3U21A

Crystal structure of a fragment of nuclear factor related to kappa-b-binding protein (residues 370-495) (nfrkb) from homo sapiens at 2.18 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
104
Chain Sequence
INEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFETQQWLLGDNEELAALFQLWLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear factor related to kappa-B-binding protein
publication title Structure of a Novel Winged-Helix Like Domain from Human NFRKB Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation, dna binding
total genus 31
structure length 104
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14465 NFRKB_winged NFRKB Winged Helix-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3u21A00
3U21A
chains in the Genus database with same CATH superfamily
2HR3A 4RAFA 4A6EA 2F4MB 4YRVA 1WSUA 3RQIA 4O5VA 2CS3A 1I39A 4LD5A 5LHGA 4BJ5C 2I8DA 2GXAA 2HDCA 3PUBA 1S7OA 4XN0A 3FMSA 5HVQC 1A36A 4J19A 1DUXC 3OYLA 1X4PA 1LKXA 3SFZA 2HZTA 2HOSA 4IHXA 1VQ8I 2MW8A 3GEZA 4E4HA 2EV5A 4DIQA 4ZYDA 3H5AA 2JQ7A 2VT3A 5CVJA 3JRBA 4L9TA 2DK8A 4RLQA 3G1MA 4W1UA 3LAPA 2OUMA 4QIWN 2VI6A 1FIAA 1MJAA 4IRHA 2A05A 3HUGA 4UXNA 3M8EA 3DCFA 3BCBA 2L9NA 1XX5A 3AG1H 1HW2A 1LVKA 4Y52J 4EV0A 3I58A 2MH2A 2LYCA 4GXOA 4QSHA 3V7RA 3VFZA 1BL0A 2GM4A 3R0JA 4D7MA 4YIIA 3K7AJ 4MGRA 2TDXA 1ETQA 4KT5C 4ENKA 1X1CA 4LG0A 3PNYA 3ZQLA 1TNTA 1X1DA 4Y3OA 4A5NA 4BUPA 2GQQA 5JR3A 4EGZA 4C2TA 4OU0A 3C1DA 3BLYA 4M71A 3BZKA 2WY8Q 1MBHA 4NBQA 5J1RA 1OISA 2K9QA 4G6QA 1P4WA 3WE3A 3H0DA 1KU2A 2DT6A 2IEKA 4LG3A 4OMZA 4U7DA 3VEPA 1W1WE 2CSOA 3QP5A 2VQCA 3E5QA 3C2GA 3HM5A 4BHCA 3H1CA 4QTRA 1SC7A 2QF7A 3SYTA 1XPXA 4AVZA 5J6XA 1E3PA 2AXTC 2LREA 2P7CB 1KONA 1R58A 2BXZA 1IXRC 4BDZA 1SANA 2OF7A 1VTNC 2H94A 1E2XA 3CCMI 3AL0C 4ZTFA 3RPQA 3W6JB 2CFOA 2ZJPF 2O0YA 1Z6RA 2DOAA 2NVQJ 2XPVA 1YX5A 3RI4A 1O57A 1GT0C 4BQNA 2V9KA 4ZDOA 4HF2A 3NQOA 4U87A 2XUBA 3BR1A 3BTIA 3OL3A 4EATA 3PO3J 2KZGA 2LY2A 1UB9A 4N4OB 5D5UB 1HBXG 1Z91A 4HYEA 4NUBA 3BG9A 1Z21A 3C2BA 2FQ4A 2X0LA 2ZNYA 4TV7A 1H8AC 1JKQC 3SQNA 5K7ZA 4IEJA 3ABKH 4C3IJ 5M3FJ 5FD5A 1ZN2A 1HA8A 3LFUA 3HRUA 2M8GX 1W36D 1VQNI 4A3GJ 3OL4A 3FHZA 3FKJA 2XRNA 3K4LA 3R6SA 2DFEA 2JN6A 1W4MA 2NS8A 2NVUB 5K7FA 2KHMA 1K6YA 3GFLA 3VWBA 2ZXHA 2DA1A 1PYVA 3ERED 4AU7A 4Q5SF 1EJ9A 5GPAA 3K70C 3BR3A 2XSJC 2CMPA 3U1KA 4LK0F 1ZARA 5F08A 3I5UA 1MH4A 3I3LA 3F23A 4E7LA 3VB2A 1YIJI 3BJ6A 4Y17A 2QM3A 4CDGA 2DFHA 1PJRA 3T8TA 3KE2A 5DYMA 3OOUA 5GTIC 3FISA 3JRGA 3IC7A 1QZYA 4PFPA 2VKHA 3S2HJ 3KP6A 5J4YA 4OAYA 2O5RA 1E17A 4HQEA 3I59B 3U21A 2FX0A 2WY7Q 2L54A 4D0PA 1N25A 2Y0MA 1XSXA 1HW5A 2HQRA 3ROUA 2WB1A 2LMDA 3GUDA 4NNJA 3FXKA 5GAHJ 4WXCA 1UAAA 1BI1A 5C44J 1ZGJA 4JX5A 2B7EA 5F64A 4ESJA 1AU7A 4UUVA 3CP2A 4ON0A 4OOIA 2VKVA 4ZTJA 2PFBA 1WVRA 3K2AA 2LKSA 1KGSA 1W7PA 4HLXA 4JX6A 5DUKA 4FCYA 2VN2A 1WZ2A 4DGWB 1V4RA 3H3UA 5E1ZB 3LA2A 2HKXA 5JI6A 4A0ZA 3G1LA 4YFNF 2Y69H 2VB6A 1F9NA 2CGPA 3SXYA 5HDKA 3BCAA 3OSFA 2EIKH 4OMYA 2EFNA 2JK3A 3IH2A 2FOKA 4C9YA 1E3OC 3ZMZA 4RAGA 1KZHA 2PLYA 3HXLA 2M3AA 2WV1A 2OJED 3K4MA 3K10A 2OC6A 1K78A 3TGNA 5ICCA 3LSMA 2P4WA 3ABTA 2KT0A 1FLIA 2VT2A 3RYRA 1X4OA 3SDGA 1O3QA 1RC9A 2EINH 1JHHA 4AWXB 4CCOA 1FBUA 1MZBA 2HU9A 3PFIA 2JPBA 1U5TB 2GIZA 4BQQA 2OTLI 1X2MA 1ENHA 1APLC 3ECOA 4LLNA 3DQVC 3AKZA 1ZAOA 4KN7X 5IYBJ 2P8TA 2QSGX 1WRJA 2L4MA 4KFCA 3SZGA 4MEYF 2E1MB 3ZQHA 3TP3A 4UNOA 3ZN0A 1ZREA 1QA6A 3S16J 2E2HJ 2VXZA 2Y75A 5ED4A 3GX4X 3L9FA 1DU0A 1JKOC 4RGRA 1FX7A 4KJZA 1LPQA 3HUGB 2X48A 4M3EA 4P9FA 1BJZA 4YG2F 1WQ2A 5CQGA 2QBYB 2DA2A 1B4AA 1ZKGA 2R7SA 4AC0A 3JR9A 4BJTA 