3U1JB

Aprotinin bound to dengue virus protease
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
166
structure length
166
Chain Sequence
DVPSPPETQKAELEEGVYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTMPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-bound structures of the dengue virus protease reveal the active conformation
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease subunit NS2B
total genus 34
structure length 166
sequence length 166
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3u1jB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3u1jB01
3STIA 3ODDA 1NRNH 4CRGA 1AI8H 1QIXB 4NSVA 2BY5X 4Y11E 1GBHA 5JPMH 3RLWH 1E0FD 3PMBB 2WYJA 4I32A 1GGDB 2IJD1 3F68H 3UR9A 4RI0A 1QA7A 1CHOF 2B5TB 3MO3A 5FPSA 1TALA 1ELDE 2ZDKA 1HYLA 2ZO3H 3SU3A 2ZGJA 4I8HA 5GXPA 1YPMH 1XXFA 5C5NA 2FX6A 1CA0C 3TU7H 4A7IB 2A5KA 1ESTA 2ZECA 4AFQA 1Y5AT 5T6FA 3GYLB 1C4V2 3B23B 8LPRA 3O8BA 3GCHC 2XBYA 3M3TA 1BJUA 5C67A 1LHCH 1Y3VA 2H1UA 2ODPA 4D7GA 5JBCS 3K6YA 3F9HA 1A61H 1C1VH 1DWEH 2BX3A 1GGDC 1D3DB 4ABGA 4DCDA 4X6MA 5C1XA 3FANA 1FPCH 2GZ9A 2HPQH 2BVSH 3QGNB 2TIOA 3R3GB 3K9XB 1CBWB 1O5FH 4BTUB 2ZU4A 4X2XA 2ZFTA 1ZTLA 4INLA 1O30A 4B2CA 1ABIH 4GLYA 3W94A 6GCHF 1P02A 1UCYK 3MH7A 1EPTA 2QF0A 1TMTH 1LVOA 3U9AH 3EA8A 3KN2A 1AHTH 2SNWA 2ZGXH 4YO9A 1UHBB 1ZHPA 1VCQA 2GP9B 3VB5A 4MQAA 3GOVB 2XWBI 3H09A 3SU1A 1C5MD 2ANWA 4TY7A 2D2DA 2FZZA 2IPHA 2ZHFH 3RXTA 1BITA 1ELAA 2VIWA 4TWYA 3P95A 2Y80A 1P3EA 1Y5UT 3TNTA 1A0JA 1JOUB 2V0BA 3SJKA 4B73A 2XTTB 5EW2H 7GCHF 3LH1A 3ZVEA 5BRRE 2SGEE 1UK4A 1ESAA 5EG4A 1ZHMA 1CHGA 1MU8B 1VGCB 2J94A 3MU4A 4AX9H 1J14A 3MWIU 2ZTYA 4FUJA 2A0QB 1GMDG 4CREA 1GBAA 1UTNA 1ANDA 3TJUA 1U6QA 3ELAH 4AB9A 4GPGA 1SGEE 3RXUA 2BVXH 1TLDA 1GI3A 1MQ5A 3SUGA 1OP8A 1JXPA 4I8KA 4U2WA 1P10A 5EU8A 1GVZA 2QF3A 3RXLA 3BIUH 1W13U 1HAPH 5EPNA 2ODQA 4WH6A 1GBCA 1P2NA 3U98H 1DFPA 2IN2A 1D3QB 1K1IA 1W7GH 2G81E 1NZQH 1MAXA 3MI4A 4UEHH 2FLBH 4ABJA 1HUTH 2Y5FA 2KAIA 1MCTA 1RGQA 2GCTB 4NFEA 4WXIA 2W3KA 1PJPA 2FI5E 1T8MA 2D8WA 1A46H 1HAGE 3URDA 2XNIA 2FYQA 3NK8A 2B7DH 2BDCA 3SQEE 1GPZA 4E7NA 1D3TB 1EOJA 1ZRKA 4M7GA 1YBWA 1GBIA 3P8OA 3PMHB 2V35A 1QNJA 2R9PA 4K1EA 4A92A 2BD5A 1DVAH 1CA8B 3LGYA 3TIUA 1G2MA 5F8TA 1SLUB 1TGCA 2PKSC 1FJSA 4LOYH 3ENSB 3HATH 1J16A 1HBTH 5A8YA 1PQ7A 5TCAA 4H42U 4U01A 2FEQH 1DY9A 3SJOA 1THSH 3ZVBA 1TPSA 2F9NA 2FI4E 1MZAA 2JETB 1XUKA 1F0TA 2GMTB 3MH4A 1P11E 2AIPA 1HGTH 2XWAA 1O2QA 3SUDA 4Y71A 4AB8A 3MNBA 1HFDA 4X1NU 4GHTA 1UVTH 1W7XH 4ZROA 1HNEE 2H9TH 4NIWA 1RD3B 1L1JA 1V3XA 1BMLA 1T31A 1ZMNA 1UCYE 1NFUA 8KME2 3SU5A 2BLWA 4Y7AA 5I46H 3RM2H 4JZIA 3TJVA 1K28D 2CF9H 3BTME 4HI3A 3SN8A 1GMHF 1CGHA 1PYTC 4Y8XA 2EC9H 4ISLA 4F4OC 2A7HA 3M3VA 2BD3A 3PTBA 1QRWA 4X1PU 3HK3B 2SGPE 2BDBA 1NFWA 2ZWLH 1ANBA 1UTLM 1ZPBA 4Q7XA 3ZYEA 1ELBA 2FOHA 3AW1A 1IHTH 2UUKB 1O2IA 2AGGX 3TK9A 2OC0A 3Q3XA 1BRCE 4YOGA 1W11U 4ZHLU 1L1GA 3SV7A 4Q7ZA 1FN8A 1K2I1 1ZOMA 4HFPB 1P03A 1H9IE 1OWKA 3QZRA 1RRKA 3RM0H 3SZNA 1ZJDA 1V2OT 1G9IE 1PPGE 3QZQA 1NRSH 3A7YA 4K69A 5LPRA 1BRBE 1GI9B 1O35A 3RXEA 1T8LA 2WPHS 1EAIA 1ETRH 2F9VA 1SSXA 2BHGA 3A8BA 3OTJE 4LZ4B 3M7QA 1BTWA 1AUTC 1CSOE 2AFQB 4JZEH 3ATMA 4X2VA 2OINA 2WINI 4DG4A 3HKJB 1DDJA 1NM6A 1TONA 2J4IA 1O5DH 1RTKA 1DT2A 4JZDH 1QB1A 1ZSLA 2AS9A 4R8TB 3NWUA 3T2NA 1D3PB 3PO1C 1YM0A 2R2MB 1LHEH 2NU2E 2ZPSA 2ILNA 3SUFA 2FWWA 3DFLA 5AVDA 2W3IA 3SORA 1SGDE 1HAYB 3L6PA 2ZDLA 1BB0B 3KF2A 4JK6A 2OQUA 1TGNA 4ZAEA 4WVPE 1G3CA 3KCGH 4LZ1H 1EZXC 4VGCC 1OWEA 2K1QA 2XW9A 3UNQA 1ELEE 5GJ4B 3OTPA 1DPOA 4NWKA 3FVFB 1T7CA 2ZTZA 2QAAA 3TPIZ 4ZXXH 3LPRA 1W0ZU 3A7XA 2BXUH 1BT7A 1GCDA 3RXDA 5GWZA 1ANEA 2Y5GA 3GY6A 3TH3H 4E06H 1XXDA 1V2NT 2H6MA 3MOCA 1OS8A 3AAVA 3DUXH 1O2NA 3UFAA 5HXFA 1V2JT 4XE4A 2BYAX 1O39A 5C1YA 1IQGA 1EUFA 3BEUA 4XSKU 2PV9B 3SW2B 1BZXE 1CO7E 2A5AA 2BD4A 1D4PB 1W10U 3GY2A 4ISIH 5E2PA 1NROH 4OGXA 1VGCC 3U69H 2H5CA 2GVFA 1XKAC 2VWMA 1B5GH 1PYTD 1EASA 2UUJB 2FXRA 2AH4X 1DANH 1KXFA 3EE0B 4AG1A 3S7HB 1MD8A 3SU0A 1G2LA 2FESH 1YPHE 4X8TH 3UR6A 5F8XA 4NIYA 4B76A 3VXEH 4DT7B 1FIWA 2FODA 4CRFA 1GI8B 1DX5M 1IAUA 1QBOA 2Y82A 1S82A 7LPRA 4IMZA 1TNLA 1CA0B 1AD8H 5FAHA 1INCA 4JK5A 2WUCA 3GCOA 1NO9H 3F9EA 1LHGH 2OC8A 3MFJA 2WPLS 1MU6B 1UTMA 1AFQC 2BQ7B 2ZGBH 4UFGH 1O3PB 1UHBA 4D8NA 1KY9A 1C1MA 4H6SB 2ZFSA 1AKSA 1GBLA 1HAVB 2ZCLP 2ZQ2A 1E37B 1WTGH 4CRDA 2ZA5A 2ZHWH 5GDSH 1YPHC 1RFNA 2QV1A 8GCHG 1MKXK 3SGBE 2BD8A 1A5IA 1GI2A 1QRXA 5DP9A 1SBWA 1LPKB 4BNRA 4MPWA 4JMYA 2Q6FA 5EOKA 1TRNA 1JWTA 1T4UH 3L33A 4ZKSU 1BJVA 1KXCA 2BLOA 5E0GA 3ZVDA 1O2SA 4B2AA 1GJ6A 1NPMA 1SGYE 1WXRA 1SGFA 1HJ8A 5L2ZH 3TVJB 4NA9H 2DE9A 2O8WA 1AN1E 3QUMP 1P09A 3A82A 3I77A 1GBTA 2ZKSA 2OQ5A 1HIAB 2C4FH 4WMDA 4TYDA 4WH8A 1H9HE 1C5QA 3IITA 1BTPA 5DG6A 2Q6DA 2GV6A 3ZZ7A 3QTVH 3D65E 5SGAE 2RCEA 1HLTH 1FAXA 1QQUA 1G32B 3EGKH 3PLBA 4NSYA 1SGRE 3SV2H 2HNTF 2VVVA 5GCHF 1L4ZA 1BIOA 2PUQH 5DP7A 1SGTA 4Q2KA 5C2ZA 1C1PA 3RU4T 5J4QA 2JKHA 2BDAA 3RMNH 3P8FA 1O2VA 1DUEA 4K8YA 5TJXA 4NZQA 1O36A 3UNSA 3RMOH 4O3TA 2BLQA 3GDVA 2ZP0H 4WMEA 4GUXA 3UOUA 1TGBA 4CBNA 3RXVA 3H7OA 5TCCA 3SJ9A 