3U1QA

Crystal structure of m. tuberculosis ld-transpeptidase type 2 with 2-mercaptoethanol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
283
structure length
262
Chain Sequence
TLNAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mycobacteria Tuberculosis LD-transpeptidase type 2
publication title The Structure of Mycobacterium tuberculosis L,D-transpeptidase 2 provides insights into targeting the cell wall of persisters
rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
total genus 68
structure length 262
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3u1qA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u1qA01
4GSQA 3TX4A 3VAEA 3ZQDA 4QRAA 4K73A 5D7HA 5DZPA 4GSUA 4XVOA 3VYPA 3ZG4A 4JMNA 4ZFQA 4GSRA 3U1QA 3TURA 5E51A 1ZATA 2MTZA 5E1IA 5DUJA 5DC2A 4LZHA 4QTFA 1Y7MA 4QR7A 5E5LA 4A1JA 4QRBA 5LBGA 2HKLA 4LPQA 4A52A 5DU7A 5E1GA 5DVPA 3U1PA 5LB1A 3VYNA 5K69A 4JMXA 4A1KA 4Z7AA 5DCCA 5DZJA 4HU2A 4A1IA 3VYOA 3ZGPA 4HUCA
chains in the Genus database with same CATH superfamily
3MV11 2QSQA 1J1OL 2R2HB 5KYYA 4ACPA 1BMWA 2B0SL 5E8PB 5I19L 1I7ZB 2LVEA 5A2CA 2C9XA 4Z7NB 3D39E 1IGJB 2JJSC 2V2WA 1J9RA 3BKJH 2Q86B 3WEOA 3UIYA 4M56A 3HG1A 1GAFL 2OX5A 2AJVH 1L9PA 2YKLH 1OARH 2XX1A 3AJ7A 5CN1A 5FYJL 1KCVH 2DI7A 1CLCA 3T65A 4I18A 5E6SB 4Z7QB 1VFAB 1W0WA 5T1LB 2ZE0A 3EJUA 4UI2A 4ZK8A 3STLA 5DUBB 4Z7NF 3H2WA 2P5EA 4WIQA 1AVAA 4JKPL 5IQNA 4KXDA 2VR4A 3L08A 5F93C 3WS3A 5MEOA 5H2BB 1I1AC 1HZLA 2JH2A 1MVFA 3G5XB 4XP1H 2KL6A 3ZGHA 2N59A 5GIRA 4RSYA 5F7EL 3LKSB 4PYHA 3RKPA 5A43C 3F7VA 1JJUA 1AZVA 4UOW1 3T8VA 3NTCH 1KY6A 4H0LC 2CE6A 4NB7A 4RAVA 2X87A 3EYUL 4UYQA 5CGYD 4G83A 4WTXA 1IC0A 3EH1A 5DS1A 2DTMH 25C8H 2QLYA 3P4MB 2O30A 3RI5K 4APQA 5GRVL 4MBRA 1S7VB 4WU7B 4XMKH 5IF0B 3RX5A 5LBSH 4GIOA 3EHBC 4AZ8A 3PQYE 4MAZA 3UERA 5LGJA 4OU3A 3DOSA 1XFPA 3T4AC 5BZDA 1YEWA 1QWHA 3RILA 2C34A 4PN6A 2FWOB 1OCCB 4F93B 1YNKL 2VO8A 4Y7OC 4OUUA 4GT7A 1XAUA 3LD8B 3FTVA 4Y88A 4O51B 2EH8H 4OF5A 4M3KB 2BOBB 4AMKL 4MQXC 3MRJB 5GRZA 4IS6B 3SE6A 1TQSA 4EI6B 2VXVL 1JNJA 3NCCB 3IE4A 5LWYH 1YQVL 4R90H 1L5GA 2BSED 4AEHH 5DFVC 2E56A 3ISRA 1KBBA 1MW1A 1WA0X 4LOFA 3S37H 1SN5A 1T0OA 4A67A 5D70L 1XB6A 5E2WL 1KBKA 3FU6A 3L3OA 2ZYSA 1TLKA 3QRGH 3ZKND 1J0IA 1IEAA 3HFMH 5ETUA 3QQDA 1Q9OB 2IFFL 3LHPL 4PY8I 3UDWA 4X83A 4NERA 5E99H 4LPXA 1AR1B 3CX5J 3D1MC 1DQMH 3JBG7 4AUJA 1JTOA 1RVFH 2DKSA 4NBYB 4RGMB 3L1OL 4FI8A 3K91A 1U42A 3MV9B 1D6EB 1R3KA 1GGBL 4Q6KA 4XOAA 4FQXC 3S5YA 5C0JB 1PG7H 4ZO9A 1N2RB 4NYLA 2DLGA 4W81A 4MCZA 1J0HA 4U7KA 1WISA 1A25A 3LKSA 3MNVA 4URTB 5IMOB 3QFDA 2BSTB 1ACZA 5FOBA 1UOWA 2Y06H 3SQRA 4P4RA 3S5LG 3VFNA 2BNRA 3FF8A 4NBXB 1JCKA 1KJ3L 2AK4B 2YRBA 1RP9A 1OSPH 2P5WA 4P5TD 2CO7B 3LS4H 1BZOA 1M7IB 3DRTB 4MQTB 3ME0B 1JN6B 4YDIL 5FFGA 5I1HL 1MFMA 1ZA3A 5LGKA 2AXHA 2PCYA 3A21A 4PJ9A 3RZCC 4OJYA 4CW1A 3FBKA 5E08L 4WO4B 1XF5B 2SODB 3AITA 3DX7A 3O2DL 2EC8A 3DO4A 1A1MA 5DT1H 3H53A 3TC9A 4RFEA 5G5DB 2BIPA 4NZUH 3SDDC 4Q6YA 2AJ3B 4KZCA 1WPCA 2XXMB 2Z91B 5DHYB 2WD0A 3K6FA 3DHPA 3VFWA 3WI9A 2GITA 1MHPH 1NUNB 5EU6A 3QUXA 1J7VR 5IW3A 4A1IA 1ODUA 6FABH 1L4IA 2IH1B 3SO3B 3T77B 3ZXAC 1CGWA 4X9HA 3NJHA 1NMAL 3SJVE 1A2YA 4AGLA 4ONGL 1KTJA 1WTLA 2GJRA 4K71C 1LO2H 4G8IB 4Z0XB 3DUUB 4WI0A 2Q6WA 3V0DA 5FKPA 5DVMA 3WHXA 5F2FA 5CZVL 4WNJA 2X1WL 5E4EB 4K3DH 5F9OL 1CTOA 4M1DH 4F8TA 1MCOH 4GW4A 2P3YA 1D7DA 3CFJA 4WO0A 5IB4B 3NRQA 1CG9B 4JANB 5J7CC 1NGXA 2EDDA 1XGRB 4L9LA 1NMCB 1ZHBB 1TQBB 3EO1B 3B3IB 1BPVA 4XB3A 1BJ8A 4FABH 3HRPA 4UNVA 4QJ3B 4UM9D 2WKOA 1MCFA 4FFVC 2PWGA 3T09A 3WLBA 4PJFA 5JW4N 2YSTA 2JVUA 2VH5H 3KPRD 4NKMB 4TSAH 1DBKH 4LLMA 3BH8A 2P8MB 4BFEA 3Q06A 2N0KA 3FCUB 3A5VA 5FA4B 3LZQA 4QRRA 4OJFL 4WFED 3BPLB 5I1JL 3BZFB 1L9NA 2WQWA 3O6FB 4XCYB 4ZS7L 2JQMA 35C8H 1I8KA 2PW2A 3OB0H 3DSNA 3BIKB 3TYGH 4FQ2L 1MW3A 2AZUA 3T3MF 2BSDA 3D51A 4AOFA 2MMXA 1IVTA 2HJKB 2R2EB 3IFLL 3IMVA 3VXOA 4L1DA 5A16A 1FZOB 1DEEA 4J3OF 1MRDL 3BC9A 4LSVH 4RNRA 1NBYA 5C0AD 3ZTNH 3DETC 4M8RA 5IFJA 5C7XH 5I6KA 4GKOA 1O9ZA 3HPLB 3WIIL 3VNZA 2G3NA 5DWUH 2M1KA 3OJDA 3T0EB 5BRPA 1RMFL 2B5IC 1RIHL 2NLJA 2N4IA 5DEGA 7PAZA 3VD4A 4PIRF 3BT2L 4G70B 2VJXA 4UUJA 2IIJA 1UJ3A 2K9UA 2ZUVA 4OCYL 1TTGA 4TMPA 4NP4L 1KTLB 1E9OA 3FSAA 4PJ7B 3SGKA 3FFCA 2OW7A 4Z7WB 4DVRL 3L3IB 3U36B 1RSYA 4JG0H 4RBPK 3F5WB 1BWWA 3IVKA 4BQ9A 5IW6B 4LQFL 2R39A 4Y5XA 3MBWB 3RGHA 1S7SA 5MP6H 2XQBL 1D2PA 2QADB 1NSNL 2NY0B 5B39B 1XL4A 1DJGA 2BIMA 5I1GL 3MRQB 3T0AA 1BGXH 4HBQA 4J6RH 4N2OA 4K94L 4GJTB 1ML0A 3FK3A 4AJ0A 4JQVC 3FOLA 4LDOB 4I0KA 3C60C 1I3VA 3DX4A 3O2WL 2IANB 4FNQA 4JRYE 4Z95H 5GGUB 4AE1A 4K7PY 2NYZA 2DQTL 3LKRB 1NBQA 4L1BA 2QKIB 4JRWA 3PWJA 1CFBA 3UEQA 5HI5D 3VG9B 5AVXB 3QRBA 3RZWA 3VFOA 5MEQB 3KBHE 1PVHA 3C8KA 2OI9B 1W6LA 5CKGA 4O02L 1RZ7L 1S8DB 1P84J 1MW0A 1U8LB 3QSKB 1OAKL 2BP8B 1EHKB 3VRJB 3WXVL 2XA3A 2VDQH 1BVKA 1NCBL 3C09B 3D25B 1JPST 4OT1L 5EIQA 4ODXB 2Y0SA 3JWDC 5KTEL 1CBVH 3U0TB 5EIIA 1IU1A 1U21A 5IQMA 4A63A 3G5YB 2ODIA 1AZCA 2WXMA 4I0PB 1OPGH 2P8LA 5C08B 1EHLL 3M46A 5F7BA 5A2AA 3KYMA 4P05A 4JZNA 5I18H 1G6RL 2BXYA 4JDZB 4L5FH 1AE6L 1U8JB 