3U1JB

Aprotinin bound to dengue virus protease
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
166
structure length
166
Chain Sequence
b'DVPSPPETQKAELEEGVYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTMPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease subunit NS2B
publication title Ligand-bound structures of the dengue virus protease reveal the active conformation
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Hydrolase/hydrolase inhibitor
total genus 34
structure length 166
sequence length 166
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3u1jB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3u1jB01
1N8OB 3PLPA 3LH1A 4CR9A 3SU1A 1K1MA 1RD3B 1BRAA 1GWAA 1SSXA 2GZ7A 2ZDVH 5FBIA 1TOMH 3VB5A 2F9VA 1DY9A 2XBXA 1QBOA 2ZCLP 1AB9B 1DUEA 3AK5A 1W7XH 3SV7A 1EAWA 1O3JA 4YLUA 3MHWU 3SV9A 1G36A 2FOFA 1DVAH 1GJ6A 1LVBA 2G8TA 1G30B 2WV9A 3A89A 3ENSB 2ZDLA 1PYTC 1UK3A 1ABIH 1EP5A 4OS7A 3BEFB 1VCPA 3RXAA 4ESTE 3HPTB 5C20A 1ZPCA 1GBMA 3MU4A 5DP8A 1MTWA 1A7SA 2CJIA 5FXLA 2PW8H 3TJOA 3VEQB 3OYPA 2R2MB 1O3PB 2AH4X 1LQEA 5IDKA 1VITG 1S5SA 2BZ6H 5A0CA 1QB9A 1GHBF 4X8SH 2J9NA 1NU9A 4KELA 4X1SU 3A84A 1OYTH 2ZHEH 1ANDA 1GPZA 2M5TA 1H9LB 3GDUA 1NC6A 2ZPRA 1XUJA 2PKAA 3A82A 1A1RA 1LVMA 3TU7H 1F0SA 3BTTE 3SJOA 2Z9JA 3VPKA 4CRFA 1QA0A 1GDQA 3A80A 2G81E 1YPEH 3ZZ9A 1C5MD 1YKTA 1GMHF 4WXVA 1GMCF 2UWPA 2FDAA 3RXIA 1EJNA 1EZQA 5C2ZA 4ABFA 1C5SA 4NCYA 2VU8E 1ZMLA 2BYAX 3M3SA 4AZ2B 4MG3A 1OSSA 2UUJB 4O97A 3M5MA 4CRAA 1YPJH 4CHAC 5DG6A 3WY8A 1AKSB 2GCTC 4U32A 3T25A 3PV2A 1G2MA 1RTLA 1ZRKA 4I31A 2NU1E 2WPIS 2ZCHP 1NESE 4NZLA 3AAUA 2WV4A 1SGIB 4Y11E 1P9UA 3AVZA 3T27A 1KXEA 2OXSA 1KXCA 1XXDA 1TMUH 3DA9B 5A8ZA 5GJ4B 1LTOA 4GVUA 4AG2A 1VZQH 1O36A 1ZOMA 2OCVB 2ANMH 1C1PA 1O2KA 2WPHS 4BTUB 4YM9A 1RIWC 1GL0E 2ZHQH 3SI4H 9ESTA 3EA7A 3P6ZB 4IW4E 1IHSH 3A8DA 3MU5A 1BMAA 2P3UB 4VGCB 4SGAE 1PQ8A 1EPTA 5EU8A 1SMFE 2Z3DA 4ZKRU 3Q3XA 3OY5U 1FIZA 3SOSA 4IBLH 2XC0A 3ZZBA 4ZHLU 2ANWA 1EAXA 4CBNA 2QV1A 4I7YH 2FTMA 1QBNA 1KXFA 2PSXA 2YNAA 1MZAA 5EXNA 2B9LA 3KQBA 1O2NA 1O2WA 2Q6FA 2PKSC 1AFEH 1S6FA 1GHWH 2BTCE 2TGTA 2ZFFH 1TFXA 1BHXB 2HLCA 1F0RA 5F8TA 2FX6A 1SGEE 1EKBB 2A4GA 4JYUH 3MH6A 1SFQB 4GCHF 3IWMA 5FCRA 3H09A 1C5TA 3OSYA 1QB1A 1HV7A 1QNJA 3N7OA 2GKVE 1Y8TA 2A31A 1TGBA 4X6MA 1HAOH 4UFEH 1TBQH 2AGIX 1GI7B 1QRWA 1BBRK 2GMTB 2NU2E 3ELAH 2Y5GA 2FOAA 1FAXA 1AZZA 1Z7KA 1IHTH 4KP0A 4FXGH 2ZDNA 4R8TB 1JIMA 1GL1A 5DP9A 5FPSA 3VB7A 2ZGXH 1GHAF 1HFDA 2W5EA 2STBE 4XSKU 2QAAA 1UTKA 3SU0A 1QQUA 2TGAA 1AHTH 4NIYA 2ZQ1A 1B0FA 1BHXF 2R9PA 1FN8A 3URDA 2QF0A 1B7XB 1QL9A 2FEQH 1C5YB 1GI6A 1G9IE 1GI3A 1GCTC 1BB0B 1TPOA 3ATWA 2XXLA 1NPMA 2ZTXA 5BPEA 3SJIA 4WMEA 1QJ7B 3GYLB 1CGHA 1TAWA 1ARBA 1SBWA 3TNTA 1P3CA 4HFPB 1H9IE 2ANKH 1QBVH 4M9FA 2G55A 5BRRE 1N6XA 4NZQA 3SV8A 5GIBA 2GTBA 2HNTE 3PV5A 2VWLA 2BX3A 1EX3A 4HTCH 2ZU5A 3VXFH 4JZFH 3DUXH 1TABE 4I8LA 2XTTB 1EB1H 4X6OA 1S82A 2BY7X 1P2JA 3Q76A 1KXAA 2BY9X 3D23A 1THRH 1QJ1B 2WPMS 3BG8A 3SNBA 4ZAEA 2ODQA 4IC5A 1EP6A 2Q6GA 3RXLA 4OS2A 1ZRBA 4Y0ZE 1UTOA 3TH2H 1GBBA 1ELDE 2A4OA 4MNVA 2OC0A 1L0ZA 4H6SB 3V3MA 1ZSLA 2UWLA 1FY1A 1MBMA 2Y7XA 1GBDA 4Y8XA 1WU1A 4A92A 1UCYE 1ELTA 4JZDH 4AFQA 3M3TA 5C1XA 2XWBI 3E90B 4ZKNU 4ZH8A 2SFAA 1ZMNA 3GY4A 1O31A 5AFZH 3DHKH 4WVPE 1SLXB 3LT3A 2CHAC 3ZZ7A 5EW1H 1AUTC 1EOLA 2O8LA 2UWOA 1K2I1 1YCPH 3D62A 2THFB 5LGOA 2BMGB 1BUIA 1ELFA 2F9UA 5EPNA 4AN7A 3FFGA 1SGNE 3M5OA 3SW2B 1HPGA 1X7AC 2XNIA 4U01A 2VWNA 4ZHMU 1GHXH 3F6UH 5TCCA 3I77A 3E16B 3LONA 4FUGA 2OC1A 1QIXB 1MQ6A 2XCFA 3TH4H 1YPHE 2C3SA 4F4OC 2NU0E 1Y3YA 4F49A 1MAXA 1VITH 2BY6X 4YT6H 1C2HA 1BMNH 4I8GA 1O3CA 1O2JA 3SJKA 4E05H 1C2GA 4YOGA 2D8WA 1S83A 2HNTF 2R2WU 1ESAA 1A0LA 2JH6D 1TMTH 1LMWB 2DE9A 3SGAE 2BX4A 1FY8E 2G52A 5GCHF 3SU5A 1IQIA 1OWKA 3LKWA 1O2UA 1C2LA 2BVSH 3U69H 2C93B 2ULLA 2ZNKH 1IQFA 2BXTH 3GCHC 3SUEA 4LOYH 1IAUA 1FZZA 3FVFB 2P16A 4A6LA 3QUMP 2BLVA 2HOBA 4XBDA 5EXMA 1XVOA 1W2KH 3P17H 1GMCG 4R0IA 2NU3E 1ZHPA 1CSOE 1K1NA 3MYWA 1E34B 1Z6JH 1A46H 1O3NA 2GX4A 1XVMA 1DUAA 3A86A 4Y10E 2GZ9A 3RU4D 5GPIB 3F1SB 5FX5A 1AUJA 2FIRH 3ZVAA 4K2YA 1ZYOA 2R3YA 2A7HA 5DP7A 3RM2H 3SJ9A 2RA3A 2P93A 1P2QA 2ZDAH 4FU9A 3LPRA 2ZIQH 1BRBE 2ZG0H 2J38A 3LOXA 1GI0A 1EASA 2WPJS 4YOJA 2FXRA 2Z3EA 2AGGX 1AE5A 4OS4A 2SGQE 2C8ZB 1FJSA 2QXHA 3UOPA 1SPJA 3P95A 3ZYEA 5ESBA 4OGYA 1CE5A 2VINA 1GG6B 3MH4A 1DANH 5A09A 5CHAB 1K28D 1V2WT 3OU0A 4INLA 1P0SH 1GVKB 3OTPA 1C5RA 3Q77A 1V2QT 3RMOH 3UNQA 1O2QA 3RMMH 2W3KA 1J9CH 3TGKE 3ODFA 4FUEA 4IS5A 1HB0B 4DVAU 3SZNA 2OD3B 2ZGBH 1MMJN 1SOZA 1ELVA 1O3AA 2B5TB 2ZU4A 3PO1B 1NTPA 1UTLM 5FBEA 1BTXA 4K1TA 3TJNA 1LVYA 4GHTA 1O0DH 3DFJA 4X1RU 2OTVA 4JCNA 4B74A 8GCHG 2TGPZ 1HJ8A 1SC8U 5B6OA 1C1MA 1D3PB 1C5ZB 4ABJA 3MH7A 3NZIA 1TONA 1TNGA 2FP7B 2ZGJA 3GISB 3SNEA 3SUGA 3ZV9A 1BDAA 2Z3CA 2ZWLH 1K21H 2BVRH 1DT2A 4LZ1H 2XBWA 2ZECA 1MTNB 3VXEH 4U2WA 2J34A 2A0QB 2ILNA 1DLEA 4WH8A 1ETSH 4A5TS 2K1QA 1P2IA 4CRBA 4MPUA 2UUYA 4MQAA 1YCPK 2AIPA 3SQEE 1TGNA 1GHAG 2BY5X 1AIXH 3RM0H 3QX5H 4OS5A 3PB1E 1PYTD 2J94A 3PM3A 4LZ4B 4Y79A 1BRUP 2HGTH 5TCAA 2F9PA 4ASHA 1P8VC 