3BTEE 1A4WH 2D1JA 3KHVA 2AMDA 1O3KA 3EQ0H 3LGWA 5ETXA 6CHAC 4ABIA 2AYWA 2SGDE 1F5RA 3PROA 2VH0A 3I29A 1O31A 1JIMA 1FPHH 1K9OE 1XUJA 4UE7H 4FU7A 4J2YB 3PWCA 1IQJA 1UCYH 5CE1A 4KTUA 4ZMAH 3A7VA 1LPGB 3LGUA 1Z7KA 1KDQA 3EA9A 1TOCB 3E91A 1SI5H 3S0NA 1HV7A 4YESB 2VBCA 1L1NA 5CHAC 3HPTB 2WPIS 4FVBA 1O3GA 2BY8X 4ISHH 1THRH 3EAJA 3A7ZA 3TGKE 3BTDE 1OWDA 1XVMA 3E0PB 1GJ8B 1BRAA 2R2WU 2XC0A 1N8OC 3SV9A 2QYIA 3ZZ3A 3MU0A 2WUBA 1MQ6A 2JH5D 2FTLE 2EI6A 5L30H 3PWBA 1RS0A 4MNWA 4CRBA 4MPUA 2GCHG 1BBRE 5FX5A 4GCHG 2J95A 1EPTC 3V3MA 1PQAA 5DKMA 3T5FH 3SI3H 1TIOA 3RXSA 1HXFH 2WHXA 3ATLA 2OBQA 1S83A 1TQ7B 2VNTA 3MTYA 1O2KA 2Z9KA 1OOKB 1MCVA 4H4FA 3ATIA 4OGYA 2GT7A 3BEFB 2D26C 4JZ1A 1C1SA 4MNYA 3LGIA 1SPJA 2PHBA 1IOEA 3VB6A 1JRTA 1VITG 1M9UA 1BTUA 5DP6A 5GCHG 3BTHE 3MYWA 1AE5A 3A85A 3GCTF 1TE0A 1FY1A 2ZTXA 1NFYA 3ZZDA 1ARCA 3S9CA 1GHBG 2J34A 1QCPA 3VXFH 2TGDA 2A31A 3BTTE 1CQQA 4NCYA 1P3CA 1WBGB 4X1RU 1L0ZA 4ZKOU 4IGDA 3NCLA 2ANYA 1EAUA 2XCNA 1CT0E 2OCVB 2PGQB 3SNAA 2VIDA 4X8UH 2LNCA 3BF6H 4VGCB 4CBOA 3Q00A 1QTFA 2Z9GA 1L2EA 3LGTA 2J2UA 4YT6H 4CRAA 1V2VT 4X6PA 5ABWA 1O2UA 4K1TA 3ITIA 1BTYA 1P0SH 2Y7ZA 3U8OH 3MH5A 2NU0E 3H7TA 3F9GA 3A8AA 1P9UA 3PV4A 2DE8A 4BAQB 1GDUA 3E3TA 2BQ6B 2JH6D 3HKIB 2UUYA 3MMGA 2ANMH 3MU5A 1KXDA 2AGIX 4MDSA 1ZLRA 3QK1A 1GJ9B 1O2OA 4SGAE 1TGSZ 1ANCA 1C2HA 4LXBH 1C4Y2 2BOKA 3A89A 2VGCB 2HOBA 1TA6A 3KQBA 2ESTE 5HYOA 3O8DA 5A8ZA 3RMLH 1HAXB 2W26A 1HRTH 3DFJA 3V13A 1VJAU 4XOJA 3A7WA 3K2UA 5I25A 1C2DA 2ZG0H 4TWWA 4A1TA 1GBMA 4BXWA 3ZZ5A 1ZMLA 4UONA 1AY6H 1HIAA 1AB9B 1W8BH 1TBQH 2F9OA 2BD2A 3KIDU 2FDAA 3VB4A 1XMNB 3P6ZB 2BXTH 3EDXB 3RXFA 5ESBA 1BBRH 1IQIA 4ZXYH 3QX5H 2GGVB 3Q76A 1FMGA 1JRSA 1E38B 2AIQA 1NFXA 1MKWK 3VB7A 4K1SA 2ZHQH 1Z6EA 1ZMJA 1PQ8A 3GY5A 1TNJA 1DXWA 1YPLH 2OC1A 2FP7B 2R0KA 1QJ1B 1FAKH 2A7CA 1MTVA 2BLVA 5LPEA 1D6WA 4R0IA 2NU3E 4ABBA 5ESTE 1LHFH 1QL9A 1MTWA 3SU4A 4OS6A 1FDPA 3A81A 3BG4C 3TLOA 3PYHA 1C9PA 4JZFH 1GCTB 6LPRA 3MNXA 3HGPA 4B6FA 1O2JA 3TGIE 4XFQA 5C5OA 7KMEH 4ZKNU 5F6MA 2Z3EA 4Z6AH 2GD4B 4FUHA 2Z9IA 3MH6A 1J9CH 1C2GA 4FUDA 3HK6B 1C9TA 2Z7FE 1BTZA 2JH0D 2WPJS 4AFZA 1TGTA 2P94A 4HZHA 2C8XB 2G00A 4UFFH 5LH8A 3ZV8A 4FVDA 2OTVA 1YYY1 2AGEX 2SNVA 1GJAB 1H4WA 4NWLA 1O0DH 1C5YB 1MBQA 2O8UA 1HAVA 4CH8B 1SGNE 1L4DA 1GI5A 4X6NA 4BTIB 5HMAA 1YC0A 1MMJN 1P8VC 1W3CA 3ZV9A 1SHHB 1HAOH 1SFQB 1O5CB 2UWPA 1TB6H 1RXPA 4B6EA 3M7TA 1O38A 3ZYDA 3B8JA 3S7KB 2NU4E 3FP7E 3QN7A 2XYAA 2R3UA 2BY7X 3M5OA 4ISNA 3VFEA 1V2PT 2CHAC 3RXCA 1QURH 2G4TA 2GT8A 2ZPRA 3RC6A 3S69A 2BD7A 2PW8H 1AB9C 1TNHA 2C3SA 1C1TA 1O32A 3PMJA 4ZHAA 1EOLA 4F49A 4K60A 1K1NA 1GI0A 1CE5A 1Y59T 4MLFB 1QR3E 3RXPA 3SV8A 1BCUH 3DD2H 1UTQA 2HGTH 2FOFA 2V3HH 4GCHF 3RXBA 1GVLA 2PR3A 4Q80A 1ELTA 1LKAA 2H9HA 2ZHDA 1NESE 1O3DA 2F83A 2VB0A 3RLYH 3D23A 1GHAG 5FX6A 3ATWA 4I8LA 1V6DA 1WV7H 1V2RT 1TBZH 4U30A 1C5SA 1TOMH 2XBWA 5T6GA 1ZPCA 1SMFE 3SUEA 3TJOA 1N6XA 2QXHA 5CMXH 3VB3A 1N8OB 4NA8A 2BZAA 4H6TA 2STBE 2ZDVH 1WUNH 2TGTA 2WPMS 1PPBH 1O2LA 1PPEE 1YCPH 2YNAA 2A4GA 3KGPA 1O3MA 4ZH8A 2EI8A 1DSTA 3LH3A 3Q77A 4CR5A 1S6FA 4ZUHA 3RXQA 2GCHF 1O2WA 4CHAC 1O2PA 1TAWA 1WQVH 1OSSA 2FMJA 1BRUP 1C5ZB 2PKAA 3ZZCA 2UWLA 1XUGA 1AWHB 1F7ZA 4NZLA 2XRCA 3BV9B 1WSSH 1EJAA 2ZQ1A 3RXMA 1GHZA 1Z8GA 1GI6A 1GHWH 2OC7A 2OK5A 4DOQA 1Q2WA 3VGCB 2BM2A 1ZRBA 1LTOA 3U8TH 1V2LT 5L6NH 1SLWB 2IJOB 1FNIA 4Y8YA 2WV9A 3OSYA 4AYVB 4FU9A 8ESTE 2VWLA 1A0HB 3FFGA 2QXJA 4DJZB 2CMYA 3SOSA 3UREA 1B0EA 3LONA 1WYKA 3TK5A 2FOMB 1AVWA 4HTCH 2P3UB 1O5GH 3RXKA 1TABE 3E90B 4O03A 1TRMA 3BN9A 3GY7A 1RIWC 3LDXH 1NT1A 1Z8RA 1AQ7A 1XUIA 4ABDA 1P2QA 2FO9A 2BY9X 4JYTA 1KTSB 1H8IH 3TH4H 1LDTT 1PPFE 3RC4A 2ASUB 5A0AE 1P2JA 1DS2E 4AORA 3U1IB 5T1VA 1FI8A 3FAOA 4XBCA 1X7AC 1Y3WA 4Y6DA 1BA8B 1ELFA 4OM9A 2J92A 3EA7A 4IW4E 4YOJA 1GJ5H 1W2KH 2VVUA 4GHQA 1G30B 1GDQA 1F5LA 2H9EH 3PLPA 2ZFRH 1SGFG 3Q3YA 1SR5C 1HCGA 2ZFFH 1WCZA 5A8XA 1ZYOA 1H1BA 2OP9A 1C2JA 3TGJE 2UUFB 2Q6GA 1MTSA 1BQYA 1WAYB 2WZQA 1QA0A 1Y3YA 1GMCG 4OS4A 1RTFB 3FP6E 3SZEA 2P8OB 4BAOB 2ZCHP 3RC5A 2THFB 3UQVA 1C2EA 3MNCA 4I33A 1GMDF 1NU7B 1K1OA 4J1YA 4FUGA 5DPAA 2Z6BD 3LC3A 3NUMA 2CXVA 4X6OA 1CGIE 1O3AA 4D7FA 4B71A 1FZZA 1Q3XA 3PV2A 1E36B 1V2KT 1KXEA 1O2TA 3GICB 1G3DA 3UWJH 2AEIH 2Y7XA 3MU8A 4I31A 5E2OA 4XBBA 4AGKA 4DGJA 3SNDA 2BY6X 1SQTA 5EXNA 2HPPH 1CU1A 4KELA 1A5HA 1AGJA 3MU1A 2G5NA 1P04A 1YLCA 5FPYA 1EP5A 1N1LA 4Y7BA 4Y79A 4MTBA 1W12U 1YCPM 5DP4A 2BD9A 3U8RH 4TPIZ 2EA3A 1UVPA 1JBUH 7ESTE 2WPKS 1SGCA 1PPCE 2SGFE 5DGJA 2SGAA 1ZPZA 3BTGE 3L3TA 4AZ2B 1O3JA 2FS8A 4OS1A 3A80A 4CHAB 1ESBA 3LU9B 2J38A 2SFAA 3M61U 6ESTA 4INHA 3T26A 2VIQA 1CT2E 1LO6A 1ZJKA 1W0YH 1FV9A 3RDZA 2KAIB 1GVKB 1P12E 2ZU2A 1V2MT 1DWBH 2PKAB 1ETTH 4FXGH 1C2LA 3M5MA 4BANB 1AZZA 5L2YH 3RXGA 1ZHRA 4RN6A 4KTSA 3QGJA 3QWCH 4CR9A 4IN1A 3V12A 2FOGA 1AWFH 1YPEH 1NU9A 5G4BA 1LPZB 1FY4A 4Y0ZE 1O2HA 4GAWA 5EQRA 3GDUA 1SLXB 1GJ7B 1VITH 1Y8TA 1O5AB 2OLGA 3AVZA 2V3OH 1FONA 1LQEA 1O3CA 2ZCKP 2QIQA 2ZZUH 3BTWE 4ASHA 3KQDA 5GIBA 1P2OA 1SGPE 1NC6A 1P57B 2QY0B 3KL6A 1NRRH 3OY6U 1MAYA 1QFKH 2G5VA 5K7RA 1K1MA 1VZQH 1ZZZA 1GJDB 2FM2A 1LVYA 1XKBC 