4JHWH 3C5SB 2FGWL 5GS0D 3FNKA 4L5FE 3S34H 2PYEE 2HTLC 3K6NA 3L4VA 5ALBL 4NC0B 3BSHA 1C8PA 1R5IB 3APMA 4XX1G 1QBML 4TULH 4FQCH 3T5WA 4JB9L 3I3DA 2RAMA 3PWNA 2E5EA 4F8PA 2NNRA 3T0WA 5DD0H 4JFWA 5JXAL 2GCYB 4ERSL 4LVEA 5AZ2L 2DQUL 3FO9A 5LGHL 1P4UA 2EVIA 1UZ8A 2GTZA 1RUPL 4ZOBA 4AQ1B 3QJXA 2H6UA 4K5NA 2DQJL 2VR6A 4H20L 4W1TA 3VXUB 1SBBA 2B3IA 2EP6A 4KXZI 3HG2A 3QUZA 3DX8A 4BQBA 1MCCA 2Y1VA 3ATFA 1X44A 3FSZA 2BW4A 3CHSA 3PGCB 2JSFA 3ARBA 1LO0H 3MJ8B 3FB8A 4NFDA 3S6CA 1Y18B 1INEH 1DJYA 4ECNA 4KRPC 2VLKE 3BUPA 4G42A 3QYMA 1FP5A 3H0TB 4BFGA 4M61A 1UWYA 2R29H 5I73C 2F54B 4IOFC 2IH8A 3RWGB 1Q38A 3QT2A 1T89C 5CJOL 1JZ2A 3NZHL 4KTEH 2DY2A 2Z35B 4F7KA 1HHHA 2Y5EA 3KLLA 3KWWA 5EOCL 2EC9U 4NJ9L 2YBRA 5JIMA 2APVA 4D9QE 1E5BA 1PBYA 5MENE 1TO4A 1HINH 3FRPA 2P49B 5HI3C 4XR8C 4F7PA 2IPTL 3U1QA 1KULA 1T21A 4EZMA 1F1AA 4L37A 4PRDA 2R2BB 3SDXA 4WDIA 3PV6A 3FPXA 2F5AL 5E6IC 4WUUB 1ID5I 4K3HA 1HVXA 1ACYH 1NCHA 1PDKA 2I26N 3DPDA 4ZMOA 3LDBB 5CINH 3QC6X 2A9ML 5AVZB 3FCSA 4XNUH 5EORH 3PHQB 3KJ6L 5L88H 1A7RL 1S3KH 2NOYA 4U4BA 3N9GH 1RAMA 1A6ZB 5H94B 2O6CA 3EIFA 3C5ZC 5FYKD 3WKYA 2E86A 4R8WL 3F7YB 3BIBX 4G6JL 3W82A 3WIAA 2EXSA 3ZKMC 2IG2L 2YWZA 1NBVH 3D85A 4PTTA 3CSPA 3QXDB 4KMQA 2DJ4A 3QJFB 4OIBA 5DRZA 3P9LA 4NKDB 4Y4HA 4JM2A 1MCLA 2XICA 3GF8A 3ZU8A 4NGHL 2ZWZA 1GOHA 3RIKA 4E2OA 4HKZA 1YNTA 2IAMA 3EYVB 3WIHA 3MBXH 3RTLA 1OZTG 2YK1L 3FDWA 1JDCA 5TGBB 3AWGA 2L7UA 3HBGA 5IHLB 2WP3O 3GDCA 4MQSB 4U3SA 3A6OA 1WZLA 2YPLA 43CAB 1BREA 3V0AC 2NXYD 3B9KB 4LIQH 4UBDC 1CFQB 4TNEA 3KVDD 2NY3B 3RY5A 4QXVA 5I8EB 3U79A 3BHBB 3UAJD 1NFIB 2NR6A 1SLUA 4OZGA 1ETZA 4NN7C 5I1DA 4LIQE 2F58L 5J4MA 3TONA 4FDWA 4M5TA 3R7QA 2LABA 5DQ9A 5CFHA 3WAJA 3ARYA 4LSTL 4FLRA 5DGQA 1XSKA 1OAYL 1RP8A 2OL3A 3CZFA 3QI9C 5I2IA 2HPOA 1JVLA 5ACZB 1QWUA 5KVEL 3VTTA 3A4FA 3IDGA 2WXIA 3B8YA 4X0NA 1OW0A 4L3ED 5JZ7D 4HUNB 1I9RL 4XXWC 4M6OH 4AI7A 1IGCH 2H9GA 4EDXA 4N5ED 2WBWB 3Q5YA 2WQRA 5JA9A 3U9PH 1OCZB 3D52A 3ETBF 1RZIB 1MFAH 3NCYS 3UPRA 1LO4L 3BN3B 4XNXL 3LEVH 3UL4A 4YZWA 4G43B 2R83A 2Y7NA 2WXGA 3QB7C 3ZPDA 2YAHA 4H44C 2Z8VC 5JPNC 3EJSA 2NX5D 1JUFB 1T03H 3MRMB 1M6UA 1Z5LB 3UXFA 3ZY7A 4TL4A 1ZGLP 2GJ6D 1ZLUH 1W16A 3RI5F 3F58L 1XCQB 2IPUG 1CT8A 5DRWA 1FVEA 1R5VA 1S7TA 4NKDA 2X4UB 5EEZA 1I85C 3G5ZA 1OZUA 2D9CA 2B08A 1JVKA 5AVQB 1USZA 3D39D 4IGBC 5KBPA 5IMKB 3OWRA 3BUDA 1AY1L 4OD2B 2V17L 3RP1A 4Q9QL 1I7TA 4NCC2 1X5AA 5EO1A 1KACB 5I1LA 4LDEB 3L3DB 3QG7H 1N3NA 3BP6A 1KB5L 4ZTPL 1AQ8A 4LEXL 4ELME 3GMMA 3APCA 5GS1A 2QQKH 1TZIB 4HCFA 4LESA 1CC3A 4P9HH 5IBUB 1TVHA 4POUB 1DVZA 3HS0C 3KYNB 4LCCB 5FB8A 1DCLA 4LL1A 2GTWB 1MKFA 2DQDL 2C7FA 3R1GH 4OCLC 5I82A 1OP3K 2P80A 3PJSA 3PIQA 4F24A 4Z7OE 2BFVL 3OM3B 5L9DH 4R84A 4K2UH 3W11C 2ALAA 2CNZA 4XB7A 2NDGA 3CXFA 2ZTBA 5GJSH 1U2CA 1NCOA 4X6CE 5SWQA 4K7PL 3CN4A 4G9FA 3UTSE 4LLDB 3NBNA 3PQYD 5FO8B 3BYTA 4I4WA 1P4LB 2OP4L 2A6DA 4ONFH 3Q6GH 1J5OH 5J11C 4G72B 4F7MA 1BXXA 3I6SA 4KTYA 1ESOA 5FM4A 1X3DA 5F71A 4N9GB 3NG5A 1EH9A 4BWUA 4R97B 3FMGH 4TQEL 3O6LH 1NCIA 4BIKA 4KV5F 3HR5A 1X7TA 4XXDA 8CGTA 3MRDA 1J0ZA 2LV4A 3CU1A 1F90L 3KPSE 4JKNA 4ALAH 1XIWD 4NQEA 3H3PH 2FJSA 2Q8AH 3RVTD 1NEZB 2VXTH 3EADA 1ORSB 3KPMA 4IHOA 2CMRH 5J5EA 1KBGH 4U6XB 4ZUTA 1J8SA 2UY7B 3SCMA 2EXWC 2EECA 3VFMA 4H8HA 4AQ8A 2AJUL 2QGEA 1LP9B 3TO4C 4P9MH 3O3EA 2FEEL 4U6YA 1FNEA 3IWVA 5CMAA 5BRZB 3MRHA 5T1JA 2VZUA 4RRPA 4NT6A 4LVHB 4N0FA 1HCZA 4ZAKA 2P5EE 2QVFB 3DECA 1LK3L 1QFWL 2WLLB 4K23L 4F57L 4HIHB 4I13B 1S5HA 4Z7IA 3QPXH 4KQ0A 2QMKA 3QO0B 2VLJB 3QJZA 4V1DB 1LP9F 3GKWH 1S7XA 4ODWA 2DS4A 1AKPA 1TJMA 1H3PH 1Q72H 2VQTA 1HI6A 2JQZA 1JWUB 2XQYG 1C16A 4BCZA 4C47A 5B38A 1EGJH 2XLLA 5ANMB 5B7MA 5IWLA 2XYBA 5D2NC 3WNNA 4PG9B 2I27N 1BJ1H 4BSVA 5AEAA 2VXQL 3CX5K 4DN4H 4BSJA 2HRPH 4QO1B 2YXVA 3JTTA 4ZPTA 3C6EA 2B4CL 5E6YA 4RAHA 3NIGE 5JLZB 4PMFA 3VXPA 1MH5A 2BVQA 3BEWA 3QARA 2WLYA 4POYA 1CF8L 1BBDL 2HH0L 4RIRA 4P23D 4KJYA 1OP5H 4X50A 2O6EA 4HK0A 1Z0MA 1JHTB 3BGAA 4LHUA 2NYKA 1SJEA 4UIKL 1KELL 4KTDL 4ORZC 4PJCA 4YXKL 7CGTA 1QSFA 2QV4A 2YO3A 2HKFH 3SGDI 4FG4A 3O8XC 1HH6B 1FI8C 1QQDB 1ZT7A 2RB8A 4XMWA 4FG2A 5I8CA 1OXYA 1DQJB 4JY5L 5I5JA 3FTZA 1X4ZA 3Q5OA 3EFDL 4R4ND 3HPJA 5F89A 4YR6A 5C0CA 5BV7B 3QO1B 2R0ZL 2TAAA 3G04A 3RIFK 3SKNB 4ZMVA 3QW9A 3D0VA 3CXHJ 5E4AA 3SJVD 4XO8A 1JSYA 1KEML 3ZUCA 4RZCA 5HYJB 1NBZB 4JRXA 1CFNA 4TL5A 1GZQA 3D7PA 4N0YL 4Z7QE 2IXQA 3QIUA 2B1AH 4LDLB 2GK0A 4LPCA 4YHNB 4CC0A 4XNMB 2P44B 3WNPA 3OC8A 4MA7H 1FFPB 3IJ7A 2VXUH 3A67H 4DP5X 2NW2B 5ES4B 2OJ1A 2WBJC 2TSAA 1IKNA 4LLWB 5DK2A 3RAJL 1OT1A 5DSCB 2I9TB 1MI5B 1U8MA 3K6OA 1Q0YL 4XRCA 3GSWB 4JLRA 5KSUA 1UM6H 3K2IA 4X9YA 4ZNEE 2BMKA 4P3DB 2XTJB 3K4DA 1RPQA 4LCIH 4OGYH 2XPGB 4MZ2A 2BNRE 2DJMA 3UBXB 2APFA 5I76B 3H56A 8FABB 4NQSA 2YQ3A 4AY0A 4EUPG 3AVEA 1DE4A 3M1OA 1DJHA 2SEBB 1HL4A 1WICA 1DBBL 2OTPA 1K3ZA 4HKBA 4Z0BH 1IAKB 2F15A 2EDKA 1NGZA 1YEDA 5FPIA 5JHAA 3WAKA 5G4OA 2FEEI 2RR3A 3I6KA 3QNXA 3H9HB 4W9LC 5IUSA 1JGLH 2PO6A 5IT2H 3CHQA 2YSSA 4MSWB 1SDDA 5C0NC 3SYQA 3IJ9A 3OSVA 2EZ0D 1QFWI 4M4RB 1TZAA 4EF3A 3MROA 1BBJB 3EJCA 1FZMA 4JJOA 4LSQL 3RPBA 5JIIA 4EEEA 1DSWA 3HBQA 