2W7UA 4Q7XA 1E38B 4Z0KA 1GI1A 2Z9GA 3FP6E 1RTKA 1YBWA 1F0UA 1S81A 2Q1JA 4TYDA 4JK6A 4TWWA 3RXGA 1L1GA 1BBRE 1M9UA 1Z1IA 4DURA 1BTWA 4THNH 5JBAS 1XUHA 2NU4E 5C3NA 3UNRA 1CVWH 3M7UA 1C2FA 6GCHG 1TNLA 1GI5A 4YTAA 2QXIA 1KDQA 4GHQA 1CT2E 3DT0H 1NRRH 5AVDA 1OS8A 2BDIA 4MPWA 5GNDA 2F9OA 2RDLA 1ACBE 1EJAA 4XDEA 3M3VA 3H5CB 1DE7H 1HXFH 3LGUA 3CENA 1DWBH 1WSSH 2VGCC 4TPYA 3NKKA 1T7CA 1TIOA 4BAHB 1NU7B 4IN1A 2O9QA 4E7RG 5E2PA 1GBFA 3ZZ8A 2WPKS 4FU7A 1GBTA 5T6FA 1GJAB 1GI8B 3GICB 4CHAB 1GJ7B 1C5VA 3A7TA 1SQAA 1K1LA 2XCNA 1UTQA 4Y6DA 3ODDA 2Z9KA 2FYQA 4MTBA 5GXPA 1SB1H 3FANA 4WMDA 1MZDA 5ABWA 4NFEA 1HJ9A 1O3DA 4BAOB 3PMJA 3GY7A 5J4SA 1SGDE 3T5FH 1A5IA 1LCYA 1C1RA 2GT8A 1RIWB 1QGFA 3KL6A 2GD4B 1MTUA 4U30A 4X8UH 3EYDA 4NIWA 3E8LA 2OINA 1BJUA 2OUAA 1MAYA 3RXKA 1JXPA 3E0PB 4SGBE 1VR1H 3A7ZA 1NY22 2FOBA 1IQJA 2F4LA 3TJVA 1SR5C 4ZXYH 3PV4A 1BTUA 3BTQE 4YZUA 2ALPA 2GT7A 3LC5A 3MNSA 3P8OA 1E37B 2ZZUH 3A85A 3MI4A 2A1DB 2F9NA 6CHAC 1EZSC 2QGRA 2PKSB 4B1TA 4XBBA 2A5AA 2BLWA 3QZRA 1C1VH 1ELAA 2O8TA 1A0JA 4KKDA 2GV7A 4K8YA 1YLDA 3F9GA 3U9AH 3ATMA 2VVCA 2Z9IA 1QURH 4XBCA 1P03A 2FX4A 1MU6B 1UVTH 1TA6A 4RSPA 3O8CA 3MNBA 1ZTKA 3M7QA 1GBAA 1O37A 1TNHA 1ETRH 4AFSA 4UFGH 1O2OA 5T3HA 1TWXB 2FI3E 1T8OA 3LIWA 3P8FA 1O2YA 3MO3A 1J14A 3S69A 2ZFSA 2A4RA 1V2OT 1T32A 4X8VH 4AYVB 5LPEA 1Z8JB 5AHGH 2AERH 2GVFA 1DY8A 3ZZ4A 4NFFA 4CREA 4ZUHA 2IN2A 4K1EA 1LVOA 2C8YB 4ABBA 1HAYB 1GJDB 3UQVA 5EXLA 5DP5A 1QCPA 9LPRA 1GCTB 2FI4E 3QLPH 3UREA 1UHBB 1FNIA 1DDJA 1TX7A 5E2OA 1P12E 5I25A 4A1XA 3HATH 1XUIA 3G01A 1BRCE 2XBVA 3A8CA 3MTYA 2P59A 1ESTA 5F6MA 3P70B 2H9TH 1L1NA 3RDZA 1S0RA 3PTBA 1AVXA 2H6MA 1QA7A 1Q2WA 3TIUA 1AGJA 1P9SA 1V2KT 4AFZA 1TE0A 3KF2A 1AWFH 1ZPBA 1O2MA 4MNYA 1GJ5H 4TY6A 3ZZAA 1MKWH 3HK3B 1ZR0A 1GGDC 1C5WB 1OOKB 2ALVA 2ZGHA 1O3BA 1TNKA 1TX8A 2ASUB 3UY9A 4Y7BA 1RS0A 1YGCH 1J15A 4INKA 3JZ2B 3ESTA 1C2DA 2P8OC 5B6LA 2JETC 4FUHA 3SUDA 1Y59T 3HK6B 3IG6B 3MOCA 1V2LT 2CN0H 2PTNA 4NWKA 3UNSA 1GHVH 1C5QA 1C4V2 3GCTF 1AFQC 2VH0A 4NIXA 1GJ4H 2G5NA 1L1JA 4JYVH 1UTNA 3TPIZ 1W0YH 2WV5A 1UJ1A 2ANYA 4AX9H 2J95A 2R0LA 3K6ZA 1P3EA 3T26A 4CR5A 1P10A 1D9IA 3BTKE 5AF9H 2VNTA 5C1YA 1AVGH 1UVSH 1EUFA 1G3DA 2CHAB 3SU6A 2B7DH 2ZQ2A 2Q6DA 1E0FD 1O2VA 1SOTA 1FV9A 4A7IB 4CRDA 3UR9A 1O2IA 2RA0A 1P2MA 3RC6A 3GY2A 2NWNA 3FAOA 1TQ7B 1C2EA 1GMDF 4FUIA 1FY4A 1YP9A 3GDSA 7LPRA 5G4BA 3UWIA 3LU9B 1CO7E 1Z1JA 1A0HB 3BG4C 1V2MT 4J2YB 3TNSA 4ISNA 6ESTA 3UR6A 1S6HA 2QN5T 1HAXB 3NUMA 3T29A 4AORA 3UPEA 4O3UA 1SGRE 3QWCH 1DWEH 3PLBA 4Y7AA 1KYNA 3M7TA 5I46H 2WZQA 1ZGVA 2EI7A 1DPOA 1OWEA 1C1SA 5GDSH 1NO9H 5PTPA 3LGVA 3LJOA 5HYOA 1FPHH 1ELGA 1V2TT 4Q7ZA 1HAIH 1W12U 4BTIB 5C1UA 2BDBA 3PTNA 2OP9A 3RLYH 2GGVB 1PQAA 3PROA 2VB0A 2BD4A 4AOQA 3GY8A 1BTZA 3EA9A 2FODA 2VH6A 1V6DA 4HI3A 3SU2A 1FIWA 3GCHB 2ZC9H 4CBOA 1A5GH 7GCHF 1OXGA 1DS2E 3MWIU 1H8IH 1TRNA 1XUKA 2ZFTA 5JYIA 2FOCA 1O33A 1UTJA 1K1PA 1HDTH 3QK1A 4NA7A 2FM2A 1RJXB 2XYAA 1Q31A 1ZSJA 2ZDKA 1MD8A 2OLGA 1MBQA 2VIPA 2Z7FE 2IJOB 5EQQA 3UQOA 3PWBA 1C2KA 2BM2A 3SI3H 1C9TA 2EI6A 2LPRA 5GWZA 3RXBA 5FCKA 5F03A 1THPB 4B2CA 3RXRA 1FMGA 2PGQB 1C5LH 3TH3H 1T8LA 1LPKB 3FP7E 1V2ST 1O39A 1CHGA 3VB6A 1SQOA 2C8XB 3RXQA 1TPPA 2O8WA 3ATLA 1SFIA 1WCZA 1P57B 1IQMA 2QC2A 1LHDH 1EPTC 2W26A 1CHOF 3E0NB 4BTTB 5DPAA 8LPRA 1ZTLA 1ABJH 3T2NA 1GI4A 1TOCB 3C27B 3LDXH 3M61U 2HVXA 4FUDA 2BOHB 5A8YA 3URCA 1TBZH 3MNXA 4NGAH 5F8ZA 2SGPE 5L2ZH 1V3XA 1RRKA 2BY8X 3W94A 3EGKH 1O2HA 1VJAU 3ZYDA 1O3KA 1BIOA 1JRSA 1GVZA 4NG9H 2KAIA 3OTJE 3ZZ3A 3TGJE 1T8NA 2PGBB 2BQ7B 2GCHF 3UUZA 2Y81A 1QB6A 3RU4E 1GJ8B 5DK1A 1H4WA 4AGKA 1SGTA 3RP2A 3P92A 1HRTH 2EI8A 1GHBG 1GI9B 1LQDB 1F5LA 3ZZ6A 2ZU2A 4BANB 1UVOA 1GBKA 4YESB 1PPFE 1YYY1 4CRGA 1MTSA 3D65E 2EA3A 3NCLA 5C67A 1QY6A 1MKXH 2ZHFH 4M7GA 1UCYH 1WAYB 1RXPA 1VITF 1LKBA 3EA8A 1O34A 1FN6A 3RMNH 3STJA 5J4QA 1GMHG 1HAHH 3SBKA 1HAVB 1J16A 2HALA 2Z94A 2ZHDA 1KXBA 4FU8A 4WXIA 1AI8H 2ZO3H 1BA8B 2ZP0H 2A7CA 1SGYE 3T28A 3UTUH 4D9QA 1D4PB 1GBHA 1C9PA 3FZDA 3H7OA 3U1JB 1NN6A 3F9EA 1LHEH 1J8AA 4DY7B 4K8BA 1ELEE 3BTDE 3LH3A 1TGSZ 1TQ0B 1Y5UT 3MU8A 2OBQA 3CP7A 1Z6EA 3VGCC 4YO9A 1SGFA 3SU3A 3U98H 2PV9B 1E36B 1CU1A 1G3CA 1JRTA 1NROH 2GP9B 1A61H 1UVUH 1BOQA 5K0HA 4JYTA 1TA2A 1XXFA 2GDEH 2JH0D 5ESTE 1N6YA 1DOJA 2J2UA 1ANCA 1TYNA 2WINI 1IQHA 1HBTH 3V13A 3GCNA 3OY6U 4AFUA 1SGQE 2CXVA 2VVVA 3AW0A 3O8DA 2F91A 2VGCB 3A7XA 5JB9S 1KTSB 1EATA 1LPGB 4I32A 1P2NA 3SV2H 4ISHH 3RXJA 1LPZB 2JH5D 4X1NU 4Y0YE 1SI5H 1XUFA 1CBWC 2FO9A 3NK8A 4MLFB 2WUBA 3F9FA 1O3OA 6LPRA 4Z6AH 4XOJA 4IC6A 5JDUB 2BZAA 2R0KA 3PMBB 3RC4A 2EEKA 4GCHG 1P02A 1SHHB 3RXVA 3BN9A 3L3TA 1JBUH 4RI0A 2H9HA 1C5OH 2F9BH 4O9VA 4TWYA 2H2ZA 2A2QH 2V6NA 4H42U 1B0EA 1GCDA 2BLOA 2CMYA 3RC5A 1EAIA 1LHCH 1MH0A 1BJVA 2A5KA 1CGJE 2PR3A 3AAVA 3U8OH 4J1YA 2O8UA 5T6DA 1INCA 1W14U 4BAKB 2W7SA 4HZHA 2CGAA 4X2VA 1P01A 1FI8A 2A7JA 3AW1A 3PLKA 3MNCA 1BTHH 3MU1A 1KLTA 2TPIZ 1MCTA 2I6QA 4E06H 1EJMA 2CF9H 3VB4A 2ZKSA 4UFFH 3K65B 1IQKA 1YPHC 3QGJA 5TJXA 1EZXC 4B6EA 1SLVB 5E0GA 5FHTA 4I8JA 6CHAB 1ANBA 1BITA 1Q3XA 2SGDE 3BTGE 1UVPA 2ZHWH 2BDHA 1K1OA 1VJ9U 1OWDA 1XM1A 3SU4A 