3U1JB

Aprotinin bound to dengue virus protease
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
166
structure length
166
Chain Sequence
DVPSPPETQKAELEEGVYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTMPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease subunit NS2B
publication title Ligand-bound structures of the dengue virus protease reveal the active conformation
pubmed doi rcsb
source organism Dengue virus 3
total genus 34
structure length 166
sequence length 166
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3u1jB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3u1jB01
1J16A 1SSXA 5T6GA 1AFEH 1SL3A 4BTIB 3A84A 3UY9A 1QJ1B 1JRTA 2Z3EA 3OYPA 4KKDA 4DCDA 3O8RA 3FZZA 1VCPA 4FUGA 4K69A 3FP7E 3RUOA 3SGQE 3SO3A 2YOLA 1SOZA 1HJ8A 1MZAA 3SU3A 5ETXA 2R2MB 4CRGA 2XWBI 2ZO3H 4NSVA 2EI8A 1XUGA 1P02A 3K9XB 1TX8A 2BLVA 4YO9A 1C2DA 1DUAA 1ZR0A 2FEQH 3SNBA 1C1QA 3U8RH 4JZEH 4K3JA 4BAQB 1O2UA 1C5QA 3H7TA 1MTVA 3TVJB 1W11U 2J38A 3SJKA 1W8BH 1NFXA 4NIXA 1HJ9A 2D2DA 3TNTA 1MCVA 1OWDA 3QGNB 2OC7A 3MWIU 1TQ0B 1TB6H 1HIAA 1PPHE 1TNJA 3F68H 4I8JA 2H2ZA 1GI1A 3M3TA 4UD9H 1SGQE 1HAXB 4Y7AA 2C8YB 1BUIA 2ZFQH 4BNRA 1JXPA 1DY9A 1P2IA 1TOCB 2THFB 3LC5A 2G4TA 3LU9B 4D76A 1YP9A 2OP9A 1ANEA 1SFQB 1GBMA 1QBVH 3LGWA 1O3BA 3MMGA 1RS0A 1NT1A 2CV3A 1AQ7A 5G4BA 2O8UA 1L2EA 1T8LA 2AGGX 2R9PA 3RXEA 1O2IA 3PB1E 3V0XA 1WXRA 1RIWB 4UONA 9LPRA 3LGYA 3LJOA 1QB6A 4ZHLU 1BRCE 1SGTA 1RD3B 2BZAA 2KAIB 2Z3DA 2ZP0H 1YPJH 1W7XH 4ZUHA 1LVBA 1VCQA 1JWTA 2ZGJA 4FUFA 3SOSA 1QQ4A 2BHGA 3GCTF 1FY5A 1C2IA 5C20A 2RCEA 4LXBH 1EKBB 2VINA 3RXAA 1TGNA 1UK4A 3SNDA 3SBKA 4KP0A 1S81A 4OGYA 3VB6A 2QXJA 3KQDA 1AFQC 1FPCH 1JRSA 2HVXA 3BTDE 3BG8A 3BEIB 4NSYA 1QB9A 4Y79A 2A0QB 3PTBA 4B2AA 3S0NA 3OX7U 2EEKA 1XM1A 5CHAB 3BTGE 5JBTA 1AVXA 3DHKH 1DDJA 1NN6A 2OLGA 2RA0A 1A46H 1E35B 2HALA 2WPIS 3E3TA 3M37A 3GY8A 2A4QA 1AO5A 1YM0A 4U2WA 4U01A 2SNVA 2ZHDA 3JZ2B 2V35A 3ATKA 3HGPA 1C5OH 2XYAA 1OYQA 2G52A 4BAKB 2JKHA 5F8ZA 2GCTC 3QGJA 1PPEE 5B6LA 1VITF 1S0QA 2G4UA 2FDAA 1QB1A 5T6DA 2F9BH 1W13U 1ABJH 3V13A 4ABJA 2HOBA 6GCHG 3UNSA 4XBBA 2GCHF 1EZXC 3M3SA 1TMTH 5FPTA 1C5LH 1SQAA 1QQUA 4WF8A 4TPYA 3UWIA 4A7IB 1HAVB 1BTZA 2SFAA 4CREA 1O2TA 1OXGA 1HAZB 1SVPA 2Q6GA 3OY6U 3SJOA 4K1EA 3S9BA 1HLTH 3A80A 4TYDA 2P93A 2BOHB 1NZQH 1TBZH 2Z6BD 3O8DA 5A8ZA 1H9LB 5C1UA 4CRBA 3BTKE 3MH7A 2JH0D 4CRDA 1ELAA 4K60A 2QY0B 1P2OA 1WSSH 3E6PH 1NY22 5ESTE 1JOUB 2BY5X 2XBVA 1YYY1 2ZDKA 5GCHG 2AIQA 3TJVA 4B71A 3FANA 1YPHE 4XBCA 3LPRA 1SHHB 3F1SB 3GY6A 4LK4A 1YPMH 1LVYA 1MMJN 3RXBA 1A61H 1Y3UA 1OSSA 1BBRE 1DPOA 3K6YA 1IQLA 1O3LA 1OOKB 5F03A 3TITA 5GCHF 2ZPSA 3PO1C 1VJ9U 2BDCA 3T25A 2CF8H 2C8ZB 1G30B 3T5FH 1SGRE 1O5GH 3ESTA 3DFLA 4WJG2 3BV9B 1VGCC 3E0PB 4INLA 3VGCC 3ZVEA 3SUDA 1DY8A 1ZYOA 2WYGA 4WY3A 5TCCA 1Y3YA 1GBLA 1MQ6A 1V2ST 8LPRA 4ZHAA 1O3KA 1ELBA 3DFJA 1O2HA 4AGJA 3Q00A 1B0FA 3T29A 1QBOA 3A7XA 4R8TB 4B6FA 2W7SA 1O3EA 4YLUA 1O3JA 3SGAE 2SGPE 5A8XA 1NRNH 2BQWB 2H9EH 2XBYA 1LVMA 4Y6DA 1O2JA 1C1VH 1ELFA 2OBQA 1IQJA 2OD3B 4CHAB 2BOKA 1FLEE 3M5OA 2BD5A 3PV5A 3F9GA 1AFQB 3KQEA 3MHWU 3VEQB 3ODFA 3MU0A 1ELCA 2B0FA 1O3OA 3RXOA 3LGVA 3PLKA 2FTLE 2HPQH 3UOUA 1G2LA 1SGEE 3SU4A 4UDWH 5GJ4B 1O2RA 4J2YB 2GZ8A 2CHAC 3D23A 1G9IE 5AVDA 1DLEA 4E06H 2JH6D 1CA0C 2Y82A 2C8WB 3KGPA 5FPYA 3MH6A 1PPGE 3Q3YA 3QTOH 1W7GH 3ATMA 2FIRH 3NKKA 3SORA 2IOTA 5CE1A 2ANYA 1F2SE 3D62A 1B0EA 5EW2H 2GCTB 3SQHE 2VU8E 1J8AA 3DA9B 1W2KH 3PMAB 3MOCA 1SMFE 1AZ8A 4GAWA 4K1SA 3A7VA 2ZU5A 3P8OA 1C9PA 2XC4A 3EAJA 4E05H 1NRSH 1J9CH 1BTXA 1L1GA 2W7UA 1YF4A 4BAOB 1DITH 1CGJE 1NU9A 4A6LA 4UFGH 3MO3A 4DY7B 5FXLA 1PPCE 1LCYA 2CF9H 2BLQA 4I33A 1QRZA 5A0BA 2BY6X 4I8KA 1K1OA 4I8GA 4X2WA 2OXSA 3E91A 3T26A 1QURH 4B2BA 3PLPA 1O39A 1OS8A 3ZVGA 3RU4D 2G00A 1C4Y2 5FCRA 4Z6AH 1GBFA 2I6QA 1K1JA 3S9CA 1ABIH 3RXPA 8GCHG 4K8YA 4WWYA 2HLCA 1SPJA 2A7CA 1BBRH 2P3UB 4YZUA 1GHXH 1O3DA 1AZZA 2IJOB 4MLFB 4PROA 2ZCKP 4B1TA 2TPIZ 2A4OA 4FUIA 1HPGA 1KXEA 1N8OB 2G81E 3GDUA 1NFWA 8GCHF 2K1QA 3IITA 3U8OH 3RXFA 1D3TB 1BJUA 1FONA 3SU0A 3GY5A 3KL6A 1L4DA 4Z0KA 1GI0A 2UWPA 3PLBA 4AX9H 1EZSC 1RRKA 1C5MD 1GJ9B 2FESH 1V2QT 2P59A 3PMJA 4TWYA 2PUXB 3JZ1B 3GY4A 2ZGHA 2UUYA 1C1PA 3QO6A 2FS9A 3VGCB 5JBCS 1FY1A 1SBWA 1C1MA 3QZRA 1KXBA 1ID5H 1A5GH 1NFYA 1S84A 3AAVA 3F6UH 2WUBA 2ZHFH 3P70B 4DJZB 4H6SB 1LKAA 1UCYE 1V2KT 4D8NA 1TX6A 1D3QB 1GHBF 1O38A 1CU1A 2BD8A 3K65B 5DJ7A 4B73A 2ZCLP 1C5ZB 8ESTE 1L0ZA 1P2QA 1IQGA 1FNIA 5EPYA 4Y0ZE 1ETTH 2UUJB 1AVWA 4K8BA 1H8IH 3KHVA 1ANCA 2ZGBH 1TA6A 1X7AC 1GJ7B 1O3PB 2BZ6H 4I7YH 1IAUA 4DOQA 2V6NA 2TBSA 4D9RA 3TJUA 1UHBB 2D8WA 3ATIA 3ZZ7A 4BXWA 1GHZA 1CA0B 5AFZH 3Q76A 2BD7A 2TRMA 2H6MA 2OUAA 5JPMH 1A3EH 1GMDG 4ISHH 3QDZB 3MU4A 4Q7XA 4NIVA 1ETRH 1LTOA 1LKBA 5TJXA 2ZDVH 2GX4A 5AFYH 1EAXA 1CT4E 1FUJA 2IN2A 4Y7BA 5FX5A 5HM9A 1GJ8B 1V2WT 1W12U 2GT7A 2FYQA 1UHBA 1N1LA 1AVGH 1GBTA 1GMDF 2HNTC 2PTCE 1SGFA 4MNVA 1O2GH 1EASA 1GCDA 1UVPA 3M7QA 2A7HA 1OKXA 2OC1A 1K22H 1PPBH 3PV4A 1F0SA 4K2YA 4Y8XA 3KNXA 2V3OH 3P6ZB 4Y10E 2Q1JA 3KQBA 1MKWH 4MPWA 2VWNA 1TONA 1HNEE 1RGQA 3ZVCA 3BTQE 1QCPA 