3U1QA

Crystal structure of m. tuberculosis ld-transpeptidase type 2 with 2-mercaptoethanol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
283
structure length
262
Chain Sequence
TLNAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Mycobacterium tuberculosis L,D-transpeptidase 2 provides insights into targeting the cell wall of persisters
rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
molecule keywords Mycobacteria Tuberculosis LD-transpeptidase type 2
total genus 68
structure length 262
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3u1qA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u1qA01
4HU2A 4JMXA 5DC2A 3ZQDA 4A1JA 5E51A 3VAEA 4QRBA 1Y7MA 1ZATA 3U1PA 4A1IA 5DVPA 3U1QA 4LPQA 4QRAA 5DZPA 5LB1A 5LBGA 3VYPA 5E1IA 5E5LA 3ZGPA 4QR7A 4ZFQA 4LZHA 5E1GA 4JMNA 4A52A 5DUJA 5DCCA 3ZG4A 2MTZA 5D7HA 3TX4A 3VYNA 4A1KA 2HKLA 4GSUA 4GSRA 5K69A 4K73A 4HUCA 4XVOA 4QTFA 4Z7AA 3VYOA 3TURA 5DZJA 5DU7A 4GSQA
chains in the Genus database with same CATH superfamily
4H1LG 4IIQB 2EVHA 2R1YA 2NY2B 4OZFG 3B2VL 2VERA 2BNRA 1E4KA 5FGSA 2SEBA 1YRKA 3CNKA 1QR1B 1EA9C 4LLYA 3M1OA 5M7QA 2Q7AA 3QQ9C 4U2ZA 4ZZKA 1K4CA 2AQQA 3O2VL 3QC6X 3AG1B 1OEZW 4ZYKB 7CGTA 4MA1C 3ARBA 5BO0D 4AGNA 2FSDA 3O3UN 4PJXE 1KIQB 4JBSA 1HCZA 4YE0A 3RWHB 4OGYL 1NIBA 2GTWB 4FQLH 4PJXB 1IEBA 3VVVA 4Z76B 3LPGA 3QQ4A 4LKCB 4OV6F 2GG1A 1CDIA 3IAGC 4OKVB 3GRWH 1DVFD 2O5XL 4B6ZA 2BZ7A 4AYMC 5DTFA 3SIKA 4Y0GA 3FAXA 5IV2A 3C60B 2DQCL 4LPTA 3TCLA 1I1YB 5EOQH 1NM9A 3TJHC 1INQA 4G6JH 3N85H 1NAMH 1E28B 1OE2A 4KNSA 4JFZL 2PPEA 3DX3A 1WO2A 3MODL 4HS6B 4P5SA 3GD1C 4M48L 1S7UA 3CAFA 3ILPA 3P4OA 1BA9A 5ESAA 5SWQB 1DEDA 1Q0YH 3QRLA 3NJKA 1QI3A 4RGOL 5J06A 4LCVA 3LKSB 1E3FA 3EO1A 5DT1L 3SBRA 2Q8AH 2WLIB 1FZKB 4GIAA 4MYPA 3N1GC 4MA1B 3MRFB 2A9CA 3BMVA 3J8F7 3QAZB 1FBIL 1ZT1A 4OFYD 1WT5C 4M7JL 4PB9L 1N3NB 1Z9SB 5CEZD 4NWTH 3DUSB 2ZAHA 3AACA 2IDUA 4UQ2A 5EZOL 1F11A 2XWTB 2ENJA 4L3EE 3X2QB 1RU9L 1OGTB 2VL5B 4C55A 3BXNA 4MRCA 2FHFA 4IDJH 1JPST 2HXAA 2OPCA 2OSLB 1D5BA 4ELMA 1ZHNB 4G3YL 2JTDA 4RETB 5C09A 4P5RA 1FIEA 3L3GA 5I1KH 3QJFA 1P4UA 2NCEA 2NY3C 4ZMOA 3U9WA 4NKDB 1VPOL 2APFA 3DBXA 2ARJQ 4X6DA 4B9PA 4XPBH 1WAAA 5DURB 1Q0EA 4MD4A 4U6XA 3HPJA 4HX1B 3DYOA 1Q9KB 1UOVA 1DJHA 1KB5B 1ZT7B 4YDLC 2O6EA 3RL1B 3TNMA 2G2NA 3S35L 4NKOB 5D70H 2BIPA 3HZ3A 3ECBB 1IC4H 5C0EA 1NBCA 2APVA 1NGZB 3RIAF 4HV8B 5IQ9A 4FQQB 5FM5O 5HDRA 3DECA 3D3VD 1EUTA 1LO2L 1SN2A 1RZKL 2BWIA 3NA9H 5GJTH 1HVXA 5F9DC 5TGBA 4AMKH 2W88A 5C9JB 3GIVA 1W8OA 4RX4A 4WNQB 3UCQA 1MN4A 3IDNA 3GIZH 4PJ8D 4JN2A 3P02A 4HLZH 3TOPA 3UBXI 2ZZUT 4HIXL 1TZIB 5CJ5A 4EIUA 2VDPL 4JL1A 3SJVB 1YN7A 3BUIA 3DMMA 3CCHB 3LPOA 4HD5A 5E5UB 5IESL 1QLRA 5CN2A 1TQUA 4PJAF 1VPOH 4G7SB 4QPEA 5KVGL 3D2TA 5IFJB 3GINA 5IMKB 5TTRA 4I1NB 5E51A 4NQDA 1KENH 2A5UA 1RULH 1DQQA 1H3PH 4X5PA 1BVOA 4JM0A 4XAWL 5TF1L 4YVUA 1OGAB 4MWFB 5BUPA 4DZBA 4CMMB 5ID1A 2D9CA 2HJFB 4FFVD 3EZ8A 3HNSL 3ZX1A 1RJYB 5AZEH 2BCKA 3SPJA 4KOCA 2P5WA 3BIBX 1ZHBB 3ERXA 3QIWD 3ZYJA 2HSIA 4MXVF 5FO8B 3NEEA 1XH2A 2B8OT 1I1CA 3K5RA 2VJ8A 3DV4B 3JV6A 4NWUH 4AKOA 3K72B 1T7XA 1U8PA 2BFGA 1NC4D 3C5SB 4H0GA 1HINH 2GABA 1GY1A 4GS7B 3FCTA 4WGKA 3IS1X 5F7WC 3SZKC 1E9QB 4W9DC 1SYSB 4WNSA 4X99B 1YPZF 3TV8A 2ZIDA 3QISA 1HHIA 5E7BA 1MLCB 2QQLL 3HUJB 4OZ4A 5GGQL 1PD1A 2FNWA 3FTUA 4BWUA 3BYYA 4NN7C 1QEWA 1ZT4B 3ZQWA 5A2BA 1P2CB 2XACC 3IFNH 4JY6B 4Q2ZA 2IO5A 5JDJA 3PL6D 3ISYA 2R29A 3FN9A 2UY7A 3SGDI 4XB3A 3X3FL 5C0GA 3LKOA 1DJZA 3TA4D 5F7AA 4NQXA 3M86A 3AY2A 2WXKA 4LE8A 4P2CG 2W5PA 3K72A 1G7JB 3HI6H 2I5YH 4ZZFA 3BSHA 4GBXB 4KKCC 2G75B 1XF3B 4AMKL 1UG9A 1JGLL 2BS8A 3IXTB 1WV7T 4UNTA 3SZ6A 4GLRH 5EU6A 4DGYL 4W9LC 4WI8A 1KJ3H 4RSVA 5FA4A 5I0WA 2X9ZA 3IJEA 3EDJA 3BUBA 3L9RB 3GLAA 3EBIA 3I6KA 1KGJA 5EDXA 5F7UA 1KB5H 2NY4B 4PJAA 4U1GB 1U3HA 5LLIC 3L3OA 2CPCA 2UVFA 3Q6FB 1YMMA 4WU5B 3W5MA 4FQXA 3VMNA 5CCKL 4FP8L 4E9WA 2YN5A 2LFEA 4FRWA 1U3JA 4PD4J 1TXKA 4JJ5A 4Z7VA 3T0DA 4N2MA 4CDHA 4XN9A 3ZE1E 4LLQB 3D0VB 3X3FH 4A38A 5IUCA 5FGCB 3IDXL 2DQEL 2FEJA 3OLDA 2VSCA 4JZOA 2WXRA 4HUXA 1GIGL 2I25N 3MUGB 2HPTA 4AYBA 4L3CB 4JKPL 4JFHE 4LDLB 3NABH 3VQ1C 4PJEA 1LLAA 3QYNA 4U0RB 1HCYA 1S7WA 1YNLH 2GIMA 5ISZA 1Z3GL 3G6DH 4L0PB 2Y2TA 4XGZA 2YPKA 3B9KD 2G5UA 3DHPA 5HYQB 2E8ZA 1TVHB 1NGYB 3BWUC 4RH4A 5KYXB 3IN2A 4QXUH 2YEVB 3QCUL 3DHMA 3U2SA 1F41A 1NCBH 1M6UA 4RWHA 4OZGE 3ILEA 1H5BB 1XSOA 2DTML 3NK4A 5IVXA 1Q9KA 1GGTA 3M88A 4HF5L 2I07B 2F0CA 4RMUA 5FO8A 3IDUA 1EEZA 4NI6A 1Y1DA 4XPHH 1IC1A 1T2XA 3I74A 1KGCE 1NJ9B 2E7CA 1R0AL 2IMNA 1OSYA 3UCRA 3ZK0A 2AXFA 4WWID 4NNYB 1U8LA 1OGAD 4FCAA 3RVXC 4JQVC 2BWQA 2WBWB 2X1QA 3QIBA 4HCIA 4CMMA 4L3EA 1ZHNA 1MREH 5F1IA 3N6YA 1XF4A 3GUTB 2H2PC 1IM9D 5SWZB 1NMCC 2KZWA 2WUBH 1I31A 2YD0A 3QJSB 2E4TA 4UTAL 1YEGH 4KTYA 1OVZA 1B90A 5DHMC 5GJSH 4K4KA 1P7QB 1UZGA 1MFBL 1Q94B 2YRZA 3HN3A 4JPKH 1CFVH 1PX8A 2CXKA 1RURL 1FZKA 2XUWA 5DC2A 1KBGH 2NW3B 4R9HA 3JSSA 1ORSA 5C6TH 2GFBB 2FHCA 1IJNA 2ZWYA 5I28A 1WFOA 3IGKA 3KVQA 4YHYB 3CXDL 1P9MC 3H42L 4K9EL 1S7UB 1F4WL 1J8HA 1YUKB 3LVTA 1N5AA 3ZKXC 5IQ7L 1KGUA 3GPEA 5IWLC 