1IDYA 1YOVB 4Y33A 3S17J 2XF6A 1D8KA 4IHVA 3CJRB 1I3AA 4NQWB 3Q3SA 4B43A 3BTCA 2EK5A 2J5OA 2BW3B 1R1TA 2P0WA 3BR2A 1ZGWA 5KAIC 5JHFA 2L01A 4B09A 1QU3A 1IC8A 5K1YA 2KLOA 1Y8RB 1UHMA 3WGGA 2CW0F 4HDVA 2FF4A 3S3OA 2FMLA 4LB6B 3REOA 2A5WA 2K3PA 2Q0OA 4XM3A 4M9SA 3KCCA 4FX0A 2V4JC 1I5ZA 4AIJA 2N8GA 3EYIA 2QLZA 3TW6A 2XKPA 2GA1A 4HLYA 2L7MP 2O6GE 2JA7J 1IRZA 1USSA 3FXQA 1REPC 4E6KG 4DNCA 3C18A 2X6WA 1LFUP 2IGKA 4A2UA 4G12A 4N0BA 1HKTA 1WGXA 1W36C 2MFZA 1R49A 2JSCA 1IG7A 1TLHB 2L7KA 4UVBA 2LBFA 4B8XA 4CCMA 5LRSA 2CV2A 2ZMEC 4ZJZA 1RKWA 5GPCA 1TQIA 4OWRB 2CUEA 3WG7H 1DGWY 1B72B 1W5SA 3H0GJ 5L3FA 1QQIA 2ZSHB 1D3YA 3RKXA 1DDNA 2KIQA 3HOSA 2DYRH 3ZQGA 4D5FA 5B66C 3WTTC 3OS1A 1NK3P 1FY7A 3QWLA 4ZYEA 1XTAA 2ICWG 2X6YA 5EEHA 5EEGA 2O8XA 1NH3A 3MQ0A 5IY5H 5HLGA 2HI3A 1R00A 4M3DA 2NNYA 2XROA 3IRRA 4WXHA 5K5OA 5CPRB 1P7IA 4AUXA 1QHGA 4XLAA 3JW4A 1JUMA 3I55I 2CUJA 1I27A 3QYFA 4I2OA 2Q8KA 2F5EA 1RUOA 1R22A 3OY9A 1S9HA 1Z0XA 2P5KA 2NVXJ 4HNTA 2Z5UA 1T38A 4IVNA 1IN5A 3J80K 1D5YA 3IWFA 3CC4I 5DTDA 2CQKA 1O3TA 1IDZA 3K1MA 3L09A 1OYIA 4G94A 2W57A 4ESBA 2DJIA 4EJVA 3V8JA 4JYKA 1Y39A 3DU6A 2IGNA 2KZVA 1AKHA 3KZZA 5BPIA 3KP4A 3FMRA 2R5YB 3I4MJ 2DQRA 3FK6A 4GRIA 3ZMUA 1D1CA 3LMMA 3ML6A 5FFXA 3NWSA 4XLCA 1BI2A 3KEOA 2GBYA 1IAWA 2YSRA 1S5LC 3BG6A 5EF6A 2R7WA 2ID3A 2EFPA 2BY1A 5DD8A 1HF0A 2D45A 2D1HA 5IOZA 5F0HA 3BZ6A 1A04A 3PUFA 1R36A 2OCCH 2XF7A 2BYVE 4MFEA 5CKTA 3D5SC 3LSJA 1MMSA 2A69F 3TMOA 5CYVA 3SDBA 3BT9A 2DTRA 3OYCA 4I99C 2ADUA 4UB6C 2E71A 1CF7A 2HOTA 3O8GA 2GOMA 1TTYA 1QHHD 5E79C 4RAZA 4BACA 2RVCA 4D5CA 1QZEA 2HNHA 4XKCA 1A6IA 1ON2A 3NWTA 4EM1A 3FIWA 4FT8A 4HV5A 3HOUJ 2IA1A 2XAGA 5LD2C 1J5YA 2ZMEA 4L5JA 4F3QA 3FHNA 3LSTA 2DOEA 2FOWA 1U78A 5L3CA 5IOYA 2RDPA 3FKIJ 2DDBA 1FMVA 1X19A 2XF5A 1QPMA 2LY9A 3HGYA 2PMZA 5LRRA 4ENNA 1YJNI 2NOJB 3TW7A 2H1KA 3RPUD 1LEBA 1PP8F 5BS6A 1U0JA 2K85A 2VJ5A 2CO5A 3ERMA 1L3LA 3U1DA 2O9LA 2M45A 2DT5A 1FTZA 4OIQF 3FZVA 1ZELA 2R7UA 5J8CA 4UHTA 3DKWA 4XRSG 5IT9K 3TBIA 2E34A 2LKXA 1IN8A 3SEQA 1U9OA 1JUSA 4LB5A 4YFKF 2O03A 2DOFA 4GYIA 3TP0A 3H3ZA 3VDXA 2MC3A 2YU3A 4BAYA 2NRAC 3S93A 5ICEA 2XAHA 4HF1A 2IS4A 3W6VA 3DKYA 1YJ9I 2A68F 3T8RA 1YJWI 4RS8A 1FEXA 1PVEA 3WU1B 1JE8A 2VJIA 2XIGA 2KPMA 3ZQCA 4IO9F 5M5YJ 2WB1N 3LA7A 4F55A 4IXAA 4G6TB 1KU3A 2CQXA 1F5TA 4A3IJ 4QPOA 3T5XA 1U2WA 4DZJA 3VYRB 2W7NA 2PI0A 4MTEA 3KZIC 3PFYA 1R5GA 3PIPF 4IQJA 2HS5A 3GTJJ 2DLLA 1GV2A 4RM2A 3KP2A 5D6FA 3HHGA 5E1XA 3KX2A 3S1QJ 3P9CA 2PJRB 4DW6A 4C3JJ 3IP4B 3CD6I 1F1ZA 2BHYA 4ESFA 1YFHA 4LITA 1FYMA 1H89C 2HYGD 4U0VA 3CQZJ 3F8BA 2KDOA 4I0BA 1B8IB 2VASA 1MBFA 2NAZA 2TRTA 1HW1A 2K9MA 2KJCA 3L2CA 2LKPA 1VI0A 4LFUA 4OIRF 3M9AA 4WF2A 2PX9A 1TT5B 1XSVA 4F91B 1FBSA 2JVGA 4II2A 5E3NA 1TWHJ 3CCEI 1FOKA 3QODA 3EDPA 3CJQB 1EH6A 2QVOA 5FRNA 1WJCA 3RQ4A 3G73A 2VJJA 1HSJA 2JUCA 4NC7A 3MZHA 3K4JA 3PSFA 4IX7A 2LBFB 1SD4A 2G7UA 4DJAA 1G4DA 2LNBA 3H92A 5FKKA 2PMUA 1MJ9A 4KA4A 3SJMA 5LLQA 4EVIA 4MQ9F 3JRAA 1ONVA 5E1WA 4MO7A 3KP5A 3HIFA 1F43A 2MD5A 1BR4A 1MJBA 2JZYA 1FNNA 4PCQA 5DEQA 2BBYA 5ILUA 5C4XJ 4MHGA 2JMWA 1HDDC 3QU6A 2Y48A 4CCJA 1C0WA 4PGGA 3LSKA 3IKTA 5KK1A 1IXSB 1R1UA 2O8KA 1FPQA 1HXDA 1FC3A 4P1WA 3OSGA 3E1SA 3CTAA 3HOXJ 2IAIA 1S72I 1TWFJ 1WH7A 2RNGA 1EKEA 2RQQA 3H5RA 1IN7A 2DPUA 1RETA 1RR7A 4CXFA 2JUGA 4BJ6C 2OPTA 4UUSB 4O6JA 3CUQB 2VL8A 3MKWB 4C2UA 4MTDA 3ZP5A 2V26A 3DEWA 1SVMA 2DW4A 1B9NA 1V5FA 3ZQFA 3DF8A 5DUIA 4PSXA 1A5JA 5TRDA 4FQGA 1TWGJ 1H9TA 2OV7A 2KKOA 2P5LC 2B0LA 4B47A 1XS9A 1BIAA 1MDMA 2ZJRF 4B3XA 2M7AA 1TQMA 4UVCA 4CSWA 4A12A 4RAYA 3G2BA 4BHPA 2JJ7A 2KJBA 2ME0A 4HSRA 3EPZA 1FBQA 3S3MA 