2J9NA 4XBDA 1ELCA 4KP0A 2GX4A 3G01A 2VINA 2BDGA 4DIIH 5HGGA 2PWXA 1G37A 1DWCH 1TPOA 1OWHA 1F0SA 4JYUH 4D76A 3BIVH 1YCPK 1F2SE 1GHAF 1KDQB 1EKBB 1VJ9U 2AMQA 2O8TA 1W14U 4FUFA 3SYJA 4DURA 2R0LA 5E8EH 1QBNA 1DLEA 1UK3A 2GDDA 1GHXH 3V7TA 4QT8C 1MD7A 1IQKA 3FP8E 2R3YA 1AVGH 4DY7B 4E7RG 2RA0A 1VR1H 4LK4A 1IQEA 3WY8A 3LOXA 3JZ1B 1G36A 2F9PA 4K8BA 1A7SA 5HM2A 2ZGHA 1IQMA 1HJAB 4YTAA 3M7UA 5T6DA 4D9QA 4I8GA 1QB9A 2A2XH 2CV3A 4WF8A 1O3HA 4IMQA 1QRZA 2HNTC 1TPAE 3SV6A 1GHBF 4WMFA 1C2KA 2FYRA 2I6SA 2A7JA 4NFFA 3ZZAA 3SU2A 2VU8E 1DUAA 1HJ9A 2IOTA 1QGFA 4WJG2 1O2MA 2Y81A 3F9FA 2BQWB 1C5UA 2G51A 3UQOA 1O2ZA 1KTTB 3S9AA 2M5TA 1CVWH 3T25A 1C5VA 4UFEH 1A1RA 4AGJA 1F5KU 1EP6A 4UDWH 1O2RA 2ZEBA 1LVBA 3SJ8A 5C20A 5FHTA 1BTXA 2P59A 1Z8JB 5FBEA 3I78A 1C5PA 1XX9A 1O3LA 5AFZH 4DW2U 4FUBA 2I6QA 1F0RA 4U32A 5JBAS 1J17T 2ZFPH 1V2WT 1S85A 1KXBA 4MNXA 2YOLA 1AMHA 1GHVH 1P2IA 1EZSC 2BDIA 2BOHB 4KTCA 2O8MA 2H5DA 1EJNA 2PSXA 2HVXA 3OU0A 1O5BB 1AFQB 4AYYB 2AERH 1G3BA 1V2QT 1SVPA 4WXVA 2C93B 3V0XA 3FZDA 2ZDNA 1AKSB 5FXLA 3SHCH 3QO6A 1TMBH 1GBBA 2ZGCA 4THNH 2A2QH 1OYQA 3K6ZA 1TFXA 3UOPA 5B6LA 3U1JB 1KLTA 2BVRH 4BAMB 1OP0A 3PB1E 2VWNA 1FQ3A 1AU8A 4B1TA 3RXAA 4Y0YE 3PTNA 2OD3B 1Y5BT 3AAUA 2ODYB 1K1PA 1NRQH 4FUEA 3ODFA 5DP3A 1GI4A 1O3EA 4JCNA 1T8NA 1OKXA 1SLVB 3UTUH 2XBVA 1CGJE 1C5RA 1V2TT 3F6UH 4IC6A 1GI1A 3STJA 1BTHH 1S0QA 2GCTC 1LQDB 1MTNB 3GCNA 5EPYA 2F4LA 2XBXA 4JYVH 3P92A 5J4SA 1OXGA 1UVUH 1C5OH 1FUJA 1RTLA 4E05H 5EQSA 1O2XA 7GCHG 3BTQE 2XC5A 2TRMA 1P01A 2ZU3A 1Y3UA 3A8DA 1EJMA 3UWIA 2PLXA 2PTCE 1FLEE 1AZ8A 2A4OA 5GPIB 4Z0KA 1ARBA 3A8CA 4D9RA 1ORFA 2H2ZA 1O37A 1KXAA 3SHAH 1YF4A 1UVOA 1DXPA 4BTTB 4I8JA 1MTUA 3BSQA 4FUIA 3SGQE 2C8YB 3RMMH 1OWIA 2TGPZ 4A1XA 3H5CB 5C3NA 1GBFA 4ABAA 2ZDMA 1AE8H 1TNIA 2QXGA 4X0WU 1DY8A 4A1VA 1SGQE 4GVUA 1EZUC 1ACBE 1F0UA 5JB8S 2VJ1A 3KQEA 2ANKH 3IG6B 2GV7A 1KLIH 5JBTA 2XXLA 1XUHA 1TWXB 1XUFA 2FLRH 2ULLA 4TY6A 1O3IA 3T62A 1EXFA 1YKTA 1ETSH 1ABJH 6GCHG 4INKA 3LJOA 1ELVA 1MH0A 2F3CE 4SGBE 3MO6A 4Q7YA 3NZIA 3KNXA 2OUAA 1NS3A 3KQCA 5FPTA 2WYGA 2G4UA 2ZHEH 2W5EA 4ABEA 2FX4A 3ZVFA 3F1SB 2FOEA 3M5LA 4Y8ZA 1D9IA 1GBKA 1QQ4A 2QC2A 2RG3A 5A09A 5EODA 1BMAA 5DK1A 1QJ6B 4MPXA 5AHGH 1WQSA 2PTNA 3ZZ4A 1CT4E 1DOJA 2B0FA 4DVAU 1UO6A 2CN0H 1NTPA 3BG4B 2FOCA 1QJ7B 1SOZA 5DP8A 1TNKA 3D62A 3NPSA 2VWOA 3A87A 4BXSA 3BTKE 1CBWC 2ZIQH 1J8AA 5DP5A 3LKWA 4B75A 2GKVE 4ABHA 2G52A 3AW0A 4NGAH 4RSPA 1KLJH 1Q31A 4UFDH 1GWAA 1EATA 3LGVA 1GBEA 1OX1A 2Z9JA 2QCYA 5EGMA 5K0HA 3ZZ8A 1D6RA 1O3FA 2GZ7A 1LHDH 1AVXA 4RKJB 4DIHH 3VEQB 1ZTJA 1E34B 2BB4A 1QL7A 3GCHB 3LIWA 1GMHG 1AFEH 3T28A 2WV5A 3UPEA 2ALPA 2UWOA 4BAHB 1ZSKA 4X8SH 1HPGA 2JETC 4OS5A 3PO1B 1WU1A 3TITA 1RJXB 4Y10E 2W7UA 1N6YA 4O97A 4ESTE 2TGAA 4B74A 1BDAA 1LMWB 3AK5A 1IQLA 2C90B 3P70B 1HAZB 1OYTH 2HLCA 3RXRA 4YT7H 4OS7A 3M37A 1HAHH 1T32A 1P9SA 2FIRH 2LPRA 1Y3XA 5PTPA 1UTJA 1BOQA 3TH2H 5CHAB 1QHRB 4K2YA 1BBRK 4BOHA 1C5LH 2PKSB 4X1QU 3D49H 1THPB 2Z3CA 4NG9H 4IS5A 2XCFA 3M5NA 2G8TA 1C1OA 4X2YA 5C1UA 5JDUB 1GBDA 3MO9A 5FBIA 1K22H 1O2GH 1TX8A 1LKBA 4X1SU 1O33A 2BMGB 3ZZBA 1XM1A 1G3EA 1EZQA 2Y5HA 1YPGH 3AASA 1EQ9A 1A2CH 2FTMA 5EW1H 3LJJA 3MNSA 2BZ6H 3OX7U 1ZTKA 1O2YA 3PMAB 1TRYA 3ZVGA 2W7SA 1IQFA 1DM4B 1K21H 1SB1H 1VCWA 3SNCA 1TA2A 4A6LA 1S81A 4MG3A 3UIRA 3SBKA 1MTNC 1IQNA 1HDTH 3N7OA 4KKDA 4YZUA 3SQHE 3DA9B 1TNGA 3JZ2B 1QB6A 3BTFE 2ALVA 5F8ZA 3QTOH 1B7XB 3BG8A 1AO5A 1DITH 1GJCB 3RU4E 1TX6A 1O34A 5EXLA 1VCPA 4YLQH 1A3EH 1C1WH 1O3NA 2CF8H 4FU8A 2P3TB 3RXOA 1C2IA 4NIVA 2O9QA 4Y76A 4AOQA 4PROA 3QLPH 1GDNA 3W95A 1QY6A 3RU4D 1FXYA 1MZDA 1QL8A 1DLKB 2PUXB 1DICA 1GJBB 3SGAE 4X8VH 4KGAA 2NU1E 3TK6A 5A2MH 1H8DH 2EEKA 4ISOA 2AMPA 3GY8A 3OYPA 1OWJA 2CHAB 1YP9A 5A0BA 3DHKH 1C1RA 4ABFA 1EPTB 4XDEA 3A84A 4HGCA 3TNSA 3E1XB 3OY5U 2P93A 1K1LA 3M36A 3URCA 3LT3A 3SNEA 3DT0H 2ZU5A 1T4VH 1A5GH 1ZGIA 2FPZA 3GYMA 2QXIA 4IN2A 1UVSH 1SHYA 4AFSA 4TPYA 1S84A 2HNTE 3P17H 2C8WB 1EB2A 1MKXH 1C1NA 1GG6C 1T8OA 1UK2A 1GMCF 3A88A 1FIZA 2RDLA 2V6NA 4O9VA 1CHOG 2A45B 3BEIB 3EYDA 1YGCH 3GY4A 3RXHA 1OP2A 3PM3A 1ID5H 1O3OA 2P3FH 1FY5A 5AFYH 1DWDH 3P8NA 2SGQE 3RUOA 2VIPA 1IQHA 2Q1JA 1SFIA 2GMTC 3RXIA 2ZI2H 5FCRA 3QDZB 4A5TS 6CHAB 5JYIA 1HXEH 1Z71A 2CJIA 1C5TA 2ZNKH 1C1QA 2ZU1A 1K1JA 1MKWH 1RIWB 2VVCA 2YNBA 1AIXH 1NY22 2ZF0H 1BHXB 3NXPA 1FY8E 1YPJH 2A4RA 2BDYA 5DO4H 4NA7A 2TBSA 1C5WB 2FOAA 4WWYA 1GI7B 3SO3A 1SOTA 3CENA 2HWLB 2GTBA 3ATKA 2VIOA 3UY9A 1LVMA 1V2ST 1B0FA 2Z3DA 1YPKH 2TPIZ 3ZVAA 5GNDA 3VGCC 2C8ZB 3GY3A 1PPHE 1IHSH 2FOBA 1Z1JA 3C1KA 4YM9A 1WTHD 5B6OA 1ZGVA 3S9BA 4CRCA 1P05A 1S0RA 1S5SA 3SNBA 3ZVCA 3E0NB 2F91A 3PLKA 1BMNH 4ZKRU 3M3SA 5EXMA 1TMUH 1C4U2 5BPEA 5JBBS 3E8LA 1O3BA 3P8GA 1GL1A 1JIRA 3E6PH 1SL3A 4UD9H 1XVOA 9ESTA 4BAKB 3GISB 2QN5T 4CH2B 5E0JA 3B9FH 1A3BH 1BUIA 3T29A 4AG2A 4ZHMU 1KYNA 5IDKA 2HALA 1C2MA 3CS0A 2ZC9H 5E0HA 1DE7H 1DSUA 4MPVA 1PPZA 1C5XB 3IWMA 1SQOA 3SI4H 1SQAA 4MVNA 1C1UH 4MNVA 4IC5A 3VPKA 4M9FA 4K5ZA 1KSNA 1C5NH 2A5IA 1EB1H 5JB9S 3T27A 5FCKA 2A1DB 2PGBB 3RP2A 2GZ8A 3UNRA 1H9LB 1ZR0A 3A7TA 1V2UT 5AF9H 1SC8U 1PQ5A 2EI7A 2OBOA 1YLDA 1ELGA 