4NGAH 1BRUP 2A31A 2AYWA 5EXLA 1K21H 3NWUA 3SGBE 4CRAA 5FAHA 2F4LA 4GPGA 1V2OT 3BF6H 1ELEE 1YPKH 1UVOA 3M5MA 5FHTA 3KQCA 2D26C 3A7ZA 2P95A 3MNSA 1YGCH 2BVXH 4ZKSU 4XBDA 1MBQA 1HCGA 1GBCA 5B6OA 1IHTH 1WTGH 3EA8A 1JMOH 1ZGVA 3GCHC 3BTWE 2UUFB 2F9NA 2QYIA 4X1SU 3SV8A 1CSOE 2PKAB 1OX1A 1CA8B 1UCYH 1DOJA 2ZHWH 1GI5A 1E37B 1KXFA 5EU8A 4AB9A 1MTNB 3SHCH 1LMWB 2ZU3A 3BTHE 3KN2A 2GV7A 4BAMB 1C9TA 2GDEH 1F0TA 1GPZA 2A5IA 1PQ5A 4AORA 3TJNA 2Z3CA 1GWAA 2R0KA 4LOYH 2BDHA 4HZHA 3EE0B 2QF3A 1JIRA 2WPJS 1SGNE 3ZZDA 4ZMAH 1O3GA 1Z8RA 4GCHG 2QXGA 1GHAG 2PKAA 1QBNA 1AMHA 2AMQA 2GDDA 2WPLS 3MH4A 3HK3B 2FI4E 1GVZA 1O2YA 3F9EA 1ZJKA 1Y5UT 3L33A 2M5TA 4ZH8A 2F9VA 1D3PB 1TRYA 2SGDE 2BDIA 3UIRA 1CGHA 3SHAH 1EJNA 4GCHF 1GHAF 3HK6B 4DW2U 2DE9A 1GI2A 5FCKA 5FPSA 2ODPA 2PFEA 4CH2B 1ACBE 2STBE 3GICB 3V7TA 3TGJE 1C5UA 1LHGH 4U30A 1IQIA 1FI8A 3GY2A 2AFQB 2VVVA 7ESTE 2P3TB 2BXTH 4IBLH 2Z9GA 4ISIH 1CT0E 1HV7A 2ALVA 4KTCA 1WU1A 1BTHH 4J1YA 1IQEA 1SGIB 4NA9H 1HIAB 4NA8A 3ZVBA 2IPHA 5A0CA 2NU3E 4KELA 4AFQA 3PROA 4Q2KA 1ZPBA 1Y8TA 3ENSB 3OSYA 1CHOF 1O3HA 2RG3A 1EQ9A 2JH5D 3NUMA 2XNIA 1UVSH 5GDSH 4I31A 1MTUA 1ZRBA 1K9OE 3SU6A 3RXTA 4UFEH 5I46H 1P06A 1GBDA 2HGTH 4ISLA 3WY8A 2NU4E 2BYAX 3G01A 1CVWH 2EA3A 3R3GB 3LGTA 2ZTXA 1ARCA 1ESTA 1GHWH 3URDA 3VXFH 4NWLA 1AD8H 3FP8E 2HNTE 2PR3A 1GDUA 1LPGB 1LHDH 5A8YA 1J15A 2BXUH 2BX4A 1W0ZU 1HXFH 3S7HB 1GJAB 2HNTF 1PQAA 2B8OH 3IWMA 4WMFA 1QIXB 1E38B 3BTTE 1TWXB 3BSQA 4F49A 5DP3A 1B5GH 2XXLA 3QN7A 2ODQA 1AE5A 4X1NU 1ZPZA 3W94A 2W26A 2ESTE 3M35A 4JCNA 2Y7XA 5EQQA 5JB9S 2Y5GA 2ZIQH 1W0YH 3BEUA 3AW1A 1XUKA 3A85A 4HI3A 1TIOA 5DP4A 3GCTG 5DP9A 1BRBE 2SGQE 3GCHB 1HAYB 4DGJA 4FUCA 4CRCA 1AKSA 1WOFA 2WV4A 2BY8X 1F5KU 1SGYE 3VB4A 1THRH 2GD4B 3UFAA 1GJ4H 1CQQA 3MI4A 1T32A 4ZKOU 2VNTA 5E0JA 4YOGA 2FOBA 3Q3XA 4HFPB 4CHAC 5C3NA 3BG4C 2LPRA 2XCFA 5DP6A 1HYLA 1HAIH 1O30A 4Q7ZA 1O3FA 4MTBA 1FXYA 4H42U 4ABHA 4OS5A 3ZYDA 1AHTH 1GI7B 3GCOA 4X2YA 1VZQH 5DP8A 1YCPH 3SNEA 1TPAE 1C5NH 2ZQ1A 2CXVA 4JK5A 1W10U 1RJXB 2GTBA 2LNCA 1FDPA 4Y8YA 1GI3A 3T28A 2ZFRH 1VITG 1C4V2 1GBHA 1T7CA 5L30H 1TMUH 1YPGH 5E2OA 2CMYA 3FFGA 3H09A 1P11E 2VGCC 4HGCA 3KIDU 2GCHG 3VB5A 2ANWA 3FAOA 2F83A 1WUNH 3SU1A 1MD8A 1QHRB 3EA7A 3GDSA 2ODYB 3E16B 3MNBA 5GPIB 1AN1E 1HXEH 2FOGA 1NRPH 2WUCA 3A8DA 3O8BA 1KY9A 1NPMA 2ZFFH 1GBKA 1T8MA 2QGRA 1F7ZA 4WXIA 1FJSA 4XFQA 1O2OA 4KGAA 1NS3A 1A2CH 1NROH 4OS1A 1GI9B 2VIOA 4GHTA 2VJ1A 1G2MA 1BOQA 1D6RA 2BD4A 1DWCH 5GIBA 2IJD1 3LT3A 5JYIA 3VFEA 2ALPA 1P8VC 2R2WU 3A7WA 4IGDA 1UTQA 1IQKA 3TPIZ 2GZ7A 3ATLA 1G32B 2HRVA 2QV1A 1O35A 1ESBA 1K1NA 4ESTE 3SV9A 1ZGIA 4SGAE 1DWEH 4WH8A 4AG2A 1L1NA 4NWKA 1H9IE 2ZZUH 1N8OC 2PGBB 3R0FA 3HATH 2WZQA 3RC4A 3A81A 5EGMA 1C1SA 3OU0A 2Z94A 4BXSA 1KLIH 4HTCH 1NFUA 2SGFE 3E8LA 2ANMH 2B7DH 1ZOMA 3DT0H 4INKA 1TOMH 5T3HA 1EZUC 4H4FA 1GBEA 3VPKA 1AIXH 1Y3VA 4DG4A 1GMHG 3MU1A 2VIVA 1K1MA 3ZVFA 1MKWK 2FI5E 1FAKH 1O2QA 2O8TA 1QTFA 4Y8ZA 1OPHB 2OC8A 4A5TS 3ZZ9A 1DANH 1EJMA 3BEFB 1KTTB 1GGDC 1DT2A 1NO9H 1O5EH 5EW1H 2ZPRA 1C5YB 1G3CA 1KDQA 1V2VT 1FIWA 2V3HH 1ELVA 3W95A 1V2PT 4ABFA 2OQUA 3PMHB 4THNH 3AW0A 3UTUH 2CJIA 1GMHF 1GVLA 1C2EA 4NFFA 1Y5AT 4JYTA 3SU5A 4ZROA 3OTPA 1DM4B 5EOKA 3ELAH 3E90B 1O2SA 4MNWA 4CBOA 4B74A 3BG4B 3CP7A 3RXMA 1UJ1A 3ZZBA 1UCYK 2BX3A 3SQEE 2ZCHP 3NXPA 3A88A 6LPRA 3TIUA 5C5OA 3TJOA 3RXRA 1VITH 1W3CA 4ABGA 1GDQA 1OYTH 3M7TA 2ZTZA 1RTLA 1UO6A 3P17H 3RC5A 2Z7FE 1NRRH 1LDTT 1INCA 1C5WB 4ZHMU 1WCZA 2GVFA 4AG1A 1YKTA 1N6YA 3GY3A 3SUGA 3Q77A 3SV7A 3TH4H 1FV9A 4JYVH 4ISOA 2GKVE 2O8LA 3LH1A 4RKOB 5T6FA 3MU8A 1DSUA 4X8VH 5C2ZA 1BHXB 1M9UA 5FBEA 2VGCB 3AVZA 2ZFTA 1F92A 1E36B 5DPAA 1P03A 4X6NA 1B7XB 2J92A 1GDNA 3TLOA 1ZTKA 1GI6A 3CS0A 1XUHA 2BB4A 1ZMNA 1BMNH 1MH0A 2GMTC 1BHXF 4X8TH 1QY6A 3M5NA 3M5LA 1HAGE 4JZFH 2BDGA 1TNHA 2Y81A 1O33A 2OTVA 2VWLA 1AB9B 1EUFA 2ZGCA 2C90B 4MDSA 4ZXYH 4D9QA 5JBAS 1Z8GA 2BD2A 4XSKU 1C5VA 4R0IA 4ABDA 4X2XA 4NIWA 1DUEA 3ATWA 1BCUH 1THSH 2OINA 1E34B 2W3IA 4YM9A 1C5RA 5LPEA 3SYJA 3SJ8A 4Y11E 4AZ2B 3P8FA 3K6ZA 1UK3A 1NESE 3E1XB 1G3EA 3SUEA 3HPTB 5E0GA 1LHFH 1PQ8A 3TH2H 4K1TA 5ESBA 2P94A 1SFIA 1ZHMA 4TY7A 1WBGB 2ILNA 1WQSA 5JDUB 3S69A 3K2UA 4JZIA 3ZVDA 1TPSA 1MTNC 1H8DH 2AIPA 3BIVH 1XUFA 3ZV9A 2FOFA 2SGEE 1S6HA 2F9OA 1GBJA 3IG6B 4TWWA 1D9IA 1P01A 3SJIA 3UQOA 2BTCE 1MAYA 1UK2A 4X1QU 4X8UH 1GHBG 2AMPA 3SNCA 4FUBA 3RXGA 1EB2A 3AASA 3V3MA 1G37A 3B9FH 1CT2E 1Z8IB 1GGDB 1AU8A 3PV2A 2ZFSA 3RXLA 1O5FH 3LC3A 1SQOA 2VWOA 4LZ1H 3A7TA 1CGIE 3FVFB 3RXUA 4NFEA 1Z8JB 2GZ9A 1FAXA 2PWXA 3SU2A 1C5XB 4QT8C 4Q80A 1DICA 1SGCA 1EP6A 1P9UA 2BVRH 2P8OB 5LH8A 1KXDA 4E7NA 4O3TA 5CMXH 1T8OA 2Q6FA 1ZMJA 1HB0B 1O32A 2FMJA 4CR5A 4DURA 1UVTH 4BANB 3UR6A 1GG6B 1BMMH 1QJ7B 2RA3A 4CR9A 1BB0B 1J17T 3RU4E 3GDVA 4RSPA 2STAE 5DP5A 4FUHA 4UE7H 3BTME 3RDZA 1TA2A 3SI3H 4YLQH 1EP5A 3Q3KA 6ESTA 4X1PU 1SLUB 2BDAA 2GV6A 2ZTYA 1SGFG 1O3CA 1T31A 3RXQA 1E0FD 4D7GA 4XOJA 1P05A 3OY5U 1S5SA 1MUEB 1UTKA 1FZZA 4OS7A 1MZDA 4F4OC 2EI6A 3M36A 2H9HA 2PW8H 1YC0A 1YLDA 1TX7A 1OP8A 1GL0E 4XDEA 1VR1H 2VB0A 1OWHA 1FPHH 1KLTA 2O8WA 3EA9A 1GMCG 2Y5FA 1C5SA 4B6EA 4SGBE 1YPLH 