5E9DB 1E28A 5E4EB 5A7BA 4H8PA 4DP5X 1BBJB 3WG7B 4AK2A 1BX2B 3FQ1A 1NFKA 5D7SH 3BPCA 2Y7LA 1JTOA 3TN0B 4W9EC 1CR9H 2R1XB 5LBSL 1OPGL 2JJTC 3IF1B 3JWOL 4HK3J 5EO1B 4Z7UA 1VFOA 4GQRA 1BGXL 4MJ5A 4MQ7B 3PAUA 3VXUA 1BFVL 1NGXB 1IGML 3HPJB 3WXWL 4PUBH 3OAYH 4XXCC 2N01B 2Y7OA 3FSOA 4UIMA 1DN0B 2BRRL 1KIPA 1RK1A 1XVSA 4MXWH 1B2WL 3GMQB 1RJLB 4C8XA 2ZX5A 3D85A 5IROC 4CADB 4ZMPA 3WEBA 3SD5A 1G0XA 3I2CH 4PWHA 3GRWA 3T0AA 1A4CA 4PGCA 2X3CA 5D2NC 3BXNB 3KYOB 4GG6E 4Y2DC 1QSFA 3H42H 4K9EH 3QJRB 4JUSA 2VL4A 3JWDC 2HLAA 1IKNC 3DGGB 4Q0XH 5E08L 3DC0A 3PU7A 1BXVA 4WO4C 3RKDD 3DDFA 3OB0K 1ET7A 4KKZA 2K6ZA 2A77L 3RIAK 3CZJA 3EYOB 3GMRA 5H35A 1NEZA 2H0PA 4MVBD 2AJUL 3HG1B 3O45A 4WLCA 2ICWA 1RMFH 4NQCD 3GLZA 2ZOUA 4ZFGL 1TETH 2W0PA 1IBBA 4JB9H 5LJYH 4MJJA 4FQ2L 1I1YA 2MCPL 3HBGA 1FL5A 1JPTL 3BCFA 3FQ4A 3DX6A 1HIML 5L2JA 4N6RB 1XR9A 2ZX7A 5AVWB 5FYLL 1BAWA 3NFNB 5DXWA 3MNZA 4BJLA 3WD5L 5DS2A 5KS9E 2Y1AA 2IG2L 3O6KH 1XSJA 4KK5D 3IKKA 3Q2CA 4LHUG 3D07A 4XPAL 2I69A 2YARA 4HIJB 1ZV9A 2DQIL 3WDJA 3D52A 2WNGA 1MRFL 1E43A 1LO5A 1AXSA 3W81A 5IVXB 3ZE0E 2WBJC 4AM0Q 1L3NA 4JHBA 4JKMA 1TU2A 1ZLUH 2O5ZL 3QDGD 2APSA 4A04A 4OZIA 4WGVB 1SVCP 3N9GH 3QJQB 5A16A 2VT0A 3FJTA 1TVHA 1V5JA 3UYPB 4LU5H 1YSOA 4C56A 2C8NA 4ZOCA 1U93B 1ADWA 4FHKA 1PIGA 4TVUA 5T5NF 2ESVB 4WEBH 2C9VA 4GY4A 3FB7A 4KDWA 4HUXB 2WCSA 2VABB 3D7PA 2J6WA 2P4AB 2UYLA 3SE4A 2VO5A 3TTYA 1JVLA 5CZXD 2ADFL 3LZFH 1QG3A 4YHIB 4FTVD 1GS6X 1J9TA 3FDWA 5AW5B 1RIVH 3HC0A 4NBXB 4JGNA 4R7DB 2GEQA 4ZO9A 3ZDWA 1X3DA 5KUMA 4ANUA 1WBXB 5DHDA 2C9XA 2VDKL 4FI7A 3ZIYA 5KOVC 2HKFH 4UT9H 3OKLA 3FZUD 2DKMA 1JCVA 4Y5YC 3T0EC 3PV7A 4OZIE 4I2XA 5I8OH 3LRKA 3VXUB 4FFWD 2PABA 5I5IA 1WA2X 2HFEB 2R9HD 2I85A 2VWEE 2G4GA 3R8BB 2AW2A 4J2QA 4BZ2L 1UM6L 4EDXA 2OYMA 4WEBL 5T3XD 3QEHB 3FPYA 3KGRA 1J18A 4OCXH 5A43C 4PJGE 3BOVA 1Q9LA 2OCCB 3EJZC 3T08A 3BPNB 4D8OA 1I1FA 2PKDA 3M6DA 4AYSA 1HWGB 5GZNA 4UDTA 4U1MB 3FMGL 1S8DA 1QBBA 2R0KH 3V6FA 5EBWB 5L0QB 4ZNCD 4QHPA 2XQBH 4ZSOA 3WKMH 2A9AA 3C9NB 2TRHA 3QUYB 1BIIA 1MOEA 5AWNL 2FBJH 3UC2A 3AJ7A 3VI4A 4KI5F 1TG8A 4RA3A 4E9SA 2XNAB 2KH2B 2X2UA 3LQZA 1YYML 1XCQA 3PWUB 3STBA 3PAYA 1G7HB 4KKAC 3FONB 4YE4L 2IH9A 5DVLA 2ZXWB 3BQUA 3IS0X 3KH4A 4M1DL 4PJFE 4YBHA 3UP6A 2WZAA 1ZK9A 3P9MB 1KNOB 4I3RH 1F3JB 5DURD 4W81A 2WWMD 4OLVH 4WEEA 1ETB1 2P42B 5HI5D 5CINL 1AS8A 2AXFB 1SYVB 4OQTA 4ZXBD 3SPGA 4ODXA 1HI6B 4CAGA 4P04A 1F58H 4WSJA 2YGVA 3F00A 4Y2OA 1AI1H 4ZS7L 5EPMA 1E5CA 1WS7A 3KGSA 3UACA 5I23A 2V17H 3LH2H 3DXAD 2VAAA 2FWUA 4PGEB 5JIKA 4BGLA 4MWFA 3FMGH 1LEKB 2FJSA 3JT2A 3FCSB 4A1IA 1DE4A 3M8OL 2CGRH 3KPPB 2VOTA 2Z34A 3ALPA 5KVDL 3PWUA 3O9WC 2N56A 3BN3B 2R4RL 1NGPH 4OLYH 1A1OB 1WCBA 2DQUL 3R1GL 3SJVD 3EFFA 2KLRA 4YWGL 1NCCH 4XTRD 5CFHA 3HA0A 1CFBA 4BK4A 3IB4A 4JCWA 4N2GA 3WENA 1S3KH 4QGYA 4DW2L 4MMYB 1OP4A 1HKLH 1IKFH 5AOLA 1AFVL 3CFQA 4JDZA 4XC3L 3BKCL 1BEYL 1WEJH 5C9JA 3UJTL 3UJIL 4JHZA 2CIKA 4JPSA 1JPFB 2FBOJ 2X4UA 2B1AL 1FAIH 2QSTA 4GQ9L 4N2DA 5ADOL 4UQDA 3RWCB 3EGDA 4U49A 4PJAB 3S37L 3ZXAC 1GTNA 4LDCA 1P4IL 4YPJA 5H37A 3OAUH 3CDGA 3MREB 1FYTE 1KN2L 3DJTA 4K3EL 4N0FB 3ZTEA 2NY1B 1QSEE 3V5KA 2DWEB 2R0ZH 3UBGA 3MRQA 1VB9A 5CLYA 3X1GA 4NZFA 1ED3A 4Y5XC 4FFWC 4ODXB 4DO4A 4JPWH 2V4LA 1L0YA 4PJBA 1YAIA 3F7VB 4ELMB 5I71C 1VA9A 1IAII 3OG4B 4XP9H 1PD6A 3FU5A 4JFQA 1CZ8H 5HD8C 1M7IA 2O61A 1CXEA 1T22B 3DROA 4BFJA 4KRPD 1BD2D 2E56A 3K6DA 4L1DA 2KL6A 3LQZB 1ZJBA 4XXDA 4KJYA 2I9TB 4Q6KA 2VZTA 1QEWB 1KJ2A 3A5VA 3PXHA 4F7CB 1PD0A 2X4RB 3GSNL 4R90L 4OLZH 5KVFE 2AV1B 3EZJB 1TZGH 2ZG1A 2NSQA 3SDYH 4N9GA 3U4KA 2K3TA 4X8JB 1S8DB 1SYSA 4X99A 2YD5A 5IR1A 4HUWB 1RZKC 1KELL 2ZX9A 5DJ2A 2DKUA 3WO3B 3DSFH 1U3HC 5H2BA 3MV7E 3CHSA 3SPCA 5HVHC 4NUJA 3K2MC 1UXSA 4FI6A 5JIMA 2YPLB 5I1AA 1G9EA 1EO8H 1XZWA 3AREA 3DLQR 4G6ML 4OCYL 3UFIA 5D1QD 5I0ZA 2A1WH 4TUOA 4PBDA 5D4JA 5ABZA 1Y7MA 1KPUB 2PO6B 4FQLL 2ZTBA 3CFKA 4FX5A 1A9EB 3FTVA 4H0HB 2ZCKL 4OQ1A 3S3DB 4NLHA 3KYKL 4OF7A 3U0PB 4U3XA 4Q74A 3WFCH 5ADOH 4HISA 5JORA 1PJWA 1ZCRA 3S5ZA 5CR8A 5HGDB 5A2FA 2CBQA 3D18A 1E8YA 1V10A 4NT6A 4MQSB 1XHHA 1WIPA 4YL9A 3S0PA 5MENA 4XO3A 2G3MA 5D7LD 4ZFFB 1OAZH 2X9WA 1PL3A 3NIFB 2ROXA 2WJ7A 3F65A 5D5MB 5HYJD 4XBGA 3RWJA 5JIDA 1SBBA 1CFMA 2W9LA 4GXUN 4NUQA 5T3ZL 2ODIA 1T3FB 3U30B 1CVRA 1ZS8A 3SDCD 1JZ7A 1WVZA 2IXQB 1AD0A 3MV7D 4K9JA 4U7KA 3MRNA 4PJBF 2HTKD 1CZ8L 2FEEL 1OAUH 2IAMB 2CCLA 2EICA 5DJCB 1PQZB 2YQBA 3AMLA 1PFOA 1AZVA 2OMNA 3KLAA 3JXAA 4PIRF 2WXIA 4B41A 5JPMB 1QX1A 2JJTA 3MCLL 1DQDH 3QDJD 4M56A 1DBBH 2C7UB 1NCNA 3BAEL 4FHJA 1MCQA 4QRQA 1EANA 3CDCA 1S9WA 2XVKA 1BCIA 4ESKA 1JTPA 5SWZD 5I5RA 1IAMA 2CALA 3BZDA 3IEAA 3K7UA 4E9VA 1LDSA 2OL3B 2VDPB 4WI0B 5HI3D 1YEHH 2GAZA 1QFWM 4IRJB 2UXTA 4OM1L 1G0YR 4NO0B 4ONFH 5KSAD 5FYLD 3VI3B 4EI6A 4QO1B 2ARJA 5DZJA 1G7IA 4M93C 3UTTD 3WE6A 4O4YL 4MJID 3QXVA 4GRWB 1X4YA 3B9AA 3GSVB 3LH9A 2RMNA 4AQAA 2WMPB 2WCGA 3QGVA 3QW9A 4PJ9B 3PGDA 5FYJU 5GIRA 1G94A 3MRIA 4N2CA 1G7LB 4GG6F 4ZOAA 1KBGL 3SDDA 2NRDA 5TQ2L 4PVBA 5I18H 1KPRB 3MRDA 3RQ3A 4NO3B 3VG0H 5DZNA 1RHFA 2IPTH 4BSVA 4L4TD 3TA3C 1ZKAA 1KTBA 1EAQA 4NKMB 2Y22A 2FNBA 3PFUA 3SE8H 