1UTPA 3LC5A 1GL0E 2STAE 3ZZ9A 1NN6A 3TJNA 1UMAH 3Q3KA 3RXJA 2PFEA 1GG6B 1LCYA 1TX7A 1TQ0B 2PSYA 2F9UA 5H4IB 5T3HA 3MHWU 1BMMH 1TBRH 1C2FA 3FZZA 4GSOA 1UTKA 1EAXA 3O8CA 1MUEB 4WY3A 2BTCE 1PFXC 3E16B 4I7YH 1ZSJA 2FS9A 1E35B 4YOIA 1A0LA 8GCHF 1QBVH 2G55A 5EQQA 3C27B 4K3JA 2A32A 1SGIB 1AUJA 1FN6A 1GBJA 4AN7A 1BHXF 2B9LA 3A86A 2P95A 2XC4A 1OPHB 3HGNA 2WV4A 3KEEA 1JMOH 4O3UA 2Z94A 3A83A 4AFUA 1TPPA 2ZDAH 4OS2A 2DUCA 2Z9LA 1TYNA 2VH6A 3GCTG 3PV5A 3ESTA 2Y6TA 1P2KA 2O8LA 5LPFA 2CGAA 1KIGH 1Z8IB 5LGOA 3R0FA 1Z1IA 1VITF 2NWNA 3SJIA 1J15A 1P2MA 1SG8B 2VIVA 3K65B 1GJ4H 2VGCC 2QGRA 3SU6A 1O5EH 1FY3A 2OXSA 2ZPQA 2ZFQH 5IYTA 2BDHA 4X2WA 3CP7A 1UJ1A 1Z6JH 5DJ7A 4NIXA 3GDSA 1WOFA 2RA3A 3O8RA 9LPRA 2FI3E 4YLUA 2BX4A 1S6HA 1EX3A 3UUZA 1F92A 1GCTC 2F9BH 1MBMA 5A0CA 1UTOA 2B8OH 2P8OC 1P06A 2A4QA 5F03A 3CS7A 4IBLH 4RKOB 1NRPH 1HJAC 3ZZ6A 1HAIH 1EAWA 4FUCA 2QA9E 3M35A 5HM9A 2P16A 2HRVA 3NKKA 1GHYH 4B2BA 1HB0B 2GDEH
chains in the Genus database with same CATH superfamily
3STIA 3ODDA 1NRNH 4CRGA 1AI8H 1QIXB 2WPDD 4NSVA 2BY5X 4Y11E 1GBHA 5JPMH 3RLWH 1E0FD 3PMBB 1E79D 2WYJA 2J98B 4I32A 5KECA 1GGDB 2IJD1 3F68H 3UR9A 4RI0A 4YXWD 1QA7A 1CHOF 2B5TB 3MO3A 5FPSA 1TALA 1ELDE 2ZDKA 1HYLA 2ZO3H 3SU3A 2ZGJA 4I8HA 5GXPA 2KCYA 1YPMH 1XXFA 5C5NA 2FX6A 1CA0C 3TU7H 4A7IB 2A5KA 1ESTA 2ZECA 4AFQA 1Y5AT 5T6FA 3GYLB 1C4V2 3B23B 8LPRA 3O8BA 3GCHC 2XBYA 3M3TA 1BJUA 5C67A 1LHCH 1Y3VA 2H1UA 2ODPA 4D7GA 5JBCS 3K6YA 3F9HA 1A61H 1C1VH 1DWEH 2BX3A 1GGDC 1D3DB 4ABGA 4DCDA 4X6MA 5C1XA 3FANA 1FPCH 2GZ9A 2HPQH 2BVSH 3QGNB 2TIOA 3R3GB 3K9XB 1CBWB 1O5FH 4BTUB 2ZU4A 4X2XA 4ZCNA 2ZFTA 1ZTLA 4INLA 1O30A 4B2CA 1ABIH 4GLYA 3W94A 6GCHF 1P02A 1UCYK 3MH7A 1EPTA 2QF0A 1TMTH 1LVOA 3U9AH 5HIYA 3EA8A 3KN2A 1AHTH 2SNWA 2ZGXH 4YO9A 1UHBB 1ZHPA 1VCQA 2GP9B 3VB5A 4MQAA 3GOVB 2XWBI 3H09A 3SU1A 1C5MD 2ANWA 4TY7A 2D2DA 2FZZA 2IPHA 2ZHFH 3RXTA 1BITA 1ELAA 3ZIAD 2VIWA 4TWYA 3P95A 2Y80A 1P3EA 1Y5UT 3OFND 3TNTA 1A0JA 1JOUB 2V0BA 3SJKA 4B73A 2XTTB 5EW2H 7GCHF 3LH1A 3ZVEA 5BRRE 2SGEE 3F2GA 1UK4A 1ESAA 5EG4A 1ZHMA 1CHGA 1MU8B 1VGCB 2J94A 3MU4A 4AX9H 1J14A 3MWIU 2ZTYA 4FUJA 2A0QB 1GMDG 4CREA 1GBAA 1UTNA 1ANDA 3TJUA 1U6QA 3ELAH 4AB9A 4GPGA 1SGEE 3RXUA 2BVXH 1TLDA 1GI3A 1MQ5A 3SUGA 1OP8A 1JXPA 4I8KA 4U2WA 1P10A 5EU8A 1GVZA 2QF3A 3RXLA 3BIUH 3KYFA 1W13U 1HAPH 5EPNA 2ODQA 4WH6A 1GBCA 1P2NA 3U98H 1DFPA 2IN2A 1D3QB 1K1IA 3KYGA 1W7GH 2G81E 1NZQH 1MAXA 3MI4A 4UEHH 2FLBH 4ABJA 2KCAA 1HUTH 2Y5FA 4I86A 2KAIA 5C0TA 1MCTA 1RGQA 2GCTB 4NFEA 4WXIA 3UB0A 2W3KA 1PJPA 2FI5E 1T8MA 2D8WA 1A46H 1HAGE 3URDA 2XNIA 2FYQA 3NK8A 2B7DH 2BDCA 3SQEE 1GPZA 4E7NA 1D3TB 2KZ4A 1EOJA 1ZRKA 4M7GA 1YBWA 1GBIA 3P8OA 3PMHB 2V35A 1QNJA 2R9PA 4K1EA 4A92A 2BD5A 1DVAH 1CA8B 3LGYA 3TIUA 1G2MA 5F8TA 1SLUB 1TGCA 2PKSC 1FJSA 4LOYH 3ENSB 3HATH 1J16A 1HBTH 5A8YA 1PQ7A 5TCAA 4H42U 1QZ8A 4U01A 2FEQH 1DY9A 3SJOA 1THSH 3ZVBA 1TPSA 2F9NA 5KGOA 2FI4E 1MZAA 2JETB 1XUKA 1F0TA 2GMTB 3MH4A 1P11E 2AIPA 1HGTH 2XWAA 1O2QA 3SUDA 4Y71A 4AB8A 3MNBA 1HFDA 4X1NU 4GHTA 1UVTH 1W7XH 4ZROA 1HNEE 1UW7A 2H9TH 3DSPA 4NIWA 1RD3B 1L1JA 1V3XA 1BMLA 1T31A 1ZMNA 1UCYE 1NFUA 8KME2 3SU5A 2BLWA 4Y7AA 5I46H 3RM2H 4JZIA 3TJVA 1K28D 2CF9H 3BTME 4HI3A 3SN8A 1GMHF 1CGHA 2W6JD 1PYTC 4Y8XA 2EC9H 1YY3A 4ISLA 5KEDA 4F4OC 2A7HA 3M3VA 1E1RD 2BD3A 3PRDA 3PTBA 1QRWA 5IK2D 4X1PU 2L74A 3HK3B 2SGPE 2BDBA 1NFWA 2ZWLH 1ANBA 1UTLM 1ZPBA 4Q7XA 3ZYEA 1ELBA 2FOHA 3AW1A 2V7QD 1IHTH 2UUKB 1O2IA 2AGGX 4RT0A 3TK9A 2OC0A 3Q3XA 1BRCE 4YOGA 1W11U 4ZHLU 1L1GA 3SV7A 4Q7ZA 1FN8A 1K2I1 1ZOMA 4HFPB 1P03A 1H9IE 1OWKA 3QZRA 1RRKA 3RM0H 3SZNA 1ZJDA 1V2OT 1G9IE 1PPGE 3QZQA 1NRSH 3A7YA 4K69A 5LPRA 1BRBE 1GI9B 1O35A 3RXEA 1T8LA 2WPHS 1EAIA 1ETRH 2F9VA 1SSXA 2BHGA 3A8BA 3OTJE 4LZ4B 3M7QA 1BTWA 1AUTC 1CSOE 2AFQB 4JZEH 2QF4A 3ATMA 4X2VA 2OINA 2WINI 4DG4A 3HKJB 1DDJA 1NM6A 1TONA 2J4IA 1O5DH 1RTKA 1DT2A 4JZDH 1QB1A 1ZSLA 2AS9A 4R8TB 3NWUA 3T2NA 1D3PB 3PO1C 1YM0A 2R2MB 1LHEH 2NU2E 2ZPSA 2ILNA 3SUFA 2FWWA 1SQRA 3DFLA 5AVDA 2W3IA 3SORA 1SGDE 1HAYB 5HKKD 3L6PA 2ZDLA 1BB0B 3KF2A 3GS9A 4JK6A 2OQUA 1TGNA 4ZAEA 4WVPE 1G3CA 3KCGH 4LZ1H 1EZXC 1S6LA 4VGCC 1OWEA 2K1QA 2XW9A 3UNQA 1ELEE 5GJ4B 3OTPA 1DPOA 4NWKA 3FVFB 1T7CA 2ZTZA 2QAAA 3TPIZ 4ZXXH 3LPRA 1W0ZU 3A7XA 2BXUH 1BT7A 1GCDA 3RXDA 5GWZA 1ANEA 2Y5GA 3GY6A 3TH3H 4E06H 1XXDA 1V2NT 2H6MA 3MOCA 1OS8A 3AAVA 3DUXH 1O2NA 3UFAA 5HXFA 1V2JT 4XE4A 2BYAX 1O39A 5C1YA 1IQGA 1EUFA 3BEUA 4XSKU 2PV9B 3SW2B 1BZXE 1CO7E 2A5AA 2BD4A 1D4PB 1W10U 3GY2A 4ISIH 5E2PA 1NROH 4OGXA 1VGCC 3U69H 2H5CA 2GVFA 1XKAC 2VWMA 1B5GH 1PYTD 1EASA 2UUJB 2FXRA 2AH4X 1DANH 2QE7D 1KXFA 3EE0B 4AG1A 2KCOA 3S7HB 1MD8A 3SU0A 1G2LA 2FESH 1YPHE 4X8TH 3UR6A 5F8XA 4NIYA 4B76A 3VXEH 4DT7B 1FIWA 2FODA 4CRFA 1GI8B 1DX5M 1IAUA 1QBOA 2Y82A 1S82A 3OE7D 7LPRA 4IMZA 1TNLA 1CA0B 1AD8H 5FAHA 1INCA 4JK5A 2WUCA 3GCOA 1NO9H 3F9EA 1LHGH 3F2FA 2OC8A 3MFJA 2WPLS 1MU6B 1UTMA 1AFQC 2BQ7B 2ZGBH 4UFGH 1O3PB 1UHBA 4D8NA 1KY9A 1C1MA 4H6SB 2ZFSA 1AKSA 1GBLA 1HAVB 2ZCLP 2ZQ2A 1E37B 1WTGH 4CRDA 2ZA5A 2ZHWH 5GDSH 1YPHC 3WWFA 1RFNA 2QV1A 8GCHG 1MKXK 3SGBE 2BD8A 1A5IA 1GI2A 1QRXA 5DP9A 