4H6TA 1AUTC 3UQVA 1EB1H 5HGGA 3BN9A 2GMTB 3AK5A 2ZF0H 4UFFH 1SLXB 3EYDA 3V12A 2BDBA 4X1RU 3AAUA 5JBBS 1ANBA 3RXIA 5HM2A 2G5NA 3N7OA 1O5CB 1GMCF 5PTPA 4Y0YE 2FWWA 5GWZA 2P3FH 2ASUB 5HMAA 4KTUA 1BMLA 5F8XA 4K5ZA 3F9FA 3TK9A 1YCPM 1O37A 2WV9A 1LHEH 3RXDA 1XKAC 1P04A 2HPPH 3A7YA 1LO6A 1ZSJA 1TMBH 1C1RA 1EX3A 3UUZA 4GHQA 2B9LA 1OWEA 4M9FA 2WPMS 2PSYA 4ABAA 1HFDA 1ETSH 3P8NA 2J2UA 1TPOA 3I77A 2ZU4A 3A8AA 3D49H 2J94A 1DS2E 1GI4A 1RTFB 4MVNA 5BPEA 2B5TB 2W5EA 2ZHEH 2OBOA 1AE8H 1GJ6A 3LOXA 2D1JA 3GYLB 4VGCB 1GI8B 1JIMA 4MQAA 1GJ5H 1N6XA 1TGTA 3MO6A 4DVAU 1WAYB 1V2RT 1NM6A 1KSNA 1ZLRA 4WMDA 1KLJH 1EJAA 4CBNA 4M7GA 1J14A 1PPZA 2EI7A 1C1TA 1V3XA 1UTOA 9ESTA 1O2ZA 4ZKRU 1FMGA 2F3CE 1T8NA 1Q31A 3RMMH 3U8TH 3VB3A 3SZNA 2F91A 4JZDH 5FBIA 3UOPA 4AOQA 3SNAA 1C5PA 1GBIA 1Z6EA 4NCYA 1RXPA 3BTFE 3PM3A 4ZXXH 3LJJA 1XXDA 1ANDA 4NG9H 1BIOA 1PPFE 1EXFA 5EXNA 1BT7A 4X8SH 2NU0E 2TGPZ 2Y5HA 1C4U2 4B75A 2CN0H 3ZZ3A 1NTPA 3GYMA 5F8TA 1ZTLA 2AERH 1ORFA 1CBWB 2R0LA 1V2LT 5H4IB 5HXFA 5E0HA 1ELGA 5E2PA 2QN5T 1VJAU 4I8LA 2PHBA 3QK1A 1C1UH 1SGPE 1THPB 3I78A 1GJCB 4NZQA 2BD3A 1GBBA 3H5CB 1G3BA 1OWJA 1CHOG 1LHCH 3URCA 3GCNA 1TPPA 2WYJA 1P57B 5C1XA 1XVOA 1O2XA 1QA7A 1XUIA 2AEIH 1TNGA 4B76A 1NRQH 1TGSZ 3RC6A 2BMGB 2RDLA 3S9AA 4JK6A 1QL9A 2O9QA 3L6PA 3TH3H 1P2MA 2BY7X 2GGVB 1TNLA 4DT7B 1C1NA 1MBMA 4TY6A 2ANKH 2PTNA 2VIQA 1TQ7B 3UWJH 2FYRA 4CRFA 1SLWB 3F9HA 1O5BB 3RXHA 4YT6H 4ABEA 2GP9B 4AFZA 4D7FA 2WINI 3SN8A 5A2MH 3HKJB 1Z1IA 1O31A 1TALA 2J4IA 3GOVB 2C93B 1A0JA 1GL1A 1QA0A 4U32A 5J4QA 4FUJA 1ELDE 5IYTA 1SI5H 3TNSA 2BQ7B 2VH0A 3GISB 1ZSKA 1LPZB 2J95A 1OWKA 1O36A 4ABBA 2UWOA 1YLCA 1ZSLA 1CO7E 1AKSB 3MNXA 2WHXA 1KYNA 3QWCH 5L2YH 5C67A 1BTYA 6CHAB 3QZQA 1YPHC 4MG3A 1FQ3A 5DP7A 2EC9H 2ZGXH 4AN7A 3FZDA 2ZQ2A 2ZU2A 3RXSA 1V6DA 5LGOA 1MAXA 2G8TA 4JYUH 1KIGH 2BM2A 1DXWA 2Z9KA 4A1XA 2O8MA 1BBRK 3C27B 3SI4H 3U98H 1O3MA 1V2MT 1WYKA 5HYOA 2XRCA 1DWBH 1KXAA 1BA8B 2PLXA 1P10A 2UWLA 3DD2H 2ZKSA 5EXMA 1HDTH 1UTLM 4IW4E 1RTKA 1EPTC 1AI8H 3LH3A 3QUMP 4OS6A 3UPEA 2HWLB 1XMNB 2FM2A 1TRNA 4YT7H 2NWNA 2BY9X 4O3UA 1U6QA 1XKBC 3U1IB 1O3NA 3SV6A 1S85A 1UTPA 2ZC9H 4YOJA 1BZXE 3TGKE 2XBXA 1XX9A 1A1RA 2SGAA 2QC2A 1SQTA 1H1BA 1XVMA 3VB7A 4IMZA 1TFXA 2FLBH 1G36A 2BLWA 2VIWA 2OCVB 2H1UA 1TNKA 1O2VA 4ZAEA 3B23B 4WVPE 1IOEA 1VCWA 2ZEBA 1QL8A 1V2NT 1A0HB 1BDAA 3BIUH 3I29A 2DE8A 5GNDA 4INHA 2KAIA 3M3VA 1MKXH 2VVCA 1QGFA 3A86A 1K1IA 1SGDE 2AH4X 3RXJA 5LPRA 2ZDMA 3NK8A 2AGIX 1EAUA 1S0RA 3TK6A 1IQHA 2UUKB 4AYVB 4O97A 2H5DA 4IC6A 3HGNA 1SLVB 1IQMA 3ODDA 3D65E 2ZI2H 2PV9B 1A7SA 3RXCA 2Y6TA 1BTWA 1AB9C 1EZQA 2A45B 1NU7B 4ABIA 3STJA 2Q6DA 1K1LA 4AGKA 5IDKA 4GUXA 4FU7A 2R3UA 1PYTC 1TLDA 2ZDNA 1P2NA 1GHVH 3LGUA 2F9PA 1QNJA 4FUDA 4A92A 5J4SA 1P12E 1EATA 4FU9A 1HJAC 3RM2H 2ZPQA 5I25A 2BDYA 1HAPH 5EODA 1OP2A 1Z6JH 1DE7H 6GCHF 1UTJA 1P3CA 1KDQB 4IMQA 4DIIH 2C8XB 2J34A 3H7OA 4GSOA 4IC5A 4X6MA 3NZIA 1QL7A 2VVUA 2F9UA 2C4FH 1EAIA 2Z9LA 3T2NA 1ZHRA 1HAHH 1C2GA 1FY8E 2BVSH 2PUQH 3SV2H 1HAVA 4A1TA 3TGIE 2YNAA 1O2NA 3U69H 4JMYA 3ZVAA 2V0BA 1D3DB 1DSTA 2Z9IA 3U9AH 3SUFA 3PYHA 5EG4A 5C1YA 2Y7ZA 4IN1A 4LZ4B 3ZZ8A 4BTUB 2NU2E 4O9VA 1FN8A 1XUJA 2AS9A 2XCNA 4ISNA 3NPSA 5A0AE 1AUJA 2A4RA 2JETC 1AGJA 1F0RA 1AWHB 2A5AA 3KCGH 4NIYA 2XTTB 1EPTB 4UFDH 3QLPH 2P8OC 1C2FA 1P2JA 1GHYH 2NU1E 1ZMLA 4AYYB 3U1JB 1PYTD 3OTJE 5EQSA 3ZZ5A 3L3TA 1SB1H 4OS2A 2QXIA 1HUTH 4CH8B 1GBAA 1GG6C 3MO9A 2QA9E 4X2VA 4I8HA 1TE0A 1S82A 2ZU1A 2VIDA 2WPHS 3CENA 2ZDLA 2A4GA 2FOEA 5FX6A 2G51A 2VBCA 5JB8S 1P09A 1SC8U 1O3IA 2FP7B 1WTHD 1A5IA 1Z1JA 1EOJA 3LIWA 1O3AA 1Y59T 1EPTA 3LDXH 1YBWA 2BQ6B 4RKJB 1DX5M 5K7RA 1PJPA 4ASHA 1HAOH 2PSXA 4IN2A 4B2CA 2Y80A 1JBUH 3BTEE 3A8BA 2TGDA 3EDXB 3DUXH 5DKMA 4FU8A 4ZKNU 1OP0A 1QRWA 1G3DA 1HRTH 3M7UA 1SHYA 2FI3E 1BTPA 1DVAH 1FIZA 2A2QH 2G5VA 4NZLA 5TCAA 3PMBB 3ZYEA 1TBRH 1TGCA 1GCTC 1UMAH 3ITIA 3NCLA 3SZEA 5L2ZH 1A4WH 3P92A 5T1VA 1C2LA 1QFKH 1BQYA 2FODA 2PKSC 4MPVA 3S7KB 1MQ5A 1C2KA 1CE5A 1UVUH 2XC0A 3MH5A 5AHGH 1PFXC 4MPXA 1F0UA 1SG8B 4OGXA 2FPZA 3QX5H 3SJ9A 1DLKB 4WH6A 1TRMA 1QJ6B 1V2JT 2PGQB 4OM9A 1BJVA 4TPIZ 2G55A 3PWBA 4GVUA 1LVOA 1TYNA 3RMOH 5L6NH 4AFUA 3A8CA 3EGKH 3A87A 1HJAB 4MPUA 1HGTH 1KTSB 1MD7A 4X6PA 1CHGA 3RXVA 1H9HE 2FX4A 3UREA 1QR3E 2QF0A 1Y3XA 1C5TA 4AFSA 1L1JA 2ZWLH 4XE4A 3UNRA 3A83A 3MU5A 3CS7A 2VH6A 1MCTA 4VGCC 1T4VH 1ELTA 1FN6A 4X6OA 1GJDB 1HBTH 3T27A 4WXVA 1FY4A 5DK1A 4A1VA 1TGBA 3B8JA 1ZTJA 3KEEA 2H5CA 4UEHH 8KME2 2FOMB 3A82A 2FX6A 5F6MA 2WPKS 1BRAA 3C1KA 1Y5BT 4MNXA 5ABWA 3TK5A 1NC6A 2QAAA 1ARBA 2TGAA 2FOAA 1DFPA 5DO4H 3RU4T 1MU6B 2WV5A 3MNCA 1Z7KA 2JETB 3RLWH 3UR9A 3HKIB 3PO1B 4FXGH 4MNYA 1TNIA 2ZDAH 2P16A 1A0LA 1O2LA 1VGCB 3MYWA 5C5NA 1BMAA 1CBWC 1IQFA 4GLYA 1DXPA 3A89A 1GVKB 1P3EA 7GCHG 1TBQH 1C2JA 3STIA 4WMEA 3ZZCA 4BTTB 1ZRKA 3RLYH 4RI0A 2BD9A 1T4UH 3P95A 5SGAE 2J9NA 1W14U 2A2XH 3M61U 1H4WA 1OWIA 3SW2B 1MTSA 1Q3XA 2XBWA 2ZECA 3FP6E 4BOHA 7GCHF 1IQNA 1V2TT 4O03A 2CGAA 1C1OA 1YPEH 1XXFA 1UTNA 1ESAA 3RXKA 1YCPK 1EAWA 1TAWA 2ZFPH 5BRRE 2YNBA 1LQEA 2CHAB 4E7RG 2XWAA 3PWCA 3ZZAA 1O2MA 1D6WA 3LONA 1DWDH 1EOLA 1O5DH 1KXCA 