5C70A 2ICWJ 1P7HL 3G9VA 1YYLL 3AB0B 4I18B 5DRNA 5AW9B 1W6WA 1X44A 3QFGA 2P8MB 4XN8A 2BSBA 1OTUD 4M43H 4PU2A 3GJFK 4KDTA 1EZVX 2IPKB 4BXVA 3F8UB 4Z3EA 1FHGA 1RY7B 1OL0A 5DRXA 3S2CA 3QO1B 2A9MH 3FOMA 3UAEA 4FJYA 5BUAA 1I9RL 4JGJA 4MB5A 1XB3A 2PTTB 5E1GA 2LABA 1T1XA 4KMQA 5HYFA 4J6IA 2WXFA 4O4YH 3QQ3B 1MW1A 4FL4C 3GZKA 2RACA 5IOKA 3FQXB 5CGBA 2AVGA 3OZ9L 2EDFA 1N4XL 1A14H 1KIQA 2GCYB 1UATA 2YKKA 3DO7A 3KLDA 1ASQA 2OMTB 1HQ4A 3DURB 4HK3N 4XO5A 1OSZA 3VRJB 5JPNB 1DHKA 1C08A 2VMEA 2F9BT 4JVPA 5C0RH 4XCNB 3QPQD 5LBSA 4OCRL 1ROWA 5L2KB 5E9DA 5ISZB 5JIPA 3TO4D 4ISVA 4K8RD 5F1OB 5DA4A 2BZDA 1T0PB 5I6PA 4OAWA 4EZMA 3HG1D 1MJJA 3KPNA 5T3XL 4AITA 1E50A 1RFDH 2KZ1B 3PF2A 4N2BA 1LVEA 2XTJE 1EO5A 4GXFA 4B5EA 3EUDA 2OCJA 1TVBB 4J6RH 2BP8B 4CBZA 2XZCH 1IGJA 1IEHA 2ENPA 5TDOB 3T6ZA 5HGDA 3QPXH 3X12A 3UAJD 1WISA 1F56A 2PP7A 2BDNH 4K23L 4UM9D 3VFNA 4EBQL 3TBSA 2ZWKA 1CFNB 1D2PA 1ZSDA 3DX9B 3UABA 2B5IB 4L9DA 3RVTC 3ZL4L 1QR4A 5I75B 1PLBA 4FP8H 2X2YA 2F1AA 3S8GB 1KGYE 3DVNB 2P1YA 3VO0A 2JQZA 3MLWL 3OLEA 4DPAX 1JWUA 1OCOB 5IGXH 1CC3A 3QDMB 1SOSA 1HIMH 2N0MA 3QC5X 1VFBA 2QT6A 1VGKB 2A73A 4H20L 4PSRA 2BSRB 4M5TA 3TZVC 4WGWB 5FLVA 1Q1JL 5J3HC 2J55A 4GMTH 1S5IL 1W91A 5E6RB 5DD6B 3MQIA 1M3JA 4X0KB 2BCMA 1N0LA 2BNQA 3MJ7B 2XC8A 3RRQA 3SBWA 4MKTA 1PG7H 1CGXA 5GGSA 3QHZL 3VFSB 1A02N 4U3SB 3BRGC 4IGBB 1EGJL 3KM1A 4IRJD 1HYSD 2BOBB 4H40A 1A7PL 4U1LB 2B39A 4Z7NE 1DN2A 5FO7B 5LG1A 4S2SB 3FHAA 1I53A 3D87B 5F96L 4ES9A 1BPVA 1QWHA 3VRIB 4MD5A 3WJLC 1V3JA 2H3XC 3QNYB 4FTVB 4UT6A 1N4XH 3BZEA 5EO9A 3V4VH 1N2RA 3NIFF 2CDEA 3F84A 4G71B 5EG6C 3MCG1 1T22A 3DROB 3CVHL 2BNQE 3SO3B 4PJ9D 2GUOB 1NEZG 1G1OA 3VXSE 3PWNA 3MRLA 1VADB 1ZLWK 3J2PA 3HHRB 5JYMA 3F7VA 2VSMB 4ZQTA 3CXDH 1ADQL 3DTDA 5DD6A 2OTWA 1M7XA 1WGOA 4LCWB 5T3ZE 4P23A 2OKMA 3PHAA 2OMVB 1UCBL 5DS8A 5GQBA 3O8XA 4UTBH 3SKNA 3VXUE 4IBTA 4HLEA 2XZQH 2YXFA 3IJEB 2A9NH 2YBRB 5EBMB 3U0TA 1DJXA 3VH8G 1KCKA 3SE3C 1GGBL 1BBDL 1DQLL 3ARSA 2KLSA 5EU6B 2OP4H 1Q1PA 1FP5A 3BESR 5KVFH 3CQQA 1U6AL 3CH8A 1UT2A 3CE1A 2HKHL 3FFCE 4XP6L 1J8HE 5FC9A 2QL1A 3ME0B 3ATDA 3T0VA 3QJXA 3UTZA 4MJ6B 3S88L 2L4OA 1Q4NX 3B5TA 1FZMA 1BZEA 1VGEL 2XX1A 4JM2C 5IQ7H 4KNQA 4M8QB 5I17A 1SM3H 3BWAB 5CJXC 4F2ME 3CCHA 4XOBA 5E6ID 4EI0A 3NVQA 1JFHA 1AO7E 3PWLB 4BH8B 1MFAL 3QDJE 4NAJA 3E8UH 3NYKA 1I8UA 3L8QA 2H5UA 4H2CA 4RAUB 2ITDB 4HXBL 4P2RB 1WH0A 1T6VN 1AYRA 1SMOA 3KD4A 4ZJ9A 2CO2A 2FX9H 1XL6A 3ULSB 2XOTA 4JFED 5FAAA 4NSKB 2NZ1A 2P8PA 3NJGA 2V9QA 3AGWA 3HJ0A 2IPUK 4OZGB 4RQQB 4ZXBB 4MX7A 2LVEA 1O6SA 1RZGB 2UXGA 2BY1A 5LUMA 3WV0A 4PGEA 3ZZ1A 1F42A 4S1DD 3FQXA 3QCVL 3ZJAA 3G5XB 3MRRA 1WCQA 2R2CA 2W9DH 2C3VB 1RMFL 1J0YA 5G5DB 1S6NA 1LO4L 5AOZA 3V4PA 3PNRB 2V5SA 4NKQB 4BKSC 2X10A 4ADIA 4YLQT 4ZI8A 1LEIA 5AB1A 3L4CA 4PV9B 5CO1A 4BZYA 1E6JH 3HFML 3L3GB 1OF2B 1HE7A 4HHAA 2IPKA 3BP5A 2GTZA 1UM4L 2VQ1A 3QUMB 4N5ED 3GI8H 4Y2DD 5GRWA 4Z0XA 3RWFB 2ZCHH 2XKNB 1D5XB 5CEZE 4LRNL 2XWJA 4PV8A 2DQGL 2FL5A 3VFWA 5FFOA 3EOBA 4K71B 4KPHL 1XMEB 3CVIH 3QQXA 4C58B 3WFZA 4DEPB 2EDEA 2ENQA 3BRFA 2FUTA 3OLGA 5TDOA 1KEGL 2AEQH 4WV1C 4I77L 4LF3B 3MA7A 3PGFH 4FYQA 2DQTL 4JMXA 2Z4TA 1EQWA 2X4TA 4GP4B 4YXLL 1DQJB 1DCLA 2MKLC 1TEFA 5T1KB 2F53A 4QRSB 4KUCF 5LGJB 4KX8A 1EERB 1ECZA 4MA3A 5E9NA 1BYNA 1HQRB 3VDBA 4NLAA 1T2JA 1TPXC 4Y2DA 3WD5H 5BPPA 5FEBA 4TMPA 3CPLB 3L5JA 4XBPA 5D4QA 1NEPA 4ZW8A 2ETWA 3VI3A 1NC2D 3TBBA 4YHNA 5AFAA 3BN9C 1U92B 4L9LC 2LAGB 4XNZB 5DJZA 3TIDB 3LXCA 2HFEA 5AL8A 3GBDA 3JUYA 4LEOA 4EUPB 1U8QB 3FB5B 4UAOB 2KPWA 1N19A 3K81A 1VENA 4X4XA 2EDDA 1KZYA 1AG0A 3Q6GL 1LQBC 4HCFA 4UB0H 4M1GL 3GF8A 4YHYC 3UBXA 4F7KA 4FABH 3HS0C 4KRPB 1VFUA 3QHFL 3W9EA 4S1RL 4R0LC 4JVWA 4BK5C 1FGNL 4OH2A 2PPDA 1NBZA 2P5EB 2WQSA 4GUOA 3KVPA 4Z95L 1G9NH 2JJSA 3QWRD 1KYUA 3VMOA 1YEDB 4LFHG 2P46B 1FSKC 4DETA 2VABA 1FYTD 4N0YH 3BFQG 3S98A 1Z2KA 4J39A 5J1TC 4NO3A 3FRPG 2IGTA 2XETA 5HDQH 2DBLH 4Z0BL 2AV7B 5GPRA 1RU9H 2WLIA 4KGLA 4LU5L 3AU1A 2Z31A 4E41A 2F18A 5DD5H 5L4JA 3UYPA 2W9EH 3PGDB 1F5WA 1QUNB 5FFLA 2ID5A 3LNDA 1NGQH 2CKBH 1BIHA 5GRUL 4EI5B 2E7MA 2KYIA 3MGTA 4FXLA 3WE6B 5I66A 4QRUB 4BZ2H 5JHBA 2ODHA 3O41A 5EZPA 3AUVA 2FT7A 4A1JA 4JQVA 4AKQA 4FABL 2GK0B 4YE4H 3C12A 4GG8A 4KVNH 3QAQA 4Y4HA 5EULV 3DRTA 1OTSC 5I76B 3FL7A 2F1BA 4IBSA 3ABMB 4U4BA 4A55A 5CSGA 4QNPE 4OJDH 1U36A 4H26A 3CWGA 1MXDA 4UT9L 4UZSA 5A6LA 1HILB 3UTPE 4YQXH 3FOLB 4QRUA 3NSFA 2VN6A 4DP9X 1S2EA 1KLFA 2Z6FA 3HS8A 5D7LB 4HJUA 3MROB 3QEQD 2N7BA 4DPRA 5HYJB 5EHFA 2Q5BA 4UAOC 1AGEB 4N9OB 4ANWA 3V9CA 1Y7VA 2HVKB 1J5OL 1UM6H 3EYOA 3R4RA 4LOEA 5EUOB 5IY5B 3X13B 4M6NH 4C56D 4ICWA 3CX5J 2OXGB 3QFDA 3F6JA 3KNBB 3R19A 4JQIL 1HL4A 4YDIH 4BYHA 4M1GH 1U2CA 2F8OA 3GPSA 3F7YA 2BVYA 2WLNA 1SY6H 1A22B 2AJSH 2Y6SC 2W65B 3WNIA 4RGNE 4FQ2H 1H3PL 1U21A 2R1YB 5FF6B 1TJMA 1H3XA 3TA3A 5DLMH 3SEPA 4IU2A 4EUPH 3DX8A 1C12A 5D7KE 2XG5A 2IBGA 5T1KD 1NOLA 2YD4A 1AKPA 4Y9FA 5I2IA 1U3ZA 4X6DE 3L3OC 5AB9A 3FT9A 4V1DD 2QGCA 4Y16A 4N0RA 3ZO9A 2WZPA 2D31B 3B34A 3O4LB 1HXKA 1L5GA 4OGYH 4M61A 1O9WA 1XCWA 3MI6A 1SQMA 3MRBB 3DPBB 3GK8L 3OKEB 4PJDF 1FLRH 4J3OC 4B9YA 3UTTB 4OU3A 2DLFL 