3U1LA

Structure of the mrna splicing complex component cwc2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
225
structure length
216
Chain Sequence
b'SWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLALRTEVLDCFGREKFADYRRKKNKTLYVGGIDGALNSKHLKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDDRREGTGLLVKWAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor CWC2
publication title Structure of the mRNA splicing complex component Cwc2: insights into RNA recognition
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
total genus 68
structure length 216
sequence length 225
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF16131 Torus Torus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3u1lA02
2MZRA 1M90T 5DDOC 1Q7YT 2KRBA 1HD0A 1UW4A 2DNGA 5IM0A 2MKHA 1OPIA 2OTLS 3CCSS 5GADU 2CPIA 2RUGA 4CH0S 2MSSA 4LMZA 2DHGA 2MZQA 4V19X 4FXWA 5DM6Q 5LSLA 2LA4A 2KXFA 3MUTP 3UCZP 3U1MA 2DHSA 3CCMS 1VQ7S 2HZCA 2KH9A 3R1HA 4F02A 3MD3A 3G8TA 2F9DA 4QU7A 2E5GA 3R27A 3CCUS 2DGWA 2CQ2A 2MXYA 3J7YU 2DB1A 1VQKS 1YIJS 3CCQS 2DNZA 1WHYA 2DGSA 1WF0A 1Q81T 2LKZA 2E44A 2MY8A 2AYEA 3BO4A 1FXLA 3NMRA 5LJ5Y 3UCUP 1NO8A 2M8HA 1FNXH 2KFYA 2LMIA 1QM9A 2WBRA 1JMTA 2DGXA 4QPTA 2XSFA 3EGNA 1XN9A 1PO6A 2MSTA 4LJMA 3P3DA 1U1PA 3ZZZA 4IO9Q 3CC2S 2MY7A 2AYMA 3CTRA 4Y0FA 4IOCQ 3I56S 2MZ1A 1OWXA 3FEXB 2KG1A 1VQOS 3THTA 5LXRA 2CQHA 2E5HA 3MXHP 4W92B 5HL7Q 2E5JA 2M2BA 1WHWA 2MKIA 3UD3P 1Q82T 1G2EA 3VAIA 2KXHA 5CA5A 4CIOA 1WG1A 2YH0A 1UFWA 2DNOA 2VONA 1P27B 1X4HA 2LCWA 2KM8C 3CXCR 2MKJA 1QVFR 3S8SA 4F26A 2QA4S 1K73T 2LXIA 3CMES 2OSRA 2CPEA 2RNEA 2X1BA 3G96A 2VOOA 1X4BA 2XS2A 1VBZA 2FC9A 1VQ4S 2MHNA 2K3KA 2MKSA 2LECA 1OO0B 1YITS 1WWHA 3SXLA 3TYTA 3MUVP 5DDRC 2LEBA 2RS8A 5JVHQ 3BEGB 3DLLQ 2EK6A 2J0QD 5EN1A 2YTCA 2EVZA 1YWXA 1CVJA 3VAHA 3D2WA 1AUDA 4BS2A 2NZ4A 3P5TL 4CQ1A 5GAHU 5MLCV 5LSOA 3G9CA 2DHXA 2CPDA 1U1QA 2FPHX 4Y00A 3BO3A 1DRZA 2DNLA 3VAGA 4TU7A 1WG5A 3R1LA 2U2FA 1X4GA 2X1GA 2MJNA 3UD4P 1WF2A 2M52A 1UAWA 1SXLA 2JRSA 5IFMA 2DNRA 5DDQC 3NNHA 3S01A 2ZJRQ 2A3JA 2MQOA 5DM7Q 2AYGA 3S7RA 3LPYA 2OTJS 1VQ5S 2M9KA 2N3OA 1Q86T 3VAMA 2MZSA 2Q79A 1L3KA 4EGLA 4PRFA 2RRBA 3MDFA 4ZKAA 5IQQA 4QQBA 2L9WA 2KRRA 1VQNS 2V94A 2KU7A 2KG0A 2GHPA 4W90B 1M1KT 2D9PA 1WELA 2MQLA 1SJ3P 2MQMA 2FHOB 2ZJQQ 1WF1A 5GVQA 3CCRS 1DBDA 2CQ1A 2D3OR 3N9UC 2YH1A 2VOPA 2DNHA 1X5OA 2KT5A 2PE8A 1KC8T 3VF0B 3SMZA 2ZJPQ 4TU9A 1O0PA 5ITHA 1WEYA 3NNCA 2CQCA 2LEAA 2NLWA 5D77A 2MGZB 1K8AT 1KQSR 1VQ8S 2MB0B 2DH8A 4RU2A 3EGZA 3P6YC 4QU6A 2MMYA 2MZJA 5DETA 1X0FA 2UP1A 3MD1A 1ZZFA 2DNYA 3H2UB 1WG4A 3HI9A 1M5PC 2CQ3A 3UCGA 2HGNA 2JVRA 4WFNQ 4LIRA 2DK2A 2D9OA 2KM8B 1DZ5A 2QEXS 2JWNA 1YJNS 1JJ4A 2U1AA 2GO9A 2MJUA 2CQDA 1W2BR 3MOJB 2DNQA 3LQVA 3NS6A 1VBXA 1YI2S 1YTYA 2J0SD 1X4CA 2LYVA 1JJHA 4C0OC 1U1KA 1B7FA 3CULA 3CC4S 5BJRA 3P49B 1K9MT 2M7SA 1VQMS 1S79A 2RS2A 2BOPA 2EK1A 2CQ4A 1X4AA 1PGZA 5H1SV 1U1RA 3SDEB 2DO4A 1H2VZ 2YKAA 1VQPS 1N54B 2DNKA 2DISA 1IQTA 2XNQA 2LQ5A 4C4WA 3FEYB 2CQBA 1R8PA 5GAGU 2DIVA 5IM0B 1HA1A 3G71S 2DNMA 1VC6A 3US5A 2MGZA 2QFJA 2HGMA 1RK8A 2I38A 1SJQA 2PEHA 1OIAA 4UY8T 1URNA 3THPA 4WFAQ 4WFBQ 1UP1A 4J5OA 2M4MA 1WHXA 2DIUA 2ADCA 3S6EA 1FT8A 5JVGQ 2DO0A 3G6ES 2CPHA 2RQ4A 2FY1A 4P6QA 2CQIA 3CCVS 1RKJA 3B4MA 2B0GA 3VALA 5HO4A 1FO1A 4YOEA 1VQ9S 1X5TA 1YJWS 2HVZA 1F9FA 3DXBA 2I2YA 3IRWP 4WF9Q 3CPWR 1NJIT 2X1FA 1S72S 3RW7A 1R8HA 1DHMA 2RRAA 1SJRA 5LJ3Y 2KXNB 1U1LA 4U67Q 2XS5A 2N3LA 3SDEA 2HYIB 3CUNA 3VAFA 1D9AA 1WI6A 1N52B 1QVGR 3CF5Q 2OIHA 2DITA 1VBYA 5FJ4A 3CD6S 1M5KC 3OW2R 4WIIA 3I55S 2OSQA 2CJKA 2CPYA 2HGLA 2M70A 4CH1A 1KOHA 5D78A 3NNAA 1X4DA 1JJ2R 3PIOQ 1A9NB 4IUFA 1VC0A 1D8ZA 2VODA 2MYFA 1U1NA 3HHNB 2DGOA 2CPFA 3BS9A 4YB1P 1H6KX 2LXUA 2XB2D 2DH7A 3MI7X 2G1DA 2L41A 3NS5A 1WEZA 3BO2A 2XNRA 2CPZA 2XS7A 2M0GB 1WHVA 1KOOA 4UQTA 3CCLS 2G4BA 5CXTA 1N8RT 1U1MA 3EX7B 1BY9A 3MURP 1HD1A 2MZTA 1YJ9S 2RU3A 2KVIA 4ED5A 1X4FA 3L3CA 2YWKA 3UE2A 4WCEQ 3MUMP 2KN4A 1H2TZ 3CMAS 3PIPQ 4C7QA 4WKRA 3CCES 3VAJA 4FXVA 2F9JA 3UWTA 2KYXA 5GMKa 3H2VE 4A8XA 2ERRA 1A7GE 4M5DB 2X1AA 1SJFA 1ZH5A 4ERDA 3B4DA 2JVOA 2CQ0A 3Q2TC 2MQQA 2RVJA 1U6BA 4IOAQ 2J8AA 2DGTA 2N7CA 3IWNC 2RT3A 3Q2SC 1HL6A 4OZ1A 2MQPA 3G8SA 1P1TA 2DGUA 3CC7S 4PR6A 2DGVA 1X4EA 4YUDA 1U2FA 3RW6A 2BZ2A 2J76E 4OZ0A 3ZZYA 2M88A 2KHCA 2M8DB 1WTBA 2SXLA 3U1LA 2MKKA 2CPJA 2CPXA 2E5IA 3J7ZT 4F25A 2MKCA 4PKDB 1YHQS 1FJ7A 1SJ4P 2O3DA 2KI2A 2MPUA 3K0JA 3VAKA 2DHAA 3TP2A 4TLQA 1FJEB 5LXYA 5GAEU 2CQGA 2RQCA 2MQNA 4TU8A 2LA6A 1FHTA 2CQPA 1N88A 1WEXA 2JX2A 3JB9k 1VQLS 2L08A 3TO8A 5DDPC 2FC8A 2AYBA 2OJ3A 1ZZNA 3CCJS 2DNPA 4Z2XA 5CYJA 1M5OC 1U1OA 1VC5A 1H2UX 1U6FA 3ULHA 1NU4A 3V4MA 2DGQA 2ADBA 1X5SA 2G0CA 2N82B 1X5PA 1FJCA 2DNNA 1VQ6S 1WI8A 2DH9A 3G4SS 2K8GA 2AD9A 1KD1T 1M5VC 2F3JA
chains in the Genus database with same CATH superfamily