1GCTB 1SR5C 4FUEA 5K0HA 2TIOA 1A3BH 2W3KA 1PQ7A 1Q2WA 1O34A 1MKXK 4RN6A 1BITA 4YTAA 2DUCA 2OK5A 1RFNA 3RMLH 2A32A 2PKSB 3RM0H 5E8EH 2GT8A 1O0DH 2TGTA 4IS5A 4YOIA 1K28D 2A1DB 1WV7H 2QIQA 1MU8B 1ZPCA 6CHAC 2XW9A 1O5AB 2XC5A 2A7JA 4KTSA 1A5HA 3UNQA 3T62A 1AY6H 1V2UT 4OS4A 3ZZ4A 4Q7YA 2Z9JA 3MFJA 4DIHH 2H9TH 2A5KA 1C2HA 1L4ZA 2FOHA 2VIPA 4JZ1A 3E0NB 1ZHPA 2ULLA 4BAHB 1D4PB 2SNWA 2FO9A 3MTYA 1Z71A 1BTUA 1SOTA 1Y3WA 2FTMA 4NA7A 5LPFA 2AGEX 2FOCA 2ZNKH 2BLOA 1AWFH 3P8GA 1F5RA 3KF2A 2FS8A 1O2KA 2FXRA 2VWMA 1ZJDA 4FVBA 5EQRA 2R3YA 1FY3A 3LKWA 1P9SA 1RIWC 3GY7A 4YESB 3ZV8A 2ZA5A 1O2WA 4Y76A 2OC0A 1GJBB 5AF9H 1P0SH 1K1PA 1C1WH 4X0WU 1LPKB 5A09A 3LGIA 1K2I1 7KMEH 4FVDA 2OQ5A 2I6SA 2ZHQH 4AB8A 4Y71A 1C2MA 2FZZA 3QTVH 2FLRH 1IHSH 1WQVH 4I32A 1ZZZA 1TABE 3O8CA 3ZZ6A 1S83A 3TU7H 3VXEH 1F5LA 5CHAC 1P2KA 2C3SA 1LQDB 3PTNA 1MTWA 2QCYA 3EQ0H 1QRXA 3RMNH 7LPRA 5GXPA 1O2PA 2AMDA 5DGJA 1UTMA 2QXHA 5DG6A 3RP2A 5EPNA 1S6FA 2ZG0H
chains in the Genus database with same CATH superfamily
1J16A 1SSXA 5T6GA 1AFEH 1SL3A 4BTIB 3A84A 3UY9A 1QJ1B 1JRTA 2Z3EA 3OYPA 4KKDA 4DCDA 3O8RA 3FZZA 5IK2D 1VCPA 4FUGA 4K69A 2L6OA 3FP7E 3RUOA 3SGQE 3SO3A 2YOLA 1VKYA 1SOZA 1HJ8A 3F0OA 1MZAA 3SU3A 2KCPA 5ETXA 2R2MB 4CRGA 2XWBI 2ZO3H 4NSVA 2EI8A 1XUGA 1P02A 3K9XB 1TX8A 2BLVA 4YO9A 1C2DA 1DUAA 1ZR0A 2FEQH 3SNBA 1C1QA 3U8RH 4JZEH 4K3JA 4BAQB 1O2UA 1C5QA 1W0JD 5F53A 3H7TA 1MTVA 3TVJB 1W11U 2J38A 3SJKA 1W8BH 1NFXA 4NIXA 3MQKC 1HJ9A 2D2DA 3TNTA 1MCVA 1OWDA 3QGNB 2OC7A 3MWIU 1TQ0B 3PRBA 1TB6H 1HIAA 1PPHE 1TNJA 3F68H 4I8JA 2H2ZA 1GI1A 3M3TA 4UD9H 1SGQE 1HAXB 4Y7AA 2C8YB 1BUIA 2ZFQH 4BNRA 1JXPA 1DY9A 1P2IA 1TOCB 2THFB 1NBME 3LC5A 2G4TA 3LU9B 4D76A 1YP9A 2OP9A 1ANEA 1SFQB 1GBMA 1QBVH 3LGWA 1O3BA 3MMGA 1RS0A 1NT1A 2CV3A 1AQ7A 2J5UA 5G4BA 2O8UA 1L2EA 1T8LA 3U28C 2AGGX 2R9PA 3RXEA 2JDID 1S6LA 1O2IA 3PB1E 3V0XA 1WXRA 3F2GA 3GS9A 1RIWB 4UONA 9LPRA 3LGYA 3LJOA 1QB6A 4ZHLU 1BRCE 1SGTA 2XOKD 1RD3B 2BZAA 2KAIB 2KM0A 2Z3DA 2ZP0H 1YPJH 1W7XH 4ZUHA 1LVBA 1VCQA 1JWTA 2ZGJA 4FUFA 3SOSA 1QQ4A 2BHGA 3GCTF 1FY5A 4ZCNA 1C2IA 5C20A 2RCEA 4LXBH 1EKBB 2VINA 3RXAA 1TGNA 1UK4A 3SNDA 3SBKA 4KP0A 1S81A 4OGYA 3VB6A 2QXJA 3KQDA 1AFQC 1FPCH 1JRSA 2HVXA 3BTDE 3OFND 3BG8A 3BEIB 4NSYA 1QB9A 4Y79A 2A0QB 3PTBA 4B2AA 3S0NA 3OX7U 2EEKA 1XM1A 5CHAB 3BTGE 5JBTA 1AVXA 3DHKH 1DDJA 1NN6A 2OLGA 2RA0A 1A46H 1E35B 2HALA 2WPIS 3E3TA 3M37A 3GY8A 2A4QA 4F48B 1AO5A 1YM0A 4U2WA 4U01A 2SNVA 2ZHDA 2JJ1D 3JZ2B 2V35A 3ATKA 3HGPA 1C5OH 2XYAA 1OYQA 2G52A 4BAKB 2JKHA 5F8ZA 2GCTC 3QGJA 1PPEE 5B6LA 1VITF 1S0QA 2G4UA 2FDAA 1QB1A 5T6DA 2F9BH 1W13U 1ABJH 3V13A 4ABJA 2HOBA 6GCHG 2LP6A 3UNSA 4XBBA 2GCHF 1EZXC 3M3SA 1TMTH 5FPTA 1C5LH 1SQAA 1QQUA 4WF8A 4TPYA 3UWIA 4A7IB 1HAVB 1BTZA 2SFAA 4CREA 1O2TA 1OXGA 1HAZB 1SVPA 2Q6GA 3OY6U 3SJOA 4K1EA 3S9BA 1HLTH 3A80A 4TYDA 2P93A 2BOHB 1NZQH 1TBZH 5EJLA 2Z6BD 3O8DA 5A8ZA 1H9LB 5C1UA 4CRBA 3BTKE 3MH7A 2JH0D 4CRDA 1ELAA 4K60A 2QY0B 1P2OA 1WSSH 2KCAA 3E6PH 1NY22 5ESTE 1JOUB 2BY5X 2XBVA 3DSGA 1YYY1 2ZDKA 5GCHG 2AIQA 3TJVA 4B71A 3FANA 5HKKD 1YPHE 4XBCA 3LPRA 1SHHB 3F1SB 3GY6A 4LK4A 1YPMH 1LVYA 1MMJN 3RXBA 1A61H 1Y3UA 1OSSA 1BBRE 3EE7A 1DPOA 3K6YA 1IQLA 1O3LA 1OOKB 5F03A 3TITA 5GCHF 2ZPSA 3PO1C 1VJ9U 2BDCA 3T25A 2CF8H 2C8ZB 1G30B 3T5FH 1SGRE 1O5GH 3ESTA 3DFLA 4WJG2 3BV9B 1VGCC 3E0PB 4INLA 3VGCC 3ZVEA 3SUDA 1DY8A 1ZYOA 2WYGA 4WY3A 3CNRA 5TCCA 1Y3YA 1GBLA 1MQ6A 1V2ST 8LPRA 4ZHAA 1O3KA 1ELBA 3DFJA 1O2HA 4AGJA 3Q00A 1B0FA 3T29A 1K0HA 4ACAA 1QBOA 3A7XA 4R8TB 4B6FA 2W7SA 1O3EA 4YLUA 1O3JA 3SGAE 2SGPE 5A8XA 1NRNH 2BQWB 2H9EH 2XBYA 1LVMA 4Y6DA 1O2JA 1C1VH 1ELFA 2OBQA 1IQJA 2EY4C 2OD3B 2BOKA 4CHAB 1FLEE 3M5OA 2BD5A 3PV5A 3F9GA 1AFQB 3KQEA 3MHWU 3VEQB 3ODFA 3MU0A 1ELCA 2B0FA 1O3OA 3RXOA 3LGVA 3PLKA 2FTLE 2HPQH 3UOUA 1G2LA 1SGEE 3SU4A 4UDWH 5GJ4B 1O2RA 4J2YB 2GZ8A 2CHAC 3D23A 1G9IE 5AVDA 1DLEA 4E06H 1UW7A 2JH6D 1CA0C 1H8HD 2Y82A 2C8WB 3KGPA 5FPYA 3MH6A 1PPGE 3Q3YA 3QTOH 1W7GH 3ATMA 2FIRH 3NKKA 3SORA 2IOTA 5CE1A 2ANYA 1F2SE 3D62A 1B0EA 5EW2H 2GCTB 3SQHE 2VU8E 1J8AA 3DA9B 1W2KH 3PMAB 3MOCA 1SMFE 1AZ8A 4GAWA 4K1SA 3A7VA 2ZU5A 3P8OA 1C9PA 2XC4A 3EAJA 4E05H 1NRSH 1J9CH 1BTXA 1L1GA 2W7UA 1YF4A 4BAOB 1DITH 3UAIC 1CGJE 1NU9A 4A6LA 4UFGH 3MO3A 4DY7B 5FXLA 1PPCE 1LCYA 2CF9H 2BLQA 4I33A 1QRZA 5A0BA 2BY6X 4I8KA 1K1OA 4I8GA 4X2WA 2OXSA 3E91A 3T26A 1QURH 4B2BA 3PLPA 1O39A 1OS8A 3ZVGA 3RU4D 2YMSC 2G00A 1C4Y2 5FCRA 4Z6AH 1GBFA 2I6QA 1K1JA 3S9CA 1ABIH 3RXPA 8GCHG 4K8YA 4WWYA 2HLCA 1SPJA 2A7CA 1BBRH 2P3UB 2XNDD 4YZUA 1GHXH 1O3DA 1AZZA 2IJOB 4MLFB 4PROA 2ZCKP 4B1TA 2TPIZ 2A4OA 4FUIA 1HPGA 1KXEA 1N8OB 2G81E 3GDUA 1NFWA 8GCHF 2K1QA 3IITA 3U8OH 3RXFA 1D3TB 1BJUA 1FONA 3SU0A 3GY5A 3KL6A 1L4DA 4Z0KA 1GI0A 2UWPA 3PLBA 4AX9H 1EZSC 1RRKA 1C5MD 1GJ9B 2FESH 1V2QT 2P59A 2K8IA 3PMJA 4TWYA 2PUXB 3JZ1B 3GY4A 2ZGHA 2UUYA 1C1PA 3QO6A 2FS9A 3VGCB 5JBCS 1FY1A 1SBWA 1C1MA 3QZRA 1KXBA 1ID5H 1A5GH 1NFYA 1S84A 3AAVA 3F6UH 2WUBA 2ZHFH 3P70B 4DJZB 4H6SB 1LKAA 1UCYE 1V2KT 4D8NA 1TX6A 1D3QB 1GHBF 1O38A 1CU1A 2BD8A 3K65B 5DJ7A 4B73A 2J98B 1C5ZB 2ZCLP 2YMSD 8ESTE 1L0ZA 1P2QA 1IQGA 1FNIA 