB 3EARA 4Z4GA 2B6NA 3K8OE 1JFRA 4DY4A 4ZIRB 2Q28A 3NTLA 1Z35A 3I9V1 3C39A 3TGPA 4MO2A 2Y6UA 1SPXA 4C76A 2HTFA 3A9RA 4XIGS 4KQIA 2BSAA 3MT9A 2OYSA 1E2BA 2EEPA 3KHSA 2I62A 5J2UF 1WUHS 3IC5A 3PPWA 1PWHA 1T0PA 1AUWA 3EDRA 3UC5A 4K3UA 5AW4A 4ROTA 3BGVA 3NFRA 5I8ZA 3E81A 3EPRA 4Y1RA 3SNKA 4F0JA 1RAFA 3O4HA 4HSGA 5TMDA 4YAKA 3DLTA 5AM4A 5JCPA 2H5IA 2CZQA 4PG4A 4EGCB 3U4QB 1M73E 3OX3A 2BRUA 1NHGA 1NBAA 3B12A 5M34A 2P65A 1J70A 2QLBA 3HG7A 2D5CA 2L42A 2V7VA 2VNSA 4KAAA 5JSZB 4BY9E 4D9GA 2XQJA 4WACA 2GXAA 3PUYA 4HDRB 1XTUA 1S2DA 1YR9A 3R9XA 4AN0A 3N2NA 2J08A 3M3HA 1XMIA 3DTTA 3U4MA 4APBA 4GEKA 1L3CA 1WOYA 3BWBA 3GFOA 2WBLC 1OFUX 3OCZA 1HDRA 4N7RA 1A9QA 5A3VA 3GF4A 1DADA 2WJGA 4Z4QA 3RTAA 2OHIA 4M46A 1ZNYA 2WOJA 4FYKA 3QBPA 1VFNA 4PXYA 4EHHA 4YRIA 1F7UA 5A4KA 4AKHA 2VYQA 4EI9A 3L0CA 2JS7A 1KPIA 2EQ5A 4EPWA 3HCAA 4ZOLA 2NW6A 1LZKA 1WCWA 3DFZA 1RSZA 2F6RA 3L4BA 2DUWA 2CVPA 1HZZA 1R1DA 1YHYA 5DMXA 1FP1D 4RLHA 1ZMXA 4DV5B 5HTKA 5T5QA 1E77A 4G1MB 2D1QA 4MQEA 2HK7A 5BN3B 1WD7A 2J5QA 4ZGBA 2AF4C 2DLNA 1GPAA 4HMOA 2UVQA 2XNDA 4OIMA 5EEHA 1K88A 1WCYA 4YCAA 1O94A 1SKAA 2P6UA 3BMOB 4D57A 4RTPA 4I19A 3JR3A 3UGKA 2AD1A 3W2EA 2PRIA 2HX1A 2J0VA 3A4TA 3LCCA 3NYWA 4HEA1 1UFQA 2EQBA 3AL2A 5JWHA 3COWA 3FVVA 1CYEA 1EJ2A 3GJ8A 4G97A 3BBLA 3OZUA 4NZPA 2ODWA 4XQ9A 4MEBA 1SZJG 5DO9A 4ID9A 4KRFA 1E5LA 1EE2A 1VBFA 2WZDA 3DWFA 4ID3A 4LGMA 3EF0A 2ZBEA 3CZAA 5DDIP 3DS8A 4KXQA 4RK7A 3RVOA 3MHTA 1W88B 2I3GA 3UA3A 3CT6A 3B60A 3WO0A 5HHTA 5FULA 1DS6A 1UJBA 2ZTHA 3V1NA 1Z26A 3BE4A 1NUAA 2CJWB 2NTJA 2JFNA 3DO6A 1YF3A 3PA6A 2F4VB 1H4QA 3FCYA 3NWBA 1A9XB 2D13A 4NEGA 4PIPA 2VZLA 3I83A 1T0BA 1GNTA 3E27A 4R7ZA 3A2KA 4UBNA 4CMAA 3UAVA 1OAOA 2UDPA 3A1FA 3DKIA 4X7RA 5F98A 1RD4A 1W1UA 3QFFA 4G01B 4BFCA 5IZCA 3EVBA 3K0EA 1YBAA 1ZGHA 2ASVA 2H0QA 5DBFA 3IH5A 3KU1A 2VA8A 2H7CA 3BFVA 1QQ5A 3B6ZA 3DDCA 5IAKA 3C2QA 2NUAA 4F45A 2EU8A 1KJ8A 4NCNA 