5E0QA 5T3XH 1NAMB 3TBBA 5I71C 2VN4A 5EU6E 3UFIA 2Z31C 2ZICA 4PWHA 1K8IB 1NGWB 5T3XE 2YPKA 3C6SB 4GXVH 4LRNH 3TX4A 2X53A 4GP5B 2YEZA 4A66A 3DDGA 5CEYB 1UATA 1Q94B 4ZXBD 4GKSA 3PF2A 4KJQD 4N2BA 5JUEL 2IC2A 4XBGA 3NPZB 4KRLB 3TBVA 2I85A 3R4DA 1G7HA 3TBYA 5J1SC 1DQTA 3SKOB 3UBGA 4TN9A 2IGFL 4R83A 2CJUH 1RLWA 4HJ1A 1KYAA 5E2TH 4YFDB 5LN4A 5BMFL 5T1KD 5D72L 2A9BA 5JQHC 4GO6B 2IMNA 4MZ3A 1LNUA 1NJ9B 5IEKB 5IVZA 1I1AA 3BSZA 5LG6A 4FQXB 5DUPL 5F9DC 5E8OA 1Q4NX 5DJZB 3RVUD 1IARB 1ZGLM 2WIIB 3IMRA 1F1DA 5EZOH 4OFYA 2WPGA 4HUKB 4HWZB 5C2UB 2QSVA 4RWYH 4PJFE 4ZUWA 1OOWA 3FTYA 4RGNE 4ZDHA 5LKNA 4HWBL 5BXFB 3N5AA 3C87A 2G5RA 1PLCA 4HWNA 1NDGB 4XPBH 4QRRE 2O5YL 4UIMA 4FI7A 2N01B 5F3HB 3RFZA 3R4RA 4JRYD 2EVGA 3VQLA 5FUOH 1UG9A 4M7ZC 1K8DA 3D9AL 3AM8C 5D1XC 1LWHA 1OWWA 3D2UB 5GGSA 3T4AA 3K2UL 1EJOL 1QLEB 2F0CA 5F9OH 4KNQA 3S37X 4P5MA 4K7FA 1PZSA 5CEXB 2HVKB 4QJ5B 5AW9B 2ZP0T 3OBAA 1IEBB 1EFXA 4G6MH 1CS6A 4TSCL 1WEJL 3ULVL 2HUHA 3FRUB 2B20A 2KQMA 5L8KB 1TJHH 2PP7A 2CCLA 4TUKL 5HHXH 1M1XB 1Q9KB 4L1HA 3V4PL 1RXLA 4BA0A 4R4BA 4NZTH 2A6JA 3BAYA 1N5AA 1UM5L 2C4FT 1PG7W 2MEJB 5FUZL 3V9FA 3FUHA 3MLTB 4UV4L 3NJFA 2ED8A 4AZUA 3MYJB 5B1AB 2BJML 4R7DB 5ITBH 4W9KC 3X14B 3AB0C 3A23A 4MAYD 1O7SA 3ULUL 2CJ3A 3FQXA 3SKJH 4KHXH 1PG7X 3QFGA 3WN5B 4UZUA 1P84K 3BWSA 3PAUA 2WVVA 3IDYC 1BQHB 4AYBA 4U1NB 1PPIA 3F85A 2PYED 1DCEA 5LQBH 1FFOA 4MJ5B 1BZEA 2EYSA 3FFCE 5ILTH 3QHFH 4LSSL 1BF2A 3ALPA 4OZ4A 4Z7VA 2GC7C 5FKAA 4K55A 1XXDC 1JXDA 2IOIA 2QVKA 1V27A 2VNCA 2WLZA 3QIWD 3QH3B 3QUGA 4JKWA 4OQTL 3TOPA 3UZVA 4DETA 4XH2A 3UO8B 1XF4B 3JV4B 3D3VB 1FHGA 4YHZL 1ORQA 2ATPA 1ADQA 3EYSL 1W8EA 5HJDA 5EZIL 3CN0A 3LKOA 4Q0XL 4CDHA 3QEQB 1KXTB 4R7XA 1PKQB 2HG5B 5FM5O 3RZCA 4HV8B 4YDJB 2EINB 1XF2A 2ADIA 4DGYL 3VXRA 3BWUC 4KITB 6PCYA 2VLKD 3LVEA 4E68A 2C7UB 4KVNL 5DJ6B 3CC5B 4HHGA 5DQJA 4AWJC 4U2YA 3QNYB 4Y4KB 1BVLB 5J3HC 1NDMA 4MGXA 1QFUH 3K1DA 3WHE1 1C5DA 2V33A 4K94C 3SDDA 3WYRA 2Z7YA 2BY1A 4IU3B 3MRIA 3VI4F 3S3PA 3K1KC 3WUWA 4CVZB 1CD0A 1LK2A 4IBYA 1CO1A 1PD0A 5MEND 3UTTB 4ANVA 4XBEL 2QPUA 1EZVY 1DVFD 3PHOA 4NKOA 4ESKA 1UM4H 1Y1DA 4H0IA 3SKMA 3ALWA 4G7SB 1BQLL 4NM8L 2B5IB 5LCVA 4ZW5A 3MNMA 5SV4A 1AHKA 1AZRA 5D7IB 3QG6B 2OBGA 2X2IA 3CHOA 5ADPH 4MKMA 4OM0H 4WV1B 4AGQA 4IBWA 5CJQL 4Q2ZB 1R0AL 4L2LA 4N0CC 4LCVA 4X7SL 1LILA 4PJ7E 3ULVF 2KS0A 3VFTB 1THAA 1EXGA 4Z7WE 3IGAB 3BUTA 1SXAA 5D7IF 4UINH 4ZTEA 1TJXA 2CIIA 2VDLL 5FCUL 1O7VA 1W6WA 2XZQL 3HAEB 4URKA 4FXGC 5KAQF 3SOBL 1I9IL 5CSZB 4MDJB 5DJXA 3IPFA 2DL2A 1D5MB 2X4NB 4ZFGL 2ZX6A 4UOZA 4OLVH 3DV4A 1I3UA 4XWGL 5L7XH 2GEQA 3MCKA 4IHBA 2XHNA 3GLDA 2CKBB 4UAOC 3B9AA 2JELL 3C60B 4JQXC 1XEUA 4LLQA 5IW1B 1QG3A 1MQKH 4KWUA 4HLEA 4LOUC 1NGYA 5CGMA 3SGJC 3S8WA 3OB8A 2OMZB 2EDEA 4GW1B 3U2SA 2NZ9D 2DM4A 2O26U 3VA2C 3RVXD 4MLIA 3QRLA 4E5XA 3QDJA 3MRCA 3C6LD 3MFFB 2WLMA 4W4OA 3UYRL 1BZ9B 4MQ7B 4A37A 3UOAB 4ODHH 5DRXB 1BFTA 2X09A 2Z0UA 4G1EB 4NWUH 2H3NB 5HSFA 3QDMD 3TH2T 5KVFL 1HJCA 3LNIA 3L9YA 5DMIH 1PU0A 3ZO9A 2YD4A 4OUOA 1MJUH 4QAMB 3G08B 2Q0ZX 3LN5A 3I75A 4B9JA 1QEWA 1KZYA 2OJZL 3QFJB 4FL4C 2B2XH 4XMUA 1CD8A 5ADOL 4UTBL 2CK0L 5DMYA 4OGXH 1WT5C 2V5MA 1TKWA 1X9QA 2EDFA 2EE0A 2WXOA 5B3SB 1S9XB 1QFWM 4MXWL 4HIPA 5LDSA 5TTRA 1S46A 4CA4A 4F37K 4IDLA 4KVCL 3E6FB 3DROB 4V33A 4BRVA 1T0MA 3CPUA 4P2CG 1E3ZA 5F7HA 3MOAH 2KZ1B 4MRBA 3WIHH 2WXRA 5KYWB 1KG0B 4GB9A 2PTUA 2ZUXA 3NT0A 3ELQA 1UQSB 2D7TL 1J9QA 3WLWC 4K5OA 4GW5B 3VXUE 5IEHA 3P9WB 2WNGA 4JX0A 1G1OA 2A7BA 1XCTB 4IRSD 2YFOA 4JQVA 5F96L 3FQRB 4FA6A 4Y19A 2BSSA 2H26A 4M5ZL 3H8NA 5FXCH 5AD0A 1F4HA 3AC0A 2JLPA 4DCQB 1XH2A 1IE4A 2C9RA 1JZIA 2OZ4H 5GGQL 2HMID 1MCJA 4KRPB 3RWCA 1I1YA 4OZGE 2F54E 2OQJA 3ARQA 4QWWC 4R2GC 5I73B 1IGML 3JZYA 3OG4B 5AL8A 3BYYA 2AXWA 3P3RA 3JWOC 5DA0B 1DVTA 1TOXA 3NIDB 4HXBL 1NH6A 5C0DA 3VH8B 1SVBA 3B9DA 3D07A 3BT0A 3MJ6A 4WWKD 5D6CB 1VFBA 4XE5B 3LZOA 1YY8A 2K6WA 4MDIA 3ARXA 4GRLB 3PL6A 3S88L 1ICTA 2CR6A 4WU5A 5J6GA 2A9CA 1JIBA 1NFDA 1U8NB 4WCYH 3L3GB 5EDXA 1EEZB 1AGFA 3KJ4C 2VDOB 5GRJL 2GIYA 3H2QA 3L5WB 4UILL 3SDAC 3UYPA 3CCHB 3QZBA 3EJPA 3K8MA 3KWXA 4WUUE 3B43A 3UTSD 1X9RA 3BP7A 1F4YL 2FO1A 3BQVA 3HR6A 1U3HC 1NC4A 4Y5YC 5CSBA 1XGQA 4KK8D 5JQ6H 4R96A 2COVD 4P5SA 4G1MA 3L2LA 2OYKA 3T3PB 2P1YA 2ZNXA 4N26A 1UC6A 4YHML 5DHVA 4NDMB 3C5ZB 3AFLA 2AANA 3HMXL 1MF2H 1CVSC 4IIQB 4MA8L 1LD9A 1FN4A 3DUSB 1OM3H 3LEYL 2IDCA 1NGPH 1JNLL 5DGRA 4JFZH 5F88A 4WJG3 1FF5A 4F9PA 3ZT7A 2BNQA 5A6LA 2EDOA 4KDTC 1RUMH 1N12A 4GW5A 4XWOC 4Y2DD 5H35B 3MR9A 5L2KB 1T5WB 2FEDD 3N55A 1SVZA 2VMCA 4NPKA 4X42A 4IRZH 1FVDB 4ENEC 1FE8L 1DLFL 1V10A 2M83A 2PETA 4FYTA 1FL5A 1U58A 3ET9F 5EU5A 1A0QL 1BQRA 2V9TA 4JFSA 5DDHB 3KEHA 4JVWA 4Z23A 2D73A 5D4QA 4DCQA 2QQNH 4PEEA 5EO0B 3TIDA 3X1EA 3L3HB 2P5ED 2YAMA 1ZXKA 2MFNA 3AUWB 4IBZA 2E75C 5CEZL 3I3BA 3ZDXE 2ADGB 2YGOA 4NN7B 4X7TB 4Z77B 1MFDH 5I5IA 3L3JB 4YBQD 5IROA 1M6OB 3C5JB 2OJEA 3BLKA 3DYMA 5HPMA 3WNJA 2UV3A 5FV1L 1OE1A 3TWCH 3QI9B 3LYRA 4GO9A 3OKLB 2GKIA 1U8NA 2CGYA 3GBEA 3SBWC 1L0PA 2OXHB 2QDWA 3MLVL 3LY6A 3OZKA 1LMKA 4R5XA 5E6IA 1IFHH 3U7YL 3V2AR 3QA3B 3CU7A 4TUUA 4YWGL 2UZYA 2X1QA 4L4VB 