5EPYA 4Y0ZE 1ETTH 2UUJB 1AVWA 4K8BA 1H8IH 3KHVA 3VG8A 1ANCA 2ZGBH 4YXWD 1TA6A 1X7AC 1GJ7B 1O3PB 2BZ6H 4I7YH 1IAUA 4DOQA 2V6NA 2TBSA 4D9RA 3TJUA 1UHBB 2D8WA 3ATIA 3ZZ7A 4BXWA 1GHZA 1CA0B 5AFZH 3Q76A 2BD7A 2TRMA 3KYFA 2J98A 2H6MA 2OUAA 5JPMH 1A3EH 1GMDG 4ISHH 3QDZB 3MU4A 4Q7XA 4NIVA 1ETRH 1LTOA 1LKBA 5TJXA 2ZDVH 2GX4A 5AFYH 1EAXA 1CT4E 1FUJA 2IN2A 4Y7BA 5FX5A 5HM9A 1GJ8B 1V2WT 1W12U 2GT7A 2FYQA 1UHBA 1N1LA 1AVGH 1GBTA 3ZIAD 1GMDF 2HNTC 3DSPA 2PTCE 1SGFA 4MNVA 1O2GH 1EASA 1GCDA 1UVPA 3M7QA 2A7HA 1OKXA 2OC1A 1K22H 1PPBH 3PV4A 1F0SA 4K2YA 4Y8XA 3KNXA 2V3OH 3P6ZB 4Y10E 2Q1JA 3KQBA 1MKWH 4MPWA 2VWNA 2YMSB 1TONA 1HNEE 1RGQA 3ZVCA 3BTQE 1QCPA 4NGAH 1BRUP 2A31A 2AYWA 5EXLA 1K21H 3NWUA 4Q4LA 3SGBE 4CRAA 2F4LA 4GPGA 4AC9A 5FAHA 1V2OT 3BF6H 1ELEE 1YPKH 1UVOA 3M5MA 3OE7D 5FHTA 3KQCA 2D26C 3A7ZA 2P95A 3MNSA 1YGCH 2BVXH 4ZKSU 4XBDA 1MBQA 1HCGA 1GBCA 5B6OA 1IHTH 1WTGH 3EA8A 1JMOH 1ZGVA 3GCHC 3BTWE 2UUFB 2F9NA 2QYIA 4X1SU 3SV8A 1CSOE 2PKAB 1OX1A 1CA8B 3FO8D 1UCYH 1DOJA 2ZHWH 4RT1A 1GI5A 1E37B 1KXFA 5EU8A 4AB9A 1MTNB 3SHCH 1LMWB 4F55A 2ZU3A 3BTHE 3KN2A 2GV7A 4BAMB 1C9TA 2GDEH 1F0TA 1GPZA 2A5IA 1PQ5A 4AORA 3TJNA 2Z3CA 1GWAA 2R0KA 4LOYH 2BDHA 3OEHD 4HZHA 3EE0B 2QF3A 1JIRA 2WPJS 1SGNE 3ZZDA 4ZMAH 2QE7D 1O3GA 1YWUA 2L74A 1Z8RA 4GCHG 2QXGA 1GHAG 2PKAA 1QBNA 1AMHA 2AMQA 2GDDA 2WPLS 3MH4A 3HK3B 2FI4E 1GVZA 1O2YA 3F9EA 1ZJKA 1Y5UT 3L33A 2M5TA 4ZH8A 2F9VA 1D3PB 1TRYA 2SGDE 2BDIA 3UIRA 1CGHA 3SHAH 1EJNA 4GCHF 1GHAF 3HK6B 4DW2U 2DE9A 1GI2A 5FCKA 5FPSA 2ODPA 2PFEA 4CH2B 1ACBE 2STBE 3GICB 3V7TA 3TGJE 1C5UA 1LHGH 4U30A 1IQIA 1FI8A 3GY2A 2AFQB 2VVVA 7ESTE 2P3TB 2BXTH 4IBLH 2Z9GA 4ISIH 1CT0E 1HV7A 2ALVA 4KTCA 1WU1A 1BTHH 4J1YA 1IQEA 1SGIB 4NA9H 1HIAB 4NA8A 3ZVBA 2IPHA 5A0CA 2NU3E 4KELA 4AFQA 3PROA 4Q2KA 1ZPBA 1Y8TA 3ENSB 3OSYA 1CHOF 1O3HA 2RG3A 1EQ9A 2JH5D 3NUMA 2XNIA 1UVSH 5GDSH 4I31A 1MTUA 1ZRBA 1K9OE 3SU6A 3RXTA 4UFEH 5I46H 1P06A 1GBDA 2HGTH 4ISLA 3WY8A 2NU4E 2BYAX 3G01A 1CVWH 2EA3A 3R3GB 3LGTA 2ZTXA 1ARCA 1ESTA 1GHWH 3URDA 3VXFH 4NWLA 1AD8H 3FP8E 2HNTE 2PR3A 1GDUA 1LPGB 1LHDH 5A8YA 1SQRA 1J15A 2BXUH 2BX4A 5DSFA 1W0ZU 1HXFH 3S7HB 1GJAB 2HNTF 3KQ5A 1PQAA 2B8OH 3IWMA 4WMFA 1QIXB 1E38B 3BTTE 1TWXB 3BSQA 4F49A 5DP3A 2AHME 1B5GH 2XXLA 3QN7A 2ODQA 1AE5A 4X1NU 1ZPZA 3W94A 2W26A 2ESTE 3M35A 4JCNA 2Y7XA 5EQQA 5JB9S 2Y5GA 2ZIQH 1W0YH 3BEUA 3AW1A 1XUKA 3A85A 4HI3A 1TIOA 5DP4A 3GCTG 5DP9A 1BRBE 2SGQE 3GCHB 1HAYB 4DGJA 4FUCA 4CRCA 1AKSA 1WOFA 2WV4A 2BY8X 1F5KU 1SGYE 3VB4A 1THRH 2GD4B 3UFAA 1GJ4H 1CQQA 3MI4A 1T32A 4ZKOU 2VNTA 5E0JA 4YOGA 2FOBA 3Q3XA 4HFPB 4CHAC 5C3NA 3BG4C 3F2HA 2IPQX 2LPRA 2XCFA 5DP6A 1HYLA 1HAIH 1O30A 4Q7ZA 1O3FA 4MTBA 1FXYA 4H42U 4ABHA 4OS5A 3ZYDA 1AHTH 1GI7B 3GCOA 4X2YA 1VZQH 5DP8A 1YCPH 3SNEA 1TPAE 1C5NH 2ZQ1A 2CXVA 4JK5A 1W10U 1RJXB 2GTBA 2LNCA 1FDPA 4Y8YA 1GI3A 4Z1MD 3T28A 2ZFRH 1VITG 1C4V2 1GBHA 1T7CA 5L30H 1TMUH 1YPGH 5E2OA 2CMYA 3FFGA 3H09A 1P11E 2VGCC 4HGCA 3KIDU 2GCHG 3VB5A 2ANWA 3FAOA 2F83A 1WUNH 3SU1A 1MD8A 1QHRB 2HLDD 3EA7A 3GDSA 2ODYB 3E16B 3MNBA 5GPIB 1AN1E 1HXEH 2FOGA 1NRPH 2WUCA 3A8DA 3O8BA 1KY9A 1NPMA 2ZFFH 1GBKA 4P00A 1T8MA 2QGRA 1F7ZA 4WXIA 1FJSA 4XFQA 1O2OA 4KGAA 1NS3A 1A2CH 1NROH 4OS1A 1GI9B 2KR7A 2VIOA 4GHTA 2VJ1A 1G2MA 1BOQA 1D6RA 2BD4A 1DWCH 5GIBA 2IJD1 3LT3A 5JYIA 3VFEA 3WW7A 2ALPA 1P8VC 2R2WU 3A7WA 4IGDA 1UTQA 1IQKA 3TPIZ 2GZ7A 3ATLA 1G32B 2HRVA 2QV1A 1O35A 1ESBA 1K1NA 4ESTE 3SV9A 1ZGIA 3FOAA 4SGAE 1DWEH 4WH8A 4AG2A 1L1NA 4NWKA 1H9IE 2ZZUH 1N8OC 2PGBB 3R0FA 3HATH 2WZQA 3RC4A 3A81A 5EGMA 1C1SA 3OU0A 2Z94A 4BXSA 1KLIH 4HTCH 1NFUA 1BMFD 2SGFE 3E8LA 2ANMH 2B7DH 1ZOMA 3DT0H 4INKA 1TOMH 5T3HA 1EZUC 4H4FA 1GBEA 3VPKA 1AIXH 1Y3VA 4DG4A 1GMHG 3MU1A 2VIVA 1K1MA 3ZVFA 1MKWK 2FI5E 1FAKH 1O2QA 2O8TA 1QTFA 4Y8ZA 1OPHB 2OC8A 4A5TS 3ZZ9A 1DANH 1EJMA 3BEFB 1KTTB 3NRLA 1GGDC 1DT2A 1NO9H 1O5EH 5EW1H 2ZPRA 1C5YB 1G3CA 1KDQA 1V2VT 1FIWA 4FETA 2V3HH 1ELVA 3W95A 1V2PT 4ABFA 2OQUA 3PMHB 4THNH 3AW0A 3UTUH 2CJIA 4I86A 1GMHF 1GVLA 1C2EA 4NFFA 1Y5AT 4JYTA 3SU5A 4ZROA 3OTPA 1DM4B 5EOKA 3ELAH 3E90B 2J97A 1O2SA 4MNWA 4CBOA 4B74A 3BG4B 3CP7A 3RXMA 1UJ1A 3ZZBA 1UCYK 2BX3A 3SQEE 2ZCHP 3NXPA 3A88A 6LPRA 3TIUA 5C5OA 3TJOA 3RXRA 1VITH 1W3CA 2RDEA 4ABGA 1GDQA 1OYTH 3M7TA 2ZTZA 1RTLA 1UO6A 3P17H 3RC5A 2Z7FE 1NRRH 1LDTT 1INCA 1C5WB 4ZHMU 1WCZA 2GVFA 4AG1A 1YKTA 1N6YA 3GY3A 3SUGA 2HVYB 3Q77A 3SV7A 3TH4H 5C17A 1FV9A 4JYVH 4ISOA 2GKVE 2O8LA 3LH1A 4RKOB 5T6FA 3MU8A 1DSUA 4X8VH 5C2ZA 1BHXB 1M9UA 5FBEA 2VGCB 3AVZA 2ZFTA 1F92A 1E36B 5DPAA 1P03A 4X6NA 1B7XB 2J92A 1GDNA 3TLOA 1ZTKA 1GI6A 3CS0A 1XUHA 2BB4A 1ZMNA 1BMNH 1MH0A 2GMTC 1BHXF 4X8TH 1QY6A 3M5NA 3M5LA 1HAGE 4JZFH 2BDGA 1TNHA 2Y81A 1O33A 2OTVA 2VWLA 4Q63A 1AB9B 1EUFA 2ZGCA 2C90B 4MDSA 4ZXYH 4D9QA 5JBAS 1Z8GA 2BD2A 4XSKU 1C5VA 4R0IA 4ABDA 4X2XA 4NIWA 1DUEA 3ATWA 1BCUH 1THSH 2OINA 1E34B 2W3IA 4YM9A 1C5RA 5LPEA 3SYJA 3SJ8A 4Y11E 4AZ2B 3P8FA 3K6ZA 1UK3A 2KFWA 1NESE 2PP6A 3E1XB 3WWFA 1G3EA 3SUEA 3HPTB 5E0GA 1LHFH 1PQ8A 3TH2H 4K1TA 5ESBA 1ZHMA 1SFIA 2P94A 4TY7A 1WBGB 2ILNA 2W6ID 1WQSA 1KMHB 5JDUB 3S69A 3K2UA 4JZIA 5FL7D 3ZVDA 1TPSA 1MTNC 