2QA4I 3MCZA 2LRDA 2MC4A 4MIMA 1ETOA 4DQ2A 2V6EA 1Z05A 2R7DA 3CESA 3RDIA 3N05A 1WJ5A 2VKDA 3F6OA 1YHQI 2E1OA 2KP6A 4V2FA 5L3DA 1ZG1A 2R5ZA 3FXMA 5KCMA 3O6BB 2XGXA 3E6DA 2F5DA 2QUFA 2E1NA 4NC8A 3BJAA 5HLHA 3WTVC 2COMA 2PN6A 3W6KB 3GTQJ 3D5RC 2A6EF 3OV8A 4L9JA 3GTGJ 1QPIA 3GZNB 2MABA 1WJBA 5F6FA 3K0LA 1BW5A 2LC2A 1IN6A 5EGOB 5IP9J 4FHTA 1G3SA 3J81Z 2LD5A 1U3EM 2L7FP 3U2RA 1WKMA 3R61A 3BR5A 3HPHA 4BEHA 5LHIA 4XLEA 2BVMA 3RZDJ 4EM2A 1N78A 4XBFA 3CF2A 3KLOA 1VQ6I 3R0AA 1VQOI 3RKWA 2Q2EA 4A5MA 4DBQA 4RB2C 4R1HA 3PQKA 2XGEA 5HNHA 4L9VA 2FD5A 5CQEA 5JHUA 2K40A 5ILVA 4PUSA 3F21A 5E3OA 1MW7A 4ANJA 3H3VK 4ZC3A 2RAEA 5HDGA 1DP7P 4BXXJ 2DFFA 2BY0A 5DCMB 3QPSA 4OAZA 4PJNA 3HOZJ 4PJLA 1ETWA 1W5CC 1T39A 1XG1A 4Q48A 2V1NA 3H36A 4LIUA 2Z16A 1FWZA 1I1GA 3S14J 3WU0A 4D9JA 3B6CA 1LDDA 1SAUA 5FLXZ 1UG2A 2BVLA 2Z99A 5EG0B 2V9VA 3BZCA 3MAJA 2W85A 4HSTA 1ZLKA 2CV0A 2LF8A 2X1CA 3GTKJ 1ZGAA 2YPRA 3TDUC 3B6AA 2FEZA 2DN0A 1SVOA 3FMQA 1SMTA 3DFGA 4CICA 1W0TA 2IS6A 4LLLA 3DU5A 4M3BA 1PUFB 1DGRM 4IQ4A 1GXQA 1ETXA 2O3FA 2R3SA 2UWMA 1MMDA 2HXOA 5HLIA 2V9PA 1JXSA 2FSWA 1GHCA 5K5RA 4RGSA 2NOGA 1YQAA 3LL7A 3OYBA 1WCMJ 2RQPA 2M1BA 1BOBA 4D7NA 2HGCA 1WFXA 3BOQA 2PMZN 5D5XB 4CA0A 2EWNA 3ZMVA 2RN7A 4B44A 1U6GA 5J3LA 3TOBA 4ZDLA 2LY1A 3GZ5A 4YEJA 3DTIA 4UVAA 4ZYAA 3U9GA 3TO6A 2ZFWA 1T95A 4F93B 1LJ9A 2VBWA 3H5NA 3QPHA 1YS6A 3RCOA 1T33A 4XOPA 2DJNA 2ME6A 3FDYA 4XORA 1N75A 2ZBKA 1JGGA 2R7VA 1SFUA 1L0OC 1UHSA 1D0ZA 1W5TA 1XMAA 2WC2A 3ZQQA 5M3MJ 4X6AJ 2QCOA 1TNSA 1Y1WJ 3OYHA 3I71A 4LK1F 4E7HA 4IHYA 3BWGA 2MD0A 2QGUA 3M1CA 1S6LA 2BZTA 3OWTA 2D1VA 1YW8A 4HAMA 4ITVA 4ZYGA 2HWVA 3DTKA 3F8FA 3MZYA 1OCOH 4UV8A 5E8IA 2KDZA 3R4KA 4CYCA 3ZOBA 2STTA 4K2EA 4AIKA 2E5NA 3AG3H 3LSIA 2V6CA 3NRVA 4PZJA 4LMYA 3V8KA 4G7HF 4E7JA 3EYYA 3GFIA 2FU4A 2VBYA 4EM0B 3JAMZ 2KRFA 2EJRA 5M5WJ 2IT0A 3FXLA 3DBRB 1QNTA 2GAUA 4ENJA 1WWXA 1MSFC 2K5CA 1PUEE 1KYWA 4XLNF 4HX4A 3I4NJ 2R92J 2GXGA 3MZ8A 2W24A 4BKXA 5C4JJ 1UMQA 3S8PA 5BNGA 2EFOA 4Y15A 1ETYA 2DMQA 3FXJA 2E2JJ 5GTHC 1D1BA 2H6CA 2H09A 3GXOA 2KRCA 2ESHA 3RKQA 1QVUA 2HDWA 1MDMB 1BOAA 5HLTA 4YELA 4ABZA 1TQPA 2K27A 2ZXIA 4BQAA 1T2KA 3AG4H 3QPTA 5H6RA 1NK2P 2V1XA 2EFWA 2ZO4A 2YS9A 3EQLF 5H6QA 5BOXA 3JREA 1R9TJ 3HRSA 3BG5A 3D0SA 1QVTA 2Z9OA 1SD5A 3WTZA 1K4TA 4B3AA 4S0HB 5IPAA 2ACJA 4LGWA 1E3HA 2PJPA 5EZGA 2L02A 1YYVA 1RIOH 4XLFA 5IP6A 4L9NA 4M6YA 3BP8A 3DEUA 1K79A 3K4CA 5CLSA 1ACIA 1ZRFA 2DA4A 1WH5A 3CC7I 1JJ6C 1X3UA 1P4AA 5JVTA 1YLFA 3ONQA 3X2QH 4MNUA 4IOCF 1A35A 2LR8A 1Z9CA 4BEHB 5FGMA 1ITYA 4V2GA 2EA4A 2DPDA 1TP4A 2H27A 3HBLA 2CH0A 3W2WA 3J7YJ 3OS2A 2BEOA 2ZXJA 1XMXA 1VQKI 1XCBA 3PNTA 1WJFA 3GO5A 1S7EA 4PDKA 4ZZLA 2Y2ZA 1Q1VA 4X1EA 4HOBA 4GO1A 5FJ8J 4MLOA 4AIHA 1DQUA 4F7ZA 1OCCH 1BIBA 1J09A 3CF5F 4LG0B 2A61A 1FOYA 4CZCA 3OYFA 2YX7A 1GV5A 5F1JA 4G7ZF 3OMYA 2FBKA 2P7VB 5ERIA 2X6XA 2CUFA 4I6ZA 2FJ1A 2WWYA 3LWFA 4HA8A 3BROA 1BBYA 2I10A 3H35A 2HOEA 5J40A 3E97A 2VOOA 5BMZA 3A01A 5HDNA 3BQZA 9ANTA 1K4SA 3SZTA 1OYYA 2TCTA 2ZKZA 5IT3A 1HCRA 3IKVA 1D8JA 1X2NA 2EV0A 4BL0B 4E7ZA 1FZPB 2HDDA 3WODF 3HL2A 2LF7A 4LJZF 1WI9A 2EQRA 2LSOA 3HDDA 1OFCX 4KISA 4U88A 1DPRA 2I5UA 2M87A 3DV8A 5GAGJ 3OS0A 1SAXA 1D0YA 2JT1A 4G8XA 2ETHA 3CLQA 1J75A 2R7QA 3I9V2 5D4RA 1B9MA 3BC8A 3HSEA 1T0FC 1OJLA 1ZK8A 2L3DA 3F0CA 2E5ZA 4XL9A 3JRIA 1RNLA 4JOMA 4QLCU 5J4VA 1MMAA 2H1LA 3PJRA 1X58A 3RJPA 2X51A 2OTJI 4HG2A 4EEFG 5KHDA 2D5VA 3I56I 1KQ9A 3BTLA 3W3CA 4M9XA 2MSYA 1ORKA 4BS9A 1EH7A 1MD0A 4RDUA 2ESNA 2VOPA 3A1YA 2JRMA 1MNDA 4BY7J 3QAHA 1VQMI 2DCEA 2HOAA 1A31A 1OR7C 5AIQA 5FROA 4EMSA 3FBNB 2ECCA 1GLNA 1SFKA 4XONA 4BXUA 5F1RA 3CDHA 