4MPVA 3ZVDA 3ATKA 2ZPSA 1ZLRA 2PUXB 4K3JA 4X0WU 5E8EH 2I6SA 1O3HA 1ELBA 3SHCH 3EQ0H 1IQEA 4D7GA 3UIRA 4WF8A 4TPIZ 1F7ZA 1NZQH 1QTFA 4X6NA 5C5OA 2A45B 1WYKA 3U8TH 1O5EH 3GY6A 1HLTH 1GBLA 4Q80A 2BD5A 3TJUA 2GZ8A 1XKBC 2ZCKP 4X1QU 1TNJA 4KTUA 2OC8A 4H4FA 1K22H 4AGJA 2PTCE 4DOQA 4NSVA 2QY0B 3BF6H 2G4UA 1A4WH 4I8KA 2PUQH 3ZV8A 1ELCA 1ZZZA 2Y5HA 1GVLA 1KTTB 1YPLH 2BQWB 3B9FH 3RLWH 1W0ZU 2ZDMA 4ABDA 3IITA 1QL7A 2VWOA 3KEEA 3SV6A 5CE1A 3Q00A 2A2XH 2GCTB 1N1LA 1IQNA 1O3EA 1PQ7A 1F0TA 1MD7A 3R3GB 2AFQB 4BXWA 1FY3A 2FWWA 2OK5A 1BQYA 2BD3A 2XBYA 1NT1A 3RXFA 2BD9A 1KDQB 1XKAC 3V7TA 1FY5A 1CT0E 3PYHA 3TK5A 4KTCA 2VIVA 3BIUH 4UDWH 4GSOA 4DG4A 3EAJA 1D3QB 2QXJA 1DXPA 2ODPA 3BSQA 1W13U 1O35A 1C1TA 4MPXA 3RMLH 1BBRH 4DIIH 3JZ1B 3F9HA 5E0JA 1NFUA 2CV3A 2TGDA 5DP6A 2SNWA 3S7KB 1V2VT 5DKMA 2F83A 1SGPE 1W8BH 1C1WH 1HIAB 1MTNC 3RXHA 1HJAC 1C4U2 1CA0C 2P8OB 1HAPH 1BT7A 2JETB 1T8MA 2GCHG 5HXFA 3TVJB 2WUCA 3SNCA 1BCUH 1O30A 1LDTT 4NWLA 1IQLA 1AFQB 1DX5M 1TX6A 1P2KA 1A3EH 1FAKH 3QGNB 3SHAH 1Y5AT 2FI5E 1O5BB 2HPQH 3PWCA 4K5ZA 5GCHG 3SJ8A 5FAHA 5A8XA 1KXDA 2FS8A 3MO9A 4NA8A 3ITIA 3SNAA 1AZ8A 3BTWE 1VCWA 2J92A 1ETTH 3SGQE 3RXEA 1AKSA 1CA8B 1WTGH 3KN2A 1C5NH 2C4FH 4HGCA 3SQHE 1HAZB 1AY6H 1C2JA 1DM4B 4Y71A 1LKAA 1O32A 3CS7A 1OP2A 4ABAA 3Q3YA 1UHBA 4ISIH 1RFNA 3A87A 5EODA 2SGEE 3RXTA 1HXEH 1H9HE 3GY3A 1VGCC 1NRNH 2HPPH 5L2YH 3A83A 2YNBA 2B0FA 2R3UA 1FONA 1KSNA 2FOGA 4LK4A 1DLKB 2PHBA 1GI2A 4XE4A 3R0FA 2Z6BD 2UUKB 3BG4B 1C4Y2 1WBGB 3P8NA 5A0AE 1O5CB 4IGDA 1MCVA 3VFEA 1GBIA 2RCEA 1YPKH 2FOEA 1IOEA 2HRVA 3V0XA 1P05A 1G3BA 2ZGCA 5EGMA 1CQQA 5LPFA 1HYLA 3ZVFA 2FYRA 4YT7H 1C1QA 1HCGA 1L4DA 1D6RA 2VVUA 1H8DH 1WOFA 1XMNB 5SGAE 4X2WA 1TMBH 2PKAB 4AB9A 1GDUA 2H9EH 4WY3A 2WYJA 3TK9A 4WWYA 2GV6A 4DT7B 1C1NA 1TRYA 3B8JA 3QZQA 1HUTH 3ZVBA 1PPHE 2AMQA 2ZFPH 3LC3A 2TBSA 1O2RA 2XC5A 1SLWB 1KLIH 2EC9H 3A8BA 3KQEA 4RN6A 1F2SE 1N8OC 1T4UH 4DJZB 1OWJA 1ZJKA 1O2GH 1PPZA 5T1VA 2ZFRH 1AB9C 3SNDA 2BDYA 2ZEBA 1OYQA 1W11U 3S0NA 4YOIA 1LHFH 1FQ3A 2WYGA 1TLDA 3SGBE 1LHGH 2BLQA 2STAE 2C8WB 2QXGA 3TK6A 1QRXA 4X1PU 5IYTA 3MH5A 4O3TA 1O2LA 2D26C 5CMXH 1RGQA 3E91A 5HMAA 5HM9A 5FPYA 4JMYA 1C5PA 5L6NH 4NA9H 1U6QA 2FLBH 3PMHB 1O2TA 7KMEH 3LGWA 4H6TA 1F5RA 1V2NT 3UOUA 1GJ9B 2SGFE 2FZZA 1EPTB 8GCHF 3EE0B 1G32B 4K60A 1AD8H 3KIDU 2J4IA 1SLUB 1O3FA 4BAMB 1WQVH 4B6FA 1Y3VA 4AG1A 2FOHA 3QTOH 1SGFG 2Z9LA 7ESTE 2VWMA 3U1IB 4DIHH 1ANEA 1RTFB 3QO6A 2UUFB 1VCQA 1D6WA 4D7FA 3FZZA 1W10U 2XW9A 3PMAB 4XFQA 1TPSA 3B23B 1O3MA 2DE8A 1O3GA 1V2RT 2QA9E 4TY7A 1H1BA 2PFEA 1DXWA 4FVBA 1C2IA 3C1KA 1FXYA 1EXFA 3DFLA 3NPSA 1TBRH 4CRCA 1JMOH 4B2BA 1OX1A 3LJJA 2AYWA 4NIVA 2B8OH 3D49H 3KQCA 5H4IB 3TITA 3GY5A 5EOKA 2VIWA 4ABEA 1YF4A 3RXCA 1TB6H 2VIOA 4IN2A 2VIQA 1MQ5A 2V3HH 1ZMJA 1S0QA 4BAQB 3K6YA 1S85A 1YM0A 1AU8A 1V2UT 1C5UA 3A8AA 4I8HA 1PPBH 2ODYB 1J17T 1SHYA 2C90B 6GCHF 1GBJA 2ZTZA 1QR3E 1WUNH 1JOUB 4VGCC 3UWJH 1EQ9A 1Y3WA 4AYYB 1D3DB 4FUJA 5DO4H 3E6PH 1YC0A 3I29A 1E35B 3BEUA 4WMFA 4CH2B 4KTSA 4ZROA 3O8BA 4DGJA 1TPAE 3F68H 3MU0A 2BVXH 2Y80A 2BOKA 4GUXA 3SYJA 2P94A 4DW2U 1PPEE 4GAWA 1QQ4A 3KCGH 4JZ1A 1D3TB 1GJBB 2AMDA 1WV7H 1FLEE 1GHZA 2AEIH 2Y7ZA 5A2MH 2LNCA 3VGCB 4B73A 1IQGA 3A7WA 1P06A 2P3TB 3CS0A 3A7VA 4ISOA 1PFXC 5FX6A 1SG8B 1EB2A 1PPGE 1UTPA 4Q7YA 1AE8H 2FOMB 4ZKSU 1AN1E 3FP8E 2BXUH 3Q3KA 1W3CA 3BTHE 4Q2KA 4GLYA 1MKWK 1QL8A 2PLXA 2GMTC 2AMPA 1QHRB 4BXSA 4ZMAH 2ZU3A 2GDDA 2Y5FA 2FS9A 5DJ7A 1V2PT 1GJCB 3GDVA 5JPMH 1TNIA 4IMQA 1CBWB 3HKIB 2Y82A 5F8XA 1DITH 4RKJB 1TRMA 3VB3A 5LH8A 3I78A 1OWHA 1HAVA 1UTMA 4NSYA 3M36A 4A1TA 1A5HA 1ORFA 4B71A 5EQRA 5JB8S 3UFAA 3RXMA 2YOLA 1UK2A 1AQ7A 2V3OH 1ID5H 1SVPA 3RXPA 1KIGH 4OS6A 3SUFA 2P95A 2IJD1 2V0BA 1ARCA 3RUOA 2ZU1A 3SORA 1YLCA 1TGCA 8KME2 1O38A 2O8MA 3KQDA 1Z8IB 1O2PA 1MU8B 4INHA 2WHXA 2BHGA 3U8RH 1QFKH 1NFWA 2XRCA 4ABIA 3M5NA 3GOVB 2QCYA 1PPCE 3HGNA 2VJ1A 3LGIA 2Y6TA 3M37A 2P3FH 3GCOA 3RXUA 1WQSA 4I33A 1NS3A 2IOTA 4IMZA 3QN7A 5T6GA 4OS1A 1S84A 4B75A 3RU4T 2KAIB 3STIA 4ABHA 1GBEA 2ZTYA 4GPGA 1F92A 1P09A 1YPMH 2ZA5A 1OKXA 3M5LA 5EQSA 4D8NA 4FUFA 1DSTA 3QTVH 3ZVEA 4FUCA 1UO6A 4JK5A 4YLQH 1KY9A 3S9AA 3ATIA 1OPHB 1GDNA 3NXPA 1O5FH 1Y3XA 3MO6A 2QF3A 2FLRH 4D9RA 4ZKOU 2BDCA 3MFJA 4K69A 4Y8YA 1OP8A 4X6PA 5JBTA 3K2UA 1DWDH 1O2ZA 3ZZCA 4ISLA 4UFDH 1P11E 3SN8A 1SGCA 3ZZ5A 4UD9H 2AS9A 2BD2A 4B76A 1UK4A 2HNTC 2WPLS 3TGIE 3KHVA 3L6PA 4X2XA 1HNEE 5DGJA 4E7NA 2TRMA 3S7HB 1B5GH 4UONA 1K1IA 5DP4A 1O5AB 2QYIA 3ZVGA 5C5NA 4JZIA 3K9XB 1ZGIA 5AFYH 3O8RA 3BV9B 1NRQH 1CT4E 3E3TA 1L2EA 4MNWA 2A4QA 1Y3UA 3GCTG 1HGTH 3KGPA 4AB8A 3LGYA 5K7RA 1ZPZA 1MTVA 2BQ6B 4KGAA 1Z8GA 3T62A 1LO6A 2SGAA 5JBCS 5FPTA 1OWIA 1AWHB 8ESTE 3SZEA 2JKHA 1C2MA 2OC7A 4BNRA 5EW2H 4Y76A 3P8GA 2OQUA 1C1UH 4UE7H 3SO3A 3LGTA 1TALA 3TLOA 1THSH 4ZXXH 2A32A 1AO5A 2G51A 3RXDA 2VIDA 2BD8A 1Y5BT 2FMJA 2SNVA 1DFPA 1T4VH 2RG3A 2AIQA 3QDZB 1GMDG 5HGGA 2QIQA 4K1SA 3S9BA 3ZVCA 1NFYA 5HM2A 2D1JA 2ESTE 2DUCA 1NFXA 5EPYA 1DICA 1ZHRA 4WJG2 5E0HA 4D76A 1QRZA 4OM9A 2OQ5A 1F5KU 3HKJB 3EDXB 1XUGA 2BDGA 2FTLE 3A81A 4MNXA 3BIVH 5ETXA 2XC4A 3BTME 1HJAB 1P2OA 2G5VA 1CA0B 