1H8DH 2AIPA 3BIVH 1XUFA 3ZV9A 2FOFA 2SGEE 1S6HA 2F9OA 1GBJA 3DSOA 3IG6B 4TWWA 1D9IA 1P01A 3SJIA 3UQOA 2BTCE 1MAYA 1UK2A 4X1QU 4X8UH 1GHBG 2AMPA 3SNCA 4FUBA 5C0TA 3RXGA 1EB2A 3AASA 3V3MA 1G37A 3B9FH 1CT2E 1Z8IB 1GGDB 1AU8A 3PV2A 2ZFSA 3RXLA 1O5FH 3LC3A 1SQOA 2VWOA 4LZ1H 3A7TA 1CGIE 3FVFB 3RXUA 4NFEA 1Z8JB 2GZ9A 3KYGA 1FAXA 2PWXA 3SU2A 1C5XB 4QT8C 4Q80A 1DICA 1SGCA 1EP6A 1P9UA 2BVRH 2QF4A 2P8OB 5LH8A 1KXDA 4E7NA 4O3TA 5CMXH 1T8OA 2Q6FA 1ZMJA 1HB0B 1O32A 2FMJA 4CR5A 4DURA 1UVTH 4BANB 3UR6A 1GG6B 1BMMH 1QJ7B 2RA3A 4CR9A 1BB0B 1J17T 3RU4E 3GDVA 4RSPA 2STAE 5DP5A 4FUHA 4ACBA 4UE7H 3BTME 3RDZA 1TA2A 3SI3H 4YLQH 1EP5A 3Q3KA 6ESTA 4X1PU 1SLUB 2BDAA 2GV6A 2ZTYA 1SGFG 1O3CA 1T31A 3RXQA 1E0FD 4D7GA 4XOJA 1P05A 3OY5U 1S5SA 1MUEB 1UTKA 1FZZA 4OS7A 3F0PA 1MZDA 4F4OC 2EI6A 3M36A 2F43B 2H9HA 2PW8H 1YC0A 1YLDA 1TX7A 1OP8A 1GL0E 4XDEA 1VR1H 2VB0A 1OWHA 1FPHH 1KLTA 2O8WA 3EA9A 1GMCG 2Y5FA 1C5SA 4B6EA 4SGBE 1YPLH 4H6TA 1AUTC 3UQVA 1EB1H 5HGGA 3BN9A 2GMTB 3AK5A 2ZF0H 4UFFH 1SLXB 3EYDA 3V12A 2BDBA 4X1RU 3AAUA 5JBBS 1ANBA 3RXIA 5HM2A 2G5NA 3N7OA 1O5CB 1GMCF 5PTPA 4Y0YE 2FWWA 5GWZA 2P3FH 2ASUB 5HMAA 4KTUA 1BMLA 5F8XA 4K5ZA 3F9FA 3TK9A 1YCPM 1O37A 2WV9A 1LHEH 3RXDA 1XKAC 1P04A 2HPPH 3A7YA 1LO6A 1ZSJA 1TMBH 5HIYA 1C1RA 1EX3A 3UUZA 4GHQA 2B9LA 1OWEA 4M9FA 2WPMS 2PSYA 4ABAA 1HFDA 1ETSH 3P8NA 2J2UA 1TPOA 3I77A 2ZU4A 3A8AA 3D49H 2J94A 1DS2E 1GI4A 1RTFB 4MVNA 3OAAD 2B5TB 5BPEA 2W5EA 2ZHEH 2OBOA 1AE8H 1GJ6A 3LOXA 2D1JA 3GYLB 4VGCB 1GI8B 1JIMA 4MQAA 1GJ5H 1N6XA 1TGTA 3MO6A 4DVAU 1WAYB 1V2RT 1E1RD 1NM6A 1KSNA 1W0KD 1ZLRA 4WMDA 1KLJH 1EJAA 4CBNA 4M7GA 1J14A 1PPZA 2EI7A 1C1TA 1V3XA 1UTOA 9ESTA 1O2ZA 4ZKRU 1FMGA 2F3CE 1T8NA 1Q31A 3RMMH 3U8TH 3VB3A 3SZNA 2F91A 4JZDH 5FBIA 3UOPA 4AOQA 3FN8A 3SNAA 1C5PA 1GBIA 1Z6EA 4NCYA 1RXPA 3BTFE 3PM3A 4ZXXH 3LJJA 1FX0B 1XXDA 1ANDA 4NG9H 1BIOA 1PPFE 1EXFA 5EXNA 1BT7A 4X8SH 1YLNA 2NU0E 2TGPZ 2Y5HA 1C4U2 4B75A 2CN0H 3ZZ3A 4RT0A 1NTPA 3GYMA 2WPDD 5F8TA 1ZTLA 2AERH 1COWD 1CBWB 1ORFA 1V2LT 2R0LA 5H4IB 5HXFA 5EJ1A 5E0HA 1ELGA 5E2PA 2QN5T 1VJAU 4I8LA 2PHBA 3QK1A 1C1UH 1SGPE 1THPB 3I78A 1GJCB 4NZQA 2BD3A 1GBBA 3H5CB 1G3BA 1OWJA 1CHOG 1LHCH 5KEDA 3URCA 3GCNA 1TPPA 2WYJA 2KCYA 1P57B 5C1XA 1XVOA 3F2FA 1O2XA 1QA7A 1XUIA 2AEIH 1TNGA 4B76A 1NRQH 1TGSZ 3RC6A 2BMGB 2RDLA 3S9AA 4JK6A 1QL9A 2O9QA 3L6PA 3TH3H 1P2MA 2BY7X 2QF5A 2GGVB 1TNLA 4DT7B 1C1NA 1MBMA 4TY6A 2ANKH 2RFKC 2PTNA 2VIQA 1TQ7B 3UWJH 2FYRA 4CRFA 1SLWB 3F9HA 1O5BB 2LELA 3RXHA 4YT6H 4ABEA 2GP9B 4AFZA 4D7FA 2WINI 3SN8A 5A2MH 3HKJB 1Z1IA 1O31A 1TALA 2J4IA 3GOVB 4HG6A 2C93B 3UB0A 1A0JA 5C94A 1GL1A 5EIYA 1QA0A 4U32A 5J4QA 4FUJA 1ELDE 5IYTA 1SI5H 3TNSA 2BQ7B 2VH0A 3GISB 1ZSKA 2WSSD 1LPZB 2J95A 1OWKA 1O36A 4ABBA 2UWOA 1YLCA 1ZSLA 1YY3A 1CO7E 1AKSB 3MNXA 2WHXA 1KYNA 3QWCH 5L2YH 5C67A 1BTYA 6CHAB 2KX4A 3QZQA 1YPHC 4MG3A 1FQ3A 5DP7A 2EC9H 2ZGXH 4TSFD 1OHHD 4AN7A 3FZDA 2ZQ2A 2ZU2A 3RXSA 1V6DA 5LGOA 1MAXA 2G8TA 4JYUH 1KIGH 2BM2A 1DXWA 2Z9KA 4A1XA 2O8MA 1BBRK 4ASUD 3C27B 3SI4H 3U98H 1O3MA 1V2MT 1WYKA 5HYOA 2XRCA 1DWBH 1KXAA 1BA8B 2PLXA 1P10A 2UWLA 3DD2H 2ZKSA 5EXMA 1HDTH 1UTLM 4IW4E 1RTKA 1EPTC 1AI8H 3LH3A 3QUMP 4OS6A 3UPEA 2HWLB 1XMNB 2FM2A 1TRNA 4YT7H 2NWNA 2BY9X 4O3UA 1U6QA 1XKBC 3U1IB 1O3NA 2W6JD 3SV6A 1S85A 1UTPA 2ZC9H 4YOJA 1BZXE 3TGKE 2XBXA 1XX9A 1A1RA 2SGAA 2QC2A 1SQTA 1H1BA 5CDFE 4P02A 1XVMA 3VB7A 4IMZA 1TFXA 2FLBH 1G36A 2BLWA 2VIWA 1E79D 2OCVB 3N7EA 2H1UA 1TNKA 1O2VA 4ZAEA 3B23B 4WVPE 1IOEA 1VCWA 2ZEBA 1QL8A 1V2NT 1A0HB 1BDAA 3BIUH 3I29A 2DE8A 5GNDA 4INHA 2KAIA 3M3VA 1MKXH 2VVCA 1QGFA 3OEED 3A86A 1K1IA 1SGDE 2AH4X 3RXJA 5LPRA 2ZDMA 3NK8A 2AGIX 1EAUA 1S0RA 3TK6A 1IQHA 2UUKB 4AYVB 4O97A 2H5DA 4IC6A 3HGNA 1SLVB 1IQMA 3ODDA 3D65E 2ZI2H 2PV9B 4TT3D 1A7SA 3RXCA 2Y6TA 1BTWA 1AB9C 1EZQA 2A45B 1NU7B 4ABIA 3STJA 2Q6DA 1K1LA 4AGKA 5IDKA 4GUXA 4FU7A 2R3UA 1PYTC 1TLDA 2ZDNA 1P2NA 1GHVH 3LGUA 2F9PA 1QNJA 4FUDA 4A92A 2JIZD 5J4SA 1P12E 1EATA 2CK3D 4FU9A 1HJAC 3RM2H 2ZPQA 5I25A 2BDYA 1HAPH 5EODA 1OP2A 1Z6JH 1DE7H 6GCHF 1UTJA 1P3CA 1KDQB 4IMQA 4DIIH 2C8XB 2J34A 3H7OA 3N99A 4GSOA 4IC5A 4X6MA 3NZIA 5HIZA 1QL7A 2VVUA 2F9UA 2C4FH 1EAIA 2Z9LA 3T2NA 1ZHRA 1HAHH 2KZ4A 1C2GA 1FY8E 2BVSH 2PUQH 3SV2H 1HAVA 4A1TA 3TGIE 2YNAA 1O2NA 3U69H 4JMYA 3ZVAA 2V0BA 1D3DB 1DSTA 2Z9IA 3U9AH 4XD7D 3PYHA 5EG4A 5C1YA 3SUFA 2Y7ZA 4IN1A 4LZ4B 3ZZ8A 4BTUB 2NU2E 4O9VA 1FN8A 1XUJA 2AS9A 2XCNA 4ISNA 3NPSA 5A0AE 1AUJA 2A4RA 2JETC 1AGJA 3WWBA 1F0RA 1AWHB 2A5AA 3KCGH 4NIYA 2XTTB 1EPTB 4UFDH 3QLPH 2P8OC 1C2FA 1P2JA 1GHYH 2NU1E 1ZMLA 4AYYB 3U1JB 1PYTD 3OTJE 5EQSA 3ZZ5A 3L3TA 3FKSD 1SB1H 4OS2A 2QXIA 1HUTH 4CH8B 1GBAA 1GG6C 3MO9A 2QA9E 4X2VA 4I8HA 1TE0A 1S82A 2ZU1A 2VIDA 2WPHS 3CENA 2ZDLA 2A4GA 2FOEA 2VBCA 2G51A 5FX6A 5JB8S 3DCLA 1P09A 1SC8U 1O3IA 2FP7B 1WTHD 1A5IA 1Z1JA 1EOJA 3LIWA 1O3AA 1Y59T 1EPTA 3LDXH 1YBWA 2BQ6B 4RKJB 1DX5M 5K7RA 1WDIA 1PJPA 4ASHA 1HAOH 2PSXA 4IN2A 4B2CA 2Y80A 1JBUH 3BTEE 3A8BA 2TGDA 3EDXB 3DUXH 5DKMA 5KGOA 4FU8A 4ZKNU 1OP0A 1QRWA 1G3DA 1HRTH 3M7UA 1SHYA 2FI3E 1BTPA 1DVAH 1FIZA 2A2QH 2G5VA 4NZLA 5TCAA 3PMBB 3ZYEA 1TBRH 1TGCA 1GCTC 1UMAH 