4MA1C 1H3UA 5JPNB 1FH5L 2W91A 1MFUA 2O5XL 3B1TA 2Z93B 2IO5A 4Y8DC 4G3YH 5IJKC 3F2LA 3Q8EA 4CMMA 5HYSG 2BP3A 2BY0A 1J1PH 3CVIL 1UH4A 1I1RA 1TETH 1ZY9A 1AQKL 4L8SA 1QHPA 2I9LA 2Q3AA 3HW7A 1FFRA 1JRHH 5SX4H 1F02I 4QKTA 4HS3A 3IDMB 4JO4L 4P99A 1YJDH 3GO1H 1E5UI 3NDYE 4QCIB 2F19L 3MCLH 3RLSA 4CSSA 3EXJA 2XWRA 4GUPB 4RFOL 2KH2B 4IGBB 5B4MD 1J12A 4MVBC 2XPZA 3FHEA 4I3SL 3IFNH 4NQEE 4Q97A 3FH7A 2AEPH 4PY7A 4XP6H 2EDWA 2F68X 1HHGA 2XRAL 5E95B 3P54A 3CHRA 5T1LD 1ANUA 4PJXA 5C0BB 3L6FA 5IM7A 1OOAA 2NT1A 1WUNT 4KQ4H 4O5LL 1XGPA 4FLHA 4PRHB 4UU9A 3S36H 5L4IA 4PP1D 4CL7A 1YYMH 2HN7A 3GXUB 4L4TB 4YX2L 3NCJH 3VRLE 4PGDB 1ZXQA 4XVUD 3QXAA 3EFFA 1SM3H 2FZ3B 4MJIA 4NAQA 1BLNA 3HS0B 2KBGA 1G9NH 4F2MA 3IDNA 4U1KB 3SPVA 3CXHK 4DOHE 4NNPL 4HPOL 3EFOA 3FSOA 5CILL 3RWHA 3MCG1 4LAJH 3QEGL 1GR7A 4X5WA 5CGYC 1N68A 4Y4FA 1HKFA 2X41A 4AGPA 2ZSWB 4XXWA 4FQJH 4UNUA 2FIKB 3RWIA 3M1BA 4FLOA 4TLTA 3ZIMA 2ZKXA 3RPIA 2BNRD 2IQAA 4JO5A 2XACC 3MJWA 4NN6C 2JQAA 2OZNA 3NA9L 4NOBA 2PWHA 4G8GB 4PRPA 5TH2B 4CADB 2QSTA 3AG1B 3LNGA 1ZATA 3QEUA 5IBTL 5MEPB 3MLYL 5JTWA 2V3EA 3B7YA 3TM6A 4XAWL 4S2SA 3MU3A 5J11B 1B2WL 1BP3B 1F18A 1R3HB 2XA8H 4K07A 1O9VA 2AAVA 4LSUL 1QSFE 2B9BA 4PJCE 4PWIA 4AJVA 3PGFL 1P4BH 2BC4A 1BEXA 5T1MB 3QHZL 2CHWA 5IJVB 1A6UH 2B4CC 3O3AB 1FLRH 1GC1H 1WS8A 2RCSL 1I85A 1MRCL 1TQWA 3LQAL 1FL3A 1S7QB 5C0IA 3OKOB 5ISZB 1IC7L 4C83B 5GS3A 1DJXA 5EU6D 3QUXD 4HH9A 1ZHKA 5ESQB 1YMMA 1ZV5A 2IALB 2H6PB 3KPTA 5J12C 4PHXA 4ZUUB 1E3FA 4NSKA 4PH8A 5T3XD 3ZR5A 1XSIA 4H5SA 1AJ7L 1NICA 1CURA 3EZJB 2QGDA 1YUHB 4AL8C 3RWJB 3TO4B 5C0GB 4DF9A 1Z9OA 4H88L 4PJEB 5I75C 5ESAA 5D4JA 5CWSB 5JXEA 2Y7QA 3F62A 4GAYB 2F53B 1XVSA 5FK9A 3B2XA 2E47A 4LEOB 4YDVB 3QORB 4I77L 3GSNL 3H2PA 5JW5A 4BINA 1LJMA 1KIQA 2VR5A 3T2NH 3EJYC 3STBA 4YXHL 3TJHD 2WXJA 3HKZA 3NN8A 2H1XA 3ELAT 2ZSWA 5TF1H 5E1AB 4P5TC 2XDHA 1TZHA 5ANME 3V5KA 3BKYH 4BZ2A 4RGND 5C0FA 4UMGA 5D2NB 2HWZL 4KY2A 4M1CC 1INDL 4V2BA 3DI2B 4QRRD 1FVCA 4KRMB 1A6WL 3HC2A 3DMMA 1G9ML 5T8IA 2YBGA 2AKRB 3CFNA 2AXJA 1KLFB 2DQHH 4ODUA 1DQLH 2VOTA 2YMTA 3IDXH 1I8IA 1IL1A 1IT9L 3HS8A 1IC4L 2F1EA 3P9MB 5DWPA 5A2LH 1SHSA 3HZMB 4UDTA 2CK2A 1KWGA 2GHWB 3WE1A 4OZHA 1IVLA 2QELA 2CUMA 3NSXA 2NTFB 2X89D 4NPYA 5K93A 1OLLA 1IGTB 1VPOL 4AM0B 1FBIL 2FO4B 2WUCL 4G6KL 1KWKA 3OKOA 4MMXC 1KF9B 1UB6A 3MRGB 3W81A 3ZMRA 3BZDA 5F1IA 1GCFA 1RJZA 1RIUH 1FUNA 4J3VA 3VGGA 1I1CA 1HE8A 3IDIA 4LASL 4NLHA 1JV2A 1AI1H 1E27B 5DURD 3T8MA 3TBWA 1VKXB 1DJIA 4GS7C 1KBVA 4FQQA 2NY7L 5TK4A 3U46B 1OAXH 1J1XL 4MXQD 2Y1AA 2DEXX 1NGQH 4GBXA 4UNTA 4FFYH 2HT2D 4DP4X 2VDKL 4AENB 1EO5A 1EXUB 1FNAA 1KN2H 3BSZH 3L1FA 3JUZA 5JO5A 1ZT1B 3FFCD 4HKXB 4RBPH 3UZQA 4RMSA 4JFDB 2ITDB 4LSPH 4PR5B 2WBJB 3ENEA 3CUPB 4WSKA 4E36A 2KYIA 3CHPA 3ZDZB 2PPEA 2DYPA 3M45A 3V52L 3QQ3B 1KPVA 2OSXA 4XCFH 1FNLA 1TMCB 4F2FA 1SYVA 1NLBL 4EKXA 3GDBA 1CXKA 5KSBF 2QSCL 4HUUA 2XWBB 4ZZKA 2VT0A 3BN9D 1UXWB 4KX8A 1QI5A 2WQXA 4TLKA 5EBWA 1DFBH 2OMUA 1COBA 2Y2WA 3ZDZF 3ARGA 1KLUA 2VQ1B 4IKIA 4MRCA 4WFFE 3LZFH 5AW8B 5JIKA 4JG5A 5GRUH 1FZJA 1TQVA 4HC1L 2MCG1 5KSVB 4UQIM 4U1MA 3IRCA 3LPFA 3PJNA 4QHPA 2D9QB 5I6NA 4G5ZH 3SPJA 3DK0A 3GLAA 4HDIA 3RWEA 5I16A 4OF7A 1RUKH 1G7PB 4BZYA 5A2KH 5CSGA 5TQ0L 4ZFOL 4GG6B 1FRGH 3O8XA 1MJ8H 5JIQA 3IN0A 1BM3L 1IC5H 5TFSL 2XWJB 3O45B 3VSUA 2IBBA 4P2QB 4DERA 1AD9B 4YDKH 3BZEB 3HCVA 2XN0A 2HFFA 4U1HB 1IBDA 4JY6B 1PZBA 4JJ5A 4PRIB 4X6BB 5I71B 1UADC 4ETQB 4QHMA 1CGSL 1T1ZB 1PD6A 4AK2A 4GEIA 4GG6F 1N6UA 1F6AB 1NCCH 3DJ9A 3NGBC 4PBVC 1YQ2A 5JQIB 3HZVB 1PIGA 3BMVA 1V7NL 2Z31B 3VFPA 5KJRH 3TNNA 4HWEH 1KGJA 1ZLSL 2VISA 2GAZA 3GMPB 3W3BA 1ERNA 3IU4L 3TBSB 1U8CA 4XTRD 2OYLA 4XNQB 5F7FA 1TLMA 5FECB 4IRJA 2GPZA 1TF4A 1E9QB 3U9UA 3L48A 4R7NB 5TE7H 1X5XA 3MLSH 4MNQB 3O0RL 2WAQA 3BD3A 3BOVA 4WW2C 4Z7VE 5D1ZI 5DHDA 3AMKA 3O3DA 1UACH 4FYSA 4Z5RA 3ROOB 1WFNA 1NCUA 2ZWNA 1GGCH 1Y0LA 1U92A 2J56A 4ANXA 3ULUC 4WLCA 3FQUA 5F9WC 3WSQH 1YO4A 5ITFA 3NFPB 2AEQL 4A6YL 1EXHA 3VW3H 1KJVA 4MDRA 3BZ4B 4GRMB 4I1RA 1M56B 4E42A 2PCPB 4F37F 3GJFB 3QUZD 1SJVA 3AADB 4XVJL 5K9JH 1CYWA 4NUGH 1YECL 4E9WA 3ARBD 5AAWC 3QNFA 4M7ZB 1Q90A 2CLZB 1IUZA 2P4AB 5D1XB 5GZNC 3LAFA 3SYOA 3VXRE 4YUEL 1HSAB 3MV8B 5AVVB 2X4OB 3E7JA 3QPQD 2BIIA 3RTQC 1IAOA 1YAIA 7FABH 3W0WB 4YK4C 3V0GA 4PGEA 2J1WA 3FZUD 3MLWH 2VDRB 4Z7UB 3VSTA 2KLTA 1N59B 4QDGA 1PY0A 3HNVH 1NL0H 2L0DA 3B5TA 3GYRA 4TSBL 2X6AA 3DPBA 5LCVH 4OGZA 3DJZA 5DI8B 1T1ZA 2CNYA 1JYNA 2AXFB 3BH4A 3MODL 3O2DA 5EIVA 1K6QH 5EFIA 4Z7UF 2DQCL 4JRFA 1S2EA 3GMRB 4AEEA 2A4ZA 3AB0B 4YSOA 1GJIA 4BUQA 1JZEA 5CBEB 1IGFL 1ES0A 3GZQA 5T5NG 4YBLC 2YXWA 3FOMB 3OG6B 4N1CA 4AKQA 1W0YT 3BPNC 2CDFA 3DIVA 1OTUD 3HI6H 3IDYB 2A6KB 5IESH 1OTSC 2XKNB 4PJAF 1QFHA 4TQIA 4AV4A 1S7UB 3QIBA 4MD5A 2WQVA 1TJGL 2RQEA 3E1F1 3QCUL 5K1NA 2FSEA 1N18A 3TCXA 2IPUK 1KCLA 1MCKA 1MAKA 4W9DC 3UBFA 4EN3B 2WM0A 3LIUA 1QVOB 4KNSA 4JPVL 2XBZA 2D31A 4EN2A 4XNAA 4Y4HD 2IQ9H 4JM2D 1UD6A 1UD2A 4YH6A 4EQ3A 2Y1ZA 2Q8BH 1KPRA 1M05B 5M94B 2IAMD 3ZN6A 1QRNB 1OAQH 3GBNL 3U0PB 5ID1B 2VDPL 2KKQA 3Q01A 4H7VA 3RGVC 3HOGA 3TIEA 1ZHLA 5E24E 5D4HA 3QEQE 4PJDB 5CU9A 4ABQA 