1XX9A 1BTPA 1O3LA 2H1UA 3E1XB 1O5GH 2BD7A 2D2DA 3BTEE 2TIOA 5EG4A 2XWAA 1A2CH 1NRSH 2ZF0H 2BB4A 2IPHA 1QJ6B 3RXOA 4OGXA 1KLJH 1ZHMA 3S9CA 2VBCA 2OBOA 1Z71A 4ABGA 1C5XB 4BOHA 4LXBH 3RXSA 3H7TA 2BDAA 2ZPQA 3M35A 2FESH 3ZZDA 3A7YA 1AVWA 1SQTA 5JBBS 4ZHAA 1JIRA 1WTHD 2PWXA 4B2AA 1K1JA 3KNXA 7GCHG 1T31A 2FPZA 1YPGH 1FPCH 1DWCH 1MKXK 1O3IA 1GBCA 1ZTJA 1ZSKA 3A88A 4UEHH 1EOJA 1GG6C 2W3IA 2F3CE 1UCYK 3AASA 1G37A 4FUBA 4A1VA 1HAGE 5CHAC 1EZUC 1V2JT 3GYMA 1VGCB 5DP3A 2CF8H 1BZXE 1SL3A 1JWTA 1FUJA 1UMAH 2HWLB 1NRPH 4PROA 1BMLA 1NM6A 4MDSA 4CH8B 2A5IA 3MMGA 1PJPA 4WH6A 4DCDA 2H5CA 4Y8ZA 5A0BA 1OP0A 1Z8RA 1A3BH 2ZI2H 4X2YA 1PQ5A 1EAUA 1O2SA 5LPRA 2H5DA 4QT8C 3NWUA 2ZFQH 3L33A 1YCPM 3PO1C 1P04A 1C1OA 1BMMH 1HIAA 3BEIB 1W7GH 1FDPA 1L4ZA 1CGIE 1DSUA 1G2LA 1O2XA 4X8TH 2G4TA 4RKOB 1AMHA 1CHOG 1O5DH 1ZJDA 4FVDA 2PSYA 2V35A 3V12A 3OX7U 1ESBA 2AGEX 1MUEB 4MVNA 4O03A 1WXRA 1GHYH 1GGDB 1TGTA 5L30H 1K9OE 3HGPA 3W95A 1BTYA 1G3EA 4JZEH 2G00A 3DD2H 3BTFE
chains in the Genus database with same CATH superfamily
1N8OB 3PLPA 3LH1A 4CR9A 3SU1A 1K1MA 1RD3B 1BRAA 1GWAA 1SSXA 2GZ7A 2ZDVH 5FBIA 1TOMH 2CK3D 3VB5A 2F9VA 1DY9A 2XBXA 1QBOA 2ZCLP 1AB9B 1DUEA 3AK5A 1W7XH 3SV7A 1EAWA 1O3JA 4YLUA 3MHWU 3SV9A 1G36A 2FOFA 1SQRA 1DVAH 1GJ6A 1LVBA 2G8TA 1G30B 2WV9A 3A89A 3ENSB 2ZDLA 1PYTC 1UK3A 1ABIH 1EP5A 4OS7A 3BEFB 1VCPA 3RXAA 3F3BA 3HPTB 4ESTE 5C20A 1ZPCA 1GBMA 3MU4A 5DP8A 2KM0A 1MTWA 1A7SA 2CJIA 1QZ8A 5FXLA 2PW8H 3TJOA 3VEQB 3OYPA 2R2MB 1O3PB 2AH4X 1LQEA 5IDKA 1VITG 1S5SA 2BZ6H 2QF4A 5A0CA 1BMFD 1QB9A 1GHBF 4X8SH 2J9NA 1NU9A 4KELA 4X1SU 3A84A 1OYTH 2ZHEH 1ANDA 1GPZA 2M5TA 1H9LB 3GDUA 1NC6A 2ZPRA 1XUJA 2PKAA 3A82A 1A1RA 3DSPA 1LVMA 3TU7H 1F0SA 3BTTE 3SJOA 2Z9JA 3VPKA 4CRFA 1QA0A 1GDQA 3A80A 2G81E 1YPEH 3ZZ9A 1C5MD 1YKTA 1GMHF 4WXVA 1GMCF 2UWPA 2FDAA 3RXIA 1EJNA 1EZQA 5C2ZA 4ABFA 1C5SA 4NCYA 4F48B 2VU8E 1ZMLA 2BYAX 2AHME 3M3SA 4AZ2B 4MG3A 1OSSA 2UUJB 4O97A 3M5MA 4CRAA 1YPJH 4CHAC 5DG6A 3WY8A 3DCLA 1AKSB 2GCTC 4U32A 3T25A 3PV2A 1G2MA 1RTLA 2GJGA 1ZRKA 4I31A 2NU1E 2WPIS 2ZCHP 1NESE 4NZLA 3AAUA 2WV4A 1SGIB 4Y11E 1P9UA 3AVZA 3T27A 1KXEA 2OXSA 1KXCA 1XXDA 1TMUH 3DA9B 5A8ZA 5GJ4B 3CNRA 1LTOA 2JJ2D 4GVUA 4AG2A 1VZQH 1O36A 1ZOMA 2OCVB 2ANMH 1C1PA 1O2KA 2WPHS 4BTUB 4YM9A 1RIWC 1GL0E 2ZHQH 3SI4H 9ESTA 3EA7A 3P6ZB 4IW4E 1IHSH 3A8DA 3MU5A 1BMAA 2P3UB 4VGCB 4SGAE 1PQ8A 1EPTA 5EU8A 1SMFE 2Z3DA 4ZKRU 5C0UA 3Q3XA 3OY5U 1FIZA 3SOSA 4IBLH 2XC0A 3ZZBA 4ZHLU 2ANWA 1EAXA 4CBNA 2QV1A 4I7YH 2FTMA 1QBNA 1KXFA 2PSXA 2YNAA 1MZAA 5EXNA 2B9LA 3KQBA 1O2NA 4HG6A 1O2WA 4DT4A 3ZIAD 2Q6FA 2PKSC 3F0PA 1AFEH 1S6FA 1GHWH 2BTCE 2TGTA 2ZFFH 1TFXA 1BHXB 2HLCA 1F0RA 5F8TA 2FX6A 1SGEE 1EKBB 2A4GA 4JYUH 3MH6A 1SFQB 4GCHF 3IWMA 5FCRA 2KR7A 3H09A 1C5TA 3OSYA 2LELA 1QB1A 1HV7A 1QNJA 3N7OA 2GKVE 1Y8TA 2A31A 1TGBA 4X6MA 1HAOH 4UFEH 1TBQH 2AGIX 1GI7B 1QRWA 1BBRK 2GMTB 2NU2E 3ELAH 2Y5GA 2FOAA 1FAXA 1AZZA 1Z7KA 1IHTH 4KP0A 4FXGH 2ZDNA 4R8TB 1JIMA 1GL1A 5DP9A 5FPSA 2L74A 3VB7A 2ZGXH 1GHAF 1HFDA 2W5EA 2STBE 4XSKU 2QAAA 1UTKA 3SU0A 1QQUA 2TGAA 1AHTH 4NIYA 2ZQ1A 1B0FA 1BHXF 2R9PA 2YMSC 1FN8A 1E1QD 2W6ID 3URDA 2QF0A 1B7XB 1QL9A 2FEQH 1C5YB 1GI6A 1G9IE 1GI3A 1GCTC 1BB0B 1E1RD 1TPOA 3ATWA 2XXLA 1NPMA 2ZTXA 5BPEA 3SJIA 4WMEA 1QJ7B 3GYLB 1CGHA 3DSGA 1TAWA 1ARBA 1SBWA 4FETA 3TNTA 1P3CA 4HFPB 1H9IE 2ANKH 1QBVH 4M9FA 2G55A 5BRRE 1N6XA 4NZQA 3SV8A 5GIBA 2GTBA 2HNTE 3PV5A 2VWLA 5FL7D 2BX3A 1EX3A 4HTCH 2ZU5A 3VXFH 4JZFH 3DUXH 1TABE 4I8LA 2XTTB 1EB1H 4X6OA 1S82A 2BY7X 1P2JA 3Q76A 1KXAA 2BY9X 3D23A 1THRH 5KEDA 1QJ1B 2WPMS 3BG8A 1SKYE 3SNBA 4ZAEA 2ODQA 4IC5A 1EP6A 2Q6GA 3RXLA 4OS2A 1ZRBA 4Y0ZE 1UTOA 3TH2H 3VG8A 1GBBA 1ELDE 2A4OA 4MNVA 2OC0A 1L0ZA 4H6SB 3V3MA 1ZSLA 2UWLA 1FY1A 1MBMA 2Y7XA 1GBDA 4Y8XA 1WU1A 4A92A 1UCYE 1ELTA 4JZDH 4AFQA 3M3TA 5C1XA 2XWBI 3E90B 4ZKNU 4ZH8A 2SFAA 1ZMNA 3GY4A 1O31A 5AFZH 3DHKH 4WVPE 1SLXB 1EFRD 3LT3A 2CHAC 3ZZ7A 5EW1H 1AUTC 1EOLA 2O8LA 2UWOA 1K2I1 1YCPH 3D62A 2THFB 5LGOA 2BMGB 1BUIA 1ELFA 2F9UA 5EPNA 4AN7A 3FFGA 1SGNE 3M5OA 3SW2B 1HPGA 1X7AC 2XNIA 4U01A 2VWNA 4ZHMU 1GHXH 3F6UH 5TCCA 3MQKC 3I77A 3E16B 3LONA 4FUGA 2OC1A 1QIXB 1MQ6A 2XCFA 3TH4H 1YPHE 2C3SA 4F4OC 2NU0E 1Y3YA 4F49A 1MAXA 1VITH 2BY6X 4YT6H 1C2HA 1BMNH 4I8GA 1O3CA 1O2JA 3SJKA 4E05H 1C2GA 1FX0B 4YOGA 2D8WA 1S83A 2HNTF 2R2WU 1ESAA 1A0LA 2JH6D 1TMTH 1LMWB 2DE9A 3SGAE 2BX4A 1FY8E 2G52A 5GCHF 3SU5A 1IQIA 1OWKA 3LKWA 1O2UA 1C2LA 2BVSH 3U69H 2C93B 2ULLA 2ZNKH 1IQFA 2BXTH 3GCHC 3SUEA 4LOYH 1IAUA 1FZZA 3FVFB 2P16A 4A6LA 3QUMP 2BLVA 2HOBA 4XBDA 5EXMA 1XVOA 1W2KH 3P17H 1GMCG 4R0IA 2NU3E 1ZHPA 1CSOE 1K1NA 4Z1MD 3MYWA 1E34B 1Z6JH 1A46H 1KMHB 2GX4A 1O3NA 1XVMA 1DUAA 3A86A 4Y10E 2GZ9A 3RU4D 5GPIB 3F1SB 5FX5A 1AUJA 2FIRH 3ZVAA 5EJZA 4K2YA 1ZYOA 2R3YA 2A7HA 5DP7A 3RM2H 3SJ9A 2RA3A 2P93A 1P2QA 2ZDAH 4FU9A 3LPRA 2ZIQH 1BRBE 2ZG0H 2J38A 2J97A 3LOXA 1GI0A 1EASA 2WPJS 4YOJA 3PRBA 2FXRA 2Z3EA 2AGGX 1AE5A 1NBME 4OS4A 2SGQE 2C8ZB 1FJSA 2QXHA 3UOPA 1SPJA 3P95A 3ZYEA 5ESBA 4OGYA 2RDEA 1CE5A 2VINA 1GG6B 3MH4A 1DANH 5A09A 5CHAB 1K28D 1W0JD 1V2WT 3OU0A 4INLA 1P0SH 1GVKB 3OTPA 1C5RA 3Q77A 1V2QT 3RMOH 