2YU9J 2XPUA 2E7WA 2VQLA 2UV1A 4Z6YA 3HPGA 4A3CJ 1R71A 3DLAA 1BR2A 3OYMA 1O7LA 4XKBA 3CC2I 2ELHA 3K1NA 1OKRA 2NXNB 3KIOA 4DZPA 4XQFA 2GXBA 3LA3A 5BPDA 2L9RA 4XOTA 2R7RA 3DXJF 2QKLB 2WA0A 5JLXA 1T56A 5L3GA 4BDYA 4E7IA 2ZSIB 1RPWA 2ZNZA 4A3KJ 3C3WA 3ZCOA 1ZRCA 1WJEA 2MH9A 3J7ZI 5AIPA 1VQ9I 4NC6A 2LP0A 3C2HA 1ERDA 4A69C 1Z7LA 3E5XA 4B1RA 1ULYA 2FE3A 3GTPJ 4PJJA 1FSHA 4OIPF 4A3FJ 1DU6A 2F5VA 1IO2A 2X1EA 1IV8A 1LE8A 1D1AA 4XMYA 3L2UA 3FWEA 2QQAA 3F72A 3OYEA 3HC7A 5KVRA 5L3BA 1KQ0A 2O7OA 1V54H 4Y7NJ 1W7PB 3P9KA 1QO0D 4M73A 3GFMA 4RMNA 3RKYA 1XDSA 4U0YA 3ZR8X 3VSKA 1GXPA 1EH8A 4A0YA 3CMMA 3AL0B 1YG2A 3L2RA 2PMHA 3QRFF 3IUOA 3OYNA 4KT6A 3E6CC 2QSHX 1YW9A 4BE1A 4YIFA 5B1BH 4M6VA 1T0FA 2QWWA 3E0JB 5IYDJ 4A3MJ 3WHCA 1J2XA 3VYSB 1K78B 3LSPA 2RV8A 4WXDA 4GCVA 2JRTA 1FYLA 2DA3A 2E35A 2OZ6A 4IF4A 4L0YB 5DV5A 2HYJA 5H2FC 2XSDC 4J01A 3OYIA 4QWQA 2MA3A 3OYJA 4AYBA 4BQOA 2KRHA 4B48A 1BR1A 2P81A 4F92B 2NNNA 3K4BA 3A02A 3KP7A 3WGIA 1JTYA 2FBHA 2CW7A 1ZR2A 5J1UA 1B6AA 1OR7A 4RGXA 4N4NB 3GTLJ 2DQLA 3FX3A 1FP2A 3CO6C 3CCVI 3F8NA 1R4NB 4L5EA 4QPQA 1JHFA 3HG9A 3JRDA 1KYZA 1H88C 4EJOA 1QZZA 1B1BA 1EA3A 1K83J 2K4BA 3S32A 2AO9A 4XRSA 3CO7C 1IN4A 2XRLA 1VQ7I 3GLXA 1R5ID 1P7JA 3HJEA 4RB1A 2XHKA 3QU3A 1IRXA 4XN3A 1J0RA 3VYUB 4ZH4F 4BGDA 3HSFA 3L00A 2M0MA 2XKOA 2JPCA 4G7OF 2A6HF 2NS0A 2E36A 4GDFA 2K9NA 2LVSA 2EIMH 1ZRDA 1R4MB 2PEXA 3C7JA 1HLVA 2ZJ2A 2FNPA 2OA4A 3I0TA 1FSEA 3BPVA 1EF4A 1NHAA 1XB4A 3CP8A 5LFAA 3GVAA 1FOWA 3QYBA 4XNFA 3SHFA 2Y0SA 4JBAA 2RREA 1ZH5A 1OYWA 1RRJA 5EJCA 3QPLA 2XDVA 2E60A 2CQNA 4N9IA 2Z33A 4Y4RA 2BY2A 2M5WA 2R7FA 3CUOA 5TJJA 2XVCA 4I98B 3N97A 3Q5FA 2AS5F 3A01B 1UFMA 4HRIA 4I7HA 4XKVA 3LSRA 1G8XA 3RYPA 2OCEA 1LNWA 3S2WA 3IHUA 3J81K 4OINF 2OQGA 1YIOA 4IHSA 3PL8A 2CV1A 1T98A 2DODA 3WTYC 4II3A 3J7AY 3FXOA 5B3SH 4WWCA 1FTTA 2XGDA 5EEAA 5IP7J 1H9GA 1U5TC 4LLGF 3ZQIA 3FM3A 4NB5A 3BR0A 2A07F 4MFDA 2K7LA 2XC7A 2MLGA 4A3LJ 2IBDA 3EETA 4I76A 2YUSA 5E3LA 1BM9A 5JVGF 3HOWJ 2BXYA 2E1MC 3H9GA 2JTVA 2JA5J 2X4HA 3HZJA 2WAQA 3PSIA 1BC7C 3UKGA 4FE7A 2W00A 2JVHA 3K69A 2LK2A 3WHBA 1OPCA 3G4SI 1UHWA 1O3RA 3LNQA 5K5QA 2HFHA 2MGQA 2LFBA 4C2MJ 2X9DA 2DMUA 3WG9A 3ABLH 4E70A 3COAC 5EYRA 3H9QA 2H8WA 5J47A 5FLXK 1T6SA 3ASOH 1JT0A 2E2IJ 2DXIA 4CZZA 1XDUA 3A03A 1WJDA 2KL4A 2W4SA 2FXAA 4FE4A 2L9SA 1Y8QB 3KFWX 3JTHA 2M34A 1PP7U 4FETA 4CUGA 5F0CA 3CCLI 1R23A 4X0GA 2BOLA 3Q0VA 4PJ0C 1NG6A 2RKHA 1J9IA 4IKFA 2C6YA 1AKHB 3N4MA 2GIVA 3W2VA 2VXDA 3Q0UA 3HYIA 3DPTA 3NARA 2M30A 1O4XA 3GF2A 2HXIA 1HKSA 4JK1X 3PNVA 4RM3A 1P2FA 1ZLJA 2XAQA 2EH3A 2W84A 4J00A 2R7ZJ 3I64A 3ZXSA 1BI0A 3BJOA 3TO9A 2VUMJ 1GUUA 1TBXA 1HQCA 3VPRA 4RLFA 4IPAA 1ZHFA 1Y0UA 4KNYA 2F4IA 1Y0NA 2CU7A 3IAS2 2L5QA 4HQMA 4KIBA 1YO5C 2PBIA 3K2ZA 5ILSA 3MKZA 2KQRA 3QYEA 5BQTA 1CGPA 2IP2A 2FBIA 3LQRA 1IW7F 1CF7B 4Z2YA 1IGNA 1UG0A 1IUFA 2G0EA 3OIPA 1P9QC 4RBOA 2EZHA 3ZPLA 3O8HA 3Q0WA 2M4GA 1U5TA 4R8HA 5ICFA 3RIRA 5M5XJ 5FLVA 2CJJA 2ZMEB 1LQ1A 4KMFA 4CGZA 2HYFA 4BBRJ 4EGYA 1EV7A 4MQVA 2OZUA 1OMIA 3CCJI 1LFBA 2STWA 2H8RA 1ZYRF 2DT7B 3WTUC 4AM3A 4IJAA 2P5VA 5EDNA 3O3KA 2VC0A 5FLMJ 1SFXA 4I0AA 4XICA 3PM1A 3BG3A 2L9VA 3VSLA 1OCRH 1QRYA 2VIXA 4KUMA 1V5EA 3DP7A 4ZDPA 2Y9ZA 1JJ8C 1X3WB 2M8EA 1XGNA 4IHWA 5LGUA 3PQJA 4HEA2 3JAMK 4S04A 1VQPI 1FJLA 2COBA 2M0CA 2R7TA 2OBPA 4HX8A 1S3JA 2E1CA 3GW2A 2VPRA 2IRFG 3ZMTA 1IJWC 2AHQA 3CJTB 2QBYA 3P9IA 2QZ8A 1S7AA 2HVRA 5E8GA 1GVDA 3MEXA 5D8KB 2HPMA 3LFKA 2XGCA 1RI7A 3I54A 3M7GA 3A0BC 3KYCB 4NQWA 1I50J 1ZG5A 3G71I 2BW3A 2IGOA 3L2QA 1I1SA 3TO7A 4M72A 2VLAA 1B59A 1Z3XA 1BW6A 2LDUA 3GCMA 1GVJA 1LB2A 4Q47A 2R7OA 2Y9YA 1KU9A 5LEKA 