5DJ8A 4OFDA 5AUMB 1PKQE 3S35H 2MH4A 4RMUA 1KTDB 1BAFL 3I6LE 5DEZA 2F7OA 2WINB 3IDJB 4HFWB 3FFDB 4WK2B 1E4XH 5MHSE 2NR6D 1KCUL 4JCLA 2F54D 3V5DA 3V4LA 3S7GA 5DJ0B 3TEXA 2ENYA 3LNFA 1Y6NR 3IEAA 5KZCD 1HOEA 2W0FB 1BD2A 2ZD0A 4ISVB 3QDJE 5JDSA 5F9JB 2CBMA 3JTSB 4L29A 4KK5C 1ZA6A 5GHWL 4JRLA 1G1KA 1WFMA 2DLFL 4HUWA 3ZOAA 1KGYE 3VJ6B 3CDZA 5EU7C 2CDEA 4HU8A 1EUTA 3HNTH 3UTTE 1INQB 2Y2YA 4N2DA 1BEYL 4JR9L 4N8VA 5CD5C 3S5LB 5IB5A 1AKJA 2Z8RA 3NCWA 1TQCC 3B83A 1B88A 1B0WA 2XBTA 4GKZA 1MFBH 2FD6H 4WUUD 5EWIL 3VXTA 1ECZA 4HZ1A 3AREC 4UTCA 3GSVB 5DQDL 4H4NA 3GMOB 2W0KA 3E6HB 2DV6A 1IBGH 4WI4A 3DXAA 1Q9LB 4OD3L 1R33A 4HP5A 4XVTH 1HNFA 1X5JA 1R4XA 2BZCA 2WBXA 5EG6C 3MRNA 4FNUA 3GUTB 4A7SA 1SOKA 4FXGB 2YEQA 5IKCA 2P46B 2XWEA 1MFNA 1T2QH 3AY4A 4YDLC 5GGVY 2CKBH 5JMOC 2NW3B 1WAPA 4POZD 5E23A 1L0YA 2K9FB 2VABB 3U2JA 2C9AA 2WQSA 3DIFB 2OM5A 2AK1H 3SDCA 4A7VA 5D9SB 1WAEA 2ZKWA 4UAOB 3QJTB 1GIGH 2A9DA 3VDBA 3IDJA 2QHLA 3RU8L 1JWSB 1TEYA 2QZ5A 3I50L 4AYID 1RIVH 1S7WB 2V2TB 4NOFA 1HNGA 2Y07H 1DSFH 3KWUA 3JWDH 2EO7A 2J7LA 1TTCA 1TTFA 1ZT4B 4R7VA 4GQRA 3TT1H 2Y7OA 3D18B 2DB8A 4J2QA 4F3FA 3LH9A 2DEWX 1T1YA 1OP3H 5C0EB 5ICYA 1TYJA 2BVTA 1KGXA 4Z3EA 1XGZA 1AANA 5FIEA 3MX0A 2P80D 1BQ5A 5HHOA 1N26A 4NNYA 3LH8A 5CKAA 3GTNA 3WHE0 3HZYA 2VITB 3VWKA 1NFDE 3CBKB 12E8L 1D9KB 1GSKA 2MKLC 3AABA 2HPTA 1RZPA 3QFJE 1YNLH 4DGIH 3IJYA 4QRAA 4O02A 4FL4B 2VMEA 4XP9H 3UG5A 4G9FD 2F1BA 3ZG4A 3BO8A 3QWQB 3ARVA 3B37A 3D69A 4O58H 2D4DA 2X0VA 3CZGA 1WQVT 1UWGL 3QXUA 1U8HB 4ZQKA 1Q9WA 4HEPA 1FG2B 4P06A 5FDWA 2RALA 3IXAB 1TSRA 4BH8B 3S0PA 1G6RA 4YDNA 1TQTA 2VUKA 1WC7A 3LEXB 4QXUH 5KN5A 2ZXCA 4MD4A 2OMBA 3EAKA 4JAMA 2E6JA 4QKXB 4FNTA 3ZKSD 3VI3B 3PP4H 3G6JB 2WTPA 4NQED 5GRXG 1ZEAH 3CFBB 1I3RA 4HOZA 2A9NL 3ZDYB 4OZFA 3NOIA 4JQXA 1ZV9A 4P59H 1RERA 4JVPA 1SMAA 1B0GA 2D3LA 2L04A 3IE9A 4FFZL 3SY0B 2Z4QA 1T3FB 3GB7A 3T0XA 4FQ1H 1Y7VA 4ZFFB 5DD6A 3OKEB 3VI3F 3NFNB 3G6JF 5E9AA 3TN0C 2YMXH 1UOKA 2YRZA 4Y2NA 4G8FA 3NK3A 1KIPB 4R2GB 2K78A 5HGGS 4FNSA 3TFKC 5F7LB 2EDXA 2NQ3A 1FJ1B 1V7ML 3LRSA 5EZLB 1LO3L 3TNMB 2G4EA 1T4KB 1Q1JL 4GKNA 4KJWD 3FW6A 3ZHFA 5IZ7A 4WHCA 4AH2B 4PJGA 3RWDA 4GMTL 2Y5TA 2ADFL 3T4YB 1WYJA 3ESMA 4DGVL 3SE9L 5BS0A 1MNUL 5J13C 2X05A 3WNKA 3LOWA 3KJ4B 5LUMA 3QJOA 3SDAB 2D4FA 3MFGB 3KPNA 1D5ZB 2CO1A 4K9JA 3Q1SL 4LBEB 1H5BC 4DEPC 4LZKA 3FUKA 2AQRA 4LCWB 4OFPA 2JWYA 3Q6FA 1P6FA 3BLPX 1U3HB 2LR4A 3H42H 4IK6A 4Y5YB 3QUHA 1A4BA 4WI3A 2APSA 3KGRA 3T3PE 2OW6A 5HDQL 1T2XA 3CFDB 3GKZA 4NWTL 3L9BA 5F8RC 4LHUD 1X9LA 1ZGLA 1EZLA 2VC2L 1QSFD 1A22B 3PE9A 2HFEB 1S9YB 2B59A 3PNRB 2F5BL 4AYFB 1A6VL 4GRWH 4NHUA 3RUGB 1R1CA 1DLHA 3VXQA 1XAKA 4WY7L 4TUJA 1XIWC 3RVTC 4WSJA 2ENQA 1VZHA 4LLVA 1X6LA 3RA7L 1KFAH 5F9AC 4BZ1L 5L2KE 2BRRH 4GRWE 1BDYA 5K39B 4F8LA 2WJ5A 1OE3A 4P2OC 1SJHA 3F04A 4J27A 4PJ8C 2WN3A 4RAUA 4GT0A 2ATAA 5C09A 4QHUB 3QIUD 1HEZA 1SBSH 3LKQA 4DGWC 2AS5M 4W9EC 4S1SL 1B9KA 4PJXE 2NT0A 4ZMYA 1U30A 1W72L 2HP4A 4D3CH 2QDVA 4NQVB 2R4RL 3N91A 3OC5A 1Y6MR 1HQ4B 4PD4J 5D7JC 3WG7B 4YXLL 4S0SD 4UQDA 5EIIG 4MJIE 1VHPA 5FYLD 1UEMA 2W95A 3VRIA 3ZX1A 4F2ME 4OKDA 2VDMH 3AXLA 4M7LT 4K9EC 3FQWA 3X1FA 3ABGA 3DBSA 4XOCA 3EGSB 4G9DB 4UCFA 5A7EA 2AJSL 4O9HH 5FO7A 5LAXA 4B95C 5IFAL 2MTZA 3DLQR 4MMZA 3TWYA 4JZOA 1YMHA 2HCZX 5ERWA 2O6DA 1J0JA 2XV6B 4P23C 4RDQG 3VXMA 1T04B 2Y7SA 5CJXA 2LAGB 4PRPE 4E41A 5AW3B 4LRIC 2H8PB 4L8BB 4MA1B 4PW4A 2HB0A 1SGKA 2BFGA 1M9WA 2OTUB 2R0WH 2ZYRA 5IBLD 3KMDA 3DBXA 1DUYA 4PB9H 2FHBA 1PLGL 5AYTA 4LSDA 1DYZA 3TTYA 1OD9A 2VL4A 1M71A 4I3RH 1CLOH 2WIMA 5DJCA 3NYKA 4NZRH 4DAGL 2AHIA 5B39G 2BDNH 5I1KH 1CU4L 3CPLB 3GC3A 3I6GA 2E7DA 8PAZA 5F44A 3MRPB 4JGUA 1HX0A 5CJBA 3BWAA 3WE6B 3V4VB 3NP4A 1A7PL 1CDCA 3KBPA 4KDTA 4RH4A 4HD9A 4ELDA 2R0KL 4X4ZA 1PYWA 4LNRA 4R7LA 1E4KC 3FTGB 4JDTH 4OSUH 4OD1L 1YMME 2ZCKH 1V8HA 1SOQA 2QPDB 3ECVA 4ODVL 3QEHA 5LXVA 4XPGL 4XN5A 1YPZB 3FUEA 1T0NA 4F1ZA 1UVQA 4PB0H 1A3ZA 2XCMC 4WNQA 3QCVL 4FX5A 4FP8L 3LMJL 4L4TE 5TDNB 4PJ5B 4CAGA 3MXVH 5JIDA 1S9VA 3EBIA 1NMBH 2CGRL 1E67A 5CR8A 4DPCX 1I1AD 5HHVH 4FLQA 2PCFA 5EUOB 3U4EB 4BZ2H 2PYFB 4BFIB 2EO1A 3GMLB 2DQFB 1T1WB 3AAZA 1WWBX 2E3VA 3FRPG 3AT0A 1LO5B 2X12A 4N2LA 3ZQDA 1KB5A 4KY1L 3ZE1E 4B7IA 1TEGA 3HE6A 4YC2C 3ZL2A 3G6DL 3GIZL 5JW4Q 4UQ3B 4PG2C 2OSLB 3TCTA 5I1IH 1HZHH 5C0RL 4NN6B 3AQYA 5EUOF 3F8UB 1LEIA 3OPZH 4WFFD 2XTSA 3EHBD 3EJRA 4A7TA 2H1LM 2GSGA 2A73A 3IRPX 1KIUA 1Z5HA 4CSZA 5IJKA 2ZWLT 5D2LF 3NPSC 1GOFA 3LKPA 3T0BA 4OZHE 4M8UA 4BSWB 1EFXD 1X5FA 1IKFH 2X40A 2ZOLB 1KJMB 2FJGB 3EOAA 4MQXD 3KLAB 3TV3L 4DUXA 3MOBH 1OF0A 2QHRH 4N2GA 2KPWA 4B6ZA 4HS6B 2XFXA 3ZZSA 5DFVD 4Z3TA 3GXPA 5ISZE 3BP5A 3MRRA 3S36X 5D5MB 3KS0H 4XXCA 3DGGA 3K6SB 3FN0L 2KZBA 3MRLB 4N22A 2PXYC 2C1PB 4YNYB 3FU8A 4WUKH 5I24A 5J12B 1IQWL 4KQ3L 1RKRA 1PFOA 3S8FB 1A9BB 1RZKL 3RURA 1I82A 2NY1C 1WBZA 4IEFA 1I8UA 1KXQA 1Z3GL 43C9A 2OMVA 4PJEE 4HJJH 2Z8SA 2CXKA 4AXWA 1A3LL 2F53E 2NZ1A 1XGTA 2ZKHH 4OCNC 1GAFH 4PM1A 5HVGB 3CH1B 2J8UA 2K0RA 2MSPA 2X88A 3VD1A 4JL2A 1W80A 3ESNA 3RVUC 2KQNA 3NEXA 2EEBA 3NIFB 4W6WB 3PRZA 5CR1A 1IGYA 4XE0A 1L6XA 1RJLA 3PJLA 3BUIA 3QULB 3FT2B 