3UNQA 1O2QA 3RMMH 2W3KA 1J9CH 3TGKE 3ODFA 4FUEA 4IS5A 1HB0B 4DVAU 3SZNA 2OD3B 2ZGBH 1MMJN 1SOZA 1COWD 1ELVA 1O3AA 2B5TB 3F0OA 2ZU4A 3PO1B 1NTPA 1UTLM 5FBEA 1BTXA 4K1TA 3TJNA 1LVYA 4GHTA 1O0DH 3DFJA 4X1RU 2OTVA 4JCNA 4B74A 8GCHG 2TGPZ 1HJ8A 1SC8U 5B6OA 1C1MA 1D3PB 1C5ZB 4ABJA 3MH7A 3NZIA 1TONA 1TNGA 5CHBA 2FP7B 2ZGJA 3GISB 3SNEA 3SUGA 3ZV9A 1BDAA 2Z3CA 2ZWLH 1K21H 2BVRH 1DT2A 4LZ1H 2XBWA 2ZECA 1MTNB 3VXEH 4U2WA 2J34A 2A0QB 2ILNA 1DLEA 4WH8A 1ETSH 4A5TS 2K1QA 1P2IA 5C0TA 4CRBA 4MPUA 2UUYA 4MQAA 1YCPK 2AIPA 3SQEE 1TGNA 1GHAG 2BY5X 1AIXH 3RM0H 3QX5H 4OS5A 3PB1E 1PYTD 2J94A 3PM3A 4LZ4B 4Y79A 1UW7A 1BRUP 2HGTH 5TCAA 2F9PA 4ASHA 3F2HA 1P8VC 2W7UA 4Q7XA 1E38B 2JDID 4Z0KA 1GI1A 2Z9GA 3FP6E 1RTKA 1YBWA 1F0UA 1S81A 2Q1JA 4TYDA 4JK6A 4TWWA 3RXGA 1L1GA 1BBRE 1M9UA 1Z1IA 4DURA 1BTWA 4THNH 5JBAS 1XUHA 2NU4E 5C3NA 3UNRA 1CVWH 3M7UA 1C2FA 6GCHG 1TNLA 1GI5A 4YTAA 2QXIA 1KDQA 4GHQA 1CT2E 3DT0H 1NRRH 5AVDA 1OS8A 2BDIA 5EJ1A 4MPWA 5GNDA 2F9OA 2RDLA 1ACBE 2WSSD 1EJAA 4XDEA 3M3VA 3H5CB 1DE7H 3OEHD 1HXFH 3LGUA 3CENA 1DWBH 1WSSH 2VGCC 4TPYA 3NKKA 1T7CA 1TIOA 4BAHB 1NU7B 4IN1A 2O9QA 4E7RG 5E2PA 1GBFA 3ZZ8A 2WPKS 4FU7A 1GBTA 5T6FA 1GJAB 1GI8B 3GICB 2M2AA 4CHAB 1GJ7B 1C5VA 3A7TA 1SQAA 1K1LA 2XCNA 1UTQA 4Y6DA 3ODDA 2Z9KA 2FYQA 4MTBA 5GXPA 1SB1H 3FANA 4WMDA 1MZDA 5ABWA 4NFEA 1HJ9A 1O3DA 4BAOB 3PMJA 3GY7A 3N7DA 5J4SA 1SGDE 3T5FH 1A5IA 1LCYA 1C1RA 2GT8A 1RIWB 1QGFA 3KL6A 2GD4B 1MTUA 4U30A 4X8UH 3EYDA 4NIWA 3E8LA 2OINA 1BJUA 2OUAA 1MAYA 3RXKA 1JXPA 3E0PB 4SGBE 1VR1H 3A7ZA 1NY22 2FOBA 1IQJA 2F4LA 3TJVA 1SR5C 4ZXYH 3PV4A 1BTUA 3BTQE 4YZUA 2ALPA 2GT7A 3LC5A 3MNSA 3P8OA 1E37B 2ZZUH 3A85A 3MI4A 2A1DB 2F9NA 6CHAC 1EZSC 2QGRA 2PKSB 4B1TA 4XBBA 2A5AA 2BLWA 2J98A 3QZRA 1C1VH 1ELAA 5F53A 2O8TA 1A0JA 4KKDA 2GV7A 4K8YA 1YLDA 3F9GA 3U9AH 3ATMA 2KCYA 2VVCA 2Z9IA 1QURH 3KYFA 4XBCA 1P03A 2L6OA 2FX4A 1MU6B 1UVTH 1TA6A 4RSPA 3O8CA 3MNBA 1ZTKA 3M7QA 1GBAA 1O37A 1TNHA 1ETRH 4AFSA 4UFGH 1O2OA 5T3HA 1TWXB 2FI3E 1T8OA 3LIWA 3P8FA 1O2YA 3MO3A 1J14A 3S69A 2ZFSA 2A4RA 1V2OT 1T32A 4X8VH 4AYVB 5LPEA 3WWBA 1Z8JB 5AHGH 2AERH 2GVFA 1DY8A 3GS9A 2YMSD 3ZZ4A 4NFFA 4CREA 4ZUHA 2IN2A 2YMSB 1LVOA 2C8YB 4K1EA 4ABBA 1HAYB 1GJDB 3UQVA 5EXLA 5DP5A 1QCPA 9LPRA 1GCTB 5KECA 2FI4E 3QLPH 3UREA 1UHBB 1FNIA 1DDJA 1TX7A 5E2OA 1P12E 5I25A 4A1XA 3HATH 4Q4LA 1XUIA 3G01A 1BRCE 2XBVA 3A8CA 3MTYA 2P59A 1ESTA 5F6MA 3P70B 4ACAA 2H9TH 1L1NA 3RDZA 1S0RA 3PTBA 1AVXA 2H6MA 1QA7A 1Q2WA 3TIUA 1AGJA 1P9SA 1V2KT 4AFZA 1TE0A 3KF2A 1AWFH 1ZPBA 1O2MA 4MNYA 1GJ5H 4TY6A 3ZZAA 1MKWH 3HK3B 4I86A 1ZR0A 1GGDC 1C5WB 2KCAA 3UB0A 1OOKB 2ALVA 2ZGHA 1O3BA 1TNKA 1TX8A 2ASUB 3UY9A 4Y7BA 1RS0A 1YGCH 1J15A 4INKA 3JZ2B 3ESTA 1C2DA 2P8OC 5B6LA 2JETC 4FUHA 3SUDA 1Y59T 3HK6B 3IG6B 3MOCA 1V2LT 2CN0H 2PTNA 4NWKA 3UNSA 1GHVH 1C5QA 1C4V2 3GCTF 2KCOA 1AFQC 2VH0A 4NIXA 1GJ4H 2G5NA 1L1JA 4JYVH 1UTNA 3TPIZ 1W0YH 2WV5A 1UJ1A 2ANYA 4AX9H 2J95A 3PRDA 2R0LA 3K6ZA 1P3EA 3T26A 4CR5A 1P10A 1D9IA 3BTKE 5AF9H 2VNTA 5C1YA 1AVGH 1UVSH 2V7QD 1EUFA 1G3DA 2CHAB 3SU6A 2B7DH 2ZQ2A 2Q6DA 1E0FD 1O2VA 1SOTA 1FV9A 4A7IB 4CRDA 3UR9A 1O2IA 2RA0A 1P2MA 3RC6A 3GY2A 2NWNA 3FAOA 1TQ7B 1C2EA 1W0KD 1GMDF 4FUIA 1FY4A 1YP9A 3GDSA 7LPRA 5G4BA 3UWIA 3LU9B 1CO7E 1Z1JA 1A0HB 3BG4C 1V2MT 4J2YB 3TNSA 4ISNA 6ESTA 3UR6A 2QF5A 1S6HA 2QN5T 1HAXB 3NUMA 3T29A 4AORA 5EIYA 3UPEA 4O3UA 1SGRE 3QWCH 1DWEH 3PLBA 4Y7AA 1KYNA 3M7TA 5I46H 2WZQA 1ZGVA 2EI7A 1DPOA 1OWEA 1C1SA 5GDSH 1NO9H 5PTPA 3LGVA 3LJOA 5HYOA 1FPHH 1ELGA 1V2TT 3KYGA 4Q7ZA 1HAIH 1W12U 4BTIB 5C1UA 2BDBA 3PTNA 2OP9A 3RLYH 2GGVB 1PQAA 3PROA 2VB0A 2BD4A 4AOQA 3GY8A 1BTZA 3EA9A 5EJLA 2FODA 2VH6A 1V6DA 4HI3A 3SU2A 3F2GA 1FIWA 3GCHB 2ZC9H 4CBOA 1A5GH 7GCHF 1OXGA 1DS2E 3MWIU 1H8IH 1TRNA 1XUKA 2ZFTA 5JYIA 2FOCA 1O33A 1UTJA 1K1PA 1HDTH 3QK1A 4NA7A 2FM2A 1RJXB 2V3MA 2XYAA 1Q31A 1ZSJA 2ZDKA 1MD8A 2OLGA 1MBQA 2VIPA 2Z7FE 2IJOB 5EQQA 3UQOA 3PWBA 1C2KA 2BM2A 3SI3H 1C9TA 2EY4C 2EI6A 2LPRA 5GWZA 3RXBA 5FCKA 5F03A 1THPB 4B2CA 3RXRA 1FMGA 2KFWA 2PGQB 4XD7D 1C5LH 3TH3H 1T8LA 1LPKB 3FP7E 1V2ST 1O39A 1CHGA 3VB6A 1SQOA 2C8XB 3RXQA 1TPPA 2O8WA 3ATLA 1SFIA 1WCZA 1P57B 1IQMA 2QC2A 3F2FA 1LHDH 1EPTC 2W26A 1CHOF 3E0NB 4BTTB 5DPAA 8LPRA 1ZTLA 1ABJH 3OEED 3T2NA 1GI4A 1TOCB 3C27B 2W6JD 3LDXH 3M61U 2HVXA 4FUDA 2BOHB 5A8YA 3URCA 1TBZH 3MNXA 4NGAH 5F8ZA 2SGPE 5L2ZH 1V3XA 1RRKA 2BY8X 4AC9A 3W94A 3EGKH 1O2HA 1VJAU 3ZYDA 1O3KA 1BIOA 1JRSA 1GVZA 4NG9H 2KAIA 3OTJE 3ZZ3A 3TGJE 1T8NA 2JJ1D 2BQ7B 2PGBB 2GCHF 3UUZA 2Y81A 1QB6A 3RU4E 4F55A 1GJ8B 5DK1A 1H4WA 4AGKA 1SGTA 3RP2A 3P92A 1HRTH 2EI8A 1GHBG 1GI9B 1LQDB 1F5LA 3ZZ6A 2ZU2A 4BANB 1UVOA 1GBKA 4YESB 1PPFE 1YYY1 4CRGA 1MTSA 3D65E 2EA3A 3NCLA 5C67A 1QY6A 1MKXH 2ZHFH 4M7GA 1UCYH 1WAYB 1RXPA 1VITF 1LKBA 3EA8A 1O34A 1FN6A 3RMNH 3STJA 5J4QA 1GMHG 1HAHH 3SBKA 1HAVB 1J16A 2HALA 2Z94A 2ZHDA 1KXBA 1S6LA 4FU8A 4WXIA 1AI8H 2ZO3H 1BA8B 2ZP0H 2A7CA 1SGYE 3T28A 3UTUH 4D9QA 1D4PB 1GBHA 1C9PA 3FZDA 3H7OA 3U1JB 1NN6A 4TSFD 3F9EA 1LHEH 1J8AA 2J5UA 4DY7B 4K8BA 1ELEE 3BTDE 3LH3A 1TGSZ 1TQ0B 1Y5UT 4XRNA 3MU8A 2OBQA 3CP7A 1Z6EA 3VGCC 4YO9A 1SGFA 3SU3A 3U98H 2PV9B 1E36B 