4M74A 3CCUI 4CYDA 3OR2C 3QOEA 1IF1A 5H20A 4KDPA 5C3EJ 3M1EA 3LQQA 2WV0A 2KIMA 2DI3A 2QQ8A 2FA5A 2HKOA 3BPXA 2J5PA 4A93J 1JKPC 4WCGA 5F04A 5KAFC 5A2QZ 1JI8A 3B73A 3M4OJ 1UCRA 4KN4X 1ZQ3P 2VKEA 1IRFA 3DWLE 2L7ZA 2VQGA 2ZCWA 3DPUA 3HOTA 2IJLA 1P4XA 2L2OA 3JSPA 2WTEA 4M3FA 2CG4A 3RPUA 2A3SA 2QSFX 2BHZA 2IPQX 5JLWA 4HW0A 3MVPA 2UZKA 4BBSJ 3KP3A 1B72A 2KIFA 2HPIA 4A6DA 1IRGA 2XB0X 3VOEA 4AYBN 3KEYA 3A0HC 2FQ3A 3L7WA 4GYGA 4O3MA 4AIDA 3JRHA 3A2KA 3F9KA 4CCLA 2JWTA 1J59A 4FASD 3HKZA 2Y30A 2VE9A 3CCRI 5KNLA 2FMYA 3V42A 3HOVJ 4ASNA 1ON1A 3BDDA 2DTZA 1G3YA 3HEFA 2EB7A 2EZIA 4PK4A 2NVTJ 2PQ8A 2IS1A 3SFIA 2OD5A 3LSGA 3G6EI 2VPLA 2CWEA 3S2DJ 3DKXA 1MNMC 1XD7A 3K6GA 4P55A 2Z3YA 4U7BA 2DK5A 1BA5A 4PGHA 2Z2SB 1D5VA 2ZJQF 4CHUA 1S29A 4PSWA 5F0FA 2G7HA 2OAZA 3V4GA 2W48A 4U0WA 1KQ8A 1Z6TA 2RNJA 3GYHX 5D5VB 1E0EA 1HSTA 4BE0A 5FO5A 1YITI 2HQAA 2XAJA 1N77A 6PAXA 2KMUA 3S1NJ 2UXNA 3CMAI 3OYGA 2BV6A 2R5YA 1F36A 4IHTA 2GLOA 4ZZDA 3L1PA 3DBLB 3F8MA 4XRMA 4A0XA 2Y0SN 3NEUA 4BNCA 5D4SA 2P6SA 1SVLA 2EBIA 2P6TA 3E6BA 3MN2A 3T1BA 3CCSI 1YS7A 2OU2A 2MYSA 5GP9A 2GOXB 2IGMA 2FUG2 3RSNA 5FRMA 4KICA 3MWMA 1I3QJ 2QKMB 2NVYJ 4FTHA 2LTPA 4JX4A 3QQAA 3WTWC 3L2WA 3WE2A 4A3EJ 2K86A 4UB8C 5GAEJ 1XMKA 1BI3A 2BY3A 1W0UA 1Z67A 3GZ6A 3OIQA 3LOCA 2DDAA 4RB0A 2WAEA 1Y6IA 1U8BA 2XAFA 2YX4A 3MFKA 1UELB 4RA2A 5FKLA 1Q1HA 3S1MJ 4IOAF 3DTEA 3ZN1A 2R5ZB 1OCPA 3V7SA 1JGSA 2VQHA 1TZLA 4CCKA 3DEEA 5K7HA 3ZMDA 5FKOA 2XV4S 4I09A 2EPFA 2RGVA 2WAQN 2ELKA 4N9HA 1CQTA 3AFHA 3IH3A 3ABUA 3M8FA 3V7CA 4BY1J 1LVAA 2F5FA 3L2VA 2VC1A 3OOPA 2GA2A 2HEOA 1HDPA 1V55H 3HGGA 3SZPA 3JSOA 3VODA 1BJAA 4PJMA 2K9SA 3OYKA 1FOXA 1UZCA 3AG2H 2Q2EB 1MMNA 2K02A 3WGHA 3ESWB 3IL2A 1VNDA 4CO8A 2LOOA 2W82A 2IW5A 3J7AO 4HBLA 4WX9A 3DPLC 1G6NA 3V8LA 3CUQC 4C30A 2W1OA 2HZDA 1XGMA 3RTRA 5J8FA 3D5LA 3QOPA 3VYTB 1HC8A 2F2EA 5HODA 1I6XA 3HRMA 3DLLF 3ZRGA 3CDIA 4GGGA 4YFXF 4HNVA 1K6OA 2ID6A 1HOMA 4LOCA 5D5WB 4L18B 2Z1DA 1UJ8A 4BYYA 1VQLI 3PO2J 3FF5A 5FB2A 1FT9A 3JCUC 2L4AA 2AQEA 1SMYF 1Z7UA 4HV6A 4G9YA 2PJRA 3G3ZA 4CH7A 5GADJ 5B5EC 1V5GA 2BE5F 5IYCJ 2K3FA 3PIOF 3G1OA 2IXSA 4R79A 4EJTA 2V1DA 2QQ9A 3JRFA 1X1PA 3GBGA 3AAFA 1B8IA 4A3DJ 2HTJA 2JA2A 2O61A 3BTJA 4S05A 1D0XA 5DM6F 1R5HA 2JSPA 4NDLA 1PDNC 4M9ZA 3B02A 2HQNA 2EA2A 3GFJA 3FXUA 2BGCA 4HPQA 3S3NA 3CLOA 3FK7A 2HVSA 5LHHA 3KYLA 3MD2A 2R7XA 1ODDA 3ASNH 4L5IA 5TGTA 1G3TA 1YE9A 1O3SA 1XSDA 4RB3C 5HS8A 2XPWA 3E5UA 1P6RA 2X85A 5DM7F 2DO7A 1LEAA 5DS9A 1ETVA 2PG4A 4Q4ZF 3KZYA 2ZXWH 3K1PA 4FX4A 2RC4A 4EJWA 2QEXI 2ELJA 2ZB9A 5CVVA 1WJAA 4EQQA 4V19K 4BU2A 4HDUA 2OQRA 1IXCA 3ULQB 4HF0A 2MBFA 4EJUA 5E3MA 4FISA 3GTOJ 1JTXA 1V3FA 1LDJA 2R4GA 4P5OA 3LAJA 5HNFA 5LEJA 4H4KC 1RR8C 5EZHA 3CMYA 3OYDA 4CCNA 3TEDA 4P9UA 1X1BA 1OCZH 3CMEI 4AVPA 1TWAJ 2CQ7A 4L0ZB 1LUJB 3MKLA 2WBMA 2DMNA 2EZLA 1LDKB 2AQFA 1U8RA 1G2HA 1YRNA 2EV6A 1X1AA 4UUSA 3CUQA 2R0QC 1T8IA 4XK4A 1QGPA 4M3GA 4P96A 3HSRA 2M9HA 1ZR4A 2K4JA 3HRTA 3WU2C 1P92A 3GLLA 4KIGA 4CYCB 1SFEA 1SEUA 3F3XA 4XLHA 4KIFA 1TT0A 2ISYA 5FKMA 3K4KA 3JRCA 1MIJA 2B63J 1NG7A 4DBRA 3IH4A 3IAM2 1LFPA 3M07A 1XN7A 1YW7A 2WADA 3OIOA 3UR3C 2DA7A 2DA6A 4XSXF 3LSHA 2VODA 1AWCA 2DBBA 4DYRA 4LIVA 3JTGA 2M4KA 4BH9A 5D6EA 1HKQA 2GZWA 3HTUA 3W2AA 2CFXA 2QYOA 2Y31A 1XGOA 3KEQA 4BE2A 1RZ4A 1MBGA 2X6OA 1TL8A 4A3JJ 3ELKA 3MMYB 1F4KA 3TKYA 1NTCA 2F6CA 2MG4A 5DCFA 2X1DA 2ISZA 2CUZA 3TQNA 1ETKA 3GTMJ 4MEXF 1R6RA 2EFQA 4PFOA 3SEZA 1X3ZB 4A3BJ 2GWRA 3CCYA 1JKRC 3DBHB 4ETSA 1Y1VJ 1VQ4I 3S15J 1FP1D 3HKZN 5EGOA 5LBQA 2AXLA 4BHBA 1MSEC 2IA2A 2W25A 3FXRA 5L3EA 3WTXC 3A4CA 3F8CA 3UNGC 1G59A 1BC8C 2JA8J 3BG7A 5E18F 