3ITIA 3NCLA 3SZEA 5L2ZH 1A4WH 3P92A 5T1VA 1C2LA 1QFKH 1BQYA 2FODA 2PKSC 4MPVA 3S7KB 1MQ5A 1C2KA 1CE5A 1UVUH 2XC0A 3MH5A 5AHGH 1PFXC 4MPXA 1F0UA 1SG8B 4OGXA 2FPZA 3QX5H 3SJ9A 1DLKB 4WH6A 1TRMA 1QJ6B 1V2JT 2PGQB 4OM9A 1BJVA 4TPIZ 2G55A 3PWBA 4GVUA 1LVOA 1TYNA 3RMOH 5L6NH 4AFUA 3A8CA 3EGKH 3A87A 1HJAB 4MPUA 1HGTH 1KTSB 3W1EA 1MD7A 4X6PA 1CHGA 3RXVA 1H9HE 2FX4A 3UREA 1QR3E 2QF0A 1Y3XA 1C5TA 4AFSA 5DN6D 1E1QD 4DT4A 1L1JA 2ZWLH 4XE4A 3UNRA 3A83A 3MU5A 1MABB 3CS7A 2VH6A 1MCTA 4VGCC 1T4VH 1ELTA 1FN6A 4X6OA 1GJDB 1HBTH 3T27A 4WXVA 1FY4A 5DK1A 4A1VA 1TGBA 3B8JA 1ZTJA 3KEEA 2H5CA 4UEHH 8KME2 2FOMB 3A82A 2FX6A 5F6MA 2WPKS 1BRAA 3C1KA 1Y5BT 4MNXA 5ABWA 3TK5A 1NC6A 2QAAA 2K0QA 1ARBA 2TGAA 2FOAA 1DFPA 5DO4H 3RU4T 1MU6B 4XRNA 2WV5A 3MNCA 1Z7KA 2JETB 3RLWH 3UR9A 3HKIB 3PO1B 4FXGH 3N7DA 4MNYA 1TNIA 2ZDAH 2P16A 1A0LA 1O2LA 1VGCB 3MYWA 5C5NA 1BMAA 1CBWC 2V7QD 1IQFA 4GLYA 1DXPA 3A89A 1GVKB 1P3EA 7GCHG 1TBQH 1C2JA 3STIA 4WMEA 5CHBA 3ZZCA 4BTTB 1ZRKA 3RLYH 4RI0A 2BD9A 1T4UH 3P95A 5SGAE 2J9NA 1W14U 2A2XH 3M61U 1H4WA 1OWIA 3SW2B 1MTSA 1Q3XA 2XBWA 2ZECA 3FP6E 4BOHA 7GCHF 1IQNA 1V2TT 4O03A 2CGAA 1C1OA 1YPEH 1XXFA 1UTNA 1ESAA 5KECA 3RXKA 1YCPK 1EAWA 1TAWA 2ZFPH 5BRRE 2YNBA 1LQEA 2CHAB 4E7RG 2XWAA 3PWCA 1QZ8A 3ZZAA 1O2MA 1D6WA 3LONA 1DWDH 1EOLA 1O5DH 1KXCA 1GCTB 1SR5C 4FUEA 5K0HA 2TIOA 1A3BH 5EJZA 2W3KA 1PQ7A 1Q2WA 3F3BA 1O34A 1MKXK 4RN6A 1BITA 4YTAA 2DUCA 1EFRD 2OK5A 1RFNA 3RMLH 2A32A 2PKSB 3RM0H 5E8EH 2GT8A 1O0DH 2TGTA 4IS5A 4YOIA 1K28D 2A1DB 1WV7H 2QIQA 2GJGA 1MU8B 5C0UA 1ZPCA 6CHAC 2XW9A 1O5AB 2XC5A 2A7JA 4KTSA 1A5HA 3UNQA 4FOUC 3T62A 1AY6H 1V2UT 4OS4A 3ZZ4A 4Q7YA 2Z9JA 3MFJA 4DIHH 2H9TH 2A5KA 1C2HA 1L4ZA 2FOHA 2VIPA 4JZ1A 3E0NB 1ZHPA 2ULLA 4BAHB 1D4PB 2SNWA 2FO9A 3MTYA 1Z71A 1BTUA 1SOTA 1Y3WA 2FTMA 4NA7A 5LPFA 2AGEX 2FOCA 2ZNKH 2BLOA 1H8ED 1AWFH 3P8GA 2M2AA 1F5RA 3KF2A 2FS8A 1O2KA 2FXRA 2VWMA 1ZJDA 4FVBA 3PRDA 5EQRA 2R3YA 1FY3A 2EQNA 3LKWA 1P9SA 1RIWC 3GY7A 4YESB 3ZV8A 2ZA5A 1O2WA 1SKYE 2OC0A 4Y76A 1GJBB 5AF9H 1P0SH 1K1PA 1C1WH 4X0WU 1LPKB 5A09A 3LGIA 1K2I1 7KMEH 4FVDA 2OQ5A 2I6SA 2V3MA 2ZHQH 4AB8A 4Y71A 2JJ2D 1C2MA 2FZZA 3QTVH 2FLRH 1IHSH 1WQVH 4I32A 1ZZZA 1TABE 3O8CA 3ZZ6A 1S83A 3TU7H 3VXEH 1NBMD 1F5LA 5CHAC 1P2KA 2C3SA 1LQDB 3PTNA 1MTWA 2QCYA 3EQ0H 1QRXA 3RMNH 7LPRA 5GXPA 1O2PA 2AMDA 5DGJA 2KCOA 1UTMA 2QXHA 5DG6A 3RP2A 5EPNA 1S6FA 2ZG0H
chains in the Genus database with same CATH topology
1J16A 1SSXA 5T6GA 1AFEH 1SL3A 4BTIB 3A84A 3UY9A 1QJ1B 1JRTA 2Z3EA 3OYPA 4KKDA 4DCDA 3O8RA 3FZZA 5IK2D 1VCPA 4FUGA 4K69A 2L6OA 3FP7E 3RUOA 3SGQE 3SO3A 2YOLA 1SOZA 1HJ8A 3F0OA 1MZAA 3SU3A 2KCPA 5ETXA 2R2MB 4CRGA 2XWBI 2ZO3H 4NSVA 2EI8A 1XUGA 1P02A 3K9XB 1TX8A 2BLVA 4YO9A 1C2DA 1DUAA 1ZR0A 2FEQH 3SNBA 1C1QA 3U8RH 4JZEH 4K3JA 4BAQB 1O2UA 1C5QA 1W0JD 5F53A 3H7TA 1MTVA 3TVJB 1W11U 2J38A 3SJKA 1W8BH 1NFXA 4NIXA 1HJ9A 2D2DA 3TNTA 1MCVA 1OWDA 3QGNB 2OC7A 3MWIU 1TQ0B 3PRBA 1TB6H 1HIAA 1PPHE 1TNJA 3F68H 4I8JA 2H2ZA 1GI1A 3M3TA 4UD9H 1SGQE 1HAXB 4Y7AA 2C8YB 1BUIA 2ZFQH 4BNRA 1JXPA 1DY9A 1P2IA 1TOCB 2THFB 3LC5A 1NBME 2G4TA 3LU9B 4D76A 1YP9A 2OP9A 1ANEA 1SFQB 1GBMA 1QBVH 3LGWA 1O3BA 3MMGA 1RS0A 1NT1A 2CV3A 1AQ7A 2J5UA 5G4BA 2O8UA 1L2EA 1T8LA 2AGGX 2R9PA 3RXEA 2JDID 1S6LA 1O2IA 3PB1E 3V0XA 1WXRA 3F2GA 3GS9A 1RIWB 4UONA 9LPRA 3LGYA 3LJOA 1QB6A 4ZHLU 1BRCE 1SGTA 2XOKD 1RD3B 2BZAA 2KAIB 2Z3DA 2ZP0H 2KM0A 1YPJH 1W7XH 4ZUHA 1LVBA 1VCQA 1JWTA 2ZGJA 4FUFA 3SOSA 1QQ4A 2BHGA 3GCTF 1FY5A 4ZCNA 1C2IA 5C20A 2RCEA 4LXBH 1EKBB 2VINA 3RXAA 1TGNA 1UK4A 3SNDA 3SBKA 4KP0A 1S81A 4OGYA 3VB6A 2QXJA 3KQDA 1AFQC 1FPCH 1JRSA 2HVXA 3BTDE 3OFND 3BG8A 3BEIB 4NSYA 1QB9A 4Y79A 2A0QB 3PTBA 4B2AA 3S0NA 3OX7U 2EEKA 1XM1A 5CHAB 3BTGE 5JBTA 1AVXA 3DHKH 1DDJA 1NN6A 2OLGA 2RA0A 1A46H 1E35B 2HALA 2WPIS 3E3TA 3M37A 3GY8A 2A4QA 1AO5A 1YM0A 4U2WA 4U01A 2SNVA 2ZHDA 2JJ1D 3JZ2B 2V35A 3ATKA 3HGPA 1C5OH 2XYAA 1OYQA 2G52A 4BAKB 2JKHA 5F8ZA 2GCTC 3QGJA 1PPEE 5B6LA 1VITF 1S0QA 2G4UA 2FDAA 1QB1A 5T6DA 2F9BH 1W13U 1ABJH 3V13A 4ABJA 2HOBA 6GCHG 3UNSA 4XBBA 2GCHF 1EZXC 3M3SA 1TMTH 5FPTA 1C5LH 1SQAA 1QQUA 4WF8A 4TPYA 3UWIA 4A7IB 1HAVB 1BTZA 2SFAA 4CREA 1O2TA 1OXGA 1HAZB 1SVPA 2Q6GA 3OY6U 3SJOA 4K1EA 3S9BA 1HLTH 3A80A 4TYDA 2P93A 2BOHB 1NZQH 1TBZH 2Z6BD 3O8DA 5A8ZA 1H9LB 5C1UA 4CRBA 3BTKE 3MH7A 2JH0D 4CRDA 1ELAA 4K60A 2QY0B 1P2OA 1WSSH 2KCAA 3E6PH 1NY22 5ESTE 1JOUB 2BY5X 2XBVA 1YYY1 2ZDKA 5GCHG 2AIQA 3TJVA 4B71A 3FANA 5HKKD 1YPHE 4XBCA 3LPRA 1SHHB 3F1SB 3GY6A 4LK4A 1YPMH 1LVYA 1MMJN 3RXBA 1A61H 1Y3UA 1OSSA 1BBRE 1DPOA 3K6YA 1IQLA 1O3LA 1OOKB 5F03A 3TITA 5GCHF 2ZPSA 3PO1C 1VJ9U 2BDCA 3T25A 2CF8H 2C8ZB 1G30B 3T5FH 1SGRE 1O5GH 3ESTA 3DFLA 4WJG2 3BV9B 1VGCC 3E0PB 4INLA 3VGCC 3ZVEA 3SUDA 1DY8A 1ZYOA 2WYGA 4WY3A 5TCCA 1Y3YA 1GBLA 1MQ6A 1V2ST 8LPRA 4ZHAA 1O3KA 1ELBA 3DFJA 1O2HA 4AGJA 3Q00A 1B0FA 3T29A 1QBOA 3A7XA 4R8TB 4B6FA 2W7SA 1O3EA 4YLUA 1O3JA 3SGAE 2SGPE 5A8XA 1NRNH 2BQWB 2H9EH 2XBYA 1LVMA 4Y6DA 1O2JA 1C1VH 1ELFA 2OBQA 1IQJA 2OD3B 4CHAB 2BOKA 1FLEE 3M5OA 2BD5A 3PV5A 3F9GA 1AFQB 3KQEA 3MHWU 3VEQB 3ODFA 3MU0A 1ELCA 2B0FA 1O3OA 3RXOA 3LGVA 3PLKA 