1CU1A 1G3CA 1JRTA 1NROH 2GP9B 1A61H 1UVUH 1BOQA 5K0HA 4JYTA 1TA2A 3FOAA 1XXFA 2GDEH 2JH0D 5ESTE 1N6YA 1DOJA 2J2UA 1ANCA 1TYNA 2WINI 1IQHA 1HBTH 3V13A 3GCNA 3OY6U 4AFUA 1SGQE 2CXVA 2KCPA 2VVVA 3AW0A 3O8DA 2F91A 2VGCB 3A7XA 5JB9S 1KTSB 1EATA 1LPGB 4I32A 1P2NA 3SV2H 4ISHH 3RXJA 1LPZB 2JH5D 4X1NU 4Y0YE 1SI5H 1XUFA 1CBWC 2FO9A 3NK8A 4MLFB 2WUBA 3F9FA 1O3OA 6LPRA 4Z6AH 4XOJA 4IC6A 5JDUB 2BZAA 2R0KA 3PMBB 3RC4A 2EEKA 4GCHG 1P02A 1SHHB 3RXVA 3BN9A 3L3TA 1JBUH 4RI0A 2H9HA 1C5OH 2F9BH 4O9VA 4TWYA 2H2ZA 3KQ5A 2A2QH 2V6NA 4H42U 1B0EA 1GCDA 2BLOA 2CMYA 3RC5A 1EAIA 1LHCH 1MH0A 1BJVA 2A5KA 1CGJE 2PR3A 3AAVA 3U8OH 4J1YA 4RT1A 2O8UA 5T6DA 1INCA 1W14U 4BAKB 2W7SA 4HZHA 2CGAA 4X2VA 1P01A 1FI8A 2A7JA 3AW1A 3PLKA 3MNCA 1BTHH 3MU1A 1KLTA 2TPIZ 1MCTA 2I6QA 4E06H 1EJMA 3OAAD 2CF9H 3VB4A 2ZKSA 4UFFH 3K65B 1IQKA 1YPHC 3QGJA 5TJXA 1EZXC 4B6EA 1SLVB 5E0GA 5FHTA 4I8JA 6CHAB 1ANBA 1BITA 1Q3XA 2SGDE 3BTGE 1UVPA 2ZHWH 2BDHA 1K1OA 1VJ9U 1OWDA 1XM1A 3SU4A 4MPVA 3ZVDA 3ATKA 2ZPSA 1ZLRA 2PUXB 4K3JA 4X0WU 5E8EH 2I6SA 1O3HA 1ELBA 3SHCH 3EQ0H 1IQEA 4D7GA 3UIRA 4WF8A 4TPIZ 1F7ZA 1NZQH 1QTFA 2KZ4A 4X6NA 5C5OA 2A45B 1WYKA 3U8TH 1O5EH 3GY6A 1HLTH 1GBLA 4Q80A 2BD5A 4Q63A 3TJUA 2GZ8A 1XKBC 2ZCKP 4X1QU 1TNJA 4KTUA 2OC8A 4H4FA 1K22H 4AGJA 2PTCE 4DOQA 4NSVA 2QY0B 3BF6H 2G4UA 1A4WH 2XNDD 4I8KA 2PUQH 3ZV8A 1ELCA 1ZZZA 2Y5HA 1GVLA 1KTTB 1YPLH 2BQWB 3B9FH 3RLWH 1W0ZU 2ZDMA 4ABDA 3IITA 1QL7A 2VWOA 3KEEA 2XOKD 3SV6A 5CE1A 3Q00A 2A2XH 2GCTB 1N1LA 1IQNA 1O3EA 1PQ7A 1F0TA 5DN6D 1MD7A 3R3GB 5C17A 2AFQB 4BXWA 1FY3A 2FWWA 2OK5A 1BQYA 2BD3A 2XBYA 1NT1A 3RXFA 2BD9A 1KDQB 1XKAC 3V7TA 1FY5A 5KGOA 1CT0E 3PYHA 3TK5A 4KTCA 2VIVA 3BIUH 4UDWH 4GSOA 4DG4A 3EAJA 3UAIC 1D3QB 2QXJA 1DXPA 2ODPA 3BSQA 1W13U 1O35A 1C1TA 4MPXA 3RMLH 1BBRH 4DIIH 3JZ1B 3F9HA 5E0JA 1NFUA 2CV3A 2TGDA 5DP6A 2SNWA 3S7KB 1V2VT 5DKMA 2F83A 1SGPE 1W8BH 1C1WH 1HIAB 1E79D 1MTNC 3RXHA 1HJAC 1C4U2 1CA0C 2P8OB 1HAPH 1BT7A 2JETB 1T8MA 2GCHG 5HXFA 3TVJB 2WUCA 3SNCA 1BCUH 1O30A 1LDTT 4NWLA 1IQLA 1AFQB 1DX5M 1TX6A 1P2KA 1A3EH 1FAKH 3QGNB 3SHAH 1Y5AT 2FI5E 1O5BB 2HPQH 4ACBA 3PWCA 4K5ZA 5GCHG 3SJ8A 4RT0A 5FAHA 5A8XA 1KXDA 2FS8A 3MO9A 4NA8A 3ITIA 3SNAA 1AZ8A 3BTWE 1VCWA 2J92A 1ETTH 3SGQE 3RXEA 1AKSA 1CA8B 1WTGH 3KN2A 1C5NH 2C4FH 4HGCA 3SQHE 1HAZB 1AY6H 4P02A 1C2JA 1DM4B 4Y71A 3FKSD 1LKAA 1O32A 3CS7A 1OP2A 4ABAA 3Q3YA 1UHBA 4ISIH 1RFNA 3A87A 5EODA 2SGEE 3RXTA 1HXEH 1H9HE 3GY3A 1VGCC 1NRNH 2HPPH 5L2YH 3A83A 2YNBA 2B0FA 2R3UA 1FONA 1KSNA 2FOGA 4LK4A 1DLKB 2PHBA 1GI2A 4XE4A 3R0FA 3EE7A 2Z6BD 2UUKB 3BG4B 1C4Y2 1WBGB 3P8NA 5A0AE 1O5CB 4IGDA 1MCVA 3VFEA 1GBIA 2RCEA 1YPKH 2J98B 2FOEA 1IOEA 2HRVA 3V0XA 1P05A 1G3BA 2IPQX 2ZGCA 5EGMA 1CQQA 2RFKC 5LPFA 1HYLA 3ZVFA 2FYRA 4YT7H 1C1QA 1HCGA 1L4DA 1D6RA 2VVUA 1H8DH 1WOFA 1XMNB 5SGAE 4X2WA 1TMBH 2PKAB 4AB9A 1GDUA 2H9EH 4WY3A 2WYJA 3TK9A 4WWYA 2GV6A 4DT7B 1C1NA 1TRYA 3B8JA 3QZQA 1HUTH 3ZVBA 1PPHE 2AMQA 2ZFPH 3LC3A 2TBSA 5HIYA 1O2RA 2XC5A 1SLWB 1KLIH 2EC9H 3A8BA 3KQEA 4RN6A 1F2SE 1N8OC 1T4UH 4DJZB 1OWJA 2KX4A 1ZJKA 1O2GH 1PPZA 5T1VA 2ZFRH 1WDIA 1AB9C 3SNDA 2BDYA 2ZEBA 1OYQA 1W11U 3S0NA 2HVYB 4YOIA 1LHFH 1FQ3A 2WYGA 1TLDA 3SGBE 1LHGH 2BLQA 2STAE 2C8WB 2QXGA 3TK6A 1QRXA 5C94A 4X1PU 5IYTA 3MH5A 4O3TA 1O2LA 3U28C 2D26C 5CMXH 1RGQA 3E91A 5HMAA 5HM9A 5FPYA 4JMYA 1C5PA 5L6NH 4NA9H 1U6QA 2FLBH 3PMHB 1O2TA 7KMEH 3LGWA 4H6TA 1F5RA 1V2NT 3UOUA 1GJ9B 2SGFE 2FZZA 1EPTB 8GCHF 3EE0B 1G32B 5CDFE 4K60A 1AD8H 3KIDU 2J4IA 1SLUB 1O3FA 4BAMB 1WQVH 4B6FA 1Y3VA 4AG1A 2FOHA 3QTOH 1SGFG 2Z9LA 7ESTE 2VWMA 3U1IB 4DIHH 1ANEA 1RTFB 1YLNA 3QO6A 2UUFB 5IK2D 1VCQA 1D6WA 4D7FA 3FZZA 1W10U 2XW9A 3PMAB 4XFQA 1TPSA 3B23B 1O3MA 2DE8A 1O3GA 1V2RT 2QA9E 4TY7A 1H1BA 2PFEA 1DXWA 4FVBA 1C2IA 3C1KA 1FXYA 1EXFA 3DFLA 3NPSA 1TBRH 4CRCA 1JMOH 4B2BA 1OX1A 2WPDD 3LJJA 2AYWA 4NIVA 2B8OH 3D49H 3KQCA 5H4IB 3TITA 3GY5A 5EOKA 2VIWA 4ABEA 1YF4A 3RXCA 1TB6H 2VIOA 4IN2A 2VIQA 1MQ5A 2V3HH 1ZMJA 1S0QA 4BAQB 3K6YA 1S85A 1YM0A 2PP6A 1AU8A 1V2UT 1C5UA 3A8AA 4I8HA 1PPBH 2ODYB 1J17T 1SHYA 2C90B 6GCHF 1GBJA 2ZTZA 1QR3E 1WUNH 1JOUB 4VGCC 3UWJH 1EQ9A 1Y3WA 5HKKD 4AYYB 1D3DB 2HLDD 4FUJA 5DO4H 1H8ED 3E6PH 1YC0A 2EQNA 3I29A 1E35B 3BEUA 4WMFA 4CH2B 4KTSA 4ZROA 1K0HA 3O8BA 4DGJA 1TPAE 3F68H 3MU0A 2BVXH 2Y80A 2BOKA 4GUXA 3SYJA 2P94A 4DW2U 1PPEE 4GAWA 1QQ4A 3KCGH 4JZ1A 2JIZD 1D3TB 1GJBB 2AMDA 1WV7H 1FLEE 1GHZA 2AEIH 2Y7ZA 5A2MH 2LNCA 3VGCB 4B73A 1IQGA 3A7WA 1P06A 2P3TB 4YXWD 3CS0A 3A7VA 4ISOA 1PFXC 5FX6A 1SG8B 1EB2A 1PPGE 1UTPA 4Q7YA 1AE8H 2FOMB 4ZKSU 1AN1E 3FP8E 2BXUH 3Q3KA 4P00A 1W3CA 3BTHE 4Q2KA 4GLYA 1MKWK 1QL8A 2PLXA 2GMTC 2AMPA 1QHRB 4BXSA 3W1EA 2ZU3A 2GDDA 2Y5FA 4ZMAH 2FS9A 5DJ7A 1V2PT 1H8HD 1GJCB 4ZCNA 3GDVA 5JPMH 1TNIA 4IMQA 1CBWB 3HKIB 2Y82A 5F8XA 1DITH 4RKJB 1TRMA 4TT3D 3VB3A 5LH8A 3I78A 1OWHA 1HAVA 1UTMA 4NSYA 3M36A 4A1TA 1A5HA 1ORFA 4B71A 5EQRA 5JB8S 3UFAA 3RXMA 2YOLA 1UK2A 1AQ7A 2V3OH 1ID5H 1SVPA 3RXPA 1KIGH 3OFND 4OS6A 3SUFA 2P95A 2IJD1 2V0BA 1ARCA 3RUOA 2ZU1A 3SORA 1YLCA 1TGCA 8KME2 1O38A 2O8MA 3KQDA 1Z8IB 1O2PA 1MU8B 2WHXA 4INHA 2BHGA 3U8RH 1QFKH 1NFWA 2XRCA 4ABIA 3M5NA 3NRLA 3GOVB 