3ELYA 3KOXA 4W1SA 2VVTA 3LUCA 3OT5A 4ZARA 3NR2A 4JL8A 2Y3IA 5DHTA 3T3EA 2FN3A 3X1MA 4UOEA 1KWKA 2WAAA 2EZ4A 4GUAA 3EXHA 2P11A 5HGXA 2AT1A 3NP7A 3ONDA 3MCAA 3JD3A 5HDBB 3ZDDA 3EC2A 1WUKS 4DF3A 4C78A 2XNKA 5CW2A 1QWSA 3PNVA 3U3RA 1FXSA 2XLCA 3TQSA 1T5SA 1RJ9B 4LJRA 4UKDA 2SKDA 1FMCA 4H6PA 4C1NA 3EUEA 2Z0MA 4A6EA 2Q3DA 2UYYA 1GDTA 3PFWO 2E89A 2DRIA 3ILVA 3VJMA 3SZ3A 3A26A 3B6IA 3OKCA 3PI6A 4FJ0A 2GWRA 5EMNA 3ZY3A 3W77A 3DWEX 4KYTA 5KOJA 3SFZA 3KQWA 4UC0A 1NUUA 4CXMA 1GTG1 2EIHA 3IPAA 5LP1A 4AJ1A 2YXDA 3VUEA 3TLGA 3FHOA 3O1HB 4PO9A 4RACA 3PNQA 3OE1A 4KGVA 1MNQA 2B5VA 3INRA 3B7PA 2A1TR 1LPNA 2PT9A 5IARA 5HIIA 4BO9A 4M0MA 1J0CA 1NVVR 3MW8A 4ZGGA 3WOVA 4BNXA 1KBQA 3KFLA 4FINA 4LDPA 3GUYA 4RY8A 4YJGA 2Q9CA 4HADA 4XVCA 3FGPA 3DQZA 3U3KA 2H1FA 3HLKA 5CTJA 3B1FA 4NCIA 3HYCA 3TAHA 1F14A 1ZPDA 1W4CA 1J8QA 3AF1A 1Z3IX 3AOEA 1AO0A 3HR7A 5EWMB 3QFCA 4PTYA 1N9GB 3ESRA 5I9SA 3JQ9A 1GLVA 3C1OA 2OFFA 3UQYS 3GARA 3L6UA 4ALKA 1DOHA 2HA2A 5AKEA 3I9V6 5B3LA 1XJ5A 5JCJD 1AHHA 3FYUC 3HYLA 3KLNA 3T7CA 4HB0A 4G37A 2FX5A 3GG9A 4F2HA 5F76A 1GR0A 1T8RA 3FWZA 4TLBA 2C8LA 4Y6RA 1GNRA 3TIFA 3HU5A 1X39A 4P82A 1JNYA 1RJEA 5U1PA 4NR0A 2Z2XA 3MCTA 2A2ZA 1IHXA 5H68A 2EARA 4NFLA 3NX4A 4PCLA 3D1JA 2CXHA 1H1TA 1NLYA 3TCXB 4I9UA 5KYWA 2JGJA 3DD1A 3KWFA 4Y3UA 3THSA 1QG0A 3VDRA 4FMCF 4ETMA 3SVLA 2I7TA 1MEOA 3H9CA 3GUUA 4IFEA 5FAXA 4YUVA 1A8IA 1E9DA 3AFOA 2V6JA 1EK2A 2VDNB 1Q14A 2CFIA 1CYDA 3CN9A 3KJXA 3H5VA 5DT2A 3H0KA 4BO1A 3ZVKA 1PS9A 2ZQZA 5DN9A 2PLFA 2X8JA 3V7WA 1Y33E 3PXEA 1RLJA 1R18A 4GBJA 3TX6A 3VPDA 3C8ZA 4B5KA 1RWWA 3H3FA 1OFHA 2CF5A 4JXZA 3RJTA 4ZGWA 4KR7A 3KKNA 2XMRA 3D7LA 4U3JB 5DNEA 2UZIR 2WA2A 3HUUA 1X8LA 1JDJA 2BZ1A 2I6UA 1K6MA 4REMA 3S8MA 3KZCA 3MCVA 3SOPA 1HNNA 1C0LA 1C7EA 2D28C 1O08A 2CK3A 2IXTA 2VAVA 3CLKA 1IOVA 3GGDA 2IHVA 3FSGA 3AY3A 2MYUA 4OHKA 3MGAA 5B30A 2OQRA 5BYKA 5JHHB 3EDMA 3AUYA 2WJWA 2ZK7A 1WLYA 2VHUA 