1MMGA 2G9WA 4BXFA 1G3WA 3GWZA 4NHJA 1POGA 1VZ0A 5JFRA 1H0MA 4E7KA 2JA6J 3EUHC 1M1EB 1MGTA 2M7BA 5J1YA 2HVQA 3BR6A 3IV5A 3F6VA 2QENA 4C3HJ 1VQ5I 2KIUA 4XRFA 4HX7A 4IRIA 3NAUA 2VONA 1XGSA 3EUKL 3R60A 3CDLA 2LH9A 3ISPA 5DCMA 2FRHA 2LLKA 3M3YJ 1MH3A 1WI3A 2DAOA 4XKWA 3BQYA 4HZFA 1USTA 2ECBA 1YTYA 2F4OB 4D1QA 2D2WA 1SD7A 2VE8A 1KA8A 1YX3A 2LG4A 3MKYB 2UXXA 1MKMA 1SD6A 5EG0A 1Y56A 4I01A 4DYQA 5CVIA 1XC5A 3J80Z 3E6MA 4KITB 1AA7A 2DFIA 2DMPA 1MBEA 2DA5A 4UV9A 1SFOJ 3Q9SA 3KETA 1K7AA 4H0EA 2XAUA 5F27A 2V7FA 2DU9A 3FM5A 3WTSC 4IL6C 5B1AH 1OLTA 1R1VA 4YIRX 1PUFA 1W7PD 3HHHA 1S8NA 2NYXA 2DMTA 4OIOF 3IWZA 3ZQ7A 2ZC2A 2KFDA 2CQQA 2IVMA 1DP3A 2IA0A 1MBKA 3Q9VA 1YI2I 2V79A 1AOYA 5HS9A 3RZOJ 2H6BA 1TC3C 1RUNA 2FNAA 4G6DA 3CZ6A 2XASA 2CW8A 5CJ9A 5FKNA 3TDZC 2VBXA 2B9SA 5ICGA 2E19A 3K4NA 2VJ4A 3CJNA 3KYDB 5E20A 2YR2A 4I02A 2A6TA 2UUZA 2WAFA 2EILH 4DOZA 5FD6A 2IS2A 3BY6A 1STZA 1AHDP 1GDTA 1MNEA 1XCVA 1QBJA 3I4PA 2K9LA 1TWCJ 4F52A 1RESA 4HNUA 1ZG3A 3ECHA 4DYCA 3ZGKA 2MLKA 3M8JA 1TW2A 4KYWA 1T08B 2EIJH 1OCTC 4JP0A 3EUHA 1DPUA 2CRGA 3QP6A 4E7SA 1U9NA 4ZYHA 2XB5A 4WK8F 1VF9A 3O2PE 4XIDA 4B4CA 3H9JA 3HTSB 3E7LA 1MBJA 1JT6A 4UUTA 1WHUA 3I59A 3E3VA 3K9TA 3K70D 3P5JA 3T0YA 1Z1DA 4JQFA 1IV6A 1O7FA 1FYKA 3OYAA 3KLNA 5IT9Z 5A2QK 2NS7A 1Z77A 3GMEA 2F48A 3HB9A 3HOYJ 2V1UA 1YRNB 2R93J 4XR6A 1IUYA 1I6HJ 4GFBA 4XSZF 1JUPA 2HTSA 1A6QA 4RGUA 3F22A 1IZ1A 1K61A 1OQYA 2EZKA 3FBIB 1BN5A 2A5YB 3ZMSA 5HOOA 2CYYA 2M2EA 5CVUA 1LE8B 2KISA 5DD4A 4UY8I 3EUAA 2ZFUA 1FIPA 3P7NA 3TOAA 5LGTA 3CCQI 2HQ5A 1R7JA 1FMWA 3OR1C 4KMUX 2E7XA 2L0KA 2DYSH 2VBZA 5FFZA 5HS7A 5DDGA 2QQBA 5D8LB 4IZZA 3TL4X 3I53A 1ZTRA 3KPHA 4Y13A 3S1RJ 5E17F 2Q1ZB 5AONA 1WPKA 4XLPF 5TISC 4IRGA 4AD9A 1RKTA 1Z3YA 1VFCA 5LGNA 1KU7A 3IRQA 3ABMH 2F5CA 4W97A 5CVRA 4M6XA 3D1NI 1TW3A 1J7KA 4ENMA
chains in the Genus database with same CATH topology
2KPMA 2HQAA 1N77A 4JOMA 4YRVA 2KMUA 1MMAA 2CS3A 4F55A 3PJRA 2X51A 4G6TB 3OYGA 4HG2A 5KHDA 4BJ5C 2I8DA 4QPOA 3W3CA 4BS9A 3PUBA 4XN0A 3VYRB 2W7NA 5HVQC 3A1YA 3OYLA 1X4PA 1LKXA 1MNDA 3PFYA 4IQJA 2DCEA 4E4HA 4RM2A 2MYSA 1OR7C 3KX2A 5FROA 3H5AA 2GOXB 2IGMA 3FBNB 4DIQA 2FUG2 3RSNA 5FRMA 2PJRB 4RLQA 2QKMB 3IP4B 1GLNA 3L2WA 1SFKA 2OUMA 4XONA 4LITA 2VQLA 2UV1A 3BCBA 2L9NA 2KDOA 3HPGA 2VASA 3DLAA 1BR2A 3OIQA 3OYMA 1LVKA 2K9MA 2WAEA 4XKBA 1Y6IA 2LYCA 4XQFA 2HVSA 4XOTA 2R7RA 1UELB 2QKLB 2WA0A 4BDYA 4E7IA 2ZSIB 4F91B 2JVGA 4II2A 3ZCOA 3DTEA 1X1CA 3PNYA 3QODA 1X1DA 1WJEA 4Y3OA 4BUPA 3CJQB 2VQHA 4C2TA 5FRNA 1WJCA 1TZLA 3C2HA 3DEEA 3BLYA 3RQ4A 2VJJA 4CCKA 1ERDA 1Z7LA 2WY8Q 4NC7A 3K4JA 3PSFA 4IX7A 4PJJA 2LBFB 3H0DA 2DT6A 4LG3A 4DJAA 2F5VA 2VQCA 3AFHA 2X1EA 3C2GA 1D1AA 4XMYA 3L2UA 3SYTA 3OYEA 3HC7A 4AVZA 3L2VA 2LREA 1KONA 1BR4A 4BDZA 4RMNA 3AL0C 4ZTFA 4PJMA 3ZR8X 3VSKA 2CFOA 4CCJA 3OYKA 2DOAA 3CMMA 3LSKA 2Q2EB 1MMNA 1YX5A 3AL0B 3L2RA 4BQNA 4P1WA 2V9KA 3IUOA 4ZDOA 3E1SA 2LOOA 3OYNA 2W82A 4KT6A 4U87A 3OL3A 4EATA 2RNGA 4BE1A 2LY2A 2RQQA 3DPLC 4N4OB 4C30A 2W1OA 3H5RA 4NUBA 1Z21A 2HZDA 3E0JB 3RTRA 3D5LA 2JUGA 4BJ6C 3VYSB 3VYTB 2VL8A 3MKWB 3ZRGA 4C2UA 2V26A 1HA8A 1V5FA 3LFUA 4J01A 2Z1DA 3OYIA 1W36D 3OL4A 4PSXA 3FKJA 3OYJA 4AYBA 4BQOA 2KRHA 3K4LA 4B48A 1BR1A 4F92B 2OV7A 2AQEA 3K4BA 4B47A 2CW7A 2KHMA 1K6YA 4CH7A 2PJRA 3VWBA 1V5GA 4B3XA 2M7AA 2ZXHA 4N4NB 4CSWA 1PYVA 3G2BA 4AU7A 4HSRA 3EPZA 4QPQA 3K70C 3S3MA 2XSJC 2IXSA 2CMPA 4R79A 3HG9A 2LRDA 3GBGA 2MC4A 2JA2A 1EA3A 3I3LA 2V6EA 4E7LA 3S32A 3CESA 1D0XA 3N05A 1WJ5A 2JSPA 2VKDA 1PJRA 4HPQA 3S3NA 3OOUA 1IRXA 2KP6A 4XN3A 3KYLA 3MD2A 2R7XA 3VYUB 4PFPA 2VKHA 5KCMA 4BGDA 5TGTA 4OAYA 1YE9A 2O5RA 