3WW7A 2QCYA 1PPCE 3HGNA 2VJ1A 3LGIA 2Y6TA 3M37A 2P3FH 3GCOA 3RXUA 1WQSA 4I33A 1NS3A 2IOTA 4IMZA 3QN7A 5T6GA 4OS1A 1S84A 4B75A 3RU4T 2KAIB 3STIA 4ABHA 1GBEA 2ZTYA 4GPGA 1F92A 2LP6A 1P09A 1YPMH 2ZA5A 1OKXA 3M5LA 5EQSA 4D8NA 4FUFA 1DSTA 5DSFA 3QTVH 3ZVEA 4FUCA 1UO6A 4JK5A 4YLQH 1KY9A 3S9AA 3ATIA 1OPHB 1GDNA 3NXPA 3N7EA 1O5FH 1Y3XA 3MO6A 2QF3A 2FLRH 4D9RA 4ZKOU 2BDCA 2QE7D 3MFJA 4K69A 4Y8YA 1OP8A 4X6PA 5HIZA 2K0QA 5JBTA 3K2UA 1DWDH 1O2ZA 3ZZCA 4ISLA 4UFDH 1P11E 3SN8A 1SGCA 3ZZ5A 4UD9H 2AS9A 3N99A 2BD2A 4B76A 1UK4A 2HNTC 2WPLS 3TGIE 3FO8D 3KHVA 3L6PA 4X2XA 1HNEE 5DGJA 4E7NA 2TRMA 3S7HB 1B5GH 4UONA 1K1IA 5DP4A 1O5AB 2QYIA 3ZVGA 5C5NA 4JZIA 3K9XB 1ZGIA 5AFYH 3O8RA 3BV9B 4ASUD 1NRQH 1CT4E 3E3TA 1L2EA 4MNWA 2A4QA 1Y3UA 3GCTG 1HGTH 3KGPA 4AB8A 3LGYA 1YY3A 5K7RA 1ZPZA 1MTVA 2BQ6B 4KGAA 1Z8GA 3T62A 1LO6A 2SGAA 5JBCS 5FPTA 1OWIA 1AWHB 3SZEA 8ESTE 2JKHA 1C2MA 2OC7A 4BNRA 5EW2H 4Y76A 3P8GA 2OQUA 1C1UH 4UE7H 3SO3A 3LGTA 1TALA 3TLOA 1THSH 4ZXXH 2A32A 1AO5A 2G51A 3RXDA 1NBMD 2VIDA 2BD8A 1Y5BT 2FMJA 2SNVA 1DFPA 1T4VH 2RG3A 2AIQA 3QDZB 1GMDG 5HGGA 2QIQA 4K1SA 3S9BA 3ZVCA 1NFYA 2K8IA 5HM2A 2D1JA 2ESTE 2DUCA 1NFXA 5EPYA 1DICA 1ZHRA 4WJG2 5E0HA 4D76A 3OE7D 1QRZA 4OM9A 2OQ5A 1F5KU 3HKJB 3EDXB 1XUGA 2BDGA 2FTLE 3A81A 4MNXA 3BIVH 5ETXA 2XC4A 3BTME 1HJAB 1P2OA 2G5VA 1CA0B 1XX9A 1BTPA 1O3LA 2H1UA 3E1XB 1O5GH 1VKYA 2BD7A 2D2DA 3BTEE 4FOUC 2TIOA 3FN8A 5EG4A 2XWAA 1A2CH 1NRSH 2ZF0H 2BB4A 1MABB 2IPHA 1QJ6B 1OHHD 3RXOA 4OGXA 1KLJH 1ZHMA 2VBCA 3S9CA 2OBOA 1Z71A 4ABGA 1C5XB 4BOHA 4LXBH 3RXSA 3H7TA 2BDAA 2ZPQA 3M35A 2FESH 3ZZDA 3A7YA 1AVWA 1SQTA 5JBBS 4ZHAA 1JIRA 1WTHD 2PWXA 4B2AA 1K1JA 3KNXA 7GCHG 1T31A 2FPZA 1YPGH 1FPCH 1DWCH 1MKXK 1O3IA 1GBCA 1ZTJA 1ZSKA 3A88A 4UEHH 1EOJA 1GG6C 2W3IA 2F3CE 1UCYK 3AASA 1G37A 4FUBA 4A1VA 1HAGE 5CHAC 1EZUC 1V2JT 3GYMA 1VGCB 5DP3A 2CF8H 1BZXE 1SL3A 1JWTA 1FUJA 1UMAH 2HWLB 1NRPH 4PROA 1BMLA 1NM6A 4MDSA 4CH8B 2A5IA 3MMGA 1PJPA 4WH6A 4DCDA 2H5CA 3DSOA 4Y8ZA 5A0BA 1OP0A 1Z8RA 1A3BH 1YWUA 2ZI2H 4X2YA 1PQ5A 1EAUA 1O2SA 5LPRA 2H5DA 4QT8C 3NWUA 2ZFQH 3L33A 1YCPM 3PO1C 3WWFA 1P04A 1C1OA 1BMMH 1HIAA 3BEIB 1W7GH 1FDPA 1L4ZA 1CGIE 1DSUA 1G2LA 1O2XA 2F43B 4X8TH 2G4TA 4RKOB 1AMHA 1CHOG 1O5DH 1ZJDA 4FVDA 2PSYA 2V35A 3V12A 3OX7U 1ESBA 2AGEX 1MUEB 4MVNA 4O03A 1WXRA 1GHYH 1GGDB 1TGTA 5L30H 1K9OE 3HGPA 3W95A 1BTYA 1G3EA 4JZEH 2G00A 3DD2H 3BTFE
chains in the Genus database with same CATH topology
1N8OB 3PLPA 3LH1A 4CR9A 3SU1A 1K1MA 1RD3B 1BRAA 1GWAA 1SSXA 2GZ7A 2ZDVH 5FBIA 1TOMH 2CK3D 3VB5A 2F9VA 1DY9A 2XBXA 1QBOA 2ZCLP 1AB9B 1DUEA 3AK5A 1W7XH 3SV7A 1EAWA 1O3JA 4YLUA 3MHWU 3SV9A 1G36A 2FOFA 1DVAH 1GJ6A 1LVBA 2G8TA 1G30B 2WV9A 3A89A 3ENSB 2ZDLA 1PYTC 1UK3A 1ABIH 1EP5A 4OS7A 3BEFB 1VCPA 3RXAA 4ESTE 3HPTB 5C20A 3F3BA 1ZPCA 1GBMA 3MU4A 5DP8A 2KM0A 1MTWA 1A7SA 2CJIA 5FXLA 2PW8H 3TJOA 3VEQB 3OYPA 2R2MB 1O3PB 2AH4X 1LQEA 5IDKA 1VITG 1S5SA 2BZ6H 5A0CA 2QF4A 1BMFD 1QB9A 1GHBF 4X8SH 2J9NA 1NU9A 4KELA 4X1SU 3A84A 1OYTH 2ZHEH 1ANDA 1GPZA 2M5TA 1H9LB 3GDUA 1NC6A 2ZPRA 1XUJA 2PKAA 3A82A 1A1RA 3DSPA 1LVMA 3TU7H 1F0SA 3BTTE 3SJOA 2Z9JA 3VPKA 4CRFA 1QA0A 1GDQA 3A80A 2G81E 1YPEH 3ZZ9A 1C5MD 1YKTA 1GMHF 4WXVA 1GMCF 2UWPA 2FDAA 3RXIA 1EJNA 1EZQA 5C2ZA 4ABFA 1C5SA 4NCYA 2VU8E 1ZMLA 2BYAX 2AHME 3M3SA 4AZ2B 4MG3A 1OSSA 2UUJB 4O97A 3M5MA 4CRAA 1YPJH 4CHAC 5DG6A 3WY8A 3DCLA 1AKSB 2GCTC 4U32A 3T25A 3PV2A 1G2MA 1RTLA 1ZRKA 4I31A 2NU1E 2WPIS 2ZCHP 1NESE 4NZLA 3AAUA 2WV4A 1SGIB 4Y11E 1P9UA 3AVZA 3T27A 1KXEA 2OXSA 1KXCA 1XXDA 1TMUH 3DA9B 5A8ZA 5GJ4B 1LTOA 2JJ2D 4GVUA 4AG2A 1VZQH 1O36A 1ZOMA 2OCVB 2ANMH 1C1PA 1O2KA 2WPHS 4BTUB 4YM9A 1RIWC 1GL0E 2ZHQH 3SI4H 9ESTA 3EA7A 3P6ZB 4IW4E 1IHSH 3A8DA 3MU5A 1BMAA 2P3UB 4VGCB 4SGAE 1PQ8A 1EPTA 5EU8A 1SMFE 2Z3DA 4ZKRU 5C0UA 3Q3XA 3OY5U 1FIZA 3SOSA 4IBLH 2XC0A 3ZZBA 4ZHLU 2ANWA 1EAXA 4CBNA 2QV1A 4I7YH 2FTMA 1QBNA 1KXFA 2PSXA 2YNAA 1MZAA 5EXNA 2B9LA 3KQBA 1O2NA 1O2WA 4DT4A 3ZIAD 2Q6FA 2PKSC 3F0PA 1AFEH 1S6FA 1GHWH 2BTCE 2TGTA 2ZFFH 1TFXA 1BHXB 2HLCA 1F0RA 5F8TA 2FX6A 1SGEE 1EKBB 2A4GA 4JYUH 3MH6A 1SFQB 4GCHF 3IWMA 5FCRA 2KR7A 3H09A 1C5TA 3OSYA 2LELA 1QB1A 1HV7A 1QNJA 3N7OA 2GKVE 1Y8TA 2A31A 1TGBA 4X6MA 1HAOH 4UFEH 1TBQH 2AGIX 1GI7B 1QRWA 1BBRK 2GMTB 2NU2E 3ELAH 2Y5GA 2FOAA 1FAXA 1AZZA 1Z7KA 1IHTH 4KP0A 4FXGH 2ZDNA 4R8TB 1JIMA 1GL1A 5DP9A 5FPSA 3VB7A 2ZGXH 1GHAF 1HFDA 2W5EA 2STBE 4XSKU 2QAAA 1UTKA 3SU0A 1QQUA 2TGAA 1AHTH 4NIYA 2ZQ1A 1B0FA 1BHXF 2R9PA 2YMSC 1FN8A 1E1QD 2W6ID 3URDA 2QF0A 1B7XB 1QL9A 2FEQH 1C5YB 1GI6A 1G9IE 1GI3A 1GCTC 1BB0B 1TPOA 1E1RD 3ATWA 2XXLA 1NPMA 2ZTXA 5BPEA 3SJIA 4WMEA 1QJ7B 3GYLB 1CGHA 1TAWA 1ARBA 1SBWA 3TNTA 4FETA 1P3CA 4HFPB 1H9IE 2ANKH 1QBVH 4M9FA 2G55A 5BRRE 1N6XA 4NZQA 3SV8A 5GIBA 2GTBA 2HNTE 3PV5A 2VWLA 5FL7D 2BX3A 1EX3A 4HTCH 2ZU5A 3VXFH 4JZFH 3DUXH 1TABE 4I8LA 2XTTB 1EB1H 4X6OA 1S82A 2BY7X 1P2JA 3Q76A 1KXAA 2BY9X 3D23A 1THRH 1QJ1B 2WPMS 3BG8A 1SKYE 3SNBA 4ZAEA 2ODQA 4IC5A 1EP6A 2Q6GA 3RXLA 4OS2A 1ZRBA 4Y0ZE 1UTOA 3TH2H 3VG8A 1GBBA 1ELDE 2A4OA 4MNVA 2OC0A 1L0ZA 4H6SB 3V3MA 1ZSLA 2UWLA 1FY1A 1MBMA 2Y7XA 1GBDA 4Y8XA 1WU1A 4A92A 1UCYE 