3BWVA 2GO1A 4HBGA 1GCUA 2IYAA 1PR1A 2WSMA 4GMGA 5SZKB 5HRUA 5J1TB 2OILA 1NJ1A 2Q6TA 4UFNA 1IM8A 5F4BA 1N3BA 4KSYA 4V3BA 2VRWA 4N9WA 1X7ZA 1H4VB 3MJDA 1NSFA 2AYYA 3ESCA 4ZK2A 3JZAA 1QHNA 2BHRA 2Q3JA 1EESA 2XYHA 2XMCA 5A3SA 3E9ZA 4OIFA 2D4HA 1E63A 1MT0A 1K98A 1AKMA 2R7KA 1QO0A 2GBLA 3I3OA 3IBTA 4FBLA 4X84A 4HAIA 3O38A 1UF9A 3ANMA 3FUUA 3QLTA 2NTYC 4KG7A 4WNIA 3RYTC 3T1YB 3FUXA 4ZRMA 5BWCA 2ORED 1J9EA 5CP8A 4RSRA 3CEAA 1XRNA 1Y6RA 4ARSA 2P2DA 1FUOA 2PPVA 1ZONA 3LCRA 1CS0A 4NDNE 2RJ3A 4R16A 1XMXA 2BHSA 1RACA 4IMPA 4ZVPA 3H8JA 1LF0A 2PNFA 2LRHA 4JC5A 4GR5A 1W6RA 3BE8A 1M8GA 4MICA 3R3JA 4EJ6A 2AI3A 2PYIA 1GN8A 2YR0A 3I5UA 3QBTA 2XRYA 1C7QA 3HA2A 3PBKA 5ISMA 4JQSA 4DSAA 4IDEA 4PNPA 1QR6A 1O97D 2F00A 4AJOA 3UPTA 2Y93A 4ZOBA 1H2RS 4DV0B 1J07A 1LKZA 4GWLA 3DEYX 3PYLA 5H9WA 4OHCA 1Q92A 1Z4QA 4RWZA 1IN1A 1J09A 5IH7A 4LYGA 1N6RA 5H81A 1U7DA 1VXRA 3NBZC 2G08A 1YL5A 1X7WB 2C20A 5LL6P 2BGWA 3QXSA 4QEZA 5MN5A 2GRJA 3PDIA 1VB5A 4U7DA 1JHMA 3K0KA 3MK31 2E37A 4DM3A 5P21A 1FEZA 2AFIA 3OKAA 2AL7A 2NXJA 2BWJA 4FNOA 4QBGB 4RYLA 5GJCA 3ELBA 2GEBA 2CD7A 1NI5A 2OPHA 3RLIA 3EPJA 3L6OO 4XSVA 4AMBA 4E3WA 4PPNA 1K5PA 2NO7A 4IX1A 5AESA 3C5HA 2C5AA 2FHSA 3BH0A 3OCFA 1USUA 1QQAA 3VSEA 2EVWX 1ZOSA 1QTIA 2YBDA 2LKDA 1PX0A 2GXQA 5AVTA 5GTDA 1XMOB 2PUBA 1CDEA 1GRRA 2MSDB 3IVMA 4RFLA 4OLFA 5H16A 1ZITA 3G13A 4L16A 4S1WA 1RAAA 3S29A 1OYOA 3TIXB 4J94A 4N82A 2CXNA 1RXCA 5LQJA 2A9OA 1PJQA 2VF4X 1X7WA 3LPDA 3UJ9A 1FU8A 3ZK8A 5DH9A 4ARCA 2I4NA 2J9FA 1IXSB 1ESEA 2CXUA 4CM8B 3G89A 3NDRA 3SIWA 2J4FA 2QN1A 2X76A 5EMLA 3PCRB 4S1NA 3GP8A 3DTYA 3N6VA 3AB3A 5A06A 4HZUB 2PRSA 3RFCA 1SU6A 5JO0A 2PUEA 4JX8A 1AHNA 3QU7A 2X42A 2BMEA 2I1WA 2GJ8A 2D0DA 4JBWA 4Y2GA 2WMYA 1G41A 4AL4A 3UHPA 3KXDA 4IJWA 1KH2A 3WGGA 3NWOA 1K2WA 4RNCA 2QP9X 2EW8A 1AUOA 1YOBA 1Z25A 5JVDF 2FTKE 3ROXA 1OU0A 1VHDA 1ELOA 5ALFA 2O19A 3RASA 1NT2A 2HH9A 3HN7A 3I5AA 1IRIA 1