2FTLE 2HPQH 3UOUA 1G2LA 1SGEE 3SU4A 4UDWH 5GJ4B 1O2RA 4J2YB 2GZ8A 2CHAC 3D23A 1G9IE 5AVDA 1DLEA 4E06H 2JH6D 1CA0C 2Y82A 1H8HD 2C8WB 3KGPA 5FPYA 3MH6A 1PPGE 3Q3YA 3QTOH 1W7GH 3ATMA 2FIRH 3NKKA 3SORA 2IOTA 5CE1A 2ANYA 1F2SE 3D62A 1B0EA 5EW2H 2GCTB 3SQHE 2VU8E 1J8AA 3DA9B 1W2KH 3PMAB 3MOCA 1SMFE 1AZ8A 4GAWA 4K1SA 3A7VA 2ZU5A 3P8OA 1C9PA 2XC4A 3EAJA 4E05H 1NRSH 1J9CH 1BTXA 1L1GA 2W7UA 1YF4A 4BAOB 1DITH 1CGJE 1NU9A 4A6LA 4UFGH 3MO3A 4DY7B 5FXLA 1PPCE 1LCYA 2CF9H 2BLQA 4I33A 1QRZA 5A0BA 2BY6X 4I8KA 1K1OA 4I8GA 4X2WA 2OXSA 3E91A 3T26A 1QURH 4B2BA 3PLPA 1O39A 1OS8A 3ZVGA 3RU4D 2YMSC 2G00A 1C4Y2 5FCRA 4Z6AH 1GBFA 2I6QA 1K1JA 3S9CA 1ABIH 3RXPA 8GCHG 4K8YA 4WWYA 2HLCA 1SPJA 2A7CA 1BBRH 2P3UB 2XNDD 4YZUA 1GHXH 1O3DA 1AZZA 2IJOB 4MLFB 4PROA 2ZCKP 4B1TA 2TPIZ 2A4OA 4FUIA 1HPGA 1KXEA 1N8OB 2G81E 3GDUA 1NFWA 8GCHF 2K1QA 3IITA 3U8OH 3RXFA 1D3TB 1BJUA 1FONA 3SU0A 3GY5A 3KL6A 1L4DA 4Z0KA 1GI0A 2UWPA 3PLBA 4AX9H 1EZSC 1RRKA 1C5MD 1GJ9B 2FESH 1V2QT 2P59A 2K8IA 3PMJA 4TWYA 2PUXB 3JZ1B 3GY4A 2ZGHA 2UUYA 1C1PA 3QO6A 2FS9A 3VGCB 5JBCS 1FY1A 1SBWA 1C1MA 3QZRA 1KXBA 1ID5H 1A5GH 1NFYA 1S84A 3AAVA 3F6UH 2WUBA 2ZHFH 3P70B 4DJZB 4H6SB 1LKAA 1UCYE 1V2KT 4D8NA 1TX6A 1D3QB 1GHBF 1O38A 1CU1A 2BD8A 3K65B 5DJ7A 4B73A 2ZCLP 1C5ZB 2YMSD 8ESTE 1L0ZA 1P2QA 1IQGA 1FNIA 5EPYA 4Y0ZE 1ETTH 2UUJB 1AVWA 4K8BA 1H8IH 3KHVA 3VG8A 1ANCA 2ZGBH 4YXWD 1TA6A 1X7AC 1GJ7B 1O3PB 2BZ6H 4I7YH 1IAUA 4DOQA 2V6NA 2TBSA 4D9RA 3TJUA 1UHBB 2D8WA 3ATIA 3ZZ7A 4BXWA 1GHZA 1CA0B 5AFZH 3Q76A 2BD7A 2TRMA 2H6MA 2OUAA 5JPMH 1A3EH 1GMDG 4ISHH 3QDZB 3MU4A 4Q7XA 4NIVA 1ETRH 1LTOA 1LKBA 5TJXA 2ZDVH 2GX4A 5AFYH 1EAXA 1CT4E 1FUJA 2IN2A 4Y7BA 5FX5A 5HM9A 1GJ8B 1V2WT 1W12U 2GT7A 2FYQA 1UHBA 1N1LA 1AVGH 1GBTA 3ZIAD 1GMDF 2HNTC 3DSPA 2PTCE 1SGFA 4MNVA 1O2GH 1EASA 1GCDA 1UVPA 3M7QA 2A7HA 1OKXA 2OC1A 1K22H 1PPBH 3PV4A 1F0SA 4K2YA 4Y8XA 3KNXA 2V3OH 3P6ZB 4Y10E 2Q1JA 3KQBA 1MKWH 4MPWA 2VWNA 2YMSB 1TONA 1HNEE 1RGQA 3ZVCA 3BTQE 1QCPA 4NGAH 1BRUP 2A31A 2AYWA 5EXLA 1K21H 3NWUA 3SGBE 4CRAA 5FAHA 2F4LA 4GPGA 4Q4LA 1V2OT 3BF6H 1ELEE 1YPKH 1UVOA 3M5MA 3OE7D 5FHTA 3KQCA 2D26C 3A7ZA 2P95A 3MNSA 1YGCH 2BVXH 4ZKSU 4XBDA 1MBQA 1HCGA 1GBCA 5B6OA 1IHTH 1WTGH 3EA8A 1JMOH 1ZGVA 3GCHC 3BTWE 2UUFB 2F9NA 2QYIA 4X1SU 3SV8A 1CSOE 2PKAB 1OX1A 1CA8B 3FO8D 1UCYH 1DOJA 2ZHWH 1GI5A 1E37B 1KXFA 5EU8A 4AB9A 1MTNB 3SHCH 1LMWB 4F55A 2ZU3A 3BTHE 3KN2A 2GV7A 4BAMB 1C9TA 2GDEH 1F0TA 1GPZA 2A5IA 1PQ5A 4AORA 3TJNA 2Z3CA 1GWAA 2R0KA 4LOYH 2BDHA 4HZHA 3OEHD 3EE0B 2QF3A 1JIRA 2WPJS 1SGNE 3ZZDA 4ZMAH 2QE7D 1O3GA 1Z8RA 4GCHG 2QXGA 1GHAG 2PKAA 1QBNA 1AMHA 2AMQA 2GDDA 2WPLS 3MH4A 3HK3B 2FI4E 1GVZA 1O2YA 3F9EA 1ZJKA 1Y5UT 3L33A 2M5TA 4ZH8A 2F9VA 1D3PB 1TRYA 2SGDE 2BDIA 3UIRA 1CGHA 3SHAH 1EJNA 4GCHF 1GHAF 3HK6B 4DW2U 2DE9A 1GI2A 5FCKA 5FPSA 2ODPA 2PFEA 4CH2B 1ACBE 2STBE 3GICB 3V7TA 3TGJE 1C5UA 1LHGH 4U30A 1IQIA 1FI8A 3GY2A 2AFQB 2VVVA 7ESTE 2P3TB 2BXTH 4IBLH 2Z9GA 4ISIH 1CT0E 1HV7A 2ALVA 4KTCA 1WU1A 1BTHH 4J1YA 1IQEA 1SGIB 4NA9H 1HIAB 4NA8A 3ZVBA 2IPHA 5A0CA 2NU3E 4KELA 4AFQA 3PROA 4Q2KA 1ZPBA 1Y8TA 3ENSB 3OSYA 1CHOF 1O3HA 2RG3A 1EQ9A 2JH5D 3NUMA 2XNIA 1UVSH 5GDSH 4I31A 1MTUA 1ZRBA 1K9OE 3SU6A 3RXTA 4UFEH 5I46H 1P06A 1GBDA 2HGTH 4ISLA 3WY8A 2NU4E 2BYAX 3G01A 1CVWH 2EA3A 3R3GB 3LGTA 2ZTXA 1ARCA 1ESTA 1GHWH 3URDA 3VXFH 4NWLA 1AD8H 3FP8E 2HNTE 2PR3A 1GDUA 1LPGB 1LHDH 5A8YA 1J15A 2BXUH 2BX4A 5DSFA 1W0ZU 1HXFH 3S7HB 1GJAB 2HNTF 1PQAA 2B8OH 3IWMA 4WMFA 1QIXB 1E38B 3BTTE 1TWXB 3BSQA 4F49A 5DP3A 2AHME 1B5GH 2XXLA 3QN7A 2ODQA 1AE5A 4X1NU 1ZPZA 3W94A 2W26A 2ESTE 3M35A 4JCNA 2Y7XA 5EQQA 5JB9S 2Y5GA 2ZIQH 1W0YH 3BEUA 3AW1A 1XUKA 3A85A 4HI3A 1TIOA 5DP4A 3GCTG 5DP9A 1BRBE 2SGQE 3GCHB 1HAYB 4DGJA 4FUCA 4CRCA 1AKSA 1WOFA 2WV4A 2BY8X 1F5KU 1SGYE 3VB4A 1THRH 2GD4B 3UFAA 1GJ4H 1CQQA 3MI4A 1T32A 4ZKOU 2VNTA 5E0JA 4YOGA 2FOBA 3Q3XA 4HFPB 4CHAC 5C3NA 3BG4C 3F2HA 2LPRA 2XCFA 5DP6A 1HYLA 1HAIH 1O30A 4Q7ZA 1O3FA 4MTBA 1FXYA 4H42U 4ABHA 4OS5A 3ZYDA 1AHTH 1GI7B 3GCOA 4X2YA 1VZQH 5DP8A 1YCPH 3SNEA 1TPAE 1C5NH 2ZQ1A 2CXVA 4JK5A 1W10U 1RJXB 2GTBA 2LNCA 1FDPA 4Y8YA 1GI3A 4Z1MD 3T28A 2ZFRH 1VITG 1C4V2 1GBHA 1T7CA 5L30H 1TMUH 1YPGH 5E2OA 2CMYA 3FFGA 3H09A 1P11E 2VGCC 4HGCA 3KIDU 2GCHG 3VB5A 2ANWA 3FAOA 2F83A 1WUNH 3SU1A 1MD8A 1QHRB 3EA7A 3GDSA 2HLDD 2ODYB 3E16B 3MNBA 5GPIB 1AN1E 1HXEH 2FOGA 1NRPH 2WUCA 3A8DA 3O8BA 1KY9A 1NPMA 2ZFFH 1GBKA 1T8MA 2QGRA 1F7ZA 4WXIA 1FJSA 4XFQA 1O2OA 4KGAA 1NS3A 1A2CH 1NROH 4OS1A 1GI9B 2VIOA 4GHTA 2KR7A 2VJ1A 1G2MA 1BOQA 1D6RA 2BD4A 1DWCH 5GIBA 2IJD1 3LT3A 5JYIA 3VFEA 3WW7A 2ALPA 1P8VC 2R2WU 3A7WA 4IGDA 1UTQA 1IQKA 3TPIZ 2GZ7A 3ATLA 1G32B 2HRVA 2QV1A 1O35A 1ESBA 1K1NA 4ESTE 3SV9A 1ZGIA 3FOAA 4SGAE 1DWEH 4WH8A 4AG2A 1L1NA 4NWKA 1H9IE 2ZZUH 1N8OC 2PGBB 3R0FA 3HATH 2WZQA 3RC4A 3A81A 5EGMA 1C1SA 3OU0A 2Z94A 4BXSA 1KLIH 4HTCH 1NFUA 1BMFD 2SGFE 3E8LA 2ANMH 2B7DH 1ZOMA 3DT0H 4INKA 1TOMH 5T3HA 1EZUC 4H4FA 1GBEA 3VPKA 1AIXH 1Y3VA 4DG4A 1GMHG 3MU1A 2VIVA 1K1MA 3ZVFA 1MKWK 2FI5E 1FAKH 1O2QA 2O8TA 1QTFA 4Y8ZA 1OPHB 2OC8A 4A5TS 3ZZ9A 1DANH 1EJMA 3BEFB 1KTTB 3NRLA 1GGDC 1DT2A 1NO9H 1O5EH 5