3K5LA 4I6WA 1GX6A 4NZ7A 5E33A 4DFMA 4PCQA 2KJVA 3GCXP 1SL0A 1AXQA 4OYWA 4AUKA 3M8SA 1UJ5A 1GXLA 3MD3A 4OX9F 4RU9A 3ZTRA 1FFSB 1U48A 1E6YB 3RBXA 2K1RB 1HNXJ 2N7YA 3DLGB 3UN5A 3KK3A 5LSRA 2AYMA 3GCWP 3BGOP 1H38A 3PO4A 2PMHA 1NK6A 1VJQA 2J0WA 3CJ8A 4ETZA 5CA5A 2YH0A 4YB7A 4WXWA 2MLZA 3OFEA 1Y5LB 2BE7D 4PG6A 3H5XA 3SFGA 2G1HA 4ED7A 1YZ7A 2X1BA 2VOOA 4ZVQB 2Z30B 3PYFA 2Z8QA 5A76A 2R7TA 1TK8A 3G8QA 3G87A 3I9ZA 5AJ3F 2MKSA 1R6VA 1U6ZA 1S48A 2LEBA 3RAXA 5EN1A 3UNGC 1NPPA 1S1VA 3K59A 2YY3A 1XNQF 5MLCV 4NCBA 2OFGX 3IR7B 4UF4A 4XAKA 2BABA 2AZ3A 4DF8A 2JRSA 3TVYA 1S9EB 2UUWA 2MZSA 5CCLA 3LWMA 1OY6A 4HI2A 1G1XA 3GFYA 4P72A 1BLUA 4HL9A 4ZHRA 4LR8A 3KYLA 3TUZC 1WF1A 3JYTB 4DV5J 2ZC4A 4CWBA 2UU9F 3TZYA 4B3SF 4TU9A 2ZE2A 2E7WA 1DQAA 4KQZA 4FNHA 1N6QA 3MR7A 3ZNUA 4DUTA 1J2VA 2CQ3A 2GVDA 2DK2A 2QEXS 3J80U 1JJ4A 5HVHA 1W2BR 1D9FA 1X4CA 3D7SB 5J2MA 2IY5B 1NSPA 4F4XA 1HW9A 3KJNB 1VQPS 3AQPA 2B4OA 2V63A 1WOOA 1U26A 4UOFA 4OX9J 2EEYA 2Y8WA 4URGA 4C3MA 3DGPA 5G4DA 2VBYA 5HSPA 4UOHA 4R5PB 3IR5B 2V2VA 3D3BJ 4QJVA 2FVSA 3G6ES 1RKJA 2VH7A 1XR7A 4RW6B 3WX8A 1NJIT 4FF3A 3HF5A 1S76D 2RRAA 2UUAJ 1DFDA 3BR8A 3ZZRA 3Q8UA 2WVEA 2FLPA 1UVLA 1QAYA 5H9EJ 1SB6A 3K5OA 2M70A 1KOHA 2R2TA 4FDFA 3NNAA 1FVQA 3Q24A 4DPOA 5AJ3J 1URRA 1Q8IA 4HR2A 1IWAA 3QO9B 4EWTA 4DL3A 3LGHA 2IBKA 1WEZA 1XR6A 2ZFHA 3OVAA 1RTZA 4XPCA 4DV0J 5J1NA 4UQTA 2HFNA 1HD1A 3UDLA 4YDXA 2KVIA 1XNQJ 3MECA 3H25A 1GNKA 4ED4A 4DSIA 2F9JA 2VBZA 5AT1B 1CLFA 2ERRA 3JSRA 4DCPB 1A7GE 2JVOA 4LF5F 5B0AA 1NRKA 4LBHA 3Q2SC 2ZOMA 3WC2A 5U47A 4OZJA 3THVA 4KGZB 1XMBA 1U2FA 4RX6A 2CPJA 4M5JA 2MDAA 1L3UA 4N41A 2MKCA 2UU9J 3M9NB 2GHVC 2P9CA 3KHGA 4B3SJ 2DHAA 4LT6A 1ZETA 1Y5IB 3PTWA 4OYOA 3KXDA 3SEOA 2HQFA 1PAEX 3DMJB 4ECSA 2LQ9A 1F1BB 5KT5A 3CCJS 2DNPA 5ETVA 2A6MA 3IXQA 4GKJJ 1U6FA 2CZVC 5KT2A 1N5SA 2YNFB 1K0VA 3HCXA 4KFBB 5IC4B 1VISA 2AF6A 2G2ZA 2HZVA 2RF2A 5SZTA 5HROA 4X4VA 5HP1B 1RUSA 5LSLA 2XYPB 1Y7PA 4OIXA 2DHSA 2W1BA 3HVTB 5B08A 4RW8B 2EWHA 3U7JA 3M1VA 3I0SA 1TP7A 3CCQS 1GMWD 1Y5NB 1WF0A 2VL1A 1N0UA 3GYNA 4G3IA 3PRBA 3SCIE 3W2VA 3NMRA 2GVZA 2QA1A 3EUNA 1LWXA 5IOLA 6AT1B 1UEKA 2CYYA 3EPIA 4FKYA 3NCRA 4KV8A 1BWVA 1X8DA 3GV8B 1N5TA 4XIUA 3F0NA 1I51B 2MY7A 1E6VA 2YKMB 5J1PA 2Y0BB 2J7WA 2UV8G 5M2PA 1LQ9A 1RQ0A 2E5JA 1G2EA 2FJBB 1T3NA 3MPDA 2C3MA 5KFHA 4A46A 5C2CA 3OUYB 3M8ZA 3ZTPA 1RWPB 2RJZA 2XS2A 2EBEA 3PJ9A 4YB5A 2MHNA 2DYAA 2MEWA 5CYMB 5C7PA 2XC9A 1FVSA 3IFEA 1AUSL 2L9NA 3MUVP 1IQZA 1LWEB 5KFRA 1IM4A 2EVZA 3Q0AA 4A8YA 4Y65A 2ZM6F 3BH7B 4ELUA 3VAGA 3DRYA 2ZBIA 2DR7A 2RMLA 4PG5A 1TAUA 3I82A 1IR2A 4LF5J 4CYUA 5DDQC 1NSQA 3LPYA 4JV1A 1HI0P 3A4TA 4C11B 4PRFA 2FHJD 4F50A 3C6TA 3RB6A 1UEUA 1VQNS 1VQSA 4OJ3A 1D3WA 2D9PA 5CZVA 1WELA 2I9SA 2FJVA 2FZKB 5KFMA 4IFVA 4PUOA 1X5OA 4M5NA 2C3OA 4J9KA 2RHQB 1RT5A 2V4RA 2LEAA 5A0YA 3TX0A 4EMDA 4ZDNA 1UJ4A 4KH1B 5KFBA 4L74A 3HI9A 4QBUA 2JVRA 5IS2A 3QBCA 4H4MA 3NS6A 2LYVA 4C3KA 1U1KA 4FYDA 1S9GB 3CC4S 4ELTA 3ENWA 1Z2ZA 3W61A 1C1CB 2QX0A 4N76A 1BQNA 4WBFA 4FBTA 2XGQA 4JUZA 4H54A 4UZCA 2GO8A 1VRTA 1VFJA 4TVAB 3VWSA 3CD5A 1FTRA 2UZAA 4C48A 2DR9A 1URNA 1GTHA 2HVDA 2M4MA 3QGHA 1Q8KA 1CJKB 4E0DA 1FO1A 2XYHB 3POTB 2VPZB 3KLGA 3K57A 1KNZA 3DXBA 3OR2B 3IRWP 4OI0A 4KHRA 4K4XA 4ZVTB 1WC5A 3GJQB 1KHWA 4ANEA 1RT3B 4NCGA 2HYIB 3O44A 1C4CA 4NE9C 1Z4UA 3M2UA 3OW2R 4WIIA 3I55S 1T9TA 3D6FB 3IWLA 1A9NB 2XLIA 4QIEA 2XB2D 3CJSA 3NS5A 4U7CA 2GW8A 2XS7A 4UY85 2A6OA 2ZM6J 3MURP 1L5UA 3AB4B 4ED5A 4KYZA 3MM9B 3UE2A 2HRTA 1F5CA 1H2TZ 4LBIA 4XTTA 1RWXB 4CCHA 1SJFA 2HPUA 2FVRA 3B4DA 3NGKA 3PFEA 4G1PA 1RWMB 4RNFA 3VQSA 3G8SA 5D8HB 2F4VF 1TKXA 3QRPA 2WSFC 3O6QA 4CYUB 2VD3A 2UVUA 5IV3A 1RT7A 4DSLA 2M88A 4WFXA 5I3UB 2P9EA 2QRRA 1VLOA 1GXUA 2DD8S 3ADAC 4NLGA 2O3DA 2XM3A 2IJNA 3OR1A 2L9DA 2XMTA 4TU8A 4WTYA 1H74A 2OMLA 1V5VA 3C16A 1T95A 2R7XA 2FC8A 2OUGA 3BDEA 1I5OB 2HIYA 1F5AA 2EKNA 3ULHA 3M9OB 1TKZB 2XHWA 2X51A 1XR5A 4LFAF 1X5SA 2AEFA 5EX3A 2ZZMA 4JI3J 3TANA 2VJVA 5KG3A 2ZNYA 5BXIA 4USIA 3EWGA 2OD6A 5DQIA 2KDOA 2DNGA 5F8GA 4M95A 4EUVA 2MKHA 2IBOA 5HI7A 4JOUA 2VU5A 4CH0S 2FZGB 4I6YA 2BJ7A 2Z2LA 3NKYA 1RTHA 3GFHA 3T5JA 4F02A 1KRPA 1U8SA 1C1BA 4ECUA 4IR1A 3PEHA 1TL1B 1PYTA 5IT0A 4NPOA 3DI6A 4QR0A 2EW9A 2KFYA 2H51B 3MMAA 2ZHAA 3CJ0A 3M8YA 2XSFA 1DQ8A 3DOMB 4C8LA 3W60A 1HQEB 3DRSA 1QAJA 2OEJA 1AT1B 3V81B 4PQUB 4I7FB 5LXRA 1S0VA 4KHMA 2KZMA 1A6LA 3KLGB 2HQIA 1NHUA 2ZH8A 2LCWA 4ZK7M 1SUQB 1GMUA 1IKVB 5C2GA 3KKFA 4QW9A 2QV6A 4ILMA 2YKOA 1WOPA 4ID5B 1YITS 1TMJA 1ICEB 1FFGB 5DDRC 3V6JA 1N48A 3QIPA 1TV6A 2V67A 5L9XA 3M8WA 4NLTA 2E9RX 3C6UA 4IG0A 4BS2A 3A12A 2DHXA 2PA8D 1NKBA 1YK9A 4ZPWR 3MEKA 4DN9A 4TU7A 3HZGA 4KE5A 3H98A 3TQ1A 2EG1A 1UAWA 3W63A 3U27A 2QO3A 1WDTA 3KLEB 2FIUA 2F4VJ 3TA2A 4LSZB 3MDFA 2KFZA 1FTCA 3ZZTA 2ZVSA 3UVJB 2ZJQQ 5KFFA 4YQWA 1MLAA 2FHMA 5HK4A 2B4PA 2IMWP 2HFOA 2WBMA 3WZ0A 2NLWA 2XG8A 4RLEA 2B5JB 1SKUB 3MD1A 5ETNA 2HFSA 4F67A 1RHJB 3MAAB 4LFAJ 4RL1A 2VASA 1IKWB 2C2RA 1Q16B 4TN2A 3HSZA 2XY6A 1WJ9A 1P9YA 4TKTA 2BOPA 2VUGA 1RXOB 1LW0A 3SDEB 4DZ6A 1FK9B 3IRXA 1HBOB 1CC8A 2FJWA 3LGNA 1R8PA 3CCWA 1T03B 2R2SA 5J2PA 2EFGA 1VC6A 1R0AB 3PKMA 2OO4A 3LH2S 1RBLA 3UPFA 4U7UD 5IWAF 3AJ1A 3GPAA 4OX8A 4WFAQ 2D74B 1CSJA 2LLZA 2ZH7A 4K0KF 2VHGA 2CPHA 2XGPA 2CQIA 4YOEA 1VQ9S 2IM3A 2KJWA 4M5LA 2G2OA 3BREA 3H8YA 1JLCA 2O1PA 3EMTA 1DHMA 2KXNB 4U67Q 3SIPB 1HBMA 1FD8A 1JKHA 2D1CA 2ATLA 5BYRA 4QYZK 5HBMB 2XHCA 2CPYA 3W2WB 