3U1UA

Crystal structure of rna polymerase-associated protein rtf1 homolog plus-3 domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
131
Chain Sequence
PKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of RNA polymerase-associated protein RTF1 homolog Plus-3 domain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA polymerase-associated protein RTF1 homolog
total genus 37
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03126 Plus-3 Plus-3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.30 Mainly Beta Beta Complex paz domain paz domain 3u1uA01
3U1UA 4L1PA 4L1UA 2DB9A 2BZEA
chains in the Genus database with same CATH superfamily
4KRFA 3DA5A 5T7BA 4Z4FA 4F3TA 4W5TA 2L5CA 3MJ0A 4KREA 3O6EX 4L1UA 4Z4EA 4Z4CA 2XFMA 3QIRA 3F73A 3HO1A 4W5QA 4OLBA 3DLHA 3O3IX 1T2SA 4NGCA 4W5NA 4Z4IA 1Z26A 3HJFA 3DLBA 2L5DA 4OLAA 1R4KA 4NGBA 3HVRA 3O7XA 1VYNA 5KI6A 4W5RA 4NGGA 2QVWA 4W5OA 3HK2A 4L1PA 4NGFA 4NHAA 4NGDA 1U04A 1R6ZA 2FFLA 2BZEA 4NH3A 1Z25A 4Z4HA 1T2RA 1SI2A 5JS1A 3U1UA 5JS2A 3HM9A 4NH6A 4NH5A 4Z4GA 1SI3A 2DB9A 3O7VX
chains in the Genus database with same CATH topology
4KRFA 3DA5A 5T7BA 4Z4FA 4F3TA 4W5TA 2L5CA 3MJ0A 4KREA 3O6EX 4L1UA 4Z4EA 4Z4CA 2XFMA 3QIRA 3F73A 3HO1A 4W5QA 4OLBA 3DLHA 3O3IX 1T2SA 4NGCA 4W5NA 4Z4IA 1Z26A 3HJFA 3DLBA 2L5DA 4OLAA 1R4KA 4NGBA 3HVRA 3O7XA 1VYNA 5KI6A 4W5RA 4NGGA 2QVWA 4W5OA 3HK2A 4L1PA 4NGFA 4NHAA 4NGDA 1U04A 1R6ZA 2FFLA 2BZEA 4NH3A 1Z25A 4Z4HA 1T2RA 1SI2A 5JS1A 3U1UA 5JS2A 3HM9A 4NH6A 4NH5A 4Z4GA 1SI3A 2DB9A 3O7VX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1U A;  4L1P A;  4L1U A;  2DB9 A;  2BZE A; 
#chains in the Genus database with same CATH topology
 4KRF A;  3DA5 A;  5T7B A;  4Z4F A;  4F3T A;  4W5T A;  2L5C A;  3MJ0 A;  4KRE A;  3O6E X;  4L1U A;  4Z4E A;  4Z4C A;  2XFM A;  3QIR A;  3F73 A;  3HO1 A;  4W5Q A;  4OLB A;  3DLH A;  3O3I X;  1T2S A;  4NGC A;  4W5N A;  4Z4I A;  1Z26 A;  3HJF A;  3DLB A;  2L5D A;  4OLA A;  1R4K A;  4NGB A;  3HVR A;  3O7X A;  1VYN A;  5KI6 A;  4W5R A;  4NGG A;  2QVW A;  4W5O A;  3HK2 A;  4L1P A;  4NGF A;  4NHA A;  4NGD A;  1U04 A;  1R6Z A;  2FFL A;  2BZE A;  4NH3 A;  1Z25 A;  4Z4H A;  1T2R A;  1SI2 A;  5JS1 A;  3U1U A;  5JS2 A;  3HM9 A;  4NH6 A;  4NH5 A;  4Z4G A;  1SI3 A;  2DB9 A;  3O7V X; 
#chains in the Genus database with same CATH homology
 4KRF A;  3DA5 A;  5T7B A;  4Z4F A;  4F3T A;  4W5T A;  2L5C A;  3MJ0 A;  4KRE A;  3O6E X;  4L1U A;  4Z4E A;  4Z4C A;  2XFM A;  3QIR A;  3F73 A;  3HO1 A;  4W5Q A;  4OLB A;  3DLH A;  3O3I X;  1T2S A;  4NGC A;  4W5N A;  4Z4I A;  1Z26 A;  3HJF A;  3DLB A;  2L5D A;  4OLA A;  1R4K A;  4NGB A;  3HVR A;  3O7X A;  1VYN A;  5KI6 A;  4W5R A;  4NGG A;  2QVW A;  4W5O A;  3HK2 A;  4L1P A;  4NGF A;  4NHA A;  4NGD A;  1U04 A;  1R6Z A;  2FFL A;  2BZE A;  4NH3 A;  1Z25 A;  4Z4H A;  1T2R A;  1SI2 A;  5JS1 A;  3U1U A;  5JS2 A;  3HM9 A;  4NH6 A;  4NH5 A;  4Z4G A;  1SI3 A;  2DB9 A;  3O7V X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...