3LPFA 1NGWB 1FNEB 3KJ4C 1JL8A 1AY1L 2XIDA 5DQ9B 3LRLA 3OQ3B 1S5HA 5F44A 4DCQA 2XQYG 2DQCH 3EGDB 4OCMC 5CBAA 5C1MB 4HK0B 4Y4FB 2A7BA 2W07A 5KEZA 4OZHE 1J8HB 4MHHG 1HU8A 2F8IA 1IBZA 1IC5H 5AAMC 3NEOA 5FYKL 4H8WH 3WIHA 4HUWA 1QAWA 1IGYA 1Y6MR 4APQB 4TYUA 5GZND 3BKML 3MFFA 1DJGA 1PX3A 4EAEA 1JHTA 3KPRE 1TENA 3HUJE 3GSWA 4MASA 5D1XE 4K3DH 2X4RA 3ZE1F 2FWLB 1SHXA 2EYRA 4FFTA 1OM3H 3QQDA 1MRCH 1G0DA 1ESOA 3IJSB 3OLIA 1U8KA 2DQJL 1DBJL 4WENB 3TBWA 3FAWA 1XB6A 2P47B 1XH3B 2BP3A 2G9HA 2FB4H 1A7OH 1MFUA 1JF1B 2V33A 1SXZA 4KMTL 2FH6A 2B5IC 3Q05A 1NANH 4GUCA 4JFOB 5D4IA 1AY1H 4X5XB 3WFEH 5GS0H 5E24E 3VYNA 4F58H 1F2XK 4DKFL 2ADGB 1E3ZA 2EDBA 2PYEE 1TSHA 3T77A 4D9RD 3RA7H 4GRWE 3RGVB 4Y1AB 3GSNB 2M83A 1KXVA 1PYWB 4RX4D 2J43A 4ZPTA 3WIHH 2YRBA 4L5FL 4Z78B 4CSSA 4YC2B 3KW8A 4AJVA 1QRNE 4F2MB 1KCRH 4MX7B 3FONA 1T1ZB 4NM8L 3QRFM 2Z7WA 3SDDD 4IOIA 2E59A 4P9HL 4WCYL 3BO8A 1PJ9A 4PJIB 3VXMD 4U7MA 1ZWIA 2Z0UA 4YL4A 2E9WA 5DRWB 5I8KL 4PG9A 2LTQB 1KTLA 2ED7A 4NAQA 4ALAH 2NUTB 1FNGA 1ZDQA 3F58L 1CGSH 2JVUA 3AUWB 3B9VA 4QRBA 2OX5A 1AGBB 1Q9LB 4I9WD 3MVSA 5FGCE 2ZQKA 3TXAA 4QHUB 3NJLA 5DSCB 1DUYB 1FCCA 2QGBA 3ZU8A 4G8FB 4EDXB 2BY2A 2G5BA 2LQRA 3BD5A 1NAKL 4JKLA 3BEVB 1JK8A 4LEXH 3SDXB 3R0NA 3LH2L 3P77B 1IC4L 3QQNA 3U4EB 1ADQA 5HI4D 1K9TA 3LEYH 4CC1A 1OO2A 5DHXB 5HPOA 3IGLA 3MV9A 1GS8A 3FO9A 4R4NC 1PZ5A 3HMXH 3LZOA 4MCNA 3ML9A 4RGNC 4XVUD 2PW2B 5DJYA 3B9EA 1C8QA 1JZEA 3KPRD 5D1XD 1PDKA 4NQDD 3FUNA 4R26L 5IB1B 3JVGA 5LBGA 3QG6B 2E6PA 1CFTB 3CN3A 3KS0H 1XX9C 1LO0H 1NUDA 2DF3A 3C8HA 1EHAA 2A6KA 3BVVA 2DL9A 4J23A 1G9HA 4L4TE 4XCEA 4DOHB 1U2YA 5IHZA 5D7JD 5K9KA 3GBNH 1BEYH 4MNGB 5EOQL 2A83B 1E40A 3FB7B 4WI4A 4G42A 1T21B 1SPDA 4G6JL 1SXCA 4PJGF 4FYRA 3SSGA 2F5BH 3ARYA 4MSWB 4IBWA 2F5AL 2GIYA 3F3HA 1MLCA 4XXWC 2J2ZB 3RX7A 4PJCF 2BOBA 3QDME 1GZPA 2OSWA 3RGBA 3KLLA 1KXQE 4RGOH 2DQMA 1V7NH 2J21A 2Y5TB 2UZYA 4Y4FC 3P11L 1IGMH 4JDEB 3HAEA 3QUGA 2ITEA 3T2LA 4BQ8A 4DGUA 1U0QA 3WOVA 3WFBL 2D7NA 1Q9WB 3NZHH 4AV4A 4HS8H 5G2NA 1YUHA 1RL1A 1AO7A 3SOBH 2DQHH 1QSFE 4UF7C 2ZP8A 1WK0A 2W81C 5DHVB 3HHSA 3SY6A 1NL0L 1ZRUA 3REWB 3QH3B 2B9BA 4JLRB 4JO4H 3D3VA 3I3BA 5K39A 4HJIA 4QOKD 5FYKD 1SEQH 5I24A 1WJ3A 1K8IA 4HWBA 4JM4L 4N1CA 3TJEL 2Z31C 1NM4A 3RGVD 2WSDA 5GXBB 1OGAE 4QHLB 2ZKHH 3MJ9A 3MBWB 4NN5C 3GSNH 4FC3E 4WFGD 4PY7B 5EUOF 4ZUUA 3HG1A 1JFQL 2DWYA 4Y4KA 3BAXA 1C5DA 2FE0A 1ZGLA 3ZIMA 4BFEA 3O3DA 1DFBH 3ZTNH 5I1HH 2NY6D 4WWKC 4ZRGA 1FNLA 4JN2B 1M2OA 4MNHB 4OF5A 3KPNB 4KFZC 2BW4A 4RISL 1T04A 4AVIA 4MRBA 3G9AB 4X5QA 5L4FA 4BBWA 3ZE0F 3APDA 4AQEA 3INOA 1R24B 2VLRB 2WAHA 2X12A 1K8DB 4HAKA 1DUZA 1HZHL 2E7HA 3VB9A 2BY3A 1ZS2A 4NKOA 2CO6B 3H53A 3MCKA 4M6OH 1SN0A 2PR4L 4WJ5B 4JCLA 4B96A 4YFLF 4PJHA 1OAJA 3WL9B 1OHQA 3KPOA 1J5DA 1I1AD 1JZGA 5HDWA 3T1FA 5B38A 3ARWA 3QFJA 2OBGA 4XP1H 1WD8A 2CA3A 2AJVL 3DX7A 2OFQA 3PP3K 3ZKMC 4AGOA 4AYFA 2NDGA 1ODAA 1VDGA 3F12B 4IRSA 2GSIA 3MNZB 3LN4A 4PJCA 1G5AA 3KH3A 5CEYB 12E8L 3E3QC 5CS7A 1KN4H 1U8IA 3FW6A 5B1AB 2VERN 4NP9A 3NABL 2ZUTA 1F90H 43C9A 4E42A 3IDMB 2WWOA 1FNAA 3L2LA 2FSEA 4FQ1H 3CFTA 3II3A 4LL1A 3FSAA 4F7TA 3L4YA 2GQHA 2D73A 3Q1EA 1CDBA 1PMYA 4FQPA 4YBLC 2CIIA 1BZ7B 1XIWC 5DK0A 1Z9LA 1IAKB 1QHOA 3KPTA 5FK9A 3ZDYB 3FYIB 5JPMC 4ORGB 1JWMA 2DTMH 3U25A 2BVOB 1HC1A 2H1XA 2WM0A 3I75B 2ATPB 1SLVA 3KW7A 4K8RH 3NIDE 1FNSH 1MVFA 4IOFD 4HSCX 1JV5A 4O9HL 4RMVA 5E2WL 1N64H 3T0WA 3CFEB 3V6ZB 4AQAB 4YSAA 4EQ2A 3CX2A 4FXGB 2WXLA 3AB0C 4WTXA 4KU1A 5C07B 2CIIB 4CVZA 2JKXA 1BOGB 1LP9A 4EI6B 4HXAL 1TQCC 4CMHB 3IMWA 5LG6A 1AR1D 3RU8H 2VN7A 4LNVA 12E8H 3WNOA 5EN2B 2BSSB 2X42A 4LAQH 3SDXF 3VWJD 4HKZA 3V0IA 1FL6A 3WKNA 3LXAA 3F12A 4IRSB 2X4PA 3CVCA 2BFVL 4Z76A 4ODUB 5D8JH 3NFSH 3SKMA 5KVGE 3LH8A 3T4YA 4AVKA 4K3GA 2NNAA 4OFIA 4U1JA 4NDMB 1QLEB 4LSPH 4MQ7A 3KLAB 5F7KC 1CBVH 5IVOA 2XPZA 1HOEA 3KS0J 3AY4C 4RDQG 1KJ3L 5BZXA 1LE9B 1N12A 4EN2A 1TTAA 1QABA 4N8VA 4PJHF 2ZAIA 1SMAA 1UFGA 2Q8BL 4P2QE 4TXVB 3KWXA 3L5XH 2VLRA 2HVBA 2A0LD 3S96B 3AG3B 1JPEA 4PLJC 1AR2A 4N8VG 4A2MA 2YXWA 4UQAA 3OKMA 4H1LB 1BDYA 1NWPA 3BEWA 2OQJB 3RUGB 4FQXC 4YR6B 4K2UH 2AMUA 4TVPH 2IANB 1AQHA 1EPFA 3KXFA 4ZX3A 5IJCC 3W56A 4CGTA 1MFAH 1UXMA 1SUJA 2ZPKH 2H45A 5DHYB 3MUJA 1CUOA 1EAOA 1CF8L 4JJ5B 4Z7VB 3BKJL 4UINL 3FT3A 4XMUA 5GRUH 5IFHL 3NA4A 2XXGA 4N8CH 2P26A 1BZ9A 4N2OA 3P3UA 3S88H 4F5CA 3KL5A 2XN9A 4APXA 3QH3A 2PF6A 3V0VA 1Y1UA 1R34A 5IBUB 4J3TA 1FFNA 5E4OA 5KJ7E 1UJTA 4FEIA 3P30H 5FA4B 4XE5B 2LLGA 1U8LB 4X6CF 3QXDA 4OZGF 1MAJA 5D7IA 3DO4A 1OIOA 1UVQA 3KWTA 2J5WA 1ZPLA 5AVYB 1MRFH 2R4RH 4UZUA 4XPAH 1X9RA 3MU3A 2FQFA 1RVFH 4XT1C 3GSOA 4QYOA 2F54A 3QUZB 3KGTA 4LNRA 1A4KB 2ZP9A 1K5NB 4X7TA 4CN4A 4YDJB 3QIUC 5DGQA 1OAKL 5HYSB 3B4NA 2A74A 1G7MA 2OMWA 3LQMA 4XC3H 4IQHA 3N9GL 1WA1X 3ARFA 3LS5L 2DQGH 2HPOA 2VUYA 2I9TA 5E8EB 1JI1A 3RIFF 4H44C 1PZ2A 4H2AA 4YHKH 4OFQA 2WZ0A 2XBTA 4PJFA 4GQQA 5I5JA 5K1VA 2XA8H 3HN8A 4ZUWA 4PRHA 4OZHB 3SOTA 3V52H 3VJ6B 4YUEH 5FW8A 1S7TA 2RFXA 1B0GA 2A6IA 3DYPA 4G80B 4C59B 3HOGA 4XAKE 5D1ZD 3E0GA 4I0PA 4NNPH 5DMJB 1IL1A 5F7EL 3FH7A 2EXYC 3Q8BA 5BRZD 3QYCA 2R7EA 5JW4Q 1SJMA 1U8NB 3L3OB 4NHUB 