5DSFA 1SBWA 1LPKB 4BNRA 4MPWA 4JMYA 2Q6FA 5EOKA 1TRNA 1JWTA 1T4UH 3L33A 4ZKSU 1BJVA 1KXCA 2BLOA 5E0GA 3ZVDA 1O2SA 4B2AA 1GJ6A 1NPMA 3CNRA 1SGYE 1WXRA 1SGFA 1HJ8A 5L2ZH 3TVJB 4NA9H 2DE9A 2O8WA 1AN1E 2LELA 3QUMP 1P09A 3A82A 3I77A 1GBTA 2ZKSA 5DN6D 2OQ5A 1HIAB 2C4FH 4WMDA 4TYDA 4WH8A 1H9HE 1C5QA 3IITA 1BTPA 5DG6A 2Q6DA 2GV6A 3ZZ7A 3QTVH 3D65E 5SGAE 2RCEA 1HLTH 1FAXA 1QQUA 1G32B 3EGKH 3PLBA 4NSYA 1SGRE 3SV2H 2HNTF 2VVVA 5GCHF 1L4ZA 1BIOA 2PUQH 5DP7A 1SGTA 4Q2KA 5C2ZA 1C1PA 3RU4T 5J4QA 2JKHA 2BDAA 3RMNH 3P8FA 1O2VA 1DUEA 4K8YA 5TJXA 4NZQA 1O36A 3UNSA 3RMOH 4O3TA 2BLQA 3GDVA 2ZP0H 4WMEA 4GUXA 3UOUA 1TGBA 4CBNA 3RXVA 3H7OA 5TCCA 3SJ9A 3BTEE 1A4WH 2D1JA 3KHVA 4DT4A 2AMDA 1O3KA 3EQ0H 3LGWA 2IPQX 2RFKC 5ETXA 6CHAC 4ABIA 2AYWA 2SGDE 1F5RA 3PROA 2VH0A 3I29A 1O31A 1JIMA 1FPHH 1K9OE 1XUJA 4UE7H 4FU7A 4J2YB 3PWCA 1IQJA 1UCYH 5CE1A 4KTUA 4ZMAH 3A7VA 1LPGB 2HVYB 3LGUA 1Z7KA 1KDQA 3EA9A 1TOCB 3E91A 1SI5H 3S0NA 1HV7A 4YESB 2VBCA 1L1NA 5CHAC 3HPTB 2WPIS 4FVBA 1O3GA 2BY8X 4ISHH 1THRH 3EAJA 3A7ZA 3TGKE 3BTDE 1OWDA 1XVMA 3E0PB 1GJ8B 1BRAA 2R2WU 2XC0A 1N8OC 3SV9A 2QYIA 3ZZ3A 3MU0A 2WUBA 5C17A 1MQ6A 2JH5D 2FTLE 2YMSC 2EI6A 5L30H 3PWBA 1RS0A 4MNWA 4CRBA 4MPUA 3MQKC 2GCHG 1BBRE 5FX5A 4GCHG 2J95A 1EPTC 3V3MA 1PQAA 5DKMA 3T5FH 3SI3H 1TIOA 3RXSA 1HXFH 2WHXA 3ATLA 2OBQA 4XRNA 1S83A 1TQ7B 2VNTA 3MTYA 1O2KA 2Z9KA 1OOKB 1MCVA 4H4FA 3ATIA 4OGYA 2GT7A 3BEFB 2D26C 4JZ1A 1C1SA 4MNYA 3LGIA 1SPJA 2PHBA 1IOEA 3VB6A 1JRTA 1VITG 1M9UA 1BTUA 5DP6A 5GCHG 3BTHE 3MYWA 1AE5A 3A85A 3GCTF 1TE0A 1FY1A 2ZTXA 1NFYA 3ZZDA 1ARCA 3S9CA 1GHBG 2J34A 1QCPA 3VXFH 2TGDA 2A31A 3BTTE 1CQQA 4NCYA 3U28C 1P3CA 1WBGB 4X1RU 1L0ZA 1OHHD 4IGDA 4ZKOU 3NCLA 2ANYA 1EAUA 2XCNA 1CT0E 2OCVB 2PGQB 3SNAA 2VIDA 4X8UH 2LNCA 3BF6H 4VGCB 4CBOA 3Q00A 1QTFA 2Z9GA 1L2EA 3LGTA 2J2UA 4YT6H 4CRAA 1V2VT 4X6PA 5ABWA 1O2UA 4K1TA 3ITIA 1BTYA 1P0SH 2Y7ZA 3U8OH 3MH5A 2NU0E 3H7TA 3F9GA 3A8AA 1P9UA 2KFWA 3PV4A 2DE8A 4BAQB 1GDUA 3E3TA 2BQ6B 2JH6D 3HKIB 2UUYA 3MMGA 2ANMH 3MU5A 1KXDA 2AGIX 4MDSA 1ZLRA 3QK1A 1GJ9B 1O2OA 4SGAE 1TGSZ 1ANCA 1C2HA 4LXBH 1C4Y2 2BOKA 3A89A 2VGCB 2HOBA 3KQ5A 1TA6A 3KQBA 2ESTE 5HYOA 3O8DA 5A8ZA 3RMLH 1HAXB 2W26A 1HRTH 2EY4C 3DFJA 3V13A 1VJAU 4XOJA 3A7WA 3K2UA 5I25A 1C2DA 2ZG0H 4TWWA 4A1TA 1GBMA 4BXWA 3ZZ5A 1ZMLA 4UONA 1AY6H 1HIAA 1AB9B 1W8BH 1TBQH 2F9OA 2BD2A 3KIDU 2FDAA 3VB4A 1XMNB 2KCPA 3P6ZB 2BXTH 3EDXB 3RXFA 5ESBA 1BBRH 1IQIA 4ZXYH 3QX5H 2GGVB 3Q76A 1FMGA 1JRSA 1E38B 2AIQA 1NFXA 1MKWK 3VB7A 4K1SA 2ZHQH 1Z6EA 1ZMJA 1PQ8A 3GY5A 1TNJA 1DXWA 1YPLH 2OC1A 2FP7B 2R0KA 1QJ1B 1FAKH 2A7CA 1MTVA 2BLVA 5LPEA 1D6WA 4R0IA 2NU3E 4ABBA 5ESTE 1LHFH 1QL9A 1MTWA 3SU4A 4OS6A 1FDPA 3A81A 3BG4C 3TLOA 3PYHA 1C9PA 4JZFH 2KX4A 1GCTB 6LPRA 3MNXA 3HGPA 4B6FA 3F3BA 1O2JA 3TGIE 4XFQA 5C5OA 7KMEH 4ZKNU 5F6MA 2Z3EA 4ACBA 4Z6AH 2GD4B 4FUHA 2YMSD 2Z9IA 3MH6A 1J9CH 1C2GA 4FUDA 3HK6B 1C9TA 2Z7FE 1BTZA 2JH0D 2WPJS 4AFZA 1TGTA 2P94A 4HZHA 2C8XB 2G00A 4UFFH 5LH8A 3ZV8A 4FVDA 2JJ2D 2OTVA 1YYY1 2AGEX 2SNVA 1GJAB 1H4WA 4NWLA 1O0DH 1C5YB 1MBQA 2O8UA 1HAVA 4CH8B 1SGNE 1L4DA 4FETA 1GI5A 4X6NA 4BTIB 5HMAA 1YC0A 1MMJN 3FKSD 1P8VC 1W3CA 3ZV9A 1SHHB 1HAOH 1SFQB 1O5CB 2UWPA 1TB6H 1RXPA 4B6EA 3M7TA 2JIZD 1O38A 3ZYDA 3B8JA 3S7KB 2NU4E 3FP7E 3QN7A 2XYAA 2R3UA 2BY7X 3M5OA 1E1QD 4ISNA 1V2PT 2CHAC 3VG8A 3VFEA 3RXCA 1QURH 2G4TA 2GT8A 2ZPRA 3RC6A 3S69A 2BD7A 2PW8H 1AB9C 1TNHA 2C3SA 1C1TA 1O32A 3PMJA 4ZHAA 1EOLA 4F49A 4K60A 1K1NA 1GI0A 1CE5A 1Y59T 4RT1A 4MLFB 1QR3E 3RXPA 3SV8A 1BCUH 3DD2H 1UTQA 2HGTH 2FOFA 2J5UA 2J97A 2V3HH 4GCHF 3RXBA 1GVLA 2PR3A 4Q80A 1ELTA 1LKAA 2H9HA 2ZHDA 1NESE 1O3DA 2F83A 2VB0A 3RLYH 3D23A 1GHAG 5FX6A 3ATWA 4I8LA 1V6DA 2V3MA 1WV7H 1V2RT 1TBZH 4U30A 1C5SA 1TOMH 3DSGA 2XBWA 5T6GA 1ZPCA 1SMFE 3SUEA 3TJOA 1N6XA 2QXHA 5CMXH 3VB3A 1N8OB 4NA8A 2BZAA 5C0UA 4H6TA 2STBE 2ZDVH 1WUNH 2TGTA 3N99A 2WPMS 1PPBH 1O2LA 1PPEE 1YCPH 2YNAA 2A4GA 3KGPA 1O3MA 4ZH8A 2EI8A 1DSTA 3LH3A 3Q77A 4CR5A 1S6FA 4ZUHA 3RXQA 2GCHF 1O2WA 3WW7A 4CHAC 1O2PA 1TAWA 1WQVH 2KM0A 1OSSA 2FMJA 1BRUP 1C5ZB 2PKAA 3ZZCA 2UWLA 1XUGA 3PRBA 1AWHB 1F7ZA 4NZLA 2XRCA 3N7EA 5C94A 3BV9B 1WSSH 1EJAA 2ZQ1A 3RXMA 1GHZA 1Z8GA 1GI6A 1GHWH 2OC7A 2OK5A 4DOQA 1Q2WA 2LP6A 3VGCB 2BM2A 1ZRBA 1LTOA 3U8TH 1V2LT 5L6NH 1SLWB 2IJOB 1FNIA 4Y8YA 2WV9A 3OSYA 4AYVB 4FU9A 8ESTE 2VWLA 1A0HB 3FFGA 2QXJA 4DJZB 2CMYA 3SOSA 3UREA 1B0EA 3LONA 1WYKA 3TK5A 2FOMB 1AVWA 4HTCH 4AC9A 2P3UB 4Q4LA 1O5GH 3RXKA 1TABE 3E90B 4O03A 1TRMA 3BN9A 3GY7A 1RIWC 3LDXH 1NT1A 1Z8RA 1AQ7A 1XUIA 4ABDA 1P2QA 2FO9A 2BY9X 4JYTA 1KTSB 1H8IH 3TH4H 1LDTT 1PPFE 3RC4A 2ASUB 5A0AE 1P2JA 1DS2E 4AORA 3U1IB 5T1VA 1FI8A 3FAOA 4XBCA 1X7AC 1Y3WA 4OM9A 1BA8B 1ELFA 4Y6DA 2J92A 3EA7A 4IW4E 4YOJA 1GJ5H 1W2KH 2VVUA 4GHQA 1G30B 1GDQA 1F5LA 2H9EH 3PLPA 1H8ED 2ZFRH 1SGFG 3Q3YA 1SR5C 1HCGA 2ZFFH 1WCZA 5A8XA 1ZYOA 3F2HA 1H1BA 2OP9A 1C2JA 3TGJE 2UUFB 2Q6GA 1MTSA 1BQYA 1WAYB 2WZQA 1QA0A 1Y3YA 1GMCG 4OS4A 1RTFB 3FP6E 3SZEA 2P8OB 4BAOB 2ZCHP 3RC5A 2THFB 3UQVA 1C2EA 3MNCA 4I33A 1GMDF 1NU7B 1K1OA 4J1YA 4FUGA 5DPAA 2Z6BD 3LC3A 3NUMA 4ACAA 2CXVA 4X6OA 1CGIE 1O3AA 4D7FA 3PV2A 