1T0TV 2YNGA 1FE4A 4IQMA 3HHEA 3DU6A 5HLFB 3K89A 1DLOB 4X4SA 5ADZA 2L41A 4IOBA 2CPZA 2GMJA 1WHVA 5CABA 1HIYA 2MZTA 4A8WA 3L3CA 2VQFF 4WKRA 4C7QA 2R7UA 2WSCC 3KG0A 1B0PA 3FNNA 1TFWA 2J8AA 2XBPA 2NCKL 2OP5A 1ZM9A 2FJXA 5F41A 3G82B 2GFFA 1NK7A 4AL5A 1X9SA 4C8KA 2KHCA 3H5UA 4RJVA 2FJAB 4ZS6A 3GIKA 1YVFA 1DJ0A 1YLXA 4NMLA 4WE1B 2WZ1A 1LNQA 1FJEB 3FFIB 3W9IA 2AHOB 1N88A 2QLXA 5A8WA 1VHIA 5CYJA 1L3VA 1Y0HA 1CS4A 1X0PA 3TOQA 4NI2A 3M6XA 2OAUA 1B3TA 2DH9A 3TZZA 2VPWB 2AWZA 2D3UA 4NLYA 2VBXA 4I2PB 1AFJA 4QYRA 1HI8A 4K59A 4K5RA 2QJ3A 1HD0A 3GU0A 3ILIA 1H73A 2V69A 3BBBA 5EHHA 2PDAA 1N36F 3MTJA 4V19X 3MEGA 4LSLB 1QUVA 4XDDA 5DRKA 2YNHA 2KH9A 2P6TA 1RAOA 1KFDA 3JQKA 5IWAJ 2L3MA 5I3PA 2DNZA 2ZDOA 3DOLB 1HNZF 4M1KA 5J2PB 4DF4A 4K0KJ 3FKBA 4RBUA 1RBAA 1T9UA 1S6OA 4IG3B 4PZVA 2BJ3A 3QAEA 2FY8A 2JLGA 2ZKUA 2GQ2A 1UWBB 4W92B 1XNRF 2M2BA 1UFWA 1HWLA 3ZO7A 4G1QA 3S8SA 1GAOA 2W2QP 1HBMB 2OSRA 2RNEA 4J9QA 1ZOTA 3QZ7A 2ZKTA 2LECA 1WWHA 3I9V9 3TI0A 1NPRA 4CZCA 3LALA 2PA3A 3CJKB 3I6PA 4DL6A 2NS1B 3D1QA 2VQFJ 3P5TL 4M5IA 3KTQA 2V0NA 4ZPTR 1SL1A 2LVWA 5G0RA 3SFUA 3KNGA 4BWMA 3MM7B 2GIQA 2AJ1A 4DL4A 2AYGA 4YMEA 1TKTA 4DU8A 4GMKA 1Q86T 3VAMA 5FLXU 4QQBA 2ZHOA 3KLVA 4Z7CA 2QA2A 2PO4A 4QR1A 4CP5A 4F4ZA 2OPQB 2UVRA 2GZOA 2YH1A 1EB0A 5ITHA 4USTA 5B0FA 1RT1A 5FIIA 4HKQA 2YQ1A 5D3GA 1JB0C 1UMJA 1LK7A 3AD8C 2CNOB 5H9FK 2C3PA 5IZHA 2POKA 5AXMA 2PI5A 1F0XA 4OV1A 2U1AA 4WU3A 2FTRA 1FE0A 1WC1A 1JJHA 1O51A 3OHBA 2R9LA 2PEBA 1N36J 3HFZB 1EAYC 1IQTA 2XNQA 1U0HB 3IAS9 4CTAA 3LAKA 4P7VA 5D0RA 4IRKA 4DR4F 2BYCA 1SJQA 3MEGB 1UKUA 2QLJB 2G13A 3FCWA 4DR3F 3ETOA 2F8EX 4KPYA 2DT9A 3GFZA 2JLEA 1ZTWA 1FT8A 2HLTA 2PMWA 4L3NA 1DAXA 5AE3A 2JEFA 3GV7B 2B9EA 1G3OA 5DG8A 2Y9HA 1XNRJ 1NJYA 2IRUA 1JIHA 1ZM4A 1VBYA 3CD6S 5HMYA 5KG5A 3NBPA 1S1TB 2QIFA 5E3PA 2OSQA 2DR8A 4CH1A 4L76A 5L9NA 2VPXB 5FD1A 1HLWA 5J1EB 2CWKA 2JH3A 3LP0A 5KG2A 2ZHBA 2B43A 3LO3A 2ZH5A 1LEOA 2LXUA 4RW4A 4TNOA 2G0JA 4DX7A 1FKPB 3HSDA 3MCSA 3PW5A 1BY9A 1GQEA 2YWKA 2KN4A 3TWZA 1CJTB 2W9BA 1HYSB 5GMKa 5KFQA 1OQ3A 4ERDA 3FBFA 1KS2A 4KGXB 3Q2TC 2RVJA 1EETB 2NPFA 2IAJA 1QD1A 3HT3A 1HL6A 2A2DA 2J8SA 1HW8A 3ENQA 3R6LB 4YUDA 4A4JA 1RE1B 3HD2A 3GIMA 1S1UA 1OY8A 2XSJB 1RBOB 2E5IA 3OHAA 1SJ4P 2IPOB 3L95X 3EXCX 3DLHA 4QWCA 1K1SA 3UI3A 1D1UA 2YNIB 2QYGA 3ILLA 5L8RC 2F40A 3QT7A 3N28A 4M5DA 1R31A 4RUAA 4LQ9A 2UVVA 2K8GA 3MM6B 3SSQA 3M8PB 2MZRA 2QN6B 3HVRA 3CIZA 3PHTA 2DXFA 3CCSS 3R7BB 3I5BA 3UDEA 4DFJA 3M32B 3TUJC 4DR4J 3G8TA 3LPEA 4P75A 4RWXA 2CQ2A 3AJDA 2R42A 4DR3J 1HHQA 2Y1IA 4CTAB 5BR8F 2VG6A 2AYEA 1HPZB 4AQYJ 1IBMF 4DV3F 4X64F 3TVKA 2F5GA 1QE1A 4DL0C 4PWWA 3B8HA 5IT4A 4EBEA 4MKBA 3QZ8A 3THTA 1NSAA 1FWLA 5HL7Q 2VA3A 3BN4A 1Q82T 4DL2A 1BWEA 3DM2A 5SUHA 1LWFA 4C9DA 2KM8C 2B9XA 2MQ8A 3NMAA 1I1GA 3W5YA 1K73T 4UOGA 3GONA 1F2GA 3GLJA 4ZVEA 4O0NA 4DS5A 3QWPA 3M7VA 5J2QB 5JVHQ 3W9JA 1Q8LA 3O5TB 3DYAB 5ETMA 4OHXA 4JP8A 5GAHU 2JDJA 3OQ2A 3LP2B 4LRAA 4JBCA 3HSGA 2ZVIA 1FRMA 2QLBB 4IQXA 5AE1A 3S01A 2F7VA 1XQIA 3AT1B 5ETSA 1NK0A 3BF4A 3Q8RB 4M63A 4X4OA 4R25A 3MPWA 2KU7A 2YWFA 2KG0A 2P8IA 4W90B 3GG1A 2AIRB 2BJEA 1I3OB 2R3VA 5KFVA 4FPIA 4I69A 2ALZA 2R4FA 2V4JB 3R3TA 1DBDA 2ZEJA 3NGRA 1TMMA 3PYEA 2QZ8A 1K0TA 3I31A 1FEEA 4Z37A 2QMXA 4NMXA 2XMAA 2RILA 4DXLA 3H2UB 4K4VA 2EFPA 1TUGB 4MTPA 3UCGA 3OLAA 3HX9A 3MM5B 2YWGA 2HNDA 1CJVA 3DLBA 1IXKA 1SH2A 3M2VB 3CO9A 3UO0A 4L73A 4K4ZA 1OSCA 1R8AA 1WC6A 3CEDA 4KBIA 3K5PA 3DXSX 2FB0A 2MGZA 3JSMB 2AGOA 4O23A 3T1AA 5HMZA 3OTOF 5BR8J 4X4QA 3AOBA 4OZ5A 5KFLA 2DIUA 3L09A 1IBMJ 2FY1A 4DV3J 2ROPA 4X64J 4D3HA 4RKUC 3QLHB 1KLMB 3ZTOA 3VTIA 1REVA 2X7IA 2BA9A 2W4CA 4BHQA 4Y28C 2W8KA 4V19J 4W4MA 1S6PA 3BGUA 4K8RA 2PD1A 4O3OA 3CUNA 2RQKA 4O4GB 1N52B 4LSNA 1IKYB 2A1BA 3CF5Q 1RCXB 1WTFA 2C2OB 4GO7X 3IG1A 1T9XA 2RKIA 1PBUA 4GKKF 2DJWA 1WC0A 4K4YA 3L4BC 1D8ZA 2VC1A 2VODA 4DV2F 1QDUB 5C42A 3Q86A 5EWEA 4UTGA 3CIMA 4KRWA 3EDRB 3J81Y 1KOOA 4LVOP 3NAIA 1JLBB 1HHTP 1Y9OA 2QL5B 3JAMU 4FYWB 2HQGA 3KLIA 1GFWB 3UWTA 3H2VE 3PG9A 1PYSB 2OH2A 4Y2AA 1JLEA 3KJQB 4MAKA 2NR0A 5T7LA 2PIIA 2Q66A 4HEA9 3CC7S 4IO1A 1I6JA 4ES1A 3L7OA 3WIUA 2V9WA 4X66F 3GYXB 2CKWA 3M2RA 2L48A 4L6V3 1NHKL 2KI2A 2BRKA 2O01C 3Q83A 1NDKA 2GIRA 2XMUA 4HHJA 3R97A 1DQ9A 1ZYQA 3JB9k 2IDLA 1UVMA 3A1YG 3D0HE 3BQ1A 2MLXA 1BHNA 2I5JB 1XMQF 1M5VC 2VG7A 1G6BA 3TJAA 3LA0A 1M90T 5I4MA 1Q7YT 5F8HA 2BE2A 4AXJA 3RGIA 5F3ZA 3I32A 2IC3B 2C42A 3QIDA 2RUGA 2DCUB 2MSSA 1CBKA 4FKXA 2LA4A 3NL0A 1PJ7A 1JLQB 1NK8A 1VOMA 4DL7A 3MMBA 2OHDA 2V2KA 2F9DA 4DG1B 3OTOJ 3T6JA 1C0TA 2DB1A 3KLHA 2EI5A 3J81j 4EYIB 4K4TA 1SC3B 1NK9A 4RW7B 2MY8A 4ZIVA 1DTQB 2LMIA 1VI7A 3MEDA 3M4XA 3W3SA 1PO6A 4OX7A 3KDNA 5I42A 1CULA 4WP9A 3B6BA 3DLEB 1RHUB 1EIYB 4IDKB 1WG1A 1GK8A 4DPWA 2C2ZB 2VONA 2CWXA 3UFCX 4GKKJ 5T14A 2CPEA 4DV2J 2DKOB 3DRPA 2FC9A 4Z7YA 3I0RA 2F1FA 4NLRA 4PWDA 2V50A 3BEGB 3M6WA 1RTJA 2W2NP 3O2IA 1NM2A 1OYEA 4K5SA 1UZDA 1O5JA 3H59A 1BQMB 4ZLJA 2JJ4D 1V3ZA 1Q4RA 4MK7A 2HK2A 4Y00A 4WIQA 2B56A 3BKUA 1S0MA 3TNVA 1ZPWX 4EGLA 4C8MA 4ZKAA 5ETLA 3Q8SB 2W4DA 3A8EA 1TK0A 1WD6A 3LW5C 2IRYA 2MQMA 4X66J 2BUNA 2H5JB 3HHLB 3NEKA 2QFIA 1NDCA 1K47A 2N4CA 