4PREA 3R8QA 4EOWH 4J8RA 1WV7T 2JI2A 4P2RA 3SE3C 1URIA 4P5TB 5ESVB 3AS1A 1H6EA 2D3VA 1RZGA 2E7MA 2IGLA 3AU1A 3FU7A 3IJEB 5D6DC 2GSIA 1OT2A 5IP4A 1RUAL 3W2DL 4KKRA 3MBEC 5EHFA 5BQ7A 5F7NC 3TJEH 4YDZA 3GRWH 1ZWIA 3DX2A 3HC4L 5CD3B 3ZSSA 3PWLB 5GGTL 5K1VA 3RZCD 3D2UD 2VKXA 3S96A 5KS9F 1H0DB 3VXRD 4A68A 5J9PA 2HKHL 2ZCLL 4NKIL 5EPMA 3S98A 4P0DA 4HOMA 4X4MA 3UC0L 2EUZA 1FDLL 2VXQA 5E2VH 3CMGA 1H8OA 5TJWK 5I1CL 5K9OB 3II1A 5DMGD 3SDDD 3HBZA 1GYVA 1FORL 2XFGB 2VO5A 4V11A 1IKOP 1CFSB 1P4IL 4UDUB 4EXPX 4MMXB 4TVSa 5HGBA 2YQBA 4MAYC 1FFNA 4AC2A 2EDRA 3VSQA 1D5IL 2R9HC 3EH5B 3O41B 3WXWL 1BJ1J 3BAWA 1YEGL 3ILEA 4WEEA 2DJSA 4GS7B 1RZFL 2CJTA 1AXTL 1MWAB 4GOSA 4JMXA 1U8IB 1E28A 3WFHA 5D70H 3WTTA 5IK3B 5E2WH 2Y9RT 2ZYIA 1JDDA 3QQ4A 1N8OE 3BGMA 2CLRA 3CK0L 3I3EA 4JFDE 3RNKA 4UM9B 3LHPH 3U1SL 5FW7A 1NANH 3ZR6A 3MNZA 4HMDA 3FU3A 2EKJA 2VAAA 1G7IA 3KPRB 5AALA 2VL5A 4FFVD 4XN1A 2FUTA 4F7CB 5AQ0A 2BHFA 1IJNA 4DFHA 2JB6A 2BSCA 1GGBH 3FCTA 3UG3A 4Z7AA 1NCWL 3T6ZA 2QPEB 2X6CA 4UV7L 1U93B 1CYXA 3QEQD 5IJDC 4HLJA 4NP9A 1HCYA 4M7LH 4CNIB 2DKMA 1QLFA 4BWTA 1BOGA 3I6LD 5IQ7H 3OJVC 2WAHA 2ZCHH 3APDA 5MHSD 1KJ3H 4BK5A 4FJZA 1JWMB 5EC1B 3L13A 2VRKA 3RY6C 1OAZL 5H4ZA 3RPKA 3QDJD 1K5NA 4R4FH 5I1HH 2I07B 4F9LA 4XZUA 1WZMA 4AMXA 1BZ7B 3PWPA 4W9GC 1VRSA 5GS0L 4P2QE 4PSPA 2XKUA 3AW5A 2BP0A 4PRBB 3FONB 3DETD 1E43A 4WEUD 5HJ3B 3UTTD 2V8MA 1JF1A 4PRIE 2HLEB 1E90A 3WS6C 4HZLA 4TVPH 1MFEL 2C3XA 3ECBB 3LQZA 4GLRH 1A6PA 3DTXA 2FJFB 3NGBB 4LHQB 3V5HA 3EF4A 4AMWA 5HHPA 2V3DA 4TVPE 1KENH 1Z32X 3GHEL 1J11A 1YEIL 1G87A 4QRTB 4DPBX 2JIXA 4B3VA 3F6IA 1NWPA 1JPFB 1HWWA 2W38A 4ONHB 4TOYL 4PLNC 1NMAH 4K8RL 4W6XB 4ONGH 2ZX5A 4LARL 3SYCA 4WI5A 3W9EB 2Y69B 2XIIA 4DZBB 4WW2B 3PWUB 1FNFA 1CK0H 1X7SA 5CZVH 2Q7YB 1IAMA 2N1TE 4NUJB 4XN8A 1K4CB 4HGKC 3Q3GB 5HGAB 1HJBC 4DTGL 5F9WB 3GSRB 2PWDA 1YEHL 2JJVA 2NUPA 4HIXH 3CN1A 1HEHC 4KDWA 5T1DH 5I8OH 1TO5A 4QHLB 3WGVB 5E2JA 2GFBB 1J5IA 4X5XA 3C60D 2WMPA 4ENZA 2JCCF 3U82B 4F7EA 4WHTB 3OB0K 3S5ZA 5DTFA 3KR3H 3US0A 4LEEA 4LHUG 1IBYA 3QUML 5D1XE 4QRSA 3TP4A 1OKEA 3MV8E 4Y16A 1IQDA 5GXBB 2VDNL 4PTUB 5T5FH 3RTQB 3VFGL 2V2XB 3W0WE 1CE6A 5I1JH 4D8PB 1A5FH 4YK4B 3AS0A 4HWBA 4WTWA 3GUFA 3H9ZA 1BD2E 1DQQA 1TVDA 2MHAA 3VI4A 4ZS7H 5EULV 4ABWA 4QEGA 1EMTL 2J72A 5FOJA 4N28A 4PGCA 4PWKA 5IB2A 2IADB 4FQ2H 2WWMD 4UT7L 3U0WH 4MA3B 1F42A 2GSMB 1E30A 3F7QA 3KM1A 2WJ7A 3IFLH 4Y9BA 2JK5B 3U9WA 1P5VB 4J4PC 1N5YL 4PPTA 3WIFB 5FLVA 3JZ7A 2AZAA 1MRDH 3QFJD 1ZTXL 4LQ1A 4EUPB 3H7BA 3ABMB 1EEYB 1CLYH 2KI6A 3HA0A 2IDTA 3MJ7A 4KXZH 1R3JB 4X98B 4QRQB 5K59E 1NC4D 2YGVA 4YQXL 1SXNA 2WYZA 32C2A 2DWTA 4YBLB 2GI0A 3ZQWA 3VFVB 4L48A 3BPNB 2HTLD 1UGNA 3PG2A 1RMFH 1RIHH 3RDTA 3V4PA 4XVSL 3PGDA 1RZJL 2VMJA 5BVJB 2ALWA 2W0PA 5DZAA 3ZJAA 3BKCH 3SZKC 3LRHA 3FUIA 1SHXA 2FR4A 4HU2A 3EKCA 3P77B 4NP4H 4PJ6A 3STZA 3EGXA 3FULA 1IM9B 1GGYA 4XMTA 1A64A 3RE0A 1AHWC 1G7LA 5BVPH 4APXA 2FSDA 4BKLA 2Z6FA 4ZD3L 3TS8A 2E9BA 2X28A 3O2VL 4AQEB 4DVRH 1KTRL 2ITEA 4UT9L 3WL9B 1K2DB 3MA7A 1I7RB 1HU8A 1OSZA 1QFPA 4D7BA 4Z78A 3RGVB 4RGOL 2Q87A 4LQFH 4HT1L 3P4OB 1M9SA 3TZVA 3B6SB 1B0RA 3VWJA 2ZOOA 1B2YA 4Y2LA 3H54A 4QNPF 5HDLA 5AAWA 4IU2B 3O6KH 5GZNA 1Q0XL 3LXBA 5BW7C 4OQTA 1A8ZA 2CLVA 2B1HL 5DUML 5HY9B 1XO8A 2EUVA 3GMNB 3HLAB 5HJGA 3DVFA 4K94H 1OB1A 2FDBP 3O11A 4IOFD 4G8EA 4TLSA 5DZPA 1NAKH 3KXFA 3WELA 1UD5A 1A9EA 1SY6L 1KYFA 2DQTH 5F7AA 2XBDA 3FH8A 3LXCA 2O72A 2ZOUA 4J12A 4HJGA 1ULVA 4JHVA 2E7LC 3MLZH 2AJYL 4CKQA 1EDYA 5HI3D 1RZ7H 4JPWH 3JYCA 3ZE0F 3TASA 1OAKH 2R1YB 4IOIB 3WXVH 4UQ9A 2N7BA 4OT1H 4S11A 1NCBH 2ICWI 2A9AA 4DH2A 2RGSA 3K3QA 5E6ID 2XI9A 5EEXA 2YS4A 3DV6A 5C8JB 2D2OA 3AREB 3ROLA 1JTTA 1MJJB 1SQMA 1EHLH 3EYOB 3FS9A 3CFKA 2V7HB 3KPLB 4ZX4A 5E9NA 4S0TD 1WAAA 1XGUA 1A4JA 5IOPA 3B2DC 3C5ZD 5EH1A 5CLTA 4X4XB 2DM3A 3QUYA 1BZQK 2WWOA 3BWZA 4M48L 3ZKMD 3BKJL 5DR5L 2KLRA 2FJHA 3K4ZA 5EBLB 5FGBA 3FO0L 2FGWH 2FJUB 1B3IA 5L0QC 3WFBH 4O2FB 5H37A 3TEZA 1OARL 2FEDC 3CSYB 4BE6A 5F3BA 4Z3HA 2OMYB 3LN4B 1P5UC 4PVNA 4RCAA 3TA3A 1SRDA 5L2KD 1Z9SA 2HX7A 1QBMH 2B14A 4JB9H 4NKQB 5F1NA 2Z34A 4I18C 4MCYB 5EZJB 4RMWA 5HVFB 2NXYB 4BFBD 1GYUA 5AZ2H 4YHIA 3T71A 5FHBH 1FAKT 2HFGL 3PAYA 3GK8H 4UBDD 4JFOA 1E2ZA 3LPWA 3QDGA 2DQJH 2ZOKB 3CSGA 1CQKA 3O9WA 3CZKA 4QRPA 2AJZB 3KPOA 3AU0A 3DURA 2DQEL 3VFUA 1T7YA 3AY2A 2DWDB 5IV2A 1NIDA 4JN1L 4Y9CA 4MJID 1OAJA 1P2CB 5TDPA 2DTML 25C8L 2X7LA 4PJGE 3EGDB 4OW6A 1ZSDB 3KVQA 3HI1B 1QR4A 1C5CH 1JERA 4ODTL 1MVYA 4Y4FD 4APQC 2XT1B 1RZ8A 1FA4A 1MIEH 5BS0E 3TA4D 3S3DB 4BCXA 3NZHH 2KZKA 4NZFA 3DX3A 3EH3B 5KANG 2ZUSA 1J0YA 3CNKA 5EOCH 3EG9B 4K15A 4NJ9H 1LE5B 2NX5B 4MD0A 1SUJA 2OS7A 1EJ8A 2OMWB 1MWOA 3CVDA 3R0MA 3QS3A 4PRPD 4PD4K 3CFEB 2RIKA 4OGQC 2MKWA 1M2VA 2AV7B 3MSPA 3DOHA 2XU9A 1I4FB 2IPTH 1TVBB 2GJ6B 1GJWA 5AW1B 4PJHB 3ZT5A 3OF6A 5I6MA 2ZIDA 1MY7A 2J8OA 1AC0A 4G80A 4N90E 2FUQA 3IKCB 2AP2A 2LU3A 4XOEA 4Y89A 2ERJC 1CFTB 3QRGL 2GTQA 3HFML 3KJ6H 4AIZA 3D39B 2Q10A 2KLSA 2HTKC 5B4MC 4UTBA 2AF2A 3PUUA 1BFOA 1KYDA 3L3OC 1ED3B 3PPEA 4FF9A 4FHBD 5E99L 3NP3A 3ZZLA 2BW5A 4R8WH 5SWSA 1L3WA 3OHMB 2XJKA 4G6JH 1E8YA 1R3LA 3GTVA 