4K5NA 3D69B 1RK7A 4PHXA 1JGDA 4ZFZA 1ORQB 3V5KB 1YYCA 3ALWA 3FN0L 4YHPA 5DJ8A 3VI3E 4XPHL 1G1KA 1OALA 2WINB 3LYRA 3VFTA 5D1ZC 4FFYL 2NX5E 5KVEE 3B1UA 4J8RA 2IGFL 4FXKA 1RZIB 3I6LE 1FVCA 1CU4L 3CMOL 1QACA 3NIFE 1E6JL 1T89A 4V1DE 5CGMA 2HFGH 1EEYA 2YA1A 4FJZA 1AGBA 4PY8I 4ES8A 3VNZA 2YMXH 1D7BA 1Z0NA 4I2XE 2Z8RA 4AL8H 4UCFA 2K1MA 2WXGA 4M8UA 3EDFA 3VSQA 1RSYA 5TF0A 4JE0A 2ZT9C 3AY4A 5F9WB 5CZXC 2XQBL 5TD4A 3WKML 3V6OC 1P2CA 2ZCLH 1OP3K 5TJWK 2NPLX 2NMSA 1YJDH 3VGFA 1A6UH 5CJOH 1TQSA 1YO4A 4P2OB 4OCWH 2Y6SD 5E4IA 3TZVB 3ZE1B 4FNTA 2QDWA 5C0EB 1DYZA 2R2EB 3NRQA 5EU4B 2HWZL 4DTGL 3I6GB 3FCSA 4I3RL 1AIZA 4Z3GA 3S8FB 3T0EB 1GZQB 5C0ND 1NUNB 4XZ4A 1FWXA 1HSAA 4LOUD 1UD8A 4PJ6A 3VSTA 1M1XB 2ZWLT 1F3RB 5F7HA 1JTTA 1HSBB 3BGMA 1MEXH 4N2HA 4LCCC 4ZOEA 3WSQL 3MNWB 4GYBA 1HDMB 3DXAE 1OSPH 4QLRA 4TQIA 1UOLA 3LKPA 4RFOH 4U1KB 1SM3L 1AYOA 4JDVB 2Z7ZA 2Q20A 4W70A 4Z0BH 3FT4B 1LO3L 2WD0A 2VTFA 4OJEH 1CJYA 1D6EB 3RL2A 4WO4B 5ID0A 1PS3A 4HULB 1DQQB 3L08A 1XGUB 3GKWH 4LLUA 4DZ8A 3DIDA 1AQDA 3IXAA 4ZTOH 3A6OA 4J4PA 1VRSA 1MG3C 3AG4B 3S36L 4MAYB 4A67A 3DMMB 5B21A 5DJDA 3MV01 5FYJH 5KYYA 1A6AA 3BUYA 1MRDL 3ULVD 1P4LB 4R96A 4APXB 1LMKA 5D7JA 1ZTXL 4HQQL 1XGPA 3HC3H 4NOFA 3B6SA 3WUWB 1AFVH 1QPXA 5I73C 2BY0A 5DFVD 3VFOA 4PN6A 5BVPH 1OE3A 1GL4B 2DB8A 4IRSC 2X5PA 4S1SH 3ZW3A 4HV8A 1EVUA 1EEUA 1BECA 2QBWA 1EJ8A 4D7PA 5IT2L 2J44A 1KN2H 3QUYC 4JJHA 3Q5YA 1MHPH 3L3IA 5ECGA 5DFWH 2DI9A 2G3ZA 4W1TA 1YNTB 2HMIC 4I2XB 2J1XA 1NGPL 4OLYL 5KYUA 1KXHA 1OAXL 4QI3A 4DP7X 2NYZA 4N85A 4PJXA 3RWDB 2Y1ZA 4R0LB 5CMAA 2A6DB 3U9UA 1LHZA 3GJFA 4OIIL 4LSRH 1EFQA 4M1CD 4LRIA 4N8VB 4WUKL 3UX9B 5C07A 3KDMB 3MV8B 4UM9A 3BAYA 2MCMA 5IM7A 1UTDA 4GW5B 2VSKB 4GI9A 5JHDD 2CLRA 1BVLB 3V0JA 3PUCA 3SKMB 2L04A 2Q6WA 3UTSB 2PWHA 5EH1A 5HHNA 3X14A 4M7JH 4PMEA 3BN9D 4OLXH 2BHZA 4RBPK 2GY5A 4PJ8A 2AQ1A 5I1LA 3IMUA 3EDEA 1A1MB 4RMWA 3GMPB 4M6NL 1D5RA 2BO0A 3N50A 4LBEA 2CRMA 2EDXA 2GSGB 3B2XA 1H6TA 4G5ZL 1XGTA 4HFWA 3O9WB 3PFQA 2WSKA 3GKWL 4JANB 4CILA 5C0FB 5I0VA 3Q06A 2H32H 1TTGA 1ZHKB 3H9HA 2FBJL 3VW3H 4XI5C 1P7KB 3X1EA 4F7MA 4KGJA 4FERA 4YXHL 2K7PA 5C08A 2ZJSL 5JUEL 2V3DA 1GH7A 1J5IA 4PGDA 1H5BC 4YK4B 2GJJA 2WCPA 4HWEH 4Z1PA 1TUPA 1NWOA 2BVOA 5AKRA 4MDIB 4M02A 4PJDA 4PH8A 3RY6C 4QHMB 1NDGB 5B22A 4PRAA 4U1SB 3QSKB 1G7QA 3AS3A 2N1TE 1G9NL 4JFWA 5C0RL 2Y3AA 4KQ3L 1KTJA 3BZ4B 2VN4A 4JG0H 2HRPL 4YGVA 1IBDA 3ZO0A 1RIUL 4N24A 3BE1L 1M9WA 2NY2D 1RI8A 1P6WA 3RPIA 4F1SA 5IT2H 3IDMA 3L1OL 1HFUA 1K2DB 5TE6L 4G9DB 1ZANL 4DUXA 5DMKA 4NC1C 1ZLWH 3PAVA 4ZQKA 5IB5B 3MLXH 3RWGB 4YDVB 3EGSA 2GITB 2JKRM 3GNMH 5EA0H 2PPCA 2WXNA 1TLKA 1KBBA 3ZTNL 5I1HL 1QR1A 2IWEA 3OMZA 3VFUB 4WWKB 4BRJA 4ZW3A 5AW7B 2J3SA 5IMLB 1JZ2A 5CHNB 3ZL4H 1CE6B 1YN6A 1I1AB 2IBBA 1YEDA 2X1XR 4KO7A 4PS4H 3LV3B 4ZDHA 1HKFA 3HJEA 3O3EA 3HVDA 1J11A 2YKLL 4FMKA 5DJAA 5JR1L 4KVCL 2R0WH 4MS8D 3JTSB 4IRZA 4CMHC 1NFAA 5EU6E 5E1AA 1Q9OA 1X7QB 4HIIA 3CQFA 1Y07A 4UIMB 4Y4HD 1OW0A 4HAFA 4KZ0A 5J57B 1I8MB 2P5PA 4AE1A 4Y9CA 5CU5A 4L1LA 3FO1B 5HHMD 3WFHB 1WAPA 3UPCA 1BZ8A 1Z9MA 2NY0B 4Z7UB 4IDLA 3KMDA 5DZ9A 4AVJA 1YMME 1NOFA 3WXVH 1BFVH 1XCXA 3ZR5A 4PJ5B 1HHGB 1BX2A 2ZSWB 4CC4A 3AU0A 2FQDA 1KGXA 4B3VA 1S9XB 5AYUL 5I9QC 5F96H 5CZVL 4IKJA 1RJCA 3EBAA 3OKNA 1GR7A 4POUB 1QFPA 2XBDA 4QCIB 3P4MA 2IDSA 4QAWA 4S0SD 4BSWA 3L9EA 1ZA6B 3Q2LA 1XBRA 4TRPH 2FECI 1IBHA 1RK0B 3Q8FA 1IKNA 2Z91A 1OLZA 1I7RB 5LGJA 4P9HH 3FUFA 3I2CL 4XE0A 1MH5A 1CXIA 2HJLA 3A4DA 1BAGA 4G6AD 4R97B 3WY3A 3TU6A 3BI9X 1BJMA 2AERT 3IMVA 1PZ3A 1RIUH 1DTUA 1Q0XH 5KBMA 5KJ4A 3ZTCC 3ASNB 2ADIB 4LHQB 2AQNA 1RHHA 2FYYA 2CZNA 4L0ZA 4GAJH 2EADA 3OF6D 3SE8L 4JPIB 4IRSD 3MHZA 5LAXB 3O4OC 5FCUL 2QKIC 3CD4A 5I1KL 3D1MC 1HH9B 5C3IA 2DRUA 3ASOB 5EU5A 1CT8B 4HVBA 3IGAB 3MODH 2X3BA 1ND0A 2OZ4A 4YJZL 1YNLL 1NCTA 5G5DA 1AZRA 1FIGL 1I7UA 1QYGL 2BWDA 4MBOA 3ZDYE 2YJQA 5EIQA 5IHZB 4PRID 1OKEA 1TTUA 4X42A 4Y7OC 2J8UF 1PKQA 4G6KL 4XMWA 3D34A 1P4BH 3VCLA 5JQIB 1LILA 3LQAH 2CDFA 4JEGB 3E7JA 3MKGA 3VGHA 1Z6JT 1F18A 3BVUA 4U6VH 3BP6A 3L4WA 3OKKA 2QADD 1T1YB 3AWFA 3MBEB 1NGYA 4PGZA 5KANG 3W38A 3HFFA 3QZWA 4R5TA 1EHLL 1GYCA 1JMXA 1AHMA 4OTXH 1ONQA 3N0PB 1USZA 2Z64C 1BHGA 2ZKHL 4HOMA 3HS0A 3CHOA 1NINA 2IAMD 2ZUWA 3PJSA 4NJ9L 3QI9A 4TLTA 2NYYC 2X4NB 3EO9L 1AZCA 2DMKA 2BHUA 3BH4A 3TTSA 2DI7A 4X6EA 1CG9B 5DD1L 1WWWX 5D2LF 1MQKH 4G8FA 3I9GL 2OXHB 2TSAA 3HI5H 3QDJB 3PPEA 3PWPD 3AITA 3L81A 3FK3A 3L3JB 1ZVSB 2LT9A 4LHUA 4N25A 1GYWA 3NPSC 2X3AA 5I6XC 3G6JE 2F8VA 4YPGB 3L5HA 1OT2A 4LT7A 2HN7A 5IB4B 4B3EA 3HC2A 5JTWA 5CNHA 1ZEAH 3MX0B 4NQSB 1WFTA 4NOBA 2IANE 5FV2A 2XICA 1AGDB 1UQSB 4FZEL 4NO0D 5JW5B 5KSAB 1NC4B 5GJTL 3ZOAA 1E8XA 3DJZA 3RDTD 3EOAA 2AK4B 4IOIB 4XVSH 2OMVA 3WFDL 5BOJA 4MJIB 1YEJH 2DJMA 3DSNB 2PN5A 3P54A 4Q8BA 4XN4A 2HKFL 2H3NB 1DQVA 2Y7QB 4LL9A 1TJXA 4FYTA 4JZJB 4XBMA 4YFLI 3RURA 4OIBA 1IGCL 5K69A 1JGIA 5L7XL 2RJMA 2H1PL 2BNRD 4KKQA 4PWGA 5JW3H 1N2RB 4ONFL 4WFEE 4KITB 1QI5A 4O5LH 2ZNXA 2LU3A 2EIDA 1ZOXA 3Q2WA 5D55A 2GJZB 1KBPA 3BH9B 2NR6D 3REVB 3LKRB 2BINA 5E8NB 4WW2F 4FQCL 5JPNC 1D7FA 2PWGA 5AUMA 4UOQA 1HH9A 4I88A 5L9DH 2WVSA 1TOXA 