4XO0A 1HMVA 1KC8T 3VF0B 1HBNB 5K8NA 2CJAA 1WEYA 3GJSB 4ILRA 2MB0B 4A8FA 2MMYA 1ZZFA 2DNYA 3LWLA 1Q79A 3JTOA 4P2SA 2OPSA 3UQSA 2KM8B 2D9OA 1XMQJ 1XJWB 1U7LA 2GO9A 1VBXA 4C0OC 3RB0A 2GGPB 3OXFA 4O0IA 1RT4B 4CRJA 3BSAA 4CM0A 4PXBA 2OPRA 3QSIA 2YKAA 1JQGA 3BGLA 1T05A 1BUXA 3A8KA 4DHVA 2BKOA 3FEYB 4ECQA 4C97A 3VZHA 1FXRA 4Y2IA 3CD7A 1HA1A 1LOUA 3PX0A 1RHRB 4IH7A 2KT2A 1GMWA 4ES2A 1JLAA 1UA0A 1HNIB 4O4RA 2HHPA 4B9NA 2W2OP 4H4OA 4R0EA 2VFSA 3V2UC 2RQ4A 3V6DB 3KJVB 3VALA 1JWWA 2AEMA 2MTLA 3D0IE 2YX1A 1KN6A 1C0UA 2ZOGA 2YBVA 2RDJA 1D09B 4UUXA 2E7XA 1NDLA 1CULB 1YJUA 2VDHA 3O3LA 2VKRA 2V68A 1UVKA 3EPGA 1Q53A 1MROB 3IR6B 3RBDA 3HHNB 3D6TB 4O44A 2H9ZA 4DCOB 2IVYA 4OYMA 4UZBA 2XNRA 4KO0B 3KK1A 3CCLS 2VG5A 1QTMA 2DEIA 4F4WA 3T6BA 3RU0A 5EX0A 2HMIA 1VRUA 3N79A 1JLFA 4DV7F 2UUBF 1QUPA 2VICA 1DTTB 5EWFA 1ZPVA 1KEKA 3EVOA 3G6XA 1VDHA 2OFHX 3D0GE 4F2SA 2DR6A 4HTJA 2FHJA 4DPYA 2CZ4A 4USHA 4CO5A 2OEMA 4KPCA 4ZPDA 2QL7B 3U1LA 4BC9A 3DRRA 2CJYB 2I0XA 2C1EB 1GTEA 3RZAA 1CEZA 3T9NA 1YHQS 1BD6A 2CG8A 2WW8A 3VAKA 5LXYA 1RT2A 3MCMA 3NRBA 3GV5B 1RABB 2MQNA 2N4DA 1ZBTA 3JTNA 1KBRA 3HFVA 2L08A 5K8MA 3CDAA 1HWUA 4NL5A 4DR2F 2APOA 2BM1A 3J7AN 1YRXA 4ZN1A 4RNNA 2P2CB 3A3NB 3GSIA 1KTQA 1QSSA 3SQGA 3BSOA 4DX6A 1IUJA 4YS2A 2CZ9A 2KRBA 1S1WB 1OS5A 4PG8A 4ZVOB 5D6GA 5KFYA 3QGIA 3G2XA 1WC3A 2HLUA 4HI1A 3BGRA 3GYGA 3JSYA 4BC7A 1R8CA 1KONA 2B4UA 2RUSA 1KQKA 2PGCA 3J7YU 3OL9A 2VBWA 2LKZA 2JHEA 2Q1LA 2AP6A 1OYDA 2HSEB 2FDNA 3HVWA 2DXDA 4JV5F 4J90A 4J9MA 1VIOA 3FEXB 2KG1A 4X4TA 4DOZA 1I94F 3UD3P 4F3OA 4KKOB 3D4JA 3BGFA 3HLUA 4F04B 1P27B 5LOQA 3P8BB 2X3DA 1QVFR 1SVDA 1BXNA 2NUHA 3TA0A 4C8NA 2EFVA 4FBUA 3DDNA 1G7CB 1VQ4S 4LFCF 2K3KA 1MMLA 4WYWA 2CFXA 1E6YA 2K1RA 2Y0SD 3DLGA 5L1LA 3OJUA 1QAXA 2B8QA 1CVJA 2ZD1B 2J5AA 4DV7J 2UUBJ 2UUCF 1U1QA 2V8VA 3FSXA 2XTJP 4RNHA 5A2QY 1S7IA 5KT3A 1MW7A 2X1GA 2MJNA 3C14B 1BC6A 3VVUA 5KFKA 3NNHA 2OTJS 2Q79A 2BRLA 5KT6A 5AXLA 3HKZD 2V94A 3QWUA 3OFGA 1AB8A 2I6WA 1YBUA 5E0OA 2FHOB 3PXGa 4EU0A 3O1LA 2FYXA 4YR0A 4JYAF 4JV2A 2HS3A 4B9LA 2D3OR 1Q78A 3OTDA 4A47A 1HFEL 4OI3A 1CC7A 2WTFA 3KG1A 3NNCA 4Q5VA 3BBCA 5D77A 2D7SA 1RTIB 3DCAA 1D8YA 4DR2J 1LKZA 3GP9A 3RR8A 3PW7A 1RT2B 3PX4A 4LIRA 3LOUA 2XO6A 3F73A 4X62F 2FGOA 4ATNA 2YPYA 1S9EA 4OLPA 2XI3A 2Y1JA 2DXEA 4JI1F 1UETA 3OSNA 4HTIA 2OPPB 3JYTA 4HACB 4C8YA 1RB0A 1A0OB 3A3PB 1RKIA 2Z2YB 1TQLA 3CDWA 1FESA 3MM8A 2Z56B 1LFWA 2JL9A 4EI2A 2E66A 4ZPBA 8ATCB 3R5CA 3D5MA 5C24B 2B0GA 3LP1B 2B4VA 4JV5J 4DQSA 4P52A 2BVZA 4L75A 3RW7A 1U1LA 2OMOA 4U95A 2XS5A 1YJ7A 1JJCB 1WI6A 4EO6A 4ECVA 2XZDB 2OIHA 4AD6A 4KC5A 3WC0A 3QRRA 1HARA 1PC5A 2BANB 3SI8A 1IBLF 4NEYA 1VC0A 2VC0A 4LFCJ 3MTKA 2CADA 2MYFA 3W62A 1RU2A 2B3TB 2IDEA 4R5PA 1MMDA 3DRXA 4X65F 1FF2A 1FJGJ 3KUEA 1U2RA 3FBCA 2G4BA 4DI6A 3EX7B 3PDNA 3KOAA 4QWAA 4RW6A 3OL8A 2UUCJ 3BQ2A 4PYAA 3FEZA 5K14B 3VAJA 4WZQA 4FVMA 1Y3KA 2ROEA 5GADI 2ZDPA 4I2QB 2DRAA 4NX9A 1ZAXA 4DLEA 2UUAF 4Q8EA 1YKWA 4A8KA 1BGXT 1FA0A 1OQ6A 2R7RA 1XEZA 4X84A 4BWJA 3QO9A 4JYAJ 1PCAA 2V2ZA 4WWSA 1FD2A 4PYDA 1FJ7A 1JLGB 4DEZA 3TP2A 5F3TA 2CQGA 4W98A 3GG0A 4CO4A 2LA6A 1HQUB 2CQPA 1EP4A 1T9YA 5DDPC 4DV0F 5L46A 1M5OC 4JI4F 1X31C 4X62J 3TRGA 1Q5YA 3DDKA 3T1HF 2HNZB 4OZNA 5KOXA 1WI8A 1LWCB 2F3JA 5DJBA 4JI1J 1ZM3A 5DDOC 3PFOA 4WK3A 1M1HA 4P9SA 3RUBL 1TU0B 4DX5A 3TZXA 1V3RA 2RB7A 1HBUA 1TL3B 4ZVRB 3GSDA 5E3AA 3HHLD 4LMZA 2DHGA 2AU0A 4IH5A 2D41A 2HZCA 4MKVA 4B17A 2P5VA 2HZAA 3DMJA 5THWA 4I0WA 3MM8B 4TY8B 1ROFA 3ITHB 2XI2A 2J6SA 1JMTA 1EHWA 3P3DA 5HQ8A 2YNFA 2Q43A 1S4EA 3QSYB 3EDQB 4KFBA 4GKJF 1VQOS 1UA1A 2BQUA 2CQHA 3MXHP 3M8QB 4Q45A 3FGVA 1S1XB 4MMOA 4MKYA 5HP1A 5A8KB 3CXCR 3MMCB 1IBLJ 3UNYA 4I67A 2W9CB 2QA4S 1EQ0A 1VK8A 3UN3A 3CMES 3HVTA 4RW8A 1NB7A 4E8UA 4WKYA 4D3GA 4X65J 3LF0A 1HI1A 2AJFE 4JI7F 2JOQA 3PV8A 3MCNA 1UFKA 3GE9A 4I56A 2YKMA 1GT8A 2DNLA 1UWAA 5F9LA 2B51A 2H5IB 4JI5F 3OL6A 4OJGA 3ZTQA 2M52A 1NCLA 4Q43A 4OYAA 2DNRA 1VQ5S 3OXGA 3OUYA 3R6GB 3ICLA 3CCZA 1HHSA 3CCRS 5CYMA 4RR5A 1FERA 4CLUA 3HK2A 1LWEA 4UUWA 2DNHA 2JZ5A 1O8BA 1O0PA 4YB6A 4OHYA 1KQSR 1VQ8S 1RYSA 1FRJA 2BKPA 1J5OB 3EGZA 2EC0A 3JQJA 3OVSA 4USKA 1TL7B 1WG4A 4JI4J 4NLUA 1EP4B 1RAGB 3T1HJ 2YQ0A 4OYPA 2CA9A 4Y2KA 4C11A 4RW9B 3OT9A 2ALYB 3PW2A 4K4UA 2V2QA 3A3OB 1VQMS 2Q3PA 2WW4A 1PGZA 4AYBD 5KG0A 3RRHA 4ZPVR 2J6TA 2GV1A 2V5HG 1R6YA 2J9CA 5GAGU 4XPEA 1HBUB 4N8OA 2ZZTA 1RK8A 4Y2MA 4E98A 5C25B 2Q6BA 3NGSA 1OIAA 9RUBA 5JXSA 3MCOA 4ER8A 4HYKA 3CCVS 4DN0A 3CMQA 2CRLA 3GFXA 1EQMA 1RHQB 3I4PA 4I1TA 4QW8A 2HVZA 5CD4A 1XMOF 3D6MB 4DR6F 1S9GA 1TAQA 4ILLA 1KWMA 1C1CA 3K5MA 1SJRA 3SV3A 1PG5B 4U7UK 2YQ3A 3G86A 2DITA 3E2EA 2ACYA 2IHR1 3KUGA 2LQBA 4ZVFA 4JI2J 4C2MA 4WP3A 4I6AA 5BYQA 2RAQA 2E1AA 4RPFA 4E2FB 2DGOA 2CPFA 3BS9A 1RZMA 1CJKA 4JI7J 4DPXA 5CXTA 3HVAA 4DQQA 1V3SA 1IKXB 5JJBA 4OL8A 1LK5A 3POTA 2NSCA 4JV0A 3KWMA 1QSYA 1X4FA 3OR2A 1RAAB 4ZVSB 4FXVA 4JI5J 2GX8A 1Q7LB 3JTPA 4LRFA 1R27B 2RRNA 1RT3A 1SH3A 4L72B 4OZ1A 2LXFA 4B3OB 5LMUF 3HSJA 5F8JA 3CSKA 4IFYB 4ZA1A 2J76E 2QGFB 4KTQA 4KB7A 3LGMA 1WTBA 3SBMA 4LR7A 1CQMA 5KFNA 2BE9B 4Y34A 4DUZF 1SL2A 1FI4A 3K0JA 4DSJA 5GAEU 1VS3A 4JI8F 1RJJA 