1FZZA 1Q3XA 4B71A 1E36B 1V2KT 1KXEA 1O2TA 3GICB 1G3DA 3UWJH 4TSFD 2AEIH 2Y7XA 3MU8A 4I31A 5E2OA 4XBBA 4AGKA 4DGJA 3SNDA 2BY6X 1SQTA 5EXNA 2HPPH 1CU1A 4KELA 1A5HA 1AGJA 3MU1A 2G5NA 1P04A 1YLCA 5FPYA 1EP5A 1N1LA 4Y7BA 4Y79A 1EFRD 4MTBA 1W12U 1YCPM 5DP4A 2BD9A 3U8RH 4TPIZ 2EA3A 2JJ1D 1UVPA 1JBUH 7ESTE 2WPKS 1SGCA 1PPCE 2SGFE 5DGJA 2SGAA 1ZPZA 3BTGE 3L3TA 4AZ2B 1O3JA 2FS8A 2XNDD 4OS1A 3A80A 4CHAB 4FOUC 1ESBA 3LU9B 2J38A 2SFAA 3M61U 6ESTA 4INHA 3T26A 2VIQA 1CT2E 1LO6A 1ZJKA 1W0YH 1FV9A 3RDZA 2KAIB 1GVKB 1P12E 2ZU2A 1V2MT 1DWBH 2PKAB 1ETTH 4FXGH 1C2LA 3M5MA 4BANB 1AZZA 5L2YH 3RXGA 1ZHRA 4RN6A 4KTSA 3QGJA 3QWCH 4CR9A 4IN1A 3V12A 2FOGA 1AWFH 1YPEH 1NU9A 5G4BA 1LPZB 1FY4A 4Y0ZE 1O2HA 4GAWA 5EQRA 3GDUA 1SLXB 1GJ7B 1VITH 1Y8TA 1O5AB 2OLGA 3AVZA 2V3OH 1FONA 1LQEA 1O3CA 2ZCKP 2QIQA 2ZZUH 3BTWE 4ASHA 3KQDA 5GIBA 1P2OA 2W6ID 1SGPE 1NC6A 1P57B 2QY0B 3KL6A 1NRRH 3OY6U 1MAYA 1QFKH 2G5VA 5K7RA 1K1MA 2K8IA 1VZQH 1ZZZA 1GJDB 4Z1MD 2FM2A 1LVYA 3FOAA 1XKBC 2J9NA 4XBDA 1ELCA 4KP0A 2GX4A 3G01A 2VINA 5CDFE 2BDGA 4DIIH 4Q63A 5HGGA 2PWXA 1G37A 1DWCH 1TPOA 1OWHA 1F0SA 4JYUH 4D76A 3BIVH 1YCPK 1F2SE 3FO8D 1GHAF 1KDQB 1EKBB 1VJ9U 2AMQA 2O8TA 1W14U 4FUFA 3SYJA 4DURA 2R0LA 5E8EH 1QBNA 1DLEA 1UK3A 2GDDA 1GHXH 3V7TA 4QT8C 1MD7A 4ASUD 1IQKA 3FP8E 2R3YA 1AVGH 4DY7B 4E7RG 2RA0A 1VR1H 4LK4A 1IQEA 4F55A 3WY8A 3LOXA 3JZ1B 1G36A 2F9PA 4K8BA 1A7SA 5HM2A 2ZGHA 1IQMA 1HJAB 4YTAA 3M7UA 5T6DA 5HIZA 4D9QA 4I8GA 1QB9A 2A2XH 2CV3A 4WF8A 1O3HA 4IMQA 1QRZA 2HNTC 1TPAE 3SV6A 1GHBF 4WMFA 1C2KA 1NBME 2FYRA 3OAAD 2I6SA 2A7JA 4NFFA 3ZZAA 3SU2A 2VU8E 1DUAA 1HJ9A 2IOTA 1QGFA 4WJG2 1O2MA 3F0OA 2J98A 2Y81A 3F9FA 2BQWB 1C5UA 2G51A 3UQOA 1O2ZA 1KTTB 3S9AA 2M5TA 1CVWH 3T25A 1C5VA 4UFEH 1A1RA 4AGJA 4XD7D 3N7DA 1F5KU 1EP6A 3DCLA 4UDWH 1O2RA 2ZEBA 3W1EA 1LVBA 3SJ8A 5C20A 5FHTA 1BTXA 2P59A 1Z8JB 2K0QA 5F53A 3I78A 1C5PA 5FBEA 1XX9A 1O3LA 5AFZH 4DW2U 4FUBA 2I6QA 1FX0B 1F0RA 4U32A 5JBAS 1J17T 2ZFPH 1V2WT 1S85A 1KXBA 4MNXA 2YOLA 1AMHA 1GHVH 1P2IA 2YMSB 1EZSC 2BDIA 2BOHB 4KTCA 2O8MA 2H5DA 2XOKD 1EJNA 2PSXA 2HVXA 3OU0A 1O5BB 1AFQB 4AYYB 2AERH 3DSOA 1G3BA 1V2QT 5FL7D 1SVPA 4WXVA 2C93B 3V0XA 3FZDA 2ZDNA 1AKSB 5FXLA 3SHCH 3QO6A 1TMBH 1GBBA 2ZGCA 4THNH 2A2QH 1OYQA 3K6ZA 1TFXA 3UOPA 5B6LA 3U1JB 1KLTA 2BVRH 4BAMB 1OP0A 3PB1E 2VWNA 1FQ3A 1AU8A 4B1TA 3RXAA 4Y0YE 3PTNA 2OD3B 1Y5BT 3AAUA 2ODYB 1K1PA 1NRQH 4FUEA 3ODFA 5DP3A 1GI4A 1O3EA 4JCNA 1WDIA 1T8NA 2F43B 4P00A 1OKXA 1SLVB 3UTUH 2XBVA 1CGJE 1C5RA 1V2TT 3F6UH 1W0JD 4IC6A 1GI1A 1H8HD 3STJA 3UAIC 1BTHH 1S0QA 2GCTC 1LQDB 1MTNB 2F4LA 3GCNA 5EPYA 2XBXA 4JYVH 3P92A 5J4SA 1OXGA 5EJLA 1UVUH 1C5OH 1FUJA 1RTLA 1VKYA 4E05H 5EQSA 1O2XA 7GCHG 3BTQE 2XC5A 2TRMA 1P01A 2ZU3A 1Y3UA 3A8DA 1EJMA 3UWIA 2PLXA 2PTCE 1FLEE 1AZ8A 2A4OA 5GPIB 4Z0KA 1ARBA 3A8CA 4D9RA 1ORFA 2H2ZA 1O37A 1KXAA 3SHAH 1YF4A 1UVOA 1DXPA 4BTTB 4I8JA 1MTUA 3BSQA 1NBMD 4FUIA 3SGQE 2C8YB 3RMMH 1OWIA 3EE7A 2GJGA 2TGPZ 4A1XA 3H5CB 5C3NA 1GBFA 4ABAA 2ZDMA 1AE8H 1TNIA 2QXGA 4X0WU 1DY8A 4A1VA 1SGQE 4GVUA 1EZUC 1ACBE 1F0UA 5JB8S 2VJ1A 3KQEA 2ANKH 3IG6B 2GV7A 1KLIH 5JBTA 2XXLA 1XUHA 1TWXB 1XUFA 2FLRH 2ULLA 4TY6A 1O3IA 3T62A 1EXFA 1YKTA 1ETSH 1ABJH 6GCHG 4INKA 3LJOA 1ELVA 1MH0A 2F3CE 4TT3D 4SGBE 3MO6A 4Q7YA 3NZIA 3KNXA 2OUAA 1NS3A 3KQCA 5FPTA 2WYGA 2G4UA 2ZHEH 2W5EA 4ABEA 2FX4A 3ZVFA 3F1SB 1K0HA 2FOEA 3M5LA 4Y8ZA 1D9IA 1GBKA 1QQ4A 2QC2A 2RG3A 5A09A 5EODA 1BMAA 5DK1A 1QJ6B 2QF5A 4MPXA 5AHGH 1WQSA 2PTNA 3ZZ4A 1CT4E 1DOJA 2B0FA 4DVAU 3OEED 1UO6A 2CN0H 1NTPA 2JDID 3BG4B 2FOCA 1QJ7B 1SOZA 5DP8A 1TNKA 3D62A 3NPSA 2VWOA 3A87A 4BXSA 3BTKE 1CBWC 2ZIQH 1J8AA 5DP5A 3LKWA 4B75A 2GKVE 4ABHA 2G52A 3AW0A 4NGAH 4RSPA 1KLJH 1Q31A 4UFDH 1GWAA 1EATA 3LGVA 1GBEA 1OX1A 2Z9JA 2QCYA 5EGMA 5K0HA 3ZZ8A 1D6RA 1O3FA 2GZ7A 1LHDH 1AVXA 4RKJB 1MABB 4DIHH 3VEQB 1ZTJA 1E34B 2BB4A 1QL7A 3GCHB 3LIWA 1GMHG 1AFEH 3T28A 2WV5A 3UPEA 2ALPA 2UWOA 4BAHB 1ZSKA 4X8SH 1HPGA 2JETC 4OS5A 3PO1B 1WU1A 3TITA 1RJXB 4Y10E 2W7UA 1N6YA 4O97A 4ESTE 3NRLA 2TGAA 4B74A 1BDAA 1LMWB 3AK5A 1IQLA 2C90B 3P70B 1HAZB 1OYTH 2HLCA 3RXRA 4YT7H 4OS7A 3M37A 1HAHH 1T32A 1P9SA 2FIRH 2LPRA 1Y3XA 5PTPA 1UTJA 1BOQA 3TH2H 5CHAB 1QHRB 4K2YA 1BBRK 4BOHA 1C5LH 2PKSB 4X1QU 3D49H 1THPB 2Z3CA 4NG9H 4IS5A 2XCFA 3M5NA 2G8TA 1C1OA 4X2YA 5C1UA 5JDUB 1GBDA 3MO9A 5FBIA 1K22H 1O2GH 1TX8A 1LKBA 4X1SU 1O33A 2BMGB 3ZZBA 1XM1A 1G3EA 1EZQA 2Y5HA 1YPGH 3AASA 1EQ9A 1A2CH 2FTMA 5EW1H 3LJJA 3MNSA 1KMHB 2BZ6H 3OX7U 1ZTKA 1O2YA 3PMAB 1TRYA 3ZVGA 2W7SA 1IQFA 1DM4B 1K21H 1SB1H 1VCWA 3SNCA 1TA2A 4A6LA 1S81A 4MG3A 3UIRA 3SBKA 1MTNC 1IQNA 1HDTH 3N7OA 4KKDA 4YZUA 3SQHE 3DA9B 1TNGA 3JZ2B 1QB6A 3BTFE 2ALVA 5F8ZA 3QTOH 1B7XB 3BG8A 1AO5A 1DITH 1GJCB 3RU4E 1TX6A 1O34A 5EXLA 2HLDD 1VCPA 4YLQH 1A3EH 1C1WH 1O3NA 2EQNA 2CF8H 4FU8A 2P3TB 3RXOA 1C2IA 4NIVA 2O9QA 4Y76A 4AOQA 4PROA 3QLPH 1GDNA 3W95A 1SKYE 1QY6A 3RU4D 1FXYA 1MZDA 1QL8A 1DLKB 2PUXB 1DICA 1GJBB 3SGAE 4X8VH 4KGAA 2NU1E 3TK6A 5A2MH 1H8DH 2EEKA 4ISOA 2AMPA 3GY8A 3OYPA 1OWJA 2CHAB 1YP9A 5A0BA 3DHKH 1C1RA 4ABFA 1EPTB 4XDEA 3A84A 4HGCA 3TNSA 3E1XB 3OY5U 2P93A 1K1LA 3M36A 3URCA 3LT3A 3SNEA 