1YMMD 2IG2H 1RVFL 3QZOA 3AXIA 4JKLA 4BH7A 1RJCA 2YD7A 3CXDL 4HEMA 2CWRA 4PQXA 3ECWA 3DHUA 4NGHH 4PV1C 4OTXL 1SF3A 4WWOA 1OGAA 4XVUC 3JWOH 2G75B 2YK1H 5JXED 4N0UB 5IB3B 4L4TD 3BH9B 4N6RB 2R1WA 1HXYB 4B7LA 2EIMB 3G6AB 4NRYB 1YY9C 2VW4A 1SYSB 3INUL 1KNOA 3WUWG 4PV9B 2L3BA 1QSVA 3U4AA 3WY2A 3QJVB 1OSEA 1PLAA 5FA3A 5K9QG 2F58H 2QR0A 1N8ZA 3BAXA 3G9AB 5E8EB 5DF0A 5FLUA 5J13B 2DBLH 2OMTA 3BQUA 3ZKXC 2EACA 1U33A 3MTXA 4LSTH 4PJ9C 3PQYB 4GFXA 3VMOA 1MLCA 3EG9A 3FHAA 5H4YA 3WD5L 1CI5A 1QAWA 3EYFA 3JV6A 3MGTB 2AV7A 2L8AA 1I9RH 5HYQA 4NZUL 1I1FB 2X4RA 4LLYA 2Z7WA 4RQQB 1A3QA 2Y1YA 3OZ9L 2P24A 1V5JA 4YSQA 1LO4H 4XNXH 4GUCA 1JL8A 4Q8BA 5T33L 1MHPL 5EB9A 4DKEL 1OE2A 2VLLA 5FUCE 5EO9B 4MJJA 4QRFA 3U4KA 3MRKA 3OSKA 3AROA 4OZIB 1DBML 1T7WA 4E0RA 3RUGE 1DDTA 3MV7A 1D5BA 4X0KA 1XIWB 2W80C 4BXVA 5ISZD 3ARWA 3QK0A 4MASA 2Y24A 3X13B 4OJAA 1JGUH 5D8JL 3PNWA 3BGFC 3TCLA 1D5XA 3KCPA 2IOOA 4JFQA 3BIAX 5IGXH 3ZQXA 2EXWD 1KLGB 1UUSA 4OV5A 3HMXA 4KKBC 4PJ8B 3FQYA 5M95B 2Z92B 1YN7A 1HOCA 3VD3A 2V37A 3UO1L 3V95A 3WGUB 4F7TA 4L9LC 2AQ2A 4GBXD 4FABL 1U8QA 2F53D 2GVYA 3TN0A 1AY1H 3DVGA 3MREB 4E5XG 2OCJA 4ZUVA 5E6UB 1Q1PA 1ZE3C 2RA1A 2KUTA 3P3YA 3TJHC 4Q9QH 5DC2A 2MQCA 2VH5L 1XB8A 2GJPA 3FTXA 3DA0A 4TSAL 3WFZA 3GMQB 4AQAA 5HJBA 3TH4T 3TBTA 5EOQL 3DC0A 1AZUA 2J20A 4ZTPH 2Q76A 3EUUA 3QJHA 4LEXH 3FB5A 2D7PA 3FT3A 3PDGA 3S9DB 2DYPD 2VM3A 3POHA 2LLGA 3CVHL 35C8L 2C1OA 4OLXL 4Q52A 4CU6A 1GGTA 4WENB 1H6TA 1K3IA 9CGTA 2X70A 5AKSA 3QNZB 2G3XA 1KGWA 2YD9A 4DP8X 1H5BA 1KT2A 2GT9B 3OAYK 3ARZA 1A7QH 3PABA 4P23B 3ARGD 4KUZH 4M03A 3HB3C 1DHKA 2BFVH 5EU4B 4I48B 2P45B 3LNDA 2GBAA 5A2BA 1P9MA 3MUGB 4Y1AA 1F86A 3B5HA 4FFWC 1ZHNA 1UCBL 4GP4B 1PMYA 1MAML 3B5GA 1HIMH 1LM8V 4NNXA 3QGVA 5DWUL 3O8XD 2J4WH 3N0AA 1FO0L 4N2IA 5I15L 2GJJA 2OP4H 3PWVA 3BFOA 5CHNB 1JPGA 1OGTA 5B8CB 1N67A 5F7YC 2EYTA 2NUTA 4XCEB 2KZWA 3L7FB 4QUOA 4LCUA 4H0HB 3BJ91 1F4WL 1UJ3C 4C56A 4BBWA 4HGWA 1MHEB 3N1FC 4P2OA 2LFEA 1V54B 2VMFA 3LRMA 2G60H 1BOYA 2R1XB 1BAGA 1YPZE 2C26A 2WVTA 4OCRH 4P5KA 1WZAA 3X3FL 2BVOA 3SGKC 1KXQE 5I1AB 3UTPE 1F90H 1ASOA 3BDYL 4IRJD 4BFJA 5J6SA 2YAFA 1MDTA 1NC2A 1A7OL 4PJ5E 5MP6L 2J1KA 4JFDD 3HHSB 2J8UE 2EDTA 3KGUA 5D7JA 4OVUA 2LTQB 2R69L 4M9OA 4D0CB 3CN3A 4AQOA 3L4CA 5AW5B 2BZDA 5LBGA 1E4WL 3EOBB 2AFNA 1QFWH 2OYMA 3U2IA 1XTLA 4R0LA 3MNWB 4YC2B 4UM8B 2FL5B 4EBQL 4CKVX 3V8CA 5E6RB 1K5WA 5LO7A 2C4XA 5G2NA 3UTQB 2UX7A 3QXTA 5IIEA 2P7TA 1OP5K 3UTZA 4FKHA 1QO3B 1BXAA 4NXSA 3ILQC 5AVTB 3K81A 2VDQL 3KLHC 1CBVL 5E1IA 2R7EB 5CIPA 2O6PA 2VXQH 1SJMA 4TPRL 5EOTB 1ZPUA 3IYLW 2B4CH 3NPSB 3QQNA 4H25A 1JZ3A 1CD1B 2E9WA 4OFKA 5GRWA 4X4ME 1CF8H 4ORGA 3CGTA 3ARFA 2HH0H 2XN9A 5AW7B 4HUXA 4P2QD 1SMDA 5BUPA 4EDWL 1THCA 3OAUL 5DD3L 2VWEC 4ZX6A 5EF0A 2D3NA 5ICXB 3D4ZA 3C08L 5EV7A 1KELH 3BPCB 2BO0A 4PRID 5AOLA 4YXKH 4YIQB 1AYOA 1QUPA 4QTHB 1VACA 5D5ME 2XVGA 1JGEB 4LPUA 3S34L 4AL8H 2UZIL 3BP4B 3FB7A 4XTRC 4JY5H 2P42B 1NCAL 2ICES 4AT6A 2ATKB 3NZ8B 1TCRA 4YE4L 4PVMA 3EO9L 2R0ZH 4JZJA 3K72B 9PCYA 4JDEB 4G7YL 2G2RA 5FYJU 3QIBD 5FW6A 3BUYA 3JUYA 4X5RA 3WEAA 3NIFE 2L4OA 4XHJD 1S7RB 2W9DH 4GFTB 1BFVL 4N6QA 3S4SA 2IVFC 1F3JA 3UGEA 2GBTA 2H32A 5TE6L 5KSBA 2CRIA 2H7WA 4F5CA 4DP2X 3SO5A 4DKDC 1INEL 5DVLA 4KNTA 4EJ1C 4PG2A 2P28B 4JRYB 1JI1A 4NO0A 3VYNA 4XBPB 2ED7A 1BSIA 3RAJH 2DH2A 4F92B 2CGZA 3RL1A 1I8MB 3GSNA 1DDHB 3KYOA 1AP2A 2WSPA 1O9WA 3GEFA 3QPQC 3WU1A 1G7QB 1KCBA 2E9JA 2UWEB 5D1XD 2VRAA 1HH9A 3IETA 1QYGL 2OPCA 1MHCB 3F65A 5JPMA 3MV8D 3K6IA 1DBAH 2AMGA 3LKNB 1G7MB 3W0WD 4OAWA 4CGTA 4JPIB 5DJYB 4AUUA 3U83A 3OR6B 3BDBA 1BD2D 1YG9A 2DQIL 4HF5H 4ELKB 4RZKA 1H15B 2YJQA 4ICXA 4UANA 4MMYB 1DBBH 3PWPE 4YSPA 4I1NB 4UQEA 5FHAH 4NN5B 1U9KA 3WNMA 1ACYL 2K6YA 2CDGB 3CDFA 5CINL 2D7QA 3BVXA 1I7UB 2HZHA 3NAAL 4PJIB 4XNUL 5EORL 3QAZC 3OKNA 4MAYB 1AKJD 3LPGA 5D1ZA 5L88L 1S3KL 1XH3B 3GXTA 2PXYA 1JD9A 5K9KB 3NZSA 4NEHB 2DYRB 5DJ2A 3DO7A 1OTUC 3ZTDC 1E9PA 1IM3A 4LSQH 5T3ZL 3KDMA 4ZG1A 2PPAA 1NBVL 2R0LH 4QMEA 1ZK5A 4NRXA 4OLEA 4ETYA 1J5CA 2X1PA 3M17A 4ZZFA 1AIFA 2ID5A 3DXAD 3L54A 5I74C 3IJSB 4ZYKA 5IB1A 3GGWB 4PI2A 2EIZB 2PP9A 4Z76A 4M7KH 2VZ1A 1UB5A 2BS9A 5E8NA 3V0WH 5ACLA 5AW2B 1OCRB 1PEZA 3F12A 2Y6TE 4D0BA 3KPRE 2X42A 4M8QB 3K2MC 4PGBB 5DC9B 4DQOH 4U0RC 3SE3A 3L7EB 5CXPA 1KCSL 3V7AE 3UZEA 1W8NA 1QA9A 3IMSA 3OGCA 2FEJA 2ZUQC 2FHFA 2ZP8A 3MBEA 4X6EB 5DUPH 5LG1A 3SDCD 4K8RC 1I8MA 3RVWD 4D9RE 2VE6A 15C8L 1FV1B 1U36A 3MO1B 1WGVA 1WITA 4O2EB 1O5DT 1PJWA 2P8PB 4HWBH 3WY3A 2WZAA 1J48A 1FGNL 3N1MC 3MLXH 5C6TL 1GRWA 2J2ZA 3CZLA 4S1QL 2ARWA 1C12A 1IGCL 4Y1TA 1AZBA 5K5YA 5J3HD 1I3GH 3DVIA 3Q2NA 5F7DB 3TBCA 1JV5B 2VMDA 4LO9A 1QMUA 5MENB 2MTPA 1MFAL 1PGRB 5GRYA 1TR7A 4X6DB 3U6XS 3VFSA 5BJTA 4JFPB 1CFVL 2KERA 1TPXC 4HC1A 1WBXB 4JFYB 4FJ6A 2YHGA 3IF1B 1E7UA 1AGDA 1W0VA 2HKAA 1ZDQA 1WEJH 4TSCH 2FK9A 3VWKD 2A4EA 3WFEL 4JO3H 3OR7A 1T03L 2C3VB 2BK8A 5DO2C 5EN2A 3TVMA 5L4MA 4ZFOA 4PJAA 2HLAA 3OLIA 2AVFA 3F05A 2O4EA 2V4LA 4JFXA 2X0UA 1PZAA 2VM9A 1XZ0B 1DVUA 4FHKA 4N0CD 5FUZH 1SLXA 2BNUA 4HKJA 4UV4H 1AQHA 2C9UA 2EIZA 2YQ2A 2DW5A 2ITCA 2BJMH 3QWOA 3FQTB 3MMEA 4JE0A 1SZNA 4OCWH 