3SYZA 3CJTA 3WDOA 1MN9A 3MM9A 1PKUA 3TO8A 2PC6A 2HURA 1HWIA 1SV5B 4JI0F 1LW2A 1KVIA 4QYZJ 1VC5A 1REGX 3DOKB 4CLSA 2AD9A 4OI4A 5I3UA 4Q7AA 3KJFB 2CPIA 1V6HA 2DVIA 5HMXA 1P1LA 4LF6F 3WQPA 4DV6J 4OHVA 2GJFA 4MYTA 3UCZP 2HK3A 1P6TA 5KAKA 3KLFB 2XZWA 3R27A 4OZLA 1F5BA 4NLVA 1WHYA 1NO8A 1TKZA 5RUBA 1FRXA 2Y3YA 2H54B 5KG1A 2AMCB 1XMOJ 2NXNA 1AZSB 4EZ6A 3FBBA 4DR6J 2FGCA 3O8WA 1ZM2A 8RUCA 2J7UA 1OWXA 3W9HA 3HKWA 4WTOB 2WRMA 4QIWD 4JI3F 3SCJE 4J9PA 3DU5A 4J9UE 2DNOA 1HNVB 3IM9A 4ED8A 5LT5A 2LXIA 1Q0NA 1T9WA 3OBIA 5DZ6A 4L3KA 1F3FA 4HHHA 1TL1A 3VGTA 2R8JA 1FFWB 2GS8A 3CJ5A 3QPIA 5M2UA 4B08A 2ASDA 3DOMA 3VZIA 1HQEA 2QL9B 1N33F 4IH6A 2LP4A 5E41A 3V81A 2J9DA 4PQUA 3AOCA 4NASA 4I7FA 1WF2A 1NUEA 2HVHA 3ISND 2WVFA 1TKDA 5ETOA 4WU2A 2M9KA 2EKYA 1UCNA 3NGTA 1SUQA 3DLKB 5LMUJ 4EBCA 3JS9A 1SQEA 1IKVA 4ZJLA 3HDSA 2GHPA 3QQCD 5DO2A 4H4KC 1XTZA 2W2PP 5BYSA 1SJ3P 4KGKA 4ZVGA 4AT1B 3J80Y 3C15B 4ID5A 4QWEA 4DUZJ 2B6AB 1PSDA 2KT5A 5CYQB 1MU2B 4JI8J 2I8EA 2F63A 3CDUA 4F7VA 3OFFA 3HXMA 4RU2A 1OSDA 2Y1RI 4JI0J 1R0BG 1X0FA 3PNIA 1ZTTA 1ZA2B 1TVRB 3MFHA 2IYGA 1YG0A 3T5HA 1TL5A 2HGNA 1N34F 2ZWOA 3KLEA 1SPBP 2GAGC 1LW2B 2WVDA 1YJTA 1NJZA 2CDRB 4GVLA 2OEKA 1FCAA 3D6HB 3UVJA 2EK1A 1PAUB 2VA2A 1U0SA 4LF6J 1ZS6A 2DNKA 1N5QA 3HMJG 1D9DA 3E01B 4NXNF 2QFJA 2Z4PA 2B5JA 5CCMA 4NZ6A 1RWNB 1WHXA 3MAAA 2FJEB 5D4OA 3ET6B 1IKWA 4CDIA 1X5TA 4K4SA 4MK9A 4N56A 1OJ4A 1S6QB 1EKRA 2RD5C 1FKOB 2HHUA 3R2DJ 4DR7F 2H1YA 1TTHB 2IA0A 3QFHA 2HVEA 3TUIC 2IRXA 3BPSP 3DHWC 3SDEA 1FK9A 1QVGR 1S7HA 1RGVA 2UVWA 1HBOA 3BR9A 3T3FA 3I96A 4HT7A 1T03A 3NG8A 2HVIA 3BYRA 2MKYA 1RI7A 1R0AA 1IM6A 3FC9A 4PPZA 4RUCA 4B3RF 1L3SA 2EBGA 2IIHA 1WORA 1IVZA 1PIEA 3F41A 1T9VA 4USJC 1N33J 1KFSA 3MUMP 2XWXA 2XULA 4GC6A 4ZCIA 3NAHA 5B0GA 4WXOA 2J7KA 2BW7A 1N32F 2MQQA 3BJYA 4YFUA 2BW2A 5HBMA 5D0GA 5F8LA 3W2WA 2YKPA 2CAJA 2BZ2A 2KZZA 5HLFA 3FDSA 1WSRA 1DLOA 4CI0B 1F60B 4R0JA 1M0SA 1NPKA 4M5MA 4NYOA 3PCOB 4TLQA 3BKTA 2RQCA 1T3OA 3DLJA 5DLGA 1RISA 2AYBA 1ZZNA 1DARA 2JC1A 1N34J 5ETRA 4I4BA 3RJMB 3V4MA 2ADBA 2QYCA 2DTJA 3G4SS 4J9RA 2RSQA 4KGMA 4ZIWA 4ANCA 3G82A 2HNYB 4OZ3A 2KHDA 3M30B 4LUBA 4LF4F 1SIWB 3G6VA 3CJRA 1KR4A 5D4NA 3SCKE 1RT6B 4WE1A 4F2RA 5CAAA 2C22A 5D4PA 2LQ8A 4NXNJ 3FFIA 1NHVA 5GMDA 4Y6IA 3KK2B 1Q81T 3D54A 2LFVA 9ATCB 4NWBA 2PI4A 4DQIA 4FF4A 1QM9A 3HD1A 4QIGA 3V4IB 4R8UB 1XN9A 2M5YA 5A8RB 3ZZZA 4DR7J 4I2PA 2BJ1A 1KQGB 3CTRA 3F44A 3V5RA 3CWJA 4PXCA 1NKCA 2EXUA 2FQQB 1FNMA 5IXUA 1K1QA 4ECRA 4ID8A 1MG7A 3I87A 4CIOA 4LSLA 4B9TA 5AXNA 2RDIA 3OLBA 2R2UA 3H42A 1P9QC 2YX7A 4B3RJ 4NLQA 4KJIA 4LBPA 4YR2A 3QJJA 3DOLA 4ZVHA 5MAOA 3IS9B 4ECWA 3SXLA 4DSFA 3TYTA 3DLLQ 2J0QD 1S6UA 2COLA 1ACMB 4IG3A 1RWWB 1FKAF 3D2WA 2BKNA 2BDPA 4ZVUB 2WONB 2YKNB 5KT7A 1UWBA 3R9LA 1N32J 4X4NA 1HKAA 4Q0BB 3TR5A 2A3JA 3HZEA 1B4SA 4ICLB 4ZJOA 3IBWA 5C5JA 1RWOB 2RRBA 4B3TF 3QYYA 2IJFA 3FVYA 1CG2A 2L9WA 2KRRA 2NYHA 4AL6A 4FF2A 4P10A 1HWJA 4ZN3A 1J27A 4QIVA 4PG7A 4EYHB 1RP5A 5GVQA 3GQCA 3N9UC 3FRYA 2KT3A 4NYPA 3CJKA 3ZZ0A 1FDAA 1RAHB 1UTAA 2ZBQA 6FDRA 3EE3A 2MZJA 2XY5A 3LANA 2HHQA 4KR0B 2K06A 2CNKB 3MM7A 1UPPA 3EICA 3V6KA 2JWNA 2W4PA 3MOJB 4DBQA 4NRTA 1Y00A 2NXJA 4CO0A 1HR0F 5BJRA 4LF4J 4KHPF 2RS2A 1U1RA 5DGBA 4AFFA 2E29A 2VZ9A 1N54B 3IAM9 2OPQA 1LV5A 2Z57B 1N5YA 2DHHA 4ZLLA 1SC1B 3DGVA 2R8HA 2K7KA 3G71S 4DZDA 3OVBA 2HGMA 1Y3JA 2E9ZA 3FZBA 1N5VA 1VBKA 2PEHA 4ZLPA 1ZAVA 2A10A 3UD5A 1S59A 1UP1A 3T19A 5JVGQ 2H3EB 1C2PA 5JUMA 3S1TA 7FD1A 1R0CB 2B7BB 2YPZA 4ED2A 1RTDB 3QGPA 1F9FA 2FLLA 2I2YA 4Q44A 4TLRA 1S72S 2BJDA 3KHLA 4LREA 2IA6A 5L1JA 1SC6A 5CH7B 1FXDA 1X60A 1U0HA 5J2NA 1FX4A 2M3DA 2HHTA 2LU2A 1RACB 1IN0A 4A48A 2GQQA 1Y4ZB 5CHCB 2IMOA 2V8HA 4A8MP 4MFBB 1AYEA 1LXNA 5CZXA 1WNEA 2A0FB 3KHHA 2BBEA 2BV3A 3MEEB 1YJ9S 2RU3A 4NEZA 5AXKA 3K7RA 3CMAS 3TA1A 1RAEB 2YWHA 1JXLA 1VJWA 3EVWA 3JQMA 1ZH5A 1UEVA 3CD0A 3MMJA 4UT4A 4IOAQ 2DGTA 2XY7A 1S1TA 4B3TJ 3RB3A 3HFKA 2DGVA 2NREA 3R7NB 1T7PA 5J1EA 4OLOA 2GMLA 4CH7A 3J7ZT 3CW2C 4ETXA 2O66A 3ILJA 4F25A 4J9NA 1FKPA 5E3CA 2C3UA 1R7IA 2HFUA 5KFXA 3OPKA 3AAWB 1CJTA 1HYSA 2J9EA 4WFYA 1NU4A 2O67A 3W64A 1EETA 3KK3B 2V6AA 1VQ6S 3R5GA 1HR0J 5DG7A 4KHPJ 3P96A 3WIVA 3E51A 3D67A 4FYYB 2F65A 2A2CA 2XSJA 1T8EA 2XCAA 1KDNA 4CLKA 4PEOA 3MUTP 1XK8A 1YJRA 1IR0A 1VGYA 1KQFB 4DUYF 3CCUS 4U96A 3P4UB 1N5YB 4N5SA 4NLXA 2KO1A 2YNIA 4YP3A 3PACA 3BB5A 1FXLA 1X7VA 2OD4A 2HHVA 4QPTA 3BSCA 4LJMA 1S1VB 5KFJA 2AW0A 3MM6A 3M8PA 1NB2A 3D1OA 2E5HA 3UR3C 1WHWA 4USWA 3E8OA 4DR5F 3ZZUA 3M32A 4TY9A 3G96A 4O3RA 5L1KA 3H90A 4ZHRB 5J2NB 3MOZA 1HPZA 4J9SA 2EK6A 1NDPA 5E5NA 2ZE2B 4DS4A 1S99A 3ELHA 1YWXA 2JEGA 1RHKB 1AUDA 1U09A 3BSNA 1N6QB 5KFGA 5LSOA 1B99A 2XMWA 4YDDB 3N6MA 2AZ1A 4AQYF 2GVDB 1V9OA 2LQJA 4ZJQA 3OTBA 2VQEF 3EVMA 2ZJRQ 2MQOA 5L1IA 2XEXA 3KNAA 3IO1A 3Q8QB 1ITPA 3QATA 4DSEA 3PY8A 4HH0A 3ZXWA 5J2MB 2V8DA 2MQLA 4RWWA 1F6TA 2HHHF 2GAHC 2AJ2A 4DV1F 4HDHA 4ZOSA 2H4YB 4K2XA 5J2QA 2CNLB 2DPJA 3DYAA 3N0VA 1AROP 1FWKA 5K20B 1F9EB 4UQGA 4NA3A 2H5EA 3P6YC 4MJKA 3DGPB 4OJHA 3LP2A 3CDEA 1YDLA 2HQDA 2UP1A 2VIHA 2IM0A 3OFHA 3QMQA 4LF2A 2EFNA 1VRQC 3VGSA 3RRGA 1YJNS 2DRBA 1SC4B 3LQVA 1YI2S 