3DT0H 2ZU5A 1T4VH 1A5GH 1ZGIA 2FPZA 3GYMA 2QXIA 4IN2A 1UVSH 1SHYA 4AFSA 4TPYA 1S84A 2HNTE 3P17H 2C8WB 1EB2A 1MKXH 1C1NA 1GG6C 1T8OA 1UK2A 1GMCF 3A88A 1W0KD 1FIZA 2RDLA 2V6NA 4O9VA 1CHOG 2A45B 3BEIB 3EYDA 1YGCH 3GY4A 3RXHA 1OP2A 3PM3A 1ID5H 1O3OA 2P3FH 1FY5A 4HG6A 5AFYH 1DWDH 4P02A 1COWD 3P8NA 2SGQE 3RUOA 2VIPA 3OEHD 1IQHA 2Q1JA 1SFIA 5EJ1A 2GMTC 3RXIA 2ZI2H 5FCRA 3QDZB 4A5TS 6CHAB 5JYIA 1HXEH 1Z71A 3F0PA 2CJIA 1C5TA 2ZNKH 1C1QA 2ZU1A 1K1JA 1MKWH 1RIWB 2VVCA 2YNBA 1AIXH 1NY22 2ZF0H 1BHXB 3NXPA 1FY8E 1YPJH 2A4RA 2BDYA 5DO4H 4NA7A 5EJZA 2TBSA 1C5WB 2FOAA 4WWYA 1GI7B 3SO3A 5EIYA 1SOTA 3CENA 2HWLB 2GTBA 3ATKA 2RDEA 2VIOA 3UY9A 1LVMA 2WSSD 1V2ST 1B0FA 2Z3DA 1YPKH 2TPIZ 3ZVAA 5GNDA 3VGCC 2C8ZB 3GY3A 1PPHE 1IHSH 2FOBA 1Z1JA 3C1KA 4YM9A 1WTHD 5B6OA 1ZGVA 3S9BA 1YWUA 4CRCA 2PP6A 1P05A 1S0RA 1S5SA 3SNBA 3ZVCA 3E0NB 2F91A 3PLKA 1BMNH 4ZKRU 3M3SA 5EXMA 1TMUH 1C4U2 5BPEA 5JBBS 3E8LA 1O3BA 3P8GA 3FN8A 1GL1A 1JIRA 3E6PH 1SL3A 4UD9H 1XVOA 9ESTA 4BAKB 3GISB 2QN5T 2M2AA 4CH2B 5E0JA 3B9FH 1A3BH 1BUIA 3T29A 4AG2A 4ZHMU 1KYNA 2KR7A 5IDKA 2HALA 1C2MA 3CS0A 2ZC9H 5E0HA 1BMFD 1DE7H 1DSUA 4MPVA 1PPZA 1C5XB 3IWMA 1SQOA 3SI4H 1SQAA 4MVNA 3WWBA 1C1UH 4MNVA 4IC5A 3VPKA 4M9FA 4K5ZA 1KSNA 1C5NH 2AHME 2A5IA 1EB1H 5JB9S 3T27A 5FCKA 2A1DB 2PGBB 3RP2A 1YLNA 2GZ8A 2CK3D 1H9LB 3UNRA 1ZR0A 3A7TA 1V2UT 5AF9H 1SC8U 1PQ5A 2EI7A 2OBOA 1YLDA 1ELGA 1UTPA 3LC5A 1GL0E 2STAE 3ZZ9A 1NN6A 3TJNA 1UMAH 3Q3KA 3RXJA 2PFEA 1GG6B 1LCYA 1TX7A 1TQ0B 2PSYA 2F9UA 5H4IB 5T3HA 3MHWU 1BMMH 1TBRH 1C2FA 3FZZA 4GSOA 1UTKA 1EAXA 3O8CA 1MUEB 4WY3A 2BTCE 1PFXC 3E16B 4I7YH 1ZSJA 2FS9A 1E35B 4YOIA 1A0LA 8GCHF 1QBVH 2G55A 5EQQA 3C27B 4K3JA 2A32A 1SGIB 1AUJA 1FN6A 1GBJA 4AN7A 1BHXF 2B9LA 3A86A 2P95A 2XC4A 1OPHB 3HGNA 2WV4A 3KEEA 1JMOH 4O3UA 2Z94A 3A83A 4AFUA 1TPPA 2ZDAH 4OS2A 2DUCA 2Z9LA 1TYNA 2VH6A 3GCTG 3PV5A 3ESTA 2Y6TA 1P2KA 2O8LA 5LPFA 2CGAA 1KIGH 1Z8IB 5LGOA 3R0FA 1Z1IA 1VITF 2NWNA 3SJIA 1J15A 1P2MA 4F48B 1SG8B 2VIVA 3K65B 1GJ4H 2VGCC 2QGRA 3SU6A 1O5EH 1FY3A 2OXSA 2ZPQA 2ZFQH 5IYTA 2BDHA 4X2WA 3CP7A 1UJ1A 1Z6JH 5DJ7A 4NIXA 3GDSA 1WOFA 2RA3A 3O8RA 9LPRA 2FI3E 4YLUA 2BX4A 1S6HA 1EX3A 3UUZA 1F92A 1GCTC 2F9BH 1MBMA 5A0CA 1UTOA 2B8OH 5CHBA 2P8OC 1P06A 2A4QA 5F03A 3CS7A 4IBLH 4RKOB 1NRPH 1HJAC 3ZZ6A 1HAIH 1EAWA 4FUCA 2QA9E 3M35A 2L6OA 5HM9A 2P16A 2HRVA 3NKKA 1GHYH 4B2BA 1HB0B 2GDEH
chains in the Genus database with same CATH topology
3STIA 3ODDA 1NRNH 4CRGA 1AI8H 1QIXB 2WPDD 4NSVA 2BY5X 4Y11E 1GBHA 5JPMH 3RLWH 1E0FD 3PMBB 1E79D 2WYJA 4I32A 1GGDB 2IJD1 3F68H 3UR9A 4RI0A 4YXWD 1QA7A 1CHOF 2B5TB 3MO3A 5FPSA 1TALA 1ELDE 2ZDKA 1HYLA 2ZO3H 3SU3A 2ZGJA 4I8HA 5GXPA 2KCYA 1YPMH 1XXFA 5C5NA 2FX6A 1CA0C 3TU7H 4A7IB 2A5KA 1ESTA 2ZECA 4AFQA 1Y5AT 5T6FA 3GYLB 1C4V2 3B23B 8LPRA 3O8BA 3GCHC 2XBYA 3M3TA 1BJUA 5C67A 1LHCH 1Y3VA 2H1UA 2ODPA 4D7GA 5JBCS 3K6YA 3F9HA 1A61H 1C1VH 1DWEH 2BX3A 1GGDC 1D3DB 4ABGA 4DCDA 4X6MA 5C1XA 3FANA 1FPCH 2GZ9A 2HPQH 2BVSH 3QGNB 2TIOA 3R3GB 3K9XB 1CBWB 1O5FH 4BTUB 2ZU4A 4X2XA 4ZCNA 2ZFTA 1ZTLA 4INLA 1O30A 4B2CA 1ABIH 4GLYA 3W94A 6GCHF 1P02A 1UCYK 3MH7A 1EPTA 2QF0A 1TMTH 1LVOA 3U9AH 3EA8A 3KN2A 1AHTH 2SNWA 2ZGXH 4YO9A 1UHBB 1ZHPA 1VCQA 2GP9B 3VB5A 4MQAA 3GOVB 2XWBI 3H09A 3SU1A 1C5MD 2ANWA 4TY7A 2D2DA 2FZZA 2IPHA 2ZHFH 3RXTA 1BITA 1ELAA 3ZIAD 2VIWA 4TWYA 3P95A 2Y80A 1P3EA 1Y5UT 3TNTA 3OFND 1A0JA 1JOUB 2V0BA 3SJKA 4B73A 2XTTB 5EW2H 7GCHF 3LH1A 3ZVEA 5BRRE 2SGEE 3F2GA 1UK4A 1ESAA 5EG4A 1ZHMA 1CHGA 1MU8B 1VGCB 2J94A 3MU4A 4AX9H 1J14A 3MWIU 2ZTYA 4FUJA 2A0QB 1GMDG 4CREA 1GBAA 1UTNA 1ANDA 3TJUA 1U6QA 3ELAH 4AB9A 4GPGA 1SGEE 3RXUA 2BVXH 1TLDA 1GI3A 1MQ5A 3SUGA 1OP8A 1JXPA 4I8KA 4U2WA 1P10A 5EU8A 1GVZA 2QF3A 3RXLA 3BIUH 1W13U 1HAPH 5EPNA 2ODQA 4WH6A 1GBCA 1P2NA 3U98H 1DFPA 2IN2A 1D3QB 1K1IA 1W7GH 2G81E 1NZQH 1MAXA 3MI4A 4UEHH 2FLBH 4ABJA 1HUTH 2KCAA 2Y5FA 2KAIA 5C0TA 1MCTA 1RGQA 2GCTB 4NFEA 4WXIA 3UB0A 2W3KA 1PJPA 2FI5E 1T8MA 2D8WA 1A46H 1HAGE 3URDA 2XNIA 2FYQA 3NK8A 2B7DH 2BDCA 3SQEE 1GPZA 4E7NA 1D3TB 2KZ4A 1EOJA 1ZRKA 4M7GA 1YBWA 1GBIA 3P8OA 3PMHB 2V35A 1QNJA 2R9PA 4K1EA 4A92A 2BD5A 1DVAH 1CA8B 3LGYA 3TIUA 1G2MA 5F8TA 1SLUB 1TGCA 2PKSC 1FJSA 4LOYH 3ENSB 3HATH 1J16A 1HBTH 5A8YA 1PQ7A 5TCAA 4H42U 4U01A 2FEQH 1DY9A 3SJOA 1THSH 3ZVBA 1TPSA 2F9NA 2FI4E 1MZAA 2JETB 1XUKA 1F0TA 2GMTB 3MH4A 1P11E 2AIPA 1HGTH 2XWAA 1O2QA 3SUDA 4Y71A 4AB8A 3MNBA 1HFDA 4X1NU 4GHTA 1UVTH 1W7XH 4ZROA 1HNEE 2H9TH 3DSPA 4NIWA 1RD3B 1L1JA 1V3XA 1BMLA 1T31A 1ZMNA 1UCYE 1NFUA 8KME2 3SU5A 2BLWA 4Y7AA 5I46H 3RM2H 4JZIA 3TJVA 1K28D 2CF9H 3BTME 4HI3A 3SN8A 1GMHF 1CGHA 2W6JD 1PYTC 4Y8XA 2EC9H 4ISLA 4F4OC 2A7HA 3M3VA 1E1RD 2BD3A 3PRDA 3PTBA 1QRWA 5IK2D 4X1PU 3HK3B 2SGPE 2BDBA 1NFWA 2ZWLH 1ANBA 1UTLM 1ZPBA 4Q7XA 3ZYEA 1ELBA 2FOHA 3AW1A 2V7QD 1IHTH 2UUKB 1O2IA 2AGGX 3TK9A 2OC0A 3Q3XA 1BRCE 4YOGA 1W11U 4ZHLU 1L1GA 3SV7A 4Q7ZA 1FN8A 1K2I1 1ZOMA 4HFPB 1P03A 1H9IE 1OWKA 3QZRA 1RRKA 3RM0H 3SZNA 1ZJDA 1V2OT 1G9IE 1PPGE 3QZQA 1NRSH 3A7YA 4K69A 5LPRA 1BRBE 1GI9B 1O35A 3RXEA 1T8LA 2WPHS 1EAIA 1ETRH 2F9VA 1SSXA 2BHGA 3A8BA 3OTJE 4LZ4B 3M7QA 1BTWA 1AUTC 1CSOE 