2Z0BA 4B0MM 1E9QA 1U8OB 2FWSA 2DQDH 3FCTB 2JJVA 1J12A 3MRJB 4Z7NB 4WAFA 2H6OA 3GJEB 2LR4A 4K7PY 1Z66A 3GXIA 2Y7SA 3TBYA 3ZT7A 1E5BA 2OA9A 1CFSB 4RBPH 1UZ6F 4WKXA 5IOPA 3NCJH 4LESA 2A2QT 3D25A 1ITCA 4N86A 3A21A 2JV6A 3DETD 2EDQA 4J3SA 4HUVA 3ZL1A 1DQLH 4OZFB 3FFDA 4AEEA 3CLFH 3DVIA 3RWEB 1FJ1B 2ZKXA 4U3CA 5SWZE 4EKJA 1WBZB 1SDDB 5L7XH 1TIUA 5AVZB 3I50L 4LAQL 1N67A 5KVDE 1J5HA 1KIRB 1ET8A 2YZ8A 4KJPC 4P9HC 2YGNA 2IH1A 5CBAB 2VLJD 1Q72L 3TBTA 3TO4B 2ZONA 1TETL 5E08H 5DMIH 4OGQC 3WEXA 2FGZA 3FUJA 2UWEE 3EJPA 1J1OL 2DBLL 2VMDA 4GKLA 3UTQB 1F90L 2HYMA 3SDAB 3FO2B 4QXTB 5C86A 1O5PA 5E2UH 3IDXH 2VDLB 2GW5A 3GBEA 4K94L 1A6ZA 3IFLL 3MGAA 4U1HB 2C1OA 3TWCH 1EH9A 3QE5A 5FOBB 3I85A 4F57H 1JGLH 1FI8C 2W60B 4WNQA 2DQIH 4DQOH 1AQKH 2WNKA 5BOZG 4R97C 1QKZH 1TJHH 4GW1B 4OFPA 2K78A 3F7QA 4HBCL 4Y4HC 2CHZA 1WC7B 4IJ3B 2EE6A 2PYFA 4MQTB 5IJDC 2ZYRA 3ARPA 1TT6A 2C3HA 5FXCH 1GTFA 1UOKA 2LU7A 3L3HB 4A7UA 2RALA 3QCVH 2GJPA 4WSGA 2OMXB 4HJ0D 5D1QA 5IEHA 3LKQA 4FFZA 4OCLC 5MEOA 2FTAA 1MCWM 3K0YA 4A2GA 3KNBA 3KHQA 3NG5A 4UUJB 5JDSA 5L9DL 4UQ3A 4NKDA 1CXFA 2QVKA 4JFPB 1WWAX 4P4KD 4XMPL 3C2AH 4ERSH 1UM4H 4F91B 3VFRB 3MLWH 4XNDA 3EXJA 3IVKA 1K2DA 4PVMA 3IKCA 2BP0A 3UAJA 1TKWB 3DO3A 4FADA 2WBKA 3FU7A 5CP7A 1BVKB 3DMMD 1K3IA 2BK8A 1RQ5A 4C47A 3RDTB 3B1TA 5D1QC 2IF7A 2HFFA 4GKSB 4KMLB 3BT2H 1M7DB 4QRPA 4TF4A 4ELKA 4QJ5B 1VFAA 2HT4C 4BSVB 1D9KB 2LAAA 2WXJA 3L2NA 2OULB 3MZTA 5E03A 3ZVVA 1MW2A 3GTTA 6PAZA 3MRFA 2FLMA 4LRIC 3DIFB 5EUKA 4P2QD 2PCPA 4IHBA 3NZ8A 3I6SA 2GK0A 4C83B 1GOGA 4UIKH 1FCGA 1F1GA 3WJJA 3NBNA 1MRDH 3PHSA 4J28A 1R0AH 4LLMB 3D2UA 5F7LB 1HEHC 2JCWA 3KPQA 2XU9A 1CO1A 2AJVH 3BYTA 5DYFA 3FQYA 2DL2A 4MDJA 3ARED 5D5MF 4YDNA 3SN6N 5FECA 3KPLB 1L7TL 1XL4A 1NCWL 2AJZA 1UJ3C 1JXKA 3L4VA 4PWFA 2IAAC 4Y19B 5CJBA 1UXWA 2J20A 1F97A 5KSUB 4DO5A 1IFRA 1TMCB 2XYBA 3C6SA 3O2WL 4LPYA 5AWNH 1NKRA 3O4OB 4N2FA 1K6QL 3MLRL 1SLUA 3UO1H 5KZCD 5GRZA 4POZC 4HP5A 5D72H 1VFAB 5GZOC 5TFSH 2VE6B 5GGRA 1VKXA 4QRQB 1UD2A 3BT2L 1HHKA 1AQ8A 3QXWA 2ZOKB 2FIKB 3GXTA 5TDNA 3UEQA 1MXGA 4XP5H 2J8UA 3FU7B 5F1NB 1MUJA 4IOSA 4BKTC 1CK0L 2AXHA 1IZKA 5E8PA 4QOKA 2EO7A 3QA3B 3A4FA 4JQXC 3UTTE 4BV1A 1R5IA 5BOPA 1QO3A 3SE9H 1UA7A 1GZHA 3QHZH 1AIFB 1TITA 2EVGA 4XNYH 5AG9A 3GC3A 2DEYX 3QDGE 3N44B 1P7BA 1MY5A 5B1CA 4HU8A 3L3HA 3VH8A 1IBFA 3CU1A 3RVUC 1NCDH 2KKQA 1ZVHA 3AGVA 3N42B 3S3JA 3QP3A 4BKLA 4GSQA 3B2VH 1K6QH 3GXFA 3N91A 1OOWA 4YH6A 3CJJA 1N0XL 2NXYB 2VLJA 3O3AB 3H7LA 4HUUB 4PP2B 3ZHFA 3QXAB 1D5IL 2HRHA 2WB7A 4AQ1B 3UL4A 1CYXA 4X4YA 3GGWA 4QRSA 4F3FB 1QSZA 1T66D 5I6XB 3OGCB 5IBLD 3MA7B 1MFNA 3AG2B 4AT6A 2A6JB 4GINA 3HZKA 3VWKC 4CU6A 3FO2A 5HY9B 1FO0B 1RUAL 5PAZA 4P46D 1MF2L 4IGBC 3QDGB 4MA8H 4FNLH 1YEEH 1R5VA 4G8GA 3VGAB 4U1NB 4K5PA 4WK4B 2XKNA 4MXQD 5C0CA 2OMZA 4QXGH 1KCSL 4RFOL 4AQ8A 3RFZA 4IYKA 3VFRA 2YD1A 4F8LA 4KKBD 3HFMH 3UEZA 2RCSH 1SXNA 4ONHB 3VRLF 3SDAC 4NCC2 2R0ZL 4K5OA 5AAWC 2G2RA 2BXYA 6CGTA 2EH7H 5ESVA 3VXQA 2CJUH 2CD0A 1MPAL 2IVFC 3ETSA 4RFEA 1B0WA 3VM5A 5E6IC 1KJMA 3LHPH 1JZ5A 2R56L 3WN5A 4P4RA 5T1LD 4I77H 1NQBA 3L4UA 3BAKA 2ZOOA 2QPEB 4NQCB 4RIRB 3ZUCA 1O6SB 1RZGA 5D1QE 2OYPA 4ZXBA 3EFOA 4I0KA 2MPAH 3FTWA 4MAZA 3CK0L 5GS0C 2DJUA 5HXMA 2F74B 4L9LB 4UNIA 1G1CA 1MWAA 2OJZH 4XNYL 5K1JA 4E9RA 4FDWA 1H8LA 3D06A 4Z7UE 1AVAA 3FB8B 4PI0A 3SKOA 3FC8A 3VFGH 4PD4K 5GHWL 1XGRB 3GEWB 2WOYA 3ZDZF 1JF6A 1E5AA 5J6SA 2RA1A 2EIZB 4AH2B 4M7ZC 3UADA 4TQEH 3II2A 3F5WA 4PS7A 4ZG1A 2AZAA 3PV6B 4FGMA 1FYTB 1QLFB 3RFZC 1JOIA 1ZHLB 2DAVA 1MHCB 4NNXB 3RPBA 1JPFA 5DLML 2UUDK 4CKQA 3QUYD 3APFA 1LDPL 1T5WB 2CMRH 1J1PL 2EXSA 1KENL 3DVGB 3H6JA 3P9WB 4DGIH 3UG3A 4G8AC 5DQJB 5DHVH 1T4KA 4HETA 4NRYB 1BF8A 2P5WD 4IKLA 3C8KB 4X6CA 2V3EA 1XCTA 1M4KA 1MCBA 3C08H 3QHTC 4OD2A 3S36H 1FVDA 2UY6A 4P23B 4TSAH 3MJ9L 3Q3GA 1N18A 1MAMH 4OLXL 1YMMD 3G08B 3ROLB 1CDYA 3L7EA 3TYFB 1AS6A 4GEIA 4ABVA 4AXWB 3ZPDA 3CN2A 5F7DA 2X1WL 2IIJA 4KMTH 3CLEL 2W9EL 3BMWA 4O02H 1T7YA 4QXWA 4B9JA 1HK6A 3NCXA 5DUBB 3UH8A 2Y5QA 3W1ZA 4L2YA 4XNZC 3DXAB 1FN4A 2BM3A 5KS9B 1EVTC 4MBRA 3NP3A 3B43A 5AOKA 1QFWH 4HC1A 4D0DB 4CW1B 1SRDA 2HFGL 3J7HA 4LVEA 2TRYA 2VR5A 2P43B 1OCRB 3CC5B 4D0CA 5GGSB 1KNOA 3VCLB 2XTLA 4XVTL 1RZ7H 4GRLB 2Y3NA 3SDDC 1FV1A 1I7ZA 5E94A 4ZUVB 3OAZK 3DSNA 3IJ8A 4CN6A 1YHPA 3FBKA 5F0JB 3HMWL 1LP9E 3IT8D 3BAEH 1Q1JH 1YJDL 4RSYA 5EF0A 3WELA 3MLYH 4DAGH 2GBVA 4JG1H 4XMLH 1HXYA 5C71A 3C9NA 4DW2H 4UV7L 3PWPB 4JY5L 3Q44A 1HINL 1U30A 3CLEH 5KWYC 5E5RB 5G4MA 3P0YH 4ZFOB 1X7SA 3QXAA 1NLBH 4AQ1A 4JPIA 3U7WL 2XTJD 4NQEE 4Y89A 1MG2C 4MD0A 5D2LA 3VFNB 3PIQB 2AEOA 4TUJB 2AJ3A 3BVDB 3G6JA 2BVQA 3VXPA 1I3GL 2BS71 3MMEB 3S37H 3QWQB 3B56A 1EIBA 2NY3B 2UZPA 3SCMD 3UAAA 4KQ4H 4GAYA 4M6ML 4R7VA 3CPUA 1U8MA 2FX8H 3ESUF 4QJ4B 4BFIB 2WWNA 3WLBB 4K7PL 4AMXA 3T2NL 1IAIH 1MY7A 4YBQC 4CKVX 2D7MA 3HMWH 4EN3C 3CH1A 3H9YA 4I48A 3W9DB 4XCNA 1T1YA 3MBEA 1WYJA 5LNGA 1DBML 3K2KA 1ZIAA 4ONGH 4P5KB 9CGTA 5I19L 4XNMB 3NSDA 2AGJL 1HQ4B 3VRJA 4YHIA 3K1DA 1CD9B 4UMSA 2BIHA 3N41F 1L6ZA 3IDGA 1CI3M 3SGKC 4Z3JA 3AXIA 4FI8A 1P5UB 3SDCA 1KLGB 2E9GA 3PG2A 3LRGA 4I8DA 1IFGA 2J71A 4MJIE 2IPTL 