3ULUH 3ABZA 3WKNA 1A7NL 5J6HB 4YVNA 1MXDA 1PX8A 1YDPB 1H6FA 1E5AA 2CIKA 2FLBT 4C8XA 4ZSOA 3ULUE 4NQCA 3IS1X 3V6FB 4U7MA 2OCFD 5DHXB 1UFGA 5DRNB 1TQUA 4LSSH 3GHPA 4AEFA 4ATWA 3RIAK 5J56B 5JORA 4LF3B 4BV1A 1WCBA 2OCCB 1GYWA 1T6VN 4TYUA 4GUOA 4OQTH 1MDAA 4P9HL 1AGEB 3D0LB 5KSAA 5TPWL 4KKLC 4NHCL 4FAAB 5GS1C 2HKLA 2Z1KA 1E6OL 1RK1B 4ODSH 1Z5YD 5GQBA 4YGVB 3EYSH 3R1GL 2QPFA 1J9CT 2BHYA 2UZXB 3C6LB 2MOVA 5A6IA 1KJ2L 4PBDA 4A6YA 4Q0XH 1PZ5B 3N85L 2WXLA 3KXFE 3FN3A 3QDMB 3E38A 1OANA 1ZS2A 4L18A 2CO6A 1JPSL 4N87A 5HYEA 3BXNB 4EUPH 4KNUA 1RJYA 5CJ5A 5KVGL 3W37A 2G2NA 4U6HB 2QQQA 2JMRA 3DX0A 3VDCA 4EAEA 2NY2C 5BS0D 3G5VA 2HJLB 4DKFH 1KXVC 2YD3A 2BERA 3NH7L 3QZNA 3VXNB 2P47B 1NIEA 1F1GA 1LWRA 3V6ZB 4P57B 4L8CA 1KC5L 3N2JA 1ZOXA 4A04A 2LU4A 4XBEH 4I87A 1U8PB 2F7RA 5JNYB 4C54A 4GI9A 5E2UL 3O6LL 1BQLH 4NM8H 1PS3A 1OAUH 1WAAE 2CO3A 3I02A 1JHLL 2JXMB 4N90D 5H37H 3VQMA 5HGHB 5J6HA 1H8SA 3KE0A 4D0DB 5E0FA 1W91A 1AD0A 3BVTA 3Q9PA 3TT3H 1AMYA 1R0AH 1HK6A 4RMBA 4AG4H 4U1IB 5I17B 3WLWD 3QR2A 4P9ML 4IRSB 4TUOB 3KYKH 4XMPH 3SCMC 1F58H 1G7JB 2VDLH 5FCUH 2DLIA 2XZQH 1U2YA 2D7MA 1HQRA 2X4PA 1U8OB 4ANWA 5INDA 2DMKA 4PBWD 4TNFA 3SOBH 1C08A 1GZPA 3QPXL 4ELMB 5LDUA 1KPUA 1QLRA 5EF1A 2G9HA 2FLMA 3B9VA 2G0KA 2VSKB 2XPYA 4ZAKC 4UQ2B 3TYFA 4ZFGH 1Z66A 3T2QA 1ND0A 3QDGE 3WJMA 1H3PL 1Q72L 1U3NA 5ANHA 5EBGA 3D30A 4H26B 4XWGH 1OK0A 3NJXA 5C9JB 4R2GD 4QWWD 4KI1A 5GSRA 4DWHA 4WI2A 3GSOB 5CZXC 1EGJL 2V9RA 1R5WB 4ELMF 3WMPA 4DN4L 2OSYA 2X5PA 3AG2B 2HRPL 3ILPB 4TNVF 3B7TA 5IWLC 5KYXA 5C07A 5JHDA 5EU7E 2AW2A 3LB6C 2LT9A 3IU3A 5D93C 4WJ5A 2F74B 1H3XA 3LH2H 4J4PA 1UJTA 4AX3A 1EJ6A 3R06A 4RVBA 2J25A 5DYOA 3SDAD 3UYRH 4LNVA 2TRYA 3ZLQC 4Z7OF 3B2VL 4OKVA 4FQPA 2XZAL 2FGZA 1I8AA 1J05A 2HKFL 3L1GA 1XB3A 1YC7A 3OKMB 4E41D 5DZNA 1BX2B 2TSBA 1VGKB 4ZS6C 2OSWA 4X6CF 2X9XA 3FT4A 2BVPA 4HUVA 1FIEA 2ZSVA 3DJSA 3LSOB 4OIIL 4WFGE 4NQQA 4YAQB 2GI7A 2OJZH 2DIEA 3C9NB 3ML8A 3VFRA 2CHXA 3IMWA 4NQXB 1KGCE 2C4FU 3WEXA 5ADOH 4UTBH 1X7QA 4X8JA 5KYYB 3VSVA 2GHZA 5L0QB 1KN4H 3TEUA 2OK0L 3DJTA 1AHWA 4HSCX 2V2WB 4MXWH 4ZMLA 3Q05A 4XMLL 3HG1B 5AZUA 2UZPA 4XWOD 3UJJL 2OX5B 4B9FA 5D1QA 4KVCH 1BQUA 3T65B 4I18B 3IK2A 3CX2A 4FXKA 4KDVA 4J6IA 1W0WB 2BINA 2V7NA 4PRNA 3A67L 3STLB 2G9KA 3QXVA 4HEME 2P5EB 3EBAA 3GRBA 4OLWL 5BW7A 2D7TH 3RX8A 3MZTA 1NCTA 1YEEH 3WS3B 4A1RA 4DW2H 3ZT6A 5MEOB 1IKNC 3BVNA 4FEIA 3NABH 5F96H 1UM6L 4B9ZA 4J1UA 5E9DA 2JFCA 3DX6A 5GIRB 2WO2B 4OGYL 3BX7C 2EO9A 4M5ZH 4C4KT 5KBNC 5T5NF 4Q6IC 4XMVA 3CDGA 5E5MA 5KYUA 3F7VB 1P7KA 3THML 5CN3A 2VN7A 5GGQH 4RAVB 1E5ZA 4A2MA 4B0MB 3NIGB 4APQB 1R75A 4Z0BL 4HXBH 4AZ8B 4PWEA 2LU7A 5LGJB 2XXCB 3X1BA 3DOSB 4LB8A 5BZDB 3WTXA 3QHTC 3ESPA 2MCPH 1JGLL 1T5KA 1YAZA 5GGRA 3S88H 4JVUA 1H8NA 3NIGF 4OUUB 2YLHA 5J06A 5GRJH 1URZA 4UILH 2PO6C 1MREL 2CUIA 3GHBH 4QAWA 4NQXA 5T3XL 1E4JA 2VN5A 3SQOL 1F4YH 5IQ9A 1T1XA 2ERJB 1L5GB 4JREC 2D03H 3BW9A 4LRNL 4NRZA 1JAEA 3MV7E 4UWQB 4YHMH 2WNXA 1P5UA 3L3OB 3HMXH 1QWNA 1IEAB 5ETUB 4ABVA 3QQDB 2ZKMX 3WFCL 3LEYH 4MVBD 1H3GA 1JNLH 1T20A 4AVIA 5E2TL 1A1NA 2NXZD 4BQCA 1CTNA 1FGVL 3ZGIA 1AGBA 3OKDA 3OKKA 2IAAC 4L05A 5AOKA 1T83C 3UTPD 4N8PA 1JGVL 4EVNA 5E00A 4N0UE 5JOPE 4Z7QF 1R3KB 4PJ5D 4DEUA 1DLFH 1YN6A 4M62L 1U3YA 2XQ0A 2PWFA 2VIRA 4I7ZC 3QUKA 4NYLB 3GSUA 1A0QH 4U6VH 5IVNA 1T5XA 4MCZB 3SOTA 4NS0A 3T2OA 5HGDA 3C2AH 1DQVA 3MNVB 1M3IA 4CN6A 3QFDB 4XPBL 3RX7A 5FOBB 3N40P 4N8VG 5ENWA 4P4RB 2F7QA 3VFNB 3HC0A 3QQ9C 4YPJA 1AFVL 2BNRB 5CEZH 4FFZA 5FUOL 1WFJA 2P5WB 2JKJA 1F2XK 1P0SE 1F3DJ 3RFZC 4AKPA 1K4DA 1QNZH 4O4YH 4ZTOL 5CM1A 4UTAL 3IAPA 1ZA3B 1N0LA 4XCNA 3ZKXB 5CEZE 5JOFA 3UBHA 4HIJA 4PJ9B 4CW1B 2BOCA 2W07A 4W9ZA 4XPTH 1GS6X 3FSVA 1A1OA 1OVZA 4G6ML 4O2CA 3DX7B 3WEBA 1VFUA 4OFVA 1A1MB 5AYUH 4FYRA 1HS6A 1UENA 2FHCA 2B77A 1TEFA 3MLVH 4I85A 2A77L 4RFEB 4Y1AE 5HHXL 3MACH 1QABA 4D2NA 1A9VA 4NZTL 2R23A 2ZWYA 4YZFE 4OZIE 1VADA 2FLRT 3VFWB 1WH0A 2DWEA 1FH5H 2GITB 2JF1A 2O5XH 4FZEH 3UCRA 3WNIA 5EU6B 5J1TC 2X10A 3QUXB 2WCPA 5IJBC 3SKJL 4KHXL 3MJ9H 4P8QA 4ZBJA 1MZZA 1A2YB 1AQKH 5LQBL 3BGFB 4FQIL 4CSPA 4KH2A 4UT6L 2KDYA 2QEJA 4LLUA 4WI0B 4R3SA 2Q6WB 3G3LA 4C56E 5FKPB 5CCJA 2DTSA 3NQIA 1CI3M 5DJDA 3WHXB 5AKVA 4J39A 3QHFL 5E5RB 3CWGA 3K4AA 2F19H 1H3WM 1KIRA 1C9SA 4GW4B 1MJ7L 3CFJB 1MELA 1LXMA 1NGXB 4L9LB 3CFCL 5B7FA 3E80A 3H9SA 5G4MA 3V0JA 2BLFA 2E0PA 3SGEH 3MLUL 4BZ1A 4OCSL 1QPXA 4K9EH 4NZJA 2XRAH 3JQOB 3EJYD 3CVBA 3WLBB 4PJFB 4RGNB 3K0WA 4X8GA 4LLMB 3BH8B 4O5LH 4L9DA 4YX2H 4QRRB 1WD8A 1JK8A 4GQ9L 4N3UA 1F11A 3OPUA 4DFIA 3QZWA 3W9DA 4M1CD 1W72A 1G0DA 3U7WH 2W94A 3OXSA 2ORBH 3PHAA 2MQ0A 2PW2B 1I8KB 4HJSA 1I53A 2WW8A 3DSNB 3S3SA 4B9IA 4NNPH 3WKML 5CILH 2XKSA 1SN0A 1UA6L 3V6OA 3ZYZA 3QEGH 3HB3B 5D2LA 4C57C 5F97E 1QFUL 1EPFA 2FX8H 1F4XH 4HEPG 2R27A 3VXOB 1L9MA 1REIA 3MLRL 4NQUA 5A16B 3H7LA 3QZMA 3T04D 1CDHA 1DEEB 5DMGC 1TU2A 2A74A 5C86A 1N4XL 3NA9H 2WLIA 5I26A 4RNRB 4ZPVA 5I6OA 1QZ1A 1NBYB 3ISYA 4H8WC 4YVUA 2LW3A 5IFJB 2XN9E 2ZXGA 1J8HA 3G5WA 3MLYH 1CICC 3PWPD 4YLQT 1RCYA 5FWQA 4BFFA 1HAUA 3OJDB 4XAWH 2BSEA 3PFQA 1ZLVK 3VCLA 1QR1A 1WLHA 2NLJB 4Q74A 5DEGB 3RDJA 5DURB