5I3QA 2J0SD 5E2QA 1B7FA 5ETKA 1MWQA 4MYUA 2IM1A 1H98A 3Q8VA 3B82A 2IJRA 2V4JA 3D3CJ 2V8GA 4MIAA 3T9ZA 2P9GA 2ZOFA 4DUYJ 3KUHA 3US5A 1IBCB 1NK5A 4NYZA 2NZCA 3GIRA 4HHUA 1M1GA 1WKJA 4HH1A 3W66A 3MHYA 3MM5A 3B4MA 4FZVA 3GJTB 3MECB 1S77D 2PFDA 2X1FA 3M2VA 3CNQP 1S9FA 5KFZA 4DR5J 2R7OA 4FS2A 4K7QA 4LRDA 4OX6A 2ZBRA 3D66A 1Y11A 3PIOQ 1H72C 3JSMA 2E5LF 3H2LA 1H6KX 5T41A 3MI7X 2G1DA 3H7HB 1QLNA 4DMZA 1IJFB 3VVTA 3QLHA 2H65B 2CJXB 1KLMA 2WHOA 2BMBA 2NXUA 3ONQA 2HS4A 4NLWA 2GJ2A 3HHLC 3BPDA 3I4HX 3NOGA 3IGVA 2VQEJ 2ATCB 4LF7F 4J91A 4O4GA 3W65A 1IKYA 4WYLA 2EPIA 4C8ZA 2N7CA 3IWNC 2KVQE 2AX1A 4PR6A 3RBEA 2HHHJ 1U8WA 3MR3A 2OKQA 2RF2B 3RRKA 5HROB 4DV1J 2ZC3A 1U25A 1S49A 3K8WA 3TW0A 1WOSA 1JNZB 2IVFB 2WVBA 4A8QA 1JLBA 5D15A 3M05A 5L39A 3M1VB 3I0SB 1RLCL 2DR5A 1YRTA 3W2VB 3BKFA 2GVZB 3QNWB 3UR0A 1VK3A 2G0CA 3UN2A 2N82B 4KV8B 2ILYA 4WK1A 1NNDA 4G6VB 1E6VB 2DEJA 1TZ0A 4FXDA 1NBEB 5IM0A 1RAFB 1X9WA 3R5JB 5DQGA 4CLPA 5KTQA 3Q22A 4N77A 4FXWA 1MN7A 5DM6Q 3NGUA 2J9DE 1NZ8A 1SCJB 2C2MB 4C98A 4QU7A 3OD2A 1C4AA 3TAMA 1VQKS 1UL3A 4UW2A 2E44A 1UFLA 5CD4H 5DLFA 3N6NA 2I5JA 2DGXA 2E9TA 4OI2A 3B78A 1NJXA 3CJQA 3PYGA 4PG4A 4IOCQ 3F56A 3OV7A 3MF5A 1T94A 3PR4A 3VAIA 2IC3A 2KXHA 3PJXA 4ZPCA 1LFPA 3WX4A 1RYRA 4C8OA 5HVFA 1JLQA 3AHPA 4U6PA 3C6TB 2E5LJ 1NKEA 2CG4A 3BBFA 2JEIA 4DG1A 2I1RA 2EFOA 1B70B 4QOTA 4IFVB 4RW7A 5EGYA 5FLXY 4PUOB 1DTQA 2F4FA 3HO1A 3DDIA 2YTCA 3OTCA 1RT5B 1YBTA 3VAHA 2PMZD 2XMJA 3LTOA 5A0YB 2A18A 2AQ4A 1YQHA 2JFKA 2CPDA 1WG5A 2F8HA 2U2FA 4LF7J 3D28A 3DLEA 4IDKA 5ETTA 1SXLA 5IFMA 1ELOA 3CJ2A 4H4MB 2VKZG 2FHKA 3AY0A 5F0WA 1WKKA 1L3KA 4ZVPB 1Q1KA 2W25A 4Q2LA 1BQNB 3QJPA 4EFAC 1YRUA 3BQ0A 3RTVA 2YXLA 2VOPA 4HVZA 1VRTB 3SMZA 5EWGA 4IYQA 3QRQA 5B0DA 5KT4A 5KG4A 1NXIA 5H9EK 1K8AT 3TVZA 1H7WA 1BQMA 1RAIB 2G0IA 1VQYA 5HJYA 4M5GA 6FD1A 4MIWA 2DNQA 3K2YA 2HHWA 1YTYA 1WUUA 2PSZA 1WDDA 2AGQA 2XMMA 3CULA 2WSEC 3P49B 1FWPA 1K9MT 2M7SA 5KFPA 4X4PA 1X4AA 3AB2B 2CDQA 3HHLA 4NCGB 2DO4A 5FDLA 1H2VZ 2VFUA 3M2UB 3EZ5A 8AT1B 1HBNA 5IM0B 4URQU 4B9UA 2XMVA 3VGUA 5JMNA 1NSKL 3AOAA 4F4KA 1S57A 3PW0A 1Z1ZA 2X3GA 4LR9A 2QTWA 5E3RA 2C3YA 2AT1B 1QJHA 4P6QA 3TAMB 3CT9A 3TEHB 2VFRA 4RNOA 3VV2B 2GGPA 1RT4A 4K50A 2V34A 2N3LA 3P45B 3HM9A 4CLLA 2CJKA 2KYZA 1TKXB 3A8IA 3A8JA 1RT7B 3FUYA 1RWUA 1VCTA 2C2DA 2FVQA 4DLGA 3CB4A 1HNIA 4F4AA 1FEHA 3L7PA 4X4UA 3V6DA 3KJVA 3OR1B 1U47A 1O6XA 4WCEQ 3C16B 1H7XA 3ENAA 2KYXA 2HFVA 4OHWA 1TL4A 4ELVA 4NOHA 3KDOA 2AJ4A 4BBYA 1U6BA 4OI6A 2QA4G 2GHWA 5F0UA 1MROA 2HHXA 3W1YC 5EDWA 4OZ0A 2FUG9 2M8DB 2B7CB 4BLGA 2VPYB 3C3LA 3IWXA 1T11A 4KO0A 3M8RA 1NH7A 1RTHB 3PRDA 5IT9Y 1KHVA 4CLTA 3FBEA 4ENOA 4YHHF 1C1BB 2ZUGA 3QT8A 3N01A 1MMNA 1DTTA 3DI6B 4KT0C 4DWIA 1B64A 3UW1A 3MAHA 2OGUA 3MMAB 2FJDB 4F0MA 3M9MB 4RNMA 3DRSB 3GR1A 5B0CA 4DJBA 1YX2A 2JLFA 4ES3A 2JEJA 2IVMA 4F4YA 1LXJA 2GQCA 5AE2A 3FRZA 3R1HA 5FDLB 1R3NA 2IFXA 3HP6A 2DGWA 5GAHI 2MXYA 3ISNC 1YIJS 4O3QA 4EEYA 1S10A 2AKWB 5LJ5Y 4ZPAA 2M8HA 1FNXH 4LRBA 3QIPB 1TV6B 4EK2A 3C6UB 4IG0B 4DL5A 2HHSA 1S1WA 3R8YA 2MKIA 3OL7A 1ULRA 3MGJA 2E1RA 1CJUA 1YZ6A 3RBZA 2RDDA 4ZCKA 3OXLA 4LF8F 3G6YA 3IC1A 3RAQA 1FRIA 2F8MA 1OO0B 4FS1A 5HVGA 5KFDA 4IKAA 1RDRA 4CT8A 2HBYB 2RS8A 1VHFA 2MLYA 2XLKA 1CPZA 3CCTA 2NZ4A 4UOCA 3PYDA 4F8RA 1KVJA 1J5EF 1WKLA 1EARA 4NA2A 1X4GA 2GA7A 3AXKA 4KKOA 1RWKB 2FLNA 1SKWA 4ECTA 4OYXA 3SQOP 1HWKA 1VR6A 5KOWA 3N5FA 4CO3A 4LFBF 2B8PA 4YR3A 2ASJA 1LW0B 2QSWA 4CLZA 2W8LA 3IRXB 4TQRA 4USVA 2CQ1A 2ZH6A 1JXEA 4F0KA 3VHQA 3AD9C 4OMFG 4KSEB 2ZD1A 2CQCA 1XBWA 4YHHJ 4RBVA 3CGIA 2Q6CA 4DPUA 4XDCA 1FX2A 2KB2A 1M5PC 3SSRA 1DZ5A 3C14A 4B9SA 4M94A 1UVJA 1AW0A 2NSBA 4P2XA 3PZPA 1JLCB 1FDBA 1X9MA 5K8OA 1S79A 1RSCA 3DHXA 2CQ4A 2G2YA 1JKHB 1SQFA 1UW9A 5D0EA 2ZNZA 4K2JA 1T02A 4N7TA 3AA8A 4C4WA 4WPAA 2DY1A 3H5SA 4B9MA 3NP5A 2YNGB 2PT0A 3SCLE 1DY3A 2I38A 1RTIA 4ZITA 4JI6F 3RR7A 2C2KB 4J5OA 5KG6A 3CJ4A 2RE1A 2ADCA 4DFPA 3BM7A 3T5LA 4AE5A 1RU1A 5HO4A 5IQ6A 2BQ3A 3DNCA 4MH8A 4G65A 4KAIA 2NXCA 2CIMA 2R7VA 5LJ3Y 2JSXA 4N8NA 3NY0A 4LIWA 1TR0A 5M2RA 3VAFA 1D9AA 2OPPA 4HACA 1UJ6A 3JAMY 2ILZA 5FJ4A 1M5KC 5HANA 4Q2MA 2ZH9A 1W7WA 3ZZOA 1NZAA 2RHSB 1U24A 1YGYA 4LF8J 5HAOA 4I68A 1RAJA 4J9VA 2XWYA 4IUFA 4IR9A 3DC2A 4ZP8A 3U02A 4RO0A 4ECYA 3MWBA 4M5KA 1G4CA 2PN6A 3RAMA 1CJUB 2V9KA 3BO2A 1RHMB 3FJ2A 1EKSA 4P2MA 1NLKL 5C24A 4LF1A 1GX5A 3AA9A 3FQKA 3LP1A 1J5EJ 5B09A 2YWWA 5A8WB 5D0HA 5KFWA 2HQCA 4Y3CA 4A8XA 2X1AA 2W2MP 3IBFB 1CS4B 2WCXA 4NI2B 2QLWA 3QGGA 2MQPA 4CLWA 3J81U 2BANA 4DV4F 1X4EA 4LFBJ 3RW6A 3FCVA 4WJBA 3TAPA 2QG9B 4ITSA 1HNZJ 4TYAA 1PC4A 2YNHB 3H5YA 1KVKA 3CVKA 3OJSA 4PABA 1W2IA 1WEXA 2JX2A 3IA0A 1F9HA 1VQLS 1M5SA 5K14A 1AA1B 1FJGF 1GEHA 1UZHA 2R7QA 1ZA1B 1B0VA 1MWZA 1NEEA 1F2HA 4I2QA 5DQHA 2JC0A 2DNNA 2QE5A 1QSLA 4U8YA 3FZ2A 1TK5A 3X3UA 3T41A 3I5AA 2GNKA 2J0XA 3EZOA 2DRDA 2KXFA 1JLGA 4G1QB 3IN5A 4NA1A 3CCMS 3J7Z5 1S5ZA 4NRUA 1HQUA 2E5GA 4JI6J 3X1LB 4ZLNA 2C2EA 4KGVB 3BO4A 1GH8A 3VR1A 2XZTB 2FLOA 5DG9A 2YVSA 2HNZA 4IO9Q 3CC2S 1LWCA 1NH8A 2PFFB 2ZH1A 4GC7A 3KG4A 5G0RB 1TL3A 1EX8A 2CUYA 2ASYA 1IBKF 2RQMA 3MR2A 2BR0A 4GVBA 1SH0A 1TKTB 3TJ9A 2MKJA 4QIFA 1JXVA 