3U21A 2M0MA 4NC8A 2WY7Q 2X85A 2WB1A 3D5RC 2MABA 4NNJA 1WJBA 2LC2A 3CP8A 5LFAA 1UAAA 3QYBA 2ELJA 4XNFA 3CP2A 1WJAA 2Y0SA 4BU2A 3HPHA 4BEHA 4ZTJA 2RREA 4XLEA 2BVMA 1N78A 2XDVA 2E60A 3CF2A 4DGWB 4Y4RA 2R4GA 4P5OA 5HNFA 4H4KC 2VB6A 4DBQA 3OYDA 4CCNA 3BCAA 4HRIA 1X1BA 5HNHA 4XKVA 5CQEA 1G8XA 4PUSA 4C9YA 2WBMA 3HXLA 1MW7A 3PL8A 2M3AA 4ANJA 4ZC3A 1LDKB 2AQFA 2CV1A 3K4MA 3K10A 2OC6A 4II3A 1X1AA 3J7AY 3LSMA 4OAZA 1X4OA 4PJNA 4PJLA 4CCOA 2HU9A 4XLHA 2XC7A 4BQQA 1TT0A 2V1NA 3K4KA 4LIUA 2Z16A 1NG7A 4DBRA 2E1MC 3H9GA 3DQVC 4D9JA 3AKZA 3IAM2 1SAUA 1LFPA 2WADA 2WAQA 3PSIA 2BVLA 3UR3C 3SZGA 2E1MB 3LSHA 4HSTA 2W00A 2JVHA 2CV0A 2X1CA 4LIVA 2M4KA 3W2AA 2VXZA 2IS6A 3DU5A 4BE2A 1DGRM 3H9QA 4IQ4A 4KJZA 3MMYB 2F6CA 2DXIA 3HUGB 2UWMA 1MMDA 1WJDA 2X1DA 5CQGA 2KL4A 2W4SA 2CUZA 2L9SA 3LL7A 3OYBA 2R7SA 4FETA 4BJTA 4CUGA 4X0GA 1BOBA 1R6RA 2BOLA 4Y33A 4PFOA 3SEZA 2XF6A 1NG6A 1WFXA 3CJRB 4CA0A 4NQWB 4IKFA 4B43A 4B44A 2BW3B 2P0WA 5JHFA 4ZDLA 3W2VA 2VXDA 1QU3A 2LY1A 4YEJA 3DPTA 3DTIA 4ZYAA 3A4CA 2KLOA 1T95A 4F93B 3H5NA 3PNVA 4RM3A 3UNGC 1G59A 3S3OA 4J00A 2A5WA 3BG7A 3RCOA 1MMGA 2K3PA 4XOPA 3ZXSA 4BXFA 4XM3A 2V4JC 1VZ0A 3FDYA 4XORA 1N75A 4RLFA 4E7KA 2R7VA 3EUHC 2F4IA 1D0ZA 3ZQQA 2M7BA 2HVQA 3OYHA 3IAS2 2L5QA 4E6KG 4E7HA 3MKZA 2KQRA 2X6WA 2MD0A 3M1CA 2IGKA 3QYEA 3OWTA 4ITVA 3EUKL 1UG0A 2LH9A 1W36C 2MFZA 3OIPA 1P9QC 2L7KA 3DTKA 2LBFA 4CCMA 2CV2A 4ZJZA 4XKWA 4OWRB 2E5NA 3LSIA 4E7JA 2M4GA 4D1QA 1DGWY 1YX3A 2LG4A 2ZSHB 3MKYB 3HOSA 2DT7B 3OS1A 1Y56A 2K5CA 4BE0A 2X6YA 4KITB 1AA7A 3S8PA 5CPRB 4ZDPA 2VIXA 3VSLA 1V5EA 2XAUA 2V7FA 1QHGA 4XLAA 1D1BA 1OLTA 4HEA2 2CUJA 2KRCA 2HDWA 5HLTA 4YELA 2R7TA 3QYFA 2ZXIA 3OY9A 1S9HA 4HNTA 1DP3A 2HVRA 3CZ6A 2CW8A 2DJIA 3K4NA 2VJ4A 2BW3A 2IGNA 3DU6A 2IGOA 2KZVA 3L2QA 2VLAA 1Z3XA 4GRIA 2A6TA 2R7OA 1D1CA 2UUZA 3LMMA 4XLFA 2WAFA 3NWSA 4XLCA 4DOZA 2IS2A 3K4CA 3OR2C 3QOEA 1MNEA 3BG6A 2K9LA 4F52A 4HNUA 2R7WA 3ONQA 3ZGKA 3M8JA 2XF7A 1JI8A 5CKTA 4BEHB 3D5SC 4E7SA 3TMOA 3SDBA 3DWLE 3OYCA 2CH0A 3H9JA 3W2WA 3OS2A 2VQGA 3DPUA 3HOTA 3PNTA 3K70D 1WJFA 2GOMA 2L2OA 1QHHD 4JQFA 4BACA 3OYAA 2HNHA 4XKCA 4MLOA 3NWTA 1DQUA 1J09A 5LD2C 2HPIA 4CZCA 4F3QA 3OYFA 3FHNA 4XR6A 3OMYA 3KEYA 2X6XA 1FMVA 1X19A 2XF5A 3F9KA 3A2KA 2PMZA 4CCLA 4FASD 2NOJB 3HKZA 3RPUD 3H35A 5KNLA 1U0JA 3V42A 3FBIB 2VJ5A 4PK4A 5HOOA 2IS1A 3EUAA 2ZFUA 3LSGA 2R7UA 2VPLA 1ZELA 3DKXA 4BL0B 3TBIA 4E7ZA 1FMWA 3OR1C 2HPMA 3HL2A 4IZZA 3K6GA 3SEQA 4U7BA 3TL4X 4KISA 2Z2SB 2Q1ZB 3VDXA 3OS0A 1D0YA 1Z3YA 3S93A 4PSWA 2IS4A 2R7QA 3DKYA 3I9V2 3BC8A 1T0FC 1E0EA 4XL9A 2E5ZA 2VJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U21 A; 
#chains in the Genus database with same CATH topology
 2HR3 A;  4RAF A;  4A6E A;  2F4M B;  4YRV A;  1WSU A;  3RQI A;  4O5V A;  2CS3 A;  1I39 A;  4LD5 A;  5LHG A;  4BJ5 C;  2I8D A;  2GXA A;  2HDC A;  3PUB A;  1S7O A;  4XN0 A;  3FMS A;  5HVQ C;  1A36 A;  4J19 A;  1DUX C;  3OYL A;  1X4P A;  1LKX A;  3SFZ A;  2HZT A;  2HOS A;  4IHX A;  1VQ8 I;  2MW8 A;  3GEZ A;  4E4H A;  2EV5 A;  4DIQ A;  4ZYD A;  3H5A A;  2JQ7 A;  2VT3 A;  5CVJ A;  3JRB A;  4L9T A;  2DK8 A;  4RLQ A;  3G1M A;  4W1U A;  3LAP A;  2OUM A;  4QIW N;  2VI6 A;  1FIA A;  1MJA A;  4IRH A;  2A05 A;  3HUG A;  4UXN A;  3M8E A;  3DCF A;  3BCB A;  2L9N A;  1XX5 A;  3AG1 H;  1HW2 A;  1LVK A;  4Y52 J;  4EV0 A;  3I58 A;  2MH2 A;  2LYC A;  4GXO A;  4QSH A;  3V7R A;  3VFZ A;  1BL0 A;  2GM4 A;  3R0J A;  4D7M A;  4YII A;  3K7A J;  4MGR A;  2TDX A;  1ETQ A;  4KT5 C;  4ENK A;  1X1C A;  4LG0 A;  3PNY A;  3ZQL A;  1TNT A;  1X1D A;  4Y3O A;  4A5N A;  4BUP A;  2GQQ A;  5JR3 