1ELTA 4JZDH 4AFQA 3M3TA 5C1XA 2XWBI 3E90B 4ZKNU 4ZH8A 2SFAA 1ZMNA 3GY4A 1O31A 5AFZH 3DHKH 4WVPE 1SLXB 3LT3A 1EFRD 2CHAC 3ZZ7A 5EW1H 1AUTC 1EOLA 2O8LA 2UWOA 1K2I1 1YCPH 3D62A 2THFB 5LGOA 2BMGB 1BUIA 1ELFA 2F9UA 5EPNA 4AN7A 3FFGA 1SGNE 3M5OA 3SW2B 1HPGA 1X7AC 2XNIA 4U01A 2VWNA 4ZHMU 1GHXH 3F6UH 5TCCA 3I77A 3E16B 3LONA 4FUGA 2OC1A 1QIXB 1MQ6A 2XCFA 3TH4H 1YPHE 2C3SA 4F4OC 2NU0E 1Y3YA 4F49A 1MAXA 1VITH 2BY6X 4YT6H 1C2HA 1BMNH 4I8GA 1O3CA 1O2JA 3SJKA 4E05H 1C2GA 1FX0B 4YOGA 2D8WA 1S83A 2HNTF 2R2WU 1ESAA 1A0LA 2JH6D 1TMTH 1LMWB 2DE9A 3SGAE 2BX4A 1FY8E 2G52A 5GCHF 3SU5A 1IQIA 1OWKA 3LKWA 1O2UA 1C2LA 2BVSH 3U69H 2C93B 2ULLA 2ZNKH 1IQFA 2BXTH 3GCHC 3SUEA 4LOYH 1IAUA 1FZZA 3FVFB 2P16A 4A6LA 3QUMP 2BLVA 2HOBA 4XBDA 5EXMA 1XVOA 1W2KH 3P17H 1GMCG 4R0IA 2NU3E 1ZHPA 1CSOE 1K1NA 4Z1MD 3MYWA 1E34B 1Z6JH 1A46H 1O3NA 2GX4A 1XVMA 1KMHB 1DUAA 3A86A 4Y10E 2GZ9A 3RU4D 5GPIB 3F1SB 5FX5A 1AUJA 2FIRH 3ZVAA 4K2YA 1ZYOA 2R3YA 2A7HA 5DP7A 3RM2H 3SJ9A 2RA3A 2P93A 1P2QA 2ZDAH 4FU9A 3LPRA 2ZIQH 1BRBE 2ZG0H 2J38A 3LOXA 1GI0A 1EASA 2WPJS 4YOJA 3PRBA 2FXRA 2Z3EA 2AGGX 1AE5A 1NBME 4OS4A 2SGQE 2C8ZB 1FJSA 2QXHA 3UOPA 1SPJA 3P95A 3ZYEA 5ESBA 4OGYA 1CE5A 2VINA 1GG6B 3MH4A 1DANH 5A09A 5CHAB 1K28D 1W0JD 1V2WT 3OU0A 4INLA 1P0SH 1GVKB 3OTPA 1C5RA 3Q77A 1V2QT 3RMOH 3UNQA 1O2QA 3RMMH 2W3KA 1J9CH 3TGKE 3ODFA 4FUEA 4IS5A 1HB0B 4DVAU 3SZNA 2OD3B 2ZGBH 1MMJN 1SOZA 1COWD 1ELVA 1O3AA 2B5TB 3F0OA 2ZU4A 3PO1B 1NTPA 1UTLM 5FBEA 1BTXA 4K1TA 3TJNA 1LVYA 4GHTA 1O0DH 3DFJA 4X1RU 2OTVA 4JCNA 4B74A 8GCHG 2TGPZ 1HJ8A 1SC8U 5B6OA 1C1MA 1D3PB 1C5ZB 4ABJA 3MH7A 3NZIA 1TONA 1TNGA 5CHBA 2FP7B 2ZGJA 3GISB 3SNEA 3SUGA 3ZV9A 1BDAA 2Z3CA 2ZWLH 1K21H 2BVRH 1DT2A 4LZ1H 2XBWA 2ZECA 1MTNB 3VXEH 4U2WA 2J34A 2A0QB 2ILNA 1DLEA 4WH8A 1ETSH 4A5TS 2K1QA 1P2IA 5C0TA 4CRBA 4MPUA 2UUYA 4MQAA 1YCPK 2AIPA 3SQEE 1TGNA 1GHAG 2BY5X 1AIXH 3RM0H 3QX5H 4OS5A 3PB1E 1PYTD 2J94A 3PM3A 4LZ4B 4Y79A 1BRUP 2HGTH 5TCAA 2F9PA 4ASHA 3F2HA 1P8VC 2W7UA 4Q7XA 1E38B 4Z0KA 2JDID 1GI1A 2Z9GA 3FP6E 1RTKA 1YBWA 1F0UA 1S81A 2Q1JA 4TYDA 4JK6A 4TWWA 3RXGA 1L1GA 1BBRE 1M9UA 1Z1IA 4DURA 1BTWA 4THNH 5JBAS 1XUHA 2NU4E 5C3NA 3UNRA 1CVWH 3M7UA 1C2FA 6GCHG 1TNLA 1GI5A 4YTAA 2QXIA 1KDQA 4GHQA 1CT2E 3DT0H 1NRRH 5AVDA 1OS8A 2BDIA 4MPWA 5GNDA 2F9OA 2RDLA 1ACBE 2WSSD 1EJAA 4XDEA 3M3VA 3H5CB 1DE7H 3OEHD 1HXFH 3LGUA 3CENA 1DWBH 1WSSH 2VGCC 4TPYA 3NKKA 1T7CA 1TIOA 4BAHB 1NU7B 4IN1A 2O9QA 4E7RG 5E2PA 1GBFA 3ZZ8A 2WPKS 4FU7A 1GBTA 5T6FA 1GJAB 1GI8B 3GICB 2M2AA 4CHAB 1GJ7B 1C5VA 3A7TA 1SQAA 1K1LA 2XCNA 1UTQA 4Y6DA 3ODDA 2Z9KA 2FYQA 4MTBA 5GXPA 1SB1H 3FANA 4WMDA 1MZDA 5ABWA 4NFEA 1HJ9A 1O3DA 4BAOB 3PMJA 3GY7A 3N7DA 5J4SA 1SGDE 3T5FH 1A5IA 1LCYA 1C1RA 2GT8A 1RIWB 1QGFA 3KL6A 2GD4B 1MTUA 4U30A 4X8UH 3EYDA 4NIWA 3E8LA 2OINA 1BJUA 2OUAA 1MAYA 3RXKA 1JXPA 3E0PB 4SGBE 1VR1H 3A7ZA 1NY22 2FOBA 1IQJA 2F4LA 3TJVA 1SR5C 4ZXYH 3PV4A 1BTUA 3BTQE 4YZUA 2ALPA 2GT7A 3LC5A 3MNSA 3P8OA 1E37B 2ZZUH 3A85A 3MI4A 2A1DB 2F9NA 6CHAC 1EZSC 2QGRA 2PKSB 4B1TA 4XBBA 2A5AA 2BLWA 3QZRA 1C1VH 1ELAA 5F53A 2O8TA 1A0JA 4KKDA 2GV7A 4K8YA 1YLDA 3F9GA 3U9AH 3ATMA 2KCYA 2VVCA 2Z9IA 1QURH 4XBCA 1P03A 2L6OA 2FX4A 1MU6B 1UVTH 1TA6A 4RSPA 3O8CA 3MNBA 1ZTKA 3M7QA 1GBAA 1O37A 1TNHA 1ETRH 4AFSA 4UFGH 1O2OA 5T3HA 1TWXB 2FI3E 1T8OA 3LIWA 3P8FA 1O2YA 3MO3A 1J14A 3S69A 2ZFSA 2A4RA 1V2OT 1T32A 4X8VH 4AYVB 5LPEA 3WWBA 1Z8JB 5AHGH 2AERH 2GVFA 1DY8A 3GS9A 2YMSD 3ZZ4A 4NFFA 4CREA 4ZUHA 2IN2A 4K1EA 1LVOA 2C8YB 4ABBA 2YMSB 1HAYB 1GJDB 3UQVA 5EXLA 5DP5A 1QCPA 9LPRA 1GCTB 2FI4E 3QLPH 3UREA 1UHBB 1FNIA 1DDJA 1TX7A 5E2OA 1P12E 5I25A 4A1XA 3HATH 4Q4LA 1XUIA 3G01A 1BRCE 2XBVA 3A8CA 3MTYA 2P59A 1ESTA 5F6MA 3P70B 2H9TH 1L1NA 3RDZA 1S0RA 3PTBA 1AVXA 2H6MA 1QA7A 1Q2WA 3TIUA 1AGJA 1P9SA 1V2KT 4AFZA 1TE0A 3KF2A 1AWFH 1ZPBA 1O2MA 4MNYA 1GJ5H 4TY6A 3ZZAA 1MKWH 3HK3B 1ZR0A 1GGDC 1C5WB 2KCAA 3UB0A 1OOKB 2ALVA 2ZGHA 1O3BA 1TNKA 1TX8A 2ASUB 3UY9A 4Y7BA 1RS0A 1YGCH 1J15A 4INKA 3JZ2B 3ESTA 1C2DA 2P8OC 5B6LA 2JETC 4FUHA 3SUDA 1Y59T 3HK6B 3IG6B 3MOCA 1V2LT 2CN0H 2PTNA 4NWKA 3UNSA 1GHVH 1C5QA 1C4V2 3GCTF 2KCOA 1AFQC 2VH0A 4NIXA 1GJ4H 2G5NA 1L1JA 4JYVH 1UTNA 3TPIZ 1W0YH 2WV5A 1UJ1A 2ANYA 4AX9H 2J95A 3PRDA 2R0LA 3K6ZA 1P3EA 3T26A 4CR5A 1P10A 1D9IA 3BTKE 5AF9H 2VNTA 5C1YA 1AVGH 1UVSH 2V7QD 1EUFA 1G3DA 2CHAB 3SU6A 2B7DH 2ZQ2A 2Q6DA 1E0FD 1O2VA 1SOTA 1FV9A 4A7IB 4CRDA 3UR9A 1O2IA 2RA0A 1P2MA 3RC6A 3GY2A 2NWNA 3FAOA 1TQ7B 1C2EA 1W0KD 1GMDF 4FUIA 1FY4A 1YP9A 3GDSA 7LPRA 5G4BA 3UWIA 3LU9B 1CO7E 1Z1JA 1A0HB 3BG4C 1V2MT 4J2YB 3TNSA 4ISNA 6ESTA 3UR6A 2QF5A 1S6HA 2QN5T 1HAXB 3NUMA 3T29A 4AORA 3UPEA 4O3UA 1SGRE 3QWCH 1DWEH 3PLBA 4Y7AA 1KYNA 3M7TA 5I46H 2WZQA 1ZGVA 2EI7A 1DPOA 1OWEA 1C1SA 5GDSH 1NO9H 5PTPA 3LGVA 3LJOA 5HYOA 1FPHH 1ELGA 1V2TT 4Q7ZA 1HAIH 1W12U 4BTIB 5C1UA 2BDBA 3PTNA 2OP9A 3RLYH 2GGVB 1PQAA 3PROA 2VB0A 2BD4A 4AOQA 3GY8A 1BTZA 3EA9A 2FODA 2VH6A 1V6DA 4HI3A 3SU2A 3F2GA 1FIWA 3GCHB 2ZC9H 4CBOA 1A5GH 7GCHF 1OXGA 1DS2E 3MWIU 1H8IH 1TRNA 1XUKA 2ZFTA 5JYIA 2FOCA 1O33A 1UTJA 1K1PA 1HDTH 3QK1A 4NA7A 2FM2A 1RJXB 2XYAA 1Q31A 1ZSJA 2ZDKA 1MD8A 2OLGA 1MBQA 2VIP