4PG2A 4ZD3L 2XN1A 3ZE2E 5CSZB 4LGPB 4KROC 2JI3A 5J12B 1OAYH 4HWNA 4LSVL 2YUXA 4N8PA 1J87A 4S10A 5CJQH 1PLGH 4YAQA 5KBKA 5EN2A 4LEBA 2QELA 4YNYA 1RZ8A 3B3IB 4DJMA 3EHBD 3ES6B 3MUUA 4YDIL 1GJWA 2E75C 3S5YA 3LDBB 2CBOA 5E5MA 3DARA 1TU2B 2UZXB 3ZL2A 1AR1C 2E3VA 2R4SH 4R2GC 2PW1B 2BFVH 3NCWA 4X6DF 3ZHLA 2WLHA 1AGCB 1A3RH 4OFYA 2QKIA 3ATEA 1P53A 2FBRA 4PJ7A 3AS2A 3CFBA 3GIZL 5AVUB 3QBTB 2EDYA 1A3ZA 2V8MA 2X7LA 4FTVE 3SBWC 3EGSB 5IW6B 5ELIA 2R39A 2FB4L 3PHOB 1N59B 1M05B 5IMMB 1CICD 1D9KA 3C8DA 3CDZB 1SJHB 2XFXB 2OMUB 2MFNA 3KYMB 3CQPA 1TJIL 4HJJH 4UNVA 2VDQH 3KAAA 5CIPH 2IBZY 3QIBC 4U6HA 4KY1H 4F9PA 1M6OA 2FSEB 4Q4IA 3ULVE 1MVUB 2DLFH 4RGMB 1RZJL 1IJ9A 3K4ZA 4R83A 4E0RB 1MZZA 1MJUL 4F27A 2LLNA 4JFPA 4RGNB 5ERWB 4Z7WA 4YZFE 2EEAA 1X5JA 3PWPE 5I1EH 2NXZD 1A9BB 1HEZA 1W8NA 2QQNH 3JWNE 4X4KA 4WWOA 1BQLL 2EXWC 2NLJB 4A6YA 1L0QA 5HHQB 2F8XC 4P4KC 3AQXA 4A52A 1MLBB 3SKJL 5MEOB 3PQYD 2BDNL 4KKBC 3LKQB 4D0BB 2C1PA 1FFQA 4JFTA 1ZLSL 5I15L 3VGDA 3EBGA 2JELH 2PXYA 3MJ8B 1KEGH 1RZPA 1JNHA 2AEQL 2Z7YA 5E5MB 1JZ8A 1E27A 5INCB 2CR0A 2GSGA 4NUPA 5IGXL 4NJ9H 3B3IA 1NMBL 1WUNT 4N2AA 1JG9A 1ZPUA 4XMKH 5DK2B 2X28A 4GW1A 3H3PH 1WFMA 4C4BA 1JHLL 1OB1B 1UA3A 1D2OA 1IIKA 4MNHA 1FE8L 1JFQH 3QO0A 2GBTA 3BLPX 4NFCA 1FRGH 1JVKA 3KWWA 1BVLA 1XXFC 2VDOH 5K9OA 2EILB 5KAQF 3G3LA 2G5RA 5DMKB 1YPZA 1MFDH 3RNKB 3RE0A 1A1NB 4L05A 4WWNA 4NQQA 4P2OC 4FQ1L 3NJFA 2AQPA 3MUHL 4JNXA 1EX0A 4YC2C 3W9DA 3ECUA 4U2YA 5F9OL 4MMXB 1HNYA 3KYMA 4KXZH 3PABB 4GQZA 4XPFH 1RPQA 2ZOWA 3LNIA 4LPVA 2I7OA 3RWEA 1UB6B 1NFDA 1FO0H 3L3DB 3WY1A 3ENEA 3K6OA 3LJ3A 5EEZA 3QULB 5CUSL 1SDAB 1Q9WA 5DJXA 4P5TC 1QBML 1G5GA 3KLKA 3Q9PA 3K8LA 1OSEA 3R06B 5I1GH 2AEPH 4DN4H 2JTYA 1JWSA 3STLA 3PJNA 2B4CL 3PL6C 3HZMB 4LGRB 3HR5B 4N0UE 4NC0B 3L95A 3WMSA 2IDQA 4ATWA 2WLZA 3A6CH 1ZATA 4PRPA 5CSBA 2VISB 4U6TA 4KHTL 4HKJB 3T04D 4ODHL 3MTRA 3NFPB 4GT7A 1XIWD 4XAKD 2P49B 4FQJL 4ZMTA 1KLUB 1USQA 1KDIA 1OP5K 1GIGH 1CPUA 3LKRA 5D6CA 1PAMA 3RZCB 1FZJB 1T21A 5D8JL 2E46A 5KSBE 1SBSL 3GZQA 1KZQA 3QIWB 4O5LL 3DYMA 2JKIS 1P5UA 4X8CA 5T1DH 2VM9A 1M71A 4MMXC 2OJ1A 5E6UB 3ZRFC 5JQHC 2L7UA 4IKKA 5L6YL 1NMCB 1NSNL 2HMID 5F8QC 1QMUA 3L5XL 4TNGA 1X9LA 1YEJL 1GOFA 4MJ4A 2NY0C 1W0WA 2YPKB 1H8NA 5JZ7D 4D9LL 2ZNWA 5B3JE 1P5UC 1EGJA 3IFOB 5LQBL 1FN4B 2AK1H 1U42A 1KYOJ 2IALB 1C5CH 2ZOLA 1MVYA 4ZTPL 4NO5A 1FLTX 2JB6B 2R23A 1T0NB 1S7XA 2YC1A 4MZ2A 3ULVC 3ZTJG 1KEMH 2VLKD 1F4XL 3SB3A 4DQOL 2AAAA 1C7SA 3FU3A 1I8AA 5CEZH 2DI8A 2FQGA 5ENWA 3S6CA 4P46B 4XC1H 1X4ZA 3UO8B 4NQVA 5KYYB 3WS6C 3HW7A 5DEGB 5IK3A 5DJDB 3EIFA 3LEXA 5ETUB 1MI5A 5E8OA 2AABH 4JO2H 1T5WA 1JXFA 1RIVL 3Q1SH 2B2XL 4HJ0C 2ZCHL 3U6XA 3BUPA 4U1IB 3HC4L 2EXWD 4PS3A 3PQYA 3W39B 4LFHD 5C0BD 1UH2A 1KSRA 1AQKL 2G75A 1G4RA 4TVPL 3ARUA 2J72A 1QKZL 1TJHL 1JN6B 5ID0B 4POYA 2H8PB 3OG6B 4UOJA 1GC1H 5HSFA 5EU3A 2FVNA 5CD5D 1XGRA 4PBXA 2IOOA 2WQAA 3RTQA 4IRZH 4IU3B 5DD1H 1I82A 1HDMA 1J1OH 2VXQA 2NZ9C 1KTRL 5E2UL 3ARRA 4MQXD 3P9LA 2HT3C 1TR7A 2Q7YA 2Q87A 3MRPB 3TVMA 5ACZB 1IL1B 2EDMA 2DM7A 3DHUA 5FW7A 2Z92B 4HWZB 5EIIB 3T0EA 4Z77A 4TULL 2QZ5A 2HVJB 2KDYA 5G4NA 2YQGA 2HRGA 1XQ4A 3L7FA 3LKNB 4QHNB 3WN5B 3GSUB 4HZLB 4JRYE 2VUOA 4GXVL 1UCBH 2E47A 2VITA 2FO4A 1PG7L 4Q56A 4KTEH 3KXFD 1BD2E 1MHEB 1DVUA 1A7RL 5AD0A 5JXAH 3GXUB 1FORH 3HZVA 2NQCA 4G70B 3EXLA 2XLLA 3U79A 4D3CH 4Z7QF 4FG0A 2K9FB 4QYOB 5DVPA 1MWOA 2J1WA 4AM0A 2W07B 5EF3A 3OKNB 1NCAL 1U91B 3N40P 5J6GB 1IC0A 4M7ZB 3RJQB 2ZXEB 4ZBJA 1EAJA 4L4TA 3ZGIA 2HG5B 1Z32X 2XT1B 3ZE2B 3K46A 5TDPB 1WZLA 5I74C 1W80A 5DMYA 2HT3D 4ZOBA 5GSVA 2YD8A 1NCOA 5DEZA 2EDLA 5DI8B 2MTAA 4TNWK 4Z7WF 4DGIL 2B2XH 1DP0A 1SJVA 1BJ1H 3ZDYF 3EG9A 4FLOA 1EBAA 2JI1A 4YBQD 3Q0HA 2RQ8A 2EKSB 4AGLA 1JZJA 4HUUA 4IMLB 4TSCH 2CNYA 4UDUB 4KO9A 2QHRH 3T3MF 3M1BA 4L8CB 5INDA 1UH4A 5KBLA 4Y1TA 3MA9H 1MFCL 5JXAL 1CD1B 4NWTL 4QUOA 1C12B 3DX8B 2JB6A 4LCWD 4LMQE 5H4YA 3ZT6A 3T9WA 1T6WA 2ZP0T 3TNMB 2DM4A 3BEWB 3RUGA 3RGHA 2ZPKL 1CGSL 3I50H 2ITCA 4PRHE 1GMIA 1OZTG 4GRLD 3GHEL 4PYGA 3UMNA 4JO1L 1NCJA 1EAPA 4PJ8C 1C16A 4XNAA 5CBEA 1XDTT 5JIHA 1X6NA 2CXGA 4ATTA 5TFSL 3FU6A 2HKLA 5JLZB 3BKYL 5GGTH 5D7LA 3V5DB 4TN9A 3ZUNC 1CGYA 1T66C 1KELH 1S7VA 3K1KC 4HIJA 3CBRA 1SVBA 3G5ZB 5F6IB 2CJ3A 3QIWA 4KX7A 5C0BB 4JZNB 3ARDD 1EK3A 3B2PA 4W9IC 5C8JA 4AEHH 4HIEA 1KY6A 5AOMA 4I5BB 5HVWA 5AYTA 4NQEA 4CNIB 1FFNB 3TP4A 5GRJL 4JFEB 3AADB 3K8KA 4UV7H 1NCAH 1NC2B 3NQKA 4PWIA 2V7HB 32C2B 5AOIA 3W2DH 5KBPA 1JMZA 1JXDA 4GPVA 4KNTA 2CRZA 4MA8L 5DZAA 2MCG1 1NCDL 2X89D 4QHKI 2WO2B 3ULUE 3KBHE 4JL2A 4K9EC 3I75A 4KZEH 5HDBF 4LRNH 4HGWB 5F9WC 25C8L 2Y2WA 4DEWA 3V0EA 2GT9B 3HG3A 5FOJA 4HIEB 4QIRA 3ZTJH 4TL5A 2CBMA 2IV8A 5CZVH 1YYMH 1RPUA 5LDSA 4WVRA 3DI3B 2MTPA 3TVMD 4ZX6A 1Z0MA 3BH8B 4YZFF 3ROOA 4UU9A 1JDCA 2X4QB 2YWYA 2G60L 3VD5A 2EZ0C 3A6BL 3UGEA 1REIA 2D7OA 5CP3A 3FSZA 3LIUA 1BXXA 2J8UB 1TNMA 3MRCA 5EORL 1EJFA 1LD9B 4UT7L 3GJFB 1D5MA 1EJOL 1W72L 4FKHA 3ZZSA 4ODUA 1RPKA 5AW4B 1RIHH 2VDMB 2WIMA 1MCNA 3QJVB 1AHWB 1DQMH 4EI5D 2ATAA 2SEBB 5CKGA 3J27A 3KPOB 1NCWH 2QDVA 3VU2A 2BSSA 2RTTA 2MNUA 1X5IA 5FGBC 5ADPL 3CZEA 2H9GA 2YXVA 2ZF9A 