A;  4EGZ A;  4C2T A;  4OU0 A;  3C1D A;  3BLY A;  4M71 A;  3BZK A;  2WY8 Q;  1MBH A;  4NBQ A;  5J1R A;  1OIS A;  2K9Q A;  4G6Q A;  1P4W A;  3WE3 A;  3H0D A;  1KU2 A;  2DT6 A;  2IEK A;  4LG3 A;  4OMZ A;  4U7D A;  3VEP A;  1W1W E;  2CSO A;  3QP5 A;  2VQC A;  3E5Q A;  3C2G A;  3HM5 A;  4BHC A;  3H1C A;  4QTR A;  1SC7 A;  2QF7 A;  3SYT A;  1XPX A;  4AVZ A;  5J6X A;  1E3P A;  2AXT C;  2LRE A;  2P7C B;  1KON A;  1R58 A;  2BXZ A;  1IXR C;  4BDZ A;  1SAN A;  2OF7 A;  1VTN C;  2H94 A;  1E2X A;  3CCM I;  3AL0 C;  4ZTF A;  3RPQ A;  3W6J B;  2CFO A;  2ZJP F;  2O0Y A;  1Z6R A;  2DOA A;  2NVQ J;  2XPV A;  1YX5 A;  3RI4 A;  1O57 A;  1GT0 C;  4BQN A;  2V9K A;  4ZDO A;  4HF2 A;  3NQO A;  4U87 A;  2XUB A;  3BR1 A;  3BTI A;  3OL3 A;  4EAT A;  3PO3 J;  2KZG A;  2LY2 A;  1UB9 A;  4N4O B;  5D5U B;  1HBX G;  1Z91 A;  4HYE A;  4NUB A;  3BG9 A;  1Z21 A;  3C2B A;  2FQ4 A;  2X0L A;  2ZNY A;  4TV7 A;  1H8A C;  1JKQ C;  3SQN A;  5K7Z A;  4IEJ A;  3ABK H;  4C3I J;  5M3F J;  5FD5 A;  1ZN2 A;  1HA8 A;  3LFU A;  3HRU A;  2M8G X;  1W36 D;  1VQN I;  4A3G J;  3OL4 A;  3FHZ A;  3FKJ A;  2XRN A;  3K4L A;  3R6S A;  2DFE A;  2JN6 A;  1W4M A;  2NS8 A;  2NVU B;  5K7F A;  2KHM A;  1K6Y A;  3GFL A;  3VWB A;  2ZXH A;  2DA1 A;  1PYV A;  3ERE D;  4AU7 A;  4Q5S F;  1EJ9 A;  5GPA A;  3K70 C;  3BR3 A;  2XSJ C;  2CMP A;  3U1K A;  4LK0 F;  1ZAR A;  5F08 A;  3I5U A;  1MH4 A;  3I3L A;  3F23 A;  4E7L A;  3VB2 A;  1YIJ I;  3BJ6 A;  4Y17 A;  2QM3 A;  4CDG A;  2DFH A;  1PJR A;  3T8T A;  3KE2 A;  5DYM A;  3OOU A;  5GTI C;  3FIS A;  3JRG A;  3IC7 A;  1QZY A;  4PFP A;  2VKH A;  3S2H J;  3KP6 A;  5J4Y A;  4OAY A;  2O5R A;  1E17 A;  4HQE A;  3I59 B;  3U21 A;  2FX0 A;  2WY7 Q;  2L54 A;  4D0P A;  1N25 A;  2Y0M A;  1XSX A;  1HW5 A;  2HQR A;  3ROU A;  2WB1 A;  2LMD A;  3GUD A;  4NNJ A;  3FXK A;  5GAH J;  4WXC A;  1UAA A;  1BI1 A;  5C44 J;  1ZGJ A;  4JX5 A;  2B7E A;  5F64 A;  4ESJ A;  1AU7 A;  4UUV A;  3CP2 A;  4ON0 A;  4OOI A;  2VKV A;  4ZTJ A;  2PFB A;  1WVR A;  3K2A A;  2LKS A;  1KGS A;  1W7P A;  4HLX A;  4JX6 A;  5DUK A;  4FCY A;  2VN2 A;  1WZ2 A;  4DGW B;  1V4R A;  3H3U A;  5E1Z B;  3LA2 A;  2HKX A;  5JI6 A;  4A0Z A;  3G1L A;  4YFN F;  2Y69 H;  2VB6 A;  1F9N A;  2CGP A;  3SXY A;  5HDK A;  3BCA A;  3OSF A;  2EIK H;  4OMY A;  2EFN A;  2JK3 A;  3IH2 A;  2FOK A;  4C9Y A;  1E3O C;  3ZMZ A;  4RAG A;  1KZH A;  2PLY A;  3HXL A;  2M3A A;  2WV1 A;  2OJE D;  3K4M A;  3K10 A;  2OC6 A;  1K78 A;  3TGN A;  5ICC A;  3LSM A;  2P4W A;  3ABT A;  2KT0 A;  1FLI A;  2VT2 A;  3RYR A;  1X4O A;  3SDG A;  1O3Q A;  1RC9 A;  2EIN H;  1JHH A;  4AWX B;  4CCO A;  1FBU A;  1MZB A;  2HU9 A;  3PFI A;  2JPB A;  1U5T B;  2GIZ A;  4BQQ A;  2OTL I;  1X2M A;  1ENH A;  1APL C;  3ECO A;  4LLN A;  3DQV C;  3AKZ A;  1ZAO A;  4KN7 X;  5IYB J;  2P8T A;  2QSG X;  1WRJ A;  2L4M A;  4KFC A;  3SZG A;  4MEY F;  2E1M B;  3ZQH A;  3TP3 A;  4UNO A;  3ZN0 A;  1ZRE A;  1QA6 A;  3S16 J;  2E2H J;  2VXZ A;  2Y75 A;  5ED4 A;  3GX4 X;  3L9F A;  1DU0 A;  1JKO C;  4RGR A;  1FX7 A;  4KJZ A;  1LPQ A;  3HUG B;  2X48 A;  4M3E A;  4P9F A;  1BJZ A;  4YG2 F;  1WQ2 A;  5CQG A;  2QBY B;  2DA2 A;  1B4A A;  1ZKG A;  2R7S A;  4AC0 A;  3JR9 A;  4BJT A;  1IDY A;  1YOV B;  4Y33 A;  3S17 J;  2XF6 A;  1D8K A;  4IHV A;  3CJR B;  1I3A A;  4NQW B;  3Q3S A;  4B43 A;  3BTC A;  2EK5 A;  2J5O A;  2BW3 B;  1R1T A;  2P0W A;  3BR2 A;  1ZGW A;  5KAI C;  5JHF A;  2L01 A;  4B09 A;  1QU3 A;  1IC8 A;  5K1Y A;  2KLO A;  1Y8R B;  1UHM A;  3WGG A;  2CW0 F;  4HDV A;  2FF4 A;  3S3O A;  2FML A;  4LB6 B;  3REO A;  2A5W A;  2K