2GJIA 2CJQA 1Z2LA 3K58A 1WSVA 4OHZA 1VBZA 3UDCA 3FMBA 4CO1A 3LAMA 4TY8A 3ITHA 3P5BP 5K9FA 4OYIA 3VQTA 4P71A 3PEJA 3TUPA 3Q89A 1RADB 1RT1B 2NPIA 3R7SB 5D3GB 2FPHX 4G1IA 3C8YA 1DRZA 1P8GA 4X2BA 1M5HA 2R8GA 1MNEA 2VJUA 5LL6d 2AJ0A 3M8QA 1S1XA 5ETQA 5L38A 3JXOA 3UD4P 3ZC4A 5IT9U 2V8PA 5DM7Q 5A8KA 2AEJA 5F8NA 1RCOB 5LMNF 4DV4J 4JB8B 3MMCA 2Z2ZA 2W9CA 5HN0A 1VIXA 4DSKA 1M1KT 3WBZA 4KY3A 1IWGA 1OY9A 3H0PA 3GTYX 1S0OA 2KTQA 5KFTA 4IRCA 4DQRA 4QR2A 2PE8A 1TUVA 4KIAA 3GB0A 2BEFA 2QT7A 4QU6A 1NAQA 3PRVA 2ZH2A 3NCPA 2BM0A 3ENVA 4XK8C 3K5NA 3TX8A 2MJUA 1XWLA 2ZWPA 3MFIA 4DR1F 4LF9F 4P7TA 1CQNA 5H1SV 4QWBA 5HQLA 2RU9A 4QZVB 1TUWA 3NBPB 5IV4A 4OV6A 2CQBA 2HAIA 5KFCA 2W01A 2DCLA 2EFQA 1HNWF 2XMKA 3Q8PB 3BN7A 3GJRB 1SKSA 3LP0B 1J5OA 2QSFA 5F8MA 3THPA 4RW4B 1TL7A 1SQGA 3CDBA 1BQXA 3FSIA 3AFGA 3L9ZA 1W26A 4F36A 1YJWS 4RW9A 1TFYA 4NXMF 2W9BB 2JNJA 2R2RA 1IBKJ 2HQ3A 5EUHA 4RZRA 2HAFA 2WB4A 5KFAA 1PJ6A 2IAJB 1IJEB 4FPRA 4RUHA 3NOCA 5IC6B 4GVBB 2HBQB 3QAUA 3EJMA 5C25A 3C46A 2B9YA 1S1UB 4NLDA 1EZZB 3BH6B 2KKHA 4ED3A 3E3XA 2M0GB 5E7OB 4A8OA 1N8RT 3DN9A 1MSWD 3TAQA 1Q95G 3N4WA 3PIPQ 2XLJA 4YY3F 1TELA 2AGPA 4M5DB 5B0BA 2NUUG 4F0HA 3RB4A 3N6LA 3D9BA 5LMNJ 2RT3A 4U8VA 2DGUA 3KFWX 2XQCA 3ZZYA 4X4RA 3J7YI 2SXLA 2VFVA 4JI2F 4GO5X 3T1YF 3M6UA 1JX4A 4GRSA 4ZP7A 4O3NA 2HW3A 3W5ZA 1IKXA 4CLFA 3HJFA 2HBRB 4LQ3A 1WC4A 4ZCLA 4V1Ak 2R7WA 2H48B 3KMQA 1OPZA 2VG6B 2C28A 4O3SA 2D3ZA 1X5PA 2V4QA 1H3DA 4DR1J 4HDGA 1QE1B 2BOAA 4LF9J 1K44A 4CNZA 4B3OA 4KH0B 4IFYA 3MPYA 1L3TA 4N47A 2BXJA 3OSPA 1DURA 4A8SA 1F3VA 3T5KA 3PHEA 2UUTA 3DM2B 1LWFB 1HNWJ 1VQ7S 3EM1A 3Q8YA 4OJ1A 1B0TA 4B02A 2ZITA 2E1PA 1S0NA 2HRYA 1SV5A 4DFKA 3NWRA 3CJ3A 4DQPA 3PO5A 2O5DA 3PVXA 4MK8A 2UV8A 3DOKA 3H20A 3EGNA 4OQJA 3W5XA 1QAIA 5CQGA 2C2NA 4NXMJ 4J37A 3EZUA 4Y0FA 2MZ1A 2HBZB 3FSYA 2BX6A 2UXCF 1X4HA 4CT9A 3TZWA 3KLFA 1NK4A 1SKRA 1X4BA 3PKYA 4DV6F 1EJ7L 4CLYA 1PYOB 1HQ2A 1Y10A 2IYIA 3QFWA 4OYBA 1AZSA 4CQ1A 3ZFVA 4TQSA 2EC2A 2ZUAA 1UVNA 4LRCA 4PAAA 4YY3J 1JNRB 1KKHA 3R1LA 4DPTA 3GILA 3SZ2A 2HEKA 3S7RA 1HNVA 2HNDB 1CJVB 5A6WA 3B54A 5IQQA 1SJ1A 3AH6A 2H4WB 3QT6A 3K8VA 2W7OA 1Q5VA 1BMQB 4OI1A 4ZCMA 3GIJA 2ASLA 1PJ5A 3T1YJ 5A2QU 1GXTA 2E7VA 2MHEA 2HRUA 2HFZA 2BJ9A 2NYIA 2MGZB 3QJLA 3AODA 1NMEB 4HT5A 3MR5A 5DETA 1PBAA 1S97A 3IGNA 4NZ0A 2J6UA 5DS7A 4MT1A 2CQDA 2Y1LB 3DLKA 3MPVA 1REVB 3IP0A 3N5BA 2ROGA 3HHKA 3W7BA 1S6PB 3TARA 2FD2A 2WB1D 4FVCA 3C15A 4YN3B 4LSNB 5B7WA 3HHDA 2B6AA 2UXDF 3IG1B 3ETMA 3FCHA 2DIVA 5CYQA 2LDIA 1MU2A 5A6PA 3NS7B 3IMQJ 2DNMA 2RKIB 3IBCB 4ED6A 3RG6A 5KFSA 5C42B 7AT1B 1R43A 4UY8T 1TVRA 1H0HB 3ZZPA 4WFBQ 4DCJB 3U1NA 3AJ2A 4NLPA 3V6HA 2JFDA 3TJ8A 1U45A 2HWTA 5LM7E 2P6SA 4WF9Q 4DU7A 4RUBA 4BCAA 3R5DA 3KLIB 4ANDA 1R8HA 2ZZNA 2ABYA 4B3MF 3NWGA 1JK9B 2UXCJ 3HJVA 1JLEB 1XIQA 1FRLA 3NCQA 1R8BA 4OYZA 3ZNJ1 5T7LB 3ZTSA 1U2CA 1RA6A 3PJWA 2AV5A 2BJ8A 3E01A 1AFIA 4PXDA 1X4DA 4BDPA 2K3IA 2YX4A 4YB1P 3FK4A 2CVIA 2R7SA 1VYAA 3M2RB 4QWDA 3MZIA 3TQEA 3SV4A 4CNYA 1U1MA 3ET6A 3NLCA 3Q23A 1S6QA 1SI9A 3PW4A 4TXSA 2GCFA 1FKOA 1KTVA 1GMVA 5K5MA 1W25A 4PWUA 2CJBA 2HS0A 2KFNA 7FDRA 1XERA 5ETPA 4J9LA 2VFTA 1KP6A 4IRDA 2UXBF 1P1TA 2VG7B 4ECXA 4FF1A 2BE2B 4ED0A 2NQPA 2RIJA 2ZH3A 2CPXA 3VCDA 3GZ7A 1FNOA 3MPUB 4PKDB 2AJQA 1ZAWA 3MMBB 3AXMA 1FHTA 1QTNB 1C0TB 4AL7A 2FZCB 3KLHB 2R8KA 3PX6A 4PPDA 1VLYA 4Y2CA 1U1OA 4ED1A 4NLSA 1U02A 1U49A 4WZMA 3MEDB 4OFZA 1FRHA 1R89A 4S0MA 2EG2A 1APSA 1KD1T 3KHRA 5I42B 3LUYA 1UW4A 4RBTA 2ZBCA 1OPIA 5HJXA 2OTLS 1FRKA 4ALZA 5GADU 4USMA 2D69A 2LU1A 3HPOA 4F3QA 2MZQA 2UXDJ 3K17A 5D4LA 4PXEA 4F3MA 2CNNB 2FVCA 2HG4A 3PM9A 3U1MA 2OI2A 4FNIA 1FDDA 1D0EA 5DZ7A 3DRPB 1RA7A 2Y8YA 3A13A 1OMSA 4TYBA 3MR6A 3I0RB 2DGSA 4YEAA 2OELA 5E3QA 2YWEA 3GIIA 3UCUP 2K2PA 4PWDB 4WP8A 4J7CA 2WBRA 1RTJB 1IR1A 2MSTA 2VB6A 3CE8A 1U1PA 1UVIA 3I56S 2HNYA 4B3MJ 2IM2A 3M30A 2OLWA 3W8PA 4QCLA 3BYPA 5B0EA 4MIBA 2R8IA 3SSSA 5HQMA 1RT6A 3ILOA 2VF3A 4F26A 4NLOA 4I64A 3UDVA 4FN5A 4ZP9A 3KK2A 4MKAA 3GR0A 2KL8A 2FVPA 4C3LA 5F8IA 2Z58B 4C0HA 1HMVB 4EBDA 2LEPA 3EYZA 4R8UA 3V4IA 5A8RA 4P2FA 1S12A 4Q8FA 3D68A 3G9CA 3DFEA 3WHIA 4C0BA 4U9RA 3BO3A 4FYXB 2OPSB 3W8GA 2AX0A 2BACA 2ACMA 2QMWA 2G9OA 4ECZA 2UXBJ 1YSJA 2N3OA 3NGDA 2XCPA 1N56A 5GAGI 2CVEA 3OTEA 3NXZA 3I5CA 4C6AA 4USUA 2WOMA 2OPRB 3L7UA 2CXEA 5KFUA 1T05B 1BE4A 3EGWB 3IS9A 5GMEA 5H9FJ 4AXIA 3D1HA 4CM2A 1YBAA 2D3O1 1NJWA 2ZJPQ 1KSPA 3HT0A 4HLBA 2WAQD 2DH8A 3MAQA 1JLAB 2W24A 2WONA 2YKNA 3HULA 5DGAA 4DX8H 3R5AA 4H4OB 3AD7C 4WFNQ 4Q0BA 4ICLA 2CJ9A 2ZBPA 2W7AA 1C0UB 3ISZA 1SBRA 2QC3A 2DISA 2DY9A 4P73A 2LQ5A 2VDIA 4EZ9A 1XC9A 2BQRA 1S4FA 4M5HA 4FYVB 2XYGB 3PR5B 5K8PA 4PQAA 4O44B 1QY7A 3FMWA 4DDFA 2Z2MA 3H4DA 3KK1B 1WACA 3S6EA 2DO0A 4NCAA 3FQLA 2VG5B 2WVCA 1HNXF 2RH3A 3H4BA 4URSA 2HMIB 1VRUB 1JLFB 4QPXA 3CPWR 2XO7A 1V5IB 4K4WA 3EGVA 1SIZA 1UPMB 2DPIA 4M8LA 2HGLA 5GAEI 5D78A 1JJ2R 3QT5A 2GC8A 1N4LA 1U1NA 1FDNA 3DRRB 3DKDA 2DH7A 1B7YB 2W7PA 2YKQA 2Z0GA 2QLFB 3BDPA 5KG7A 2NXEA 1PILA 2WK4A 4H4KA 4WFZA 2DBBA 3C2PA 1RTDA 4ZMMA 1MWYA 2HKEA 1YJVA 3CCES 4FP9A 3EXYA 2LDYA 4J9OA 5KFOA 5F9NA 1N0VC 2CQ0A 5KFIA 3J7A1 1RLDA 3JSBA 2GIFA 3RYLA 3GWCA 1VMBA 3SQGB 2QMUB 3C66A 2HWHA 4CO2A 4O3PA 3AQOA 2MKKA 1Q8BA 2HIQA 4MFBA 4P74A 3BZQA 1KLNA 1RWVB 5HMWA 3VGVA 4DV5F 2VV5A 2MPUA 4EO8A 3BGRB 5KFEA 2WOMB 3MEEA 2E1MC 2ZH4A 4OZ2A 4ZP6A 3KMSA 2OJ3A 5HATA 3BV8A 4Z2XA 2HWIA 1U4BA 3IM8A 1H2UX 3TEGA 2GMHA 3M6VA 1I94J 3R5BA 2DGQA 3H40A 2K7JA 3CO0P 1FJCA 4LVNP 4B9VA 2W9AA 3R2CJ 3C19A 3GMGA 2E1CA 2B9WA