2AFQB 4JZEH 2QF4A 3ATMA 4X2VA 2OINA 2WINI 4DG4A 3HKJB 1DDJA 1NM6A 1TONA 2J4IA 1O5DH 1RTKA 1DT2A 4JZDH 1QB1A 1ZSLA 2AS9A 4R8TB 3NWUA 3T2NA 1D3PB 3PO1C 1YM0A 2R2MB 1LHEH 2NU2E 2ZPSA 2ILNA 3SUFA 2FWWA 3DFLA 5AVDA 2W3IA 3SORA 1SGDE 1HAYB 5HKKD 3L6PA 2ZDLA 1BB0B 3KF2A 4JK6A 3GS9A 2OQUA 1TGNA 4ZAEA 4WVPE 1G3CA 3KCGH 4LZ1H 1EZXC 1S6LA 4VGCC 1OWEA 2K1QA 2XW9A 3UNQA 1ELEE 5GJ4B 3OTPA 1DPOA 4NWKA 3FVFB 1T7CA 2ZTZA 2QAAA 3TPIZ 4ZXXH 3LPRA 1W0ZU 3A7XA 2BXUH 1BT7A 1GCDA 3RXDA 5GWZA 1ANEA 2Y5GA 3GY6A 3TH3H 4E06H 1XXDA 1V2NT 2H6MA 3MOCA 1OS8A 3AAVA 3DUXH 1O2NA 3UFAA 5HXFA 1V2JT 4XE4A 2BYAX 1O39A 5C1YA 1IQGA 1EUFA 3BEUA 4XSKU 2PV9B 3SW2B 1BZXE 1CO7E 2A5AA 2BD4A 1D4PB 1W10U 3GY2A 4ISIH 5E2PA 1NROH 4OGXA 1VGCC 3U69H 2H5CA 2GVFA 1XKAC 2VWMA 1B5GH 1PYTD 1EASA 2UUJB 2FXRA 2AH4X 1DANH 2QE7D 1KXFA 3EE0B 4AG1A 3S7HB 2KCOA 1MD8A 3SU0A 1G2LA 2FESH 1YPHE 4X8TH 3UR6A 5F8XA 4NIYA 4B76A 3VXEH 4DT7B 1FIWA 2FODA 4CRFA 1GI8B 1DX5M 1IAUA 1QBOA 2Y82A 1S82A 3OE7D 7LPRA 4IMZA 1TNLA 1CA0B 1AD8H 5FAHA 1INCA 4JK5A 2WUCA 3GCOA 1NO9H 3F9EA 1LHGH 3F2FA 2OC8A 3MFJA 2WPLS 1MU6B 1UTMA 1AFQC 2BQ7B 2ZGBH 4UFGH 1O3PB 1UHBA 4D8NA 1KY9A 1C1MA 4H6SB 2ZFSA 1AKSA 1GBLA 1HAVB 2ZCLP 2ZQ2A 1E37B 1WTGH 4CRDA 2ZA5A 2ZHWH 5GDSH 1YPHC 3WWFA 1RFNA 2QV1A 8GCHG 1MKXK 3SGBE 2BD8A 1A5IA 1GI2A 1QRXA 5DP9A 5DSFA 1SBWA 1LPKB 4BNRA 4MPWA 4JMYA 2Q6FA 5EOKA 1TRNA 1JWTA 1T4UH 3L33A 4ZKSU 1BJVA 1KXCA 2BLOA 5E0GA 3ZVDA 1O2SA 4B2AA 1GJ6A 1NPMA 1SGYE 1WXRA 1SGFA 1HJ8A 5L2ZH 3TVJB 4NA9H 2DE9A 2O8WA 1AN1E 2LELA 3QUMP 1P09A 3A82A 3I77A 1GBTA 2ZKSA 5DN6D 2OQ5A 1HIAB 2C4FH 4WMDA 4TYDA 4WH8A 1H9HE 1C5QA 3IITA 1BTPA 5DG6A 2Q6DA 2GV6A 3ZZ7A 3QTVH 3D65E 5SGAE 2RCEA 1HLTH 1FAXA 1QQUA 1G32B 3EGKH 3PLBA 4NSYA 1SGRE 3SV2H 2HNTF 2VVVA 5GCHF 1L4ZA 1BIOA 2PUQH 5DP7A 1SGTA 4Q2KA 5C2ZA 1C1PA 3RU4T 5J4QA 2JKHA 2BDAA 3RMNH 3P8FA 1O2VA 1DUEA 4K8YA 5TJXA 4NZQA 1O36A 3UNSA 3RMOH 4O3TA 2BLQA 3GDVA 2ZP0H 4WMEA 4GUXA 3UOUA 1TGBA 4CBNA 3RXVA 3H7OA 5TCCA 3SJ9A 3BTEE 1A4WH 2D1JA 3KHVA 4DT4A 2AMDA 1O3KA 3EQ0H 3LGWA 5ETXA 6CHAC 4ABIA 2AYWA 2SGDE 1F5RA 3PROA 2VH0A 3I29A 1O31A 1JIMA 1FPHH 1K9OE 1XUJA 4UE7H 4FU7A 4J2YB 3PWCA 1IQJA 1UCYH 5CE1A 4KTUA 4ZMAH 3A7VA 1LPGB 3LGUA 1Z7KA 1KDQA 3EA9A 1TOCB 3E91A 1SI5H 3S0NA 1HV7A 4YESB 2VBCA 1L1NA 5CHAC 3HPTB 2WPIS 4FVBA 1O3GA 2BY8X 4ISHH 1THRH 3EAJA 3A7ZA 3TGKE 3BTDE 1OWDA 1XVMA 3E0PB 1GJ8B 1BRAA 2R2WU 2XC0A 1N8OC 3SV9A 2QYIA 3ZZ3A 3MU0A 2WUBA 5C17A 1MQ6A 2JH5D 2FTLE 2YMSC 2EI6A 5L30H 3PWBA 1RS0A 4MNWA 4CRBA 4MPUA 2GCHG 1BBRE 5FX5A 4GCHG 2J95A 1EPTC 3V3MA 1PQAA 5DKMA 3T5FH 3SI3H 1TIOA 3RXSA 1HXFH 2WHXA 3ATLA 2OBQA 1S83A 1TQ7B 2VNTA 3MTYA 1O2KA 2Z9KA 1OOKB 1MCVA 4H4FA 3ATIA 4OGYA 2GT7A 3BEFB 2D26C 4JZ1A 1C1SA 4MNYA 3LGIA 1SPJA 2PHBA 1IOEA 3VB6A 1JRTA 1VITG 1M9UA 1BTUA 5DP6A 5GCHG 3BTHE 3MYWA 1AE5A 3A85A 3GCTF 1TE0A 1FY1A 2ZTXA 1NFYA 3ZZDA 1ARCA 3S9CA 1GHBG 2J34A 1QCPA 3VXFH 2TGDA 2A31A 3BTTE 1CQQA 4NCYA 1P3CA 1WBGB 4X1RU 1L0ZA 4ZKOU 4IGDA 1OHHD 3NCLA 2ANYA 1EAUA 2XCNA 1CT0E 2OCVB 2PGQB 3SNAA 2VIDA 4X8UH 2LNCA 3BF6H 4VGCB 4CBOA 3Q00A 1QTFA 2Z9GA 1L2EA 3LGTA 2J2UA 4YT6H 4CRAA 1V2VT 4X6PA 5ABWA 1O2UA 4K1TA 3ITIA 1BTYA 1P0SH 2Y7ZA 3U8OH 3MH5A 2NU0E 3H7TA 3F9GA 3A8AA 1P9UA 2KFWA 3PV4A 2DE8A 4BAQB 1GDUA 3E3TA 2BQ6B 2JH6D 3HKIB 2UUYA 3MMGA 2ANMH 3MU5A 1KXDA 2AGIX 4MDSA 1ZLRA 3QK1A 1GJ9B 1O2OA 4SGAE 1TGSZ 1ANCA 1C2HA 4LXBH 1C4Y2 2BOKA 3A89A 2VGCB 2HOBA 1TA6A 3KQBA 2ESTE 5HYOA 3O8DA 5A8ZA 3RMLH 1HAXB 2W26A 1HRTH 3DFJA 3V13A 1VJAU 4XOJA 3A7WA 3K2UA 5I25A 1C2DA 2ZG0H 4TWWA 4A1TA 1GBMA 4BXWA 3ZZ5A 1ZMLA 4UONA 1AY6H 1HIAA 1AB9B 1W8BH 1TBQH 2F9OA 2BD2A 3KIDU 2FDAA 3VB4A 1XMNB 2KCPA 3P6ZB 2BXTH 3EDXB 3RXFA 5ESBA 1BBRH 1IQIA 4ZXYH 3QX5H 2GGVB 3Q76A 1FMGA 1JRSA 1E38B 2AIQA 1NFXA 1MKWK 3VB7A 4K1SA 2ZHQH 1Z6EA 1ZMJA 1PQ8A 3GY5A 1TNJA 1DXWA 1YPLH 2OC1A 2FP7B 2R0KA 1QJ1B 1FAKH 2A7CA 1MTVA 2BLVA 5LPEA 1D6WA 4R0IA 2NU3E 4ABBA 5ESTE 1LHFH 1QL9A 1MTWA 3SU4A 4OS6A 1FDPA 3A81A 3BG4C 3TLOA 3PYHA 1C9PA 4JZFH 1GCTB 6LPRA 3MNXA 3HGPA 4B6FA 3F3BA 1O2JA 3TGIE 4XFQA 5C5OA 7KMEH 4ZKNU 5F6MA 2Z3EA 4Z6AH 2GD4B 4FUHA 2Z9IA 2YMSD 3MH6A 1J9CH 1C2GA 4FUDA 3HK6B 1C9TA 2Z7FE 1BTZA 2JH0D 2WPJS 4AFZA 1TGTA 2P94A 4HZHA 2C8XB 2G00A 4UFFH 5LH8A 3ZV8A 4FVDA 2JJ2D 2OTVA 1YYY1 2AGEX 2SNVA 1GJAB 1H4WA 4NWLA 1O0DH 1C5YB 1MBQA 2O8UA 1HAVA 4CH8B 1SGNE 1L4DA 4FETA 1GI5A 4X6NA 4BTIB 5HMAA 1YC0A 1MMJN 3FKSD 1P8VC 1W3CA 3ZV9A 1SHHB 1HAOH 1SFQB 1O5CB 2UWPA 1TB6H 1RXPA 4B6EA 3M7TA 2JIZD 1O38A 3ZYDA 3B8JA 3S7KB 2NU4E 3FP7E 3QN7A 2XYAA 2R3UA 2BY7X 3M5OA 4ISNA 3VFEA 1V2PT 2CHAC 1E1QD 3VG8A 3RXCA 1QURH 2G4TA 2GT8A 2ZPRA 3RC6A 3S69A 2BD7A 2PW8H 1AB9C 1TNHA 2C3SA 1C1TA 1O32A 3PMJA 4ZHAA 1EOLA 4F49A 4K60A 1K1NA 1GI0A 1CE5A 1Y59T 4MLFB 1QR3E 3RXPA 3SV8A 1BCUH 3DD2H 1UTQA 2HGTH 2FOFA 2J5UA 2V3HH 4GCHF 3RXBA 1GVLA 2PR3A 4Q80A 1ELTA 1LKAA 2H9HA 2ZHDA 1NESE 1O3DA 2F83A 2VB0A 3RLYH 3D23A 1GHAG 5FX6A 3ATWA 4I8LA 1V6DA 1WV7H 1V2RT 1TBZH 4U30A 1C5SA 1TOMH 2XBWA 5T6GA 1ZPCA 1SMFE 3SUEA 3TJOA 1N6XA 2QXHA 5CMXH 3VB3A 1N8OB 4NA8A 2BZAA 5C0UA 4H6TA 2STBE 2ZDVH 1WUNH 2TGTA 3N99A 2WPMS 1PPBH