3BAJA 4R7NB 5F21B 5H37G 2NTFA 1E5YA 1W2KT 2RR3A 5IFAH 3S4SG 4F58L 2IMMA 5CD3B 3CFCH 3KHOA 2OV0A 3MLTB 1QLEL 3O3BB 1X5ZA 3FQNA 3LDBC 2NQDA 2YMOA 3Q43A 4YSOA 3WAJA 4OV5B 4EPSA 4W9JC 3CFIC 2ESVE 5ALCH 1KTKE 2ZUUA 3EDKA 1JUFB 4JREB 2WBJA 3A67L 1S3KL 2B4CC 2VZVA 3A6BH 3TX4A 1W15A 2XWZA 2K0RA 4ZUTA 3GSXB 1DBAH 2EABA 3FO0H 4E0RA 1WAEA 2NNCA 4AQZA 1C7TA 5IVZB 3KE0A 5H4ZA 3G5ZA 4OGAC 4NFDA 4GRWH 1MEXL 3VFGL 1H3VA 3TWYA 3KBEA 2NXZB 4UQCA 4JFHD 3R8QA 1AAJA 1FVEB 2DYSB 2F7OA 4GRLA 1KT2A 3KLSA 2AJYL 5JOFB 4LPXA 5AEAA 1N59A 1M56B 4JM2A 3BPLC 4QRRE 1KIUB 2WVVB 3WJJC 3LS4L 1I1AC 1E8ZA 3MJWA 2UVEA 1GKOA 5TE4L 1N5YH 3BSZL 3GHBH 1QZ1A 5DD0L 1CB4A 5AVQB 2X6VA 1XF2B 4TM9A 4OUUB 3HAEB 4NZUH 1E9OB 5J9PA 1QRND 1U4FA 5KVEH 4HCGA 4PCYA 4XPBL 4WJ5A 3QUML 4GH7B 4MCZB 4AKPA 4HUMB 3LNGA 4AVHA 4P59L 3QCUH 4LPCA 3KYNA 2P8LA 4KX9A 4XO4A 4DEPC 2Y25A 5FYKE 1KFGA 5JA9A 2N1KA 4OCWL 5ACZA 1KB3A 2GPZA 4MA7H 4NRZB 4HLZG 4HOZA 5DWPA 2PNDA 3UBFA 4JFYB 1AKJD 3H3PL 1U8JB 1PF3A 1GGIL 3HEIB 3PHQA 1HHJB 2I9LB 2Y24A 2RIKA 4X6BB 1HL9A 4WTZG 3IETB 5TE7H 1RP9A 2VLLA 3JYCA 3H4HA 1HS6A 2XVGA 2VDOL 3P4NB 1MCIA 4OLEA 3U83A 1JN6A 1SY6L 1E4KC 5B39A 4KBPA 4NM4H 4NNXA 5CAYB 2VDPH 2G9KA 4MNQA 1PEWA 4FF9A 4JRXD 3W39A 4J8RB 1TTCA 4YDLB 4J27A 2VQ4A 1HH6A 1WAAF 5DJYB 1IM3D 1DQIA 2EJ1A 3BDYL 1IEAA 4P2RE 2YAMA 2AI0L 2FR4A 5AVSB 3G04A 4LPWA 3F7PC 4EBQH 2JLPA 1DBAL 3G6AB 1JNNL 2BVEA 2K8QA 5ALBH 4JY4B 3BAWA 4N87A 2VYRE 4R4FL 1RZFL 4KTDL 2Y7MA 1EXHA 2I9LA 1EFXA 3O8XB 3SKNB 3CK0H 2FX8L 1U8JA 5C0AD 3D25B 3MMEA 1WP6A 4JG1L 4QTHA 5H8DA 4EUPG 4OQTH 2BPBA 2F7QA 1Z5LA 4IMKA 3A23A 1MWAB 4ZD3H 4QHNA 3KJ4B 4GS7C 4HALA 1IFHH 5BVJB 3UZVB 1GOHA 1KV3A 4N0UB 3LZRA 1CDUA 3QI9B 4G5AA 1D7DA 5EO9B 3RUGF 4M62L 5F3HA 4WHYG 1RUKL 1JXGA 3BHBB 4JY6A 4Q2ZB 4PPTA 5FGBA 3WNLA 2YA2A 3QRBA 4F7EB 4CL7A 3OVUB 2R4SL 5C7XL 4PW9A 2A83A 5BV7C 3SYCA 1E6OH 3CVBA 3G5YA 2J12B 2TSBA 1FIGH 1QYGH 1K4DA 2YGQA 2BOLA 3LY6A 2AQRA 4DOHE 5B3JF 2B1HH 2N0KA 4MA7L 5C6PB 5K9JL 2C9UA 3MJ6A 2Y06L 2WVUA 4YDZA 1U8CA 5DEFB 4N28A 3GSNA 1OANA 1VCAA 2HRPH 2MNJB 2ZKMX 5GJSL 3U46A 3T77B 4X6FA 2BCKB 2WYTA 4R8WH 5IVNA 3QXDB 4HBCH 4TKWA 3IDYB 5CR1A 5JXEA 1AOZA 5GGUB 1AGFB 5DD3L 3S2AA 2IV9A 5GS0L 4NQSA 1C5BL 1YEHL 3DVNA 4KWUA 4RLDA 4M6OL 3DA0A 1KGWA 3BD4A 1MFEH 4LSUL 3TESA 3VE0B 1V3LA 4XZUB 4BM7A 1D7CA 5IJBC 1BZ9B 3TBWB 2NY7H 2RH0A 2WOBA 4GFXA 1PX4A 3ZDXB 1MQKL 2B1OA 3GM8A 2J6EH 1HHHB 1UZ8A 3FRPB 3NN8B 3NOIA 2WYZA 2XN9D 3VFPB 1QWUA 1HT6A 5IHHA 1EDYA 3U4BL 1ZEAL 1HESA 3OC5A 2BXZA 2ORBL 1T4KB 3OX8A 3GIVB 3OJVC 3PQYE 4PFEA 1AHWA 1S7QA 2K7QA 3VGAC 3MNMA 1EZSA 1QFHA 4ISVB 5IHBA 3HVNA 1QW8A 5LN8A 2WN3A 1LK3L 2YSSA 2XBZA 2WSPA 1RH8A 4FQQA 3SE3A 4DN3H 1BZDA 2GIXA 2YZ1A 3ARGC 3ESOA 3RZWA 3VRLE 5DCCA 4FMFA 4PLJD 5D6DA 4BDVA 3OXRA 4HXAH 2VIRB 1C08B 3TYGL 3W11D 4ZMNA 2YPLE 3RU8L 1OK0A 2OMBA 5EOTA 4GG6A 4GBXC 2XV6B 3FN0H 1YEKL 3BGAA 5AKSA 2J4WH 1IV8A 3OXSA 5E23A 2WLJA 3GBNL 4I0PC 5TH2A 3N44F 3EUUA 3ZKND 2E0PA 3L17A 4JRXA 3TNNA 4NZDA 4IW4C 3RDJA 3FH5A 2EIKB 5D2NB 4FQCH 3A4EA 4HKZB 3SGDH 3P2TA 3RP1A 3UBHA 1FQ9C 2XZAL 4WUUD 2GJ6B 1J8KA 2WYIA 1FO0L 1EHXA 1UA6H 5I0DA 1EHNA 3SKUD 3B2UD 3QFJD 1OGTA 2VL5A 1IAOA 1N7MH 2Y06H 1RUPL 5DWUL 2Q8BH 1J9QA 1ZVNA 4NZRH 3VXSD 1Z3GH 5BRZE 1T03H 1U8KB 2BLFA 1X5MA 3NCJL 2ZCLL 4IRJC 1YQVL 1XF2A 1MIML 2YPVH 3NZHL 4TQ8A 3WN5C 1RFDL 4WZ9A 3SY0A 4KTEL 1XD1A 2X9XA 3IE9A 4XWGL 4CNIA 4CBPA 1I7RA 5GS2H 3QI9D 5FCUH 3DTUB 4OD3L 3WTXA 3MXWL 4BH7A 5AAWA 3U6RA 2IG2H 1CF8H 3O6KL 2K8MA 4XCCL 1YY8B 4KKPA 4JRXE 3MBED 4XMVA 5KBDA 1QBMH 3WTYA 4XX1G 5E7FA 4OW6A 4G59C 2VKXA 5EBGA 3CXFA 2QJDA 2W9DL 2RB8A 1F0LA 3P1VA 4H4NA 4PJHE 1N6QL 1KPVA 4TNFA 1OP9A 2OMUA 1SDYA 1JRHL 3CUPB 3EJSA 3QR0A 4DCQB 2FEDC 3K8MA 2VR7A 2ADJA 3ESMA 1A1NA 1JGUH 1WG3A 4GSXA 3UGXA 4PRAB 3ULVF 3B3BA 4FG2A 3TBVA 4KHTH 3A3YB 5KSAC 4L8DA 2NNXA 3DUUB 5F9OH 3OHMB 4YHOH 3PDOB 4FNSA 2X7LB 2WBJB 1RUPH 3GS0A 4KK5C 4DKEL 1XF5B 4A2DA 3APCA 1PZDA 1B88A 4KZDH 4DN3L 1RSFA 2FAUA 4HJ1A 3N06B 2X0UA 1O75A 2QTEA 1NKGA 2JSFA 4G7VL 3MLTA 1MELA 5A2KH 1FZOA 5D9SB 2PCXA 4YO0B 5JOPE 1Z5YD 1NMAL 2Z35A 3ULUF 3P30L 1O9ZA 3FU0A 1TO5A 3EJCA 1SEQL 3LNHA 4OGZA 4S1RH 4E41B 2A3TA 1F4YH 4Z7IA 1FG2B 3QUXD 3LS5H 4YOKA 4YMPA 2ZUXA 3DKHA 4Y2NA 1YEEL 4ODHH 1S3RA 5F0MB 3X13A 2J5LB 2H0JA 5B38G 3UROR 2E9JA 4YDVA 3JTTA 2VLKE 5E8DL 3L5WA 3N41B 2P5EA 2VDOB 3NDYE 2OJEB 2ZKWA 2FATL 3QG7H 4PRNA 4Y4KD 1S7RB 3TH4T 4HLJA 2WZ5A 4CVWA 4DT2A 3T0BA 1IM9A 3ROOB 1CTMA 1QNIA 1P69B 2WYHA 4OT1H 4QOKE 3Q6GH 1UKQA 2ERJC 2YOCA 3LOWA 2NY6B 4HUKB 3HLAB 2D03H 1IM3A 2R83A 1S7QB 2E6QA 4K5MA 5E6YA 1VEOA 4U6VL 2FHBA 4XN1A 4JO8A 1ZLEA 4P4KA 4LBAA 1NIAA 4NEHB 5MEQB 4OUOA 2CO7B 3L54A 4WI6A 3NN8A 5B7EA 2QKIB 4PJ7B 3VFPA 5L4MA 2PCFB 1T0MA 3I9AA 2Y0SA 1T4WA 3PPSA 4N2EA 3MJGX 4F7MB 4K7FA 3SQOH 1KJVA 2V9RA 3GFUA 1BJ1J 1FRGL 5CEXB 2R1WA 2Q86B 5MI0B 5CJXA 2GJ6D 5LKNA 2BS9A 1RZ8B 4OBSA 4ICXA 4PP1D 3FYEB 4KZEL 1ZA3A 3TVMB 4KI5D 5DZOA 4HA1A 3F62A 1DVFB 1BYPA 1H0DA 1NICA 3P9LB 3QI9C 5C0AA 2NR6A 2V37A 2H6PA 4H1LH 1G7PA 1A6UL 5CJOL 1AP2B 5J0BA 2B08A 2NY1C 4PBVC 3IWUA 2YBGA 2CLRB 1A7RH 5D93B 3HZYB