chains in the Genus database with same CATH topology
3SSQA 3GR1A 3M8PB 3K5LA 2MZRA 5B0CA 4OI4A 4DJBA 3HVRA 3CIZA 2JLFA 5I3UA 4Q7AA 4I6WA 4ES3A 2JEJA 1GX6A 4NZ7A 5E33A 3CCSS 4DFMA 2CPIA 2KJVA 4PCQA 1V6HA 2IVMA 3I5BA 2DVIA 5HMXA 1P1LA 4F4YA 4LF6F 1SL0A 1AXQA 4OHVA 1LXJA 4MYTA 4DFJA 2GQCA 5AE2A 3UCZP 3M32B 3FRZA 1P6TA 3TUJC 4AUKA 5KAKA 3KLFB 3M8SA 1UJ5A 3R1HA 5FDLB 1GXLA 1R3NA 3MD3A 4OX9F 4RU9A 2IFXA 2XZWA 3G8TA 4RWXA 3R27A 3HP6A 2DGWA 5GAHI 2CQ2A 4OZLA 2MXYA 1F5BA 3ISNC 4NLVA 1YIJS 4O3QA 1WHYA 2Y1IA 4CTAB 4EEYA 5BR8F 1U48A 2VG6A 1S10A 2AYEA 1HPZB 1E6YB 5LJ5Y 4ZPAA 2K1RB 1NO8A 2M8HA 1FNXH 1TKZA 1FRXA 2N7YA 3QIPB 3DLGB 1TV6B 5KG1A 1IBMF 4DV3F 3KK3A 5LSRA 4X64F 4EZ6A 3C6UB 4IG0B 3TVKA 1QE1A 4DL0C 2FGCA 3B8HA 3O8WA 1ZM2A 2AYMA 4DL5A 5IT4A 2J7UA 4EBEA 4MKBA 2HHSA 3QZ8A 1OWXA 1H38A 3THTA 1S1WA 3HKWA 3PO4A 2WRMA 4QIWD 5HL7Q 2VA3A 3BN4A 2PMHA 2MKIA 1ULRA 3OL7A 1Q82T 1NK6A 4JI3F 3SCJE 2J0WA 4ETZA 3DU5A 4J9PA 5CA5A 2YH0A 4YB7A 4WXWA 4DL2A 3OFEA 1Y5LB 3MGJA 1BWEA 2E1RA 3DM2A 2DNOA 1HNVB 5SUHA 1LWFA 4PG6A 4C9DA 2KM8C 4ED8A 2B9XA 3H5XA 3SFGA 3NMAA 1I1GA 4ED7A 5LT5A 1K73T 4ZCKA 2LXIA 3OXLA 2X1BA 4LF8F 2VOOA 3OBIA 1F2GA 2Z8QA 3G6YA 3IC1A 4ZVEA 2R7TA 3RAQA 3G8QA 3I9ZA 5AJ3F 1FRIA 1TK8A 2MKSA 2F8MA 1TL1A 1OO0B 4FS1A 1U6ZA 2R8JA 4DS5A 3QWPA 1S48A 5KFDA 4IKAA 1RDRA 4CT8A 3CJ5A 5J2QB 2LEBA 2RS8A 5JVHQ 1Q8LA 3O5TB 3RAXA 3DYAB 1VHFA 5EN1A 3QPIA 5M2UA 2XLKA 4B08A 2ASDA 3DOMA 3VZIA 3UNGC 4OHXA 1S1VA 3K59A 1CPZA 3CCTA 1HQEA 2NZ4A 2YY3A 4UOCA 5GAHU 5MLCV 4F8RA 1XNQF 2JDJA 1KVJA 3OQ2A 1J5EF 2OFGX 4NCBA 1N33F 3LP2B 4IH6A 3IR7B 5E41A 4JBCA 3V81A 2J9DA 4PQUA 4XAKA 2BABA 4I7FA 4NA2A 1X4GA 1FRMA 2GA7A 1WF2A 4DF8A 4IQXA 2JRSA 3ISND 2HVHA 1TKDA 4KKOA 4WU2A 3TVYA 5AE1A 2FLNA 3S01A 2F7VA 1SKWA 4ECTA 1S9EB 1NK0A 2M9KA 2UUWA 2MZSA 2EKYA 3BF4A 3Q8RB 1SUQA 3DLKB 4M63A 5CCLA 4X4OA 1HWKA 4EBCA 1SQEA 4R25A 1IKVA 3MPWA 3HDSA 2KU7A 2YWFA 2GHPA 2KG0A 4HI2A 3GG1A 4H4KC 3N5FA 3GFYA 5DO2A 5KOWA 1XTZA 2BJEA 1G1XA 1BLUA 4HL9A 4CO3A 5BYSA 5KFVA 4ZHRA 1SJ3P 2ALZA 4I69A 4LFBF 2R4FA 3KYLA 2V4JB 4KGKA 4ZVGA 3TUZC 3R3TA 4YR3A 3J80Y 1WF1A 1LW0B 2ASJA 1DBDA 4ID5A 4QWEA 2QSWA 2W8LA 3IRXB 4TQRA 3JYTB 2ZC4A 2CQ1A 2ZH6A 1JXEA 2B6AB 2QZ8A 2UU9F 1K0TA 1PSDA 3I31A 1FEEA 2KT5A 5CYQB 1MU2B 4Z37A 2QMXA 4B3SF 4TU9A 2ZE2A 4OMFG 4KSEB 2I8EA 2E7WA 1DQAA 2ZD1A 2CQCA 1XBWA 3CDUA 4KQZA 4FNHA 3OFFA 4RBVA 1N6QA 3HXMA 4RU2A 2RILA 1OSDA 3CGIA 2Y1RI 2Q6CA 1X0FA 3PNIA 1ZTTA 1TVRB 4XDCA 3MFHA 2IYGA 2KB2A 3H2UB 4K4VA 1YG0A 1J2VA 1M5PC 2EFPA 3T5HA 2CQ3A 3SSRA 4MTPA 3UCGA 1TL5A 2HGNA 3OLAA 2DK2A 1DZ5A 2QEXS 3HX9A 1N34F 1JJ4A 3MM5B 4B9SA 4M94A 1UVJA 2YWGA 3KLEA 1W2BR 1AW0A 2NSBA 1LW2B 2HNDA 1YJTA 3PZPA 1NJZA 1D9FA 1JLCB 1FDBA 1X4CA 3DLBA 1X9MA 5K8OA 1IXKA 5J2MA 1SH2A 3M2VB 1FCAA 3CO9A 1S79A 4K4ZA 2EK1A 3DHXA 2CQ4A 1OSCA 4F4XA 1R8AA 1HW9A 2VA2A 1JKHB 1VQPS 2DNKA 1N5QA 2ZNZA 3AQPA 2B4OA 3CEDA 3HMJG 1T02A 1U26A 3AA8A 1D9DA 4C4WA 3E01B 3H5SA 4B9MA 3NP5A 4KBIA 2YNGB 4URGA 3K5PA 2PT0A 4C3MA 3DXSX 4NXNF 2FB0A 3SCLE 2MGZA 2QFJA 3JSMB 2I38A 2AGOA 1RTIA 2Z4PA 2B5JA 4O23A 3T1AA 4JI6F 5HMZA 3DGPA 3OTOF 5G4DA 2VBYA 4R5PB 3RR7A 3IR5B 4X4QA 5CCMA 4NZ6A 4J5OA 4OZ5A 5KG6A 1WHXA 5KFLA 2DIUA 3CJ4A 2RE1A 2ADCA 2FJEB 4DFPA 3L09A 3BM7A 4QJVA 3G6ES 5D4OA 3T5LA 2FVSA 2FY1A 4AE5A 2ROPA 1RKJA 1IKWA 2VH7A 4D3HA 5HO4A 5IQ6A 1XR7A 4RKUC 2BQ3A 3DNCA 1X5TA 3QLHB 4MH8A 4MK9A 4N56A 4KAIA 4K4SA 1S6QB 1KLMB 4RW6B 3VTIA 2RD5C 1REVA 1FKOB 2HHUA 2BA9A 1NJIT 4FF3A 4DR7F 2W4CA 2CIMA 3HF5A 4BHQA 1S76D 2RRAA 4Y28C 2R7VA 2W8KA 4V19J 2IA0A 1DFDA 5LJ3Y 1S6PA 2JSXA 3TUIC 2IRXA 3BGUA 4N8NA 3BR8A 1TR0A 4LIWA 3ZZRA 3DHWC 2PD1A 5M2RA 3SDEA 4O3OA 3CUNA 1FK9A 3VAFA 2RQKA 1D9AA 4O4GB 1N52B 2OPPA 1QVGR 1S7HA 1IKYB 1RGVA 2A1BA 4LSNA 3CF5Q 1HBOA 1UJ6A 1QAYA 2ILZA 3BR9A 3JAMY 1M5KC 1UVLA 5H9EJ 5FJ4A 3T3FA 1WTFA 4Q2MA 2ZH9A 3I96A 4GO7X 1SB6A 3IG1A 3ZZOA 4HT7A 1NZAA 3K5OA 1T03A 2M70A 3NG8A 1KOHA 2R2TA 2HVIA 1U24A 1YGYA 3NNAA 2RKIA 4GKKF 1RI7A 2DJWA 4I68A 1R0AA 1FVQA 1RAJA 2XWYA 4K4YA 4IR9A 3Q24A 4IUFA 1D8ZA 2VC1A 3DC2A 4ZP8A 4DPOA 4PPZA 3U02A 2VODA 1URRA 3MWBA 4ECYA 1Q8IA 2PN6A 4DV2F 4RUCA 5C42A 4B3RF 3RAMA 5EWEA 1L3SA 2EBGA 4EWTA 3QO9B 2V9KA 4DL3A 2IBKA 3CIMA 1WEZA 3BO2A 4KRWA 1XR6A 2ZFHA 3FJ2A 3OVAA 3J81Y 4XPCA 1KOOA 5J1NA 4UQTA 2HFNA 4LVOP 5C24A 3F41A 3NAIA 1HD1A 1JLBB 3UDLA 1HHTP 1Y9OA 4YDXA 2KVIA 4USJC 1GX5A 3MECA 3AA9A 3FQKA 3LP1A 1KFSA 3H25A 3MUMP 1GNKA 2XWXA 5B09A 2XULA 5A8WB 5KFWA 3KLIA 4DSIA 2F9JA 4GC6A 3UWTA 4ZCIA 2VBZA 3H2VE 4Y3CA 4A8XA 1CLFA 3NAHA 3JSRA 2ERRA 1A7GE 5B0GA 4WXOA 2X1AA 2J7KA 2OH2A 4Y2AA 1JLEA 4MAKA 2WCXA 1N32F 2JVOA 2QLWA 4LF5F 2MQQA 3BJYA 2NR0A 5T7LA 4YFUA 3QGGA 5B0AA 2PIIA 1NRKA 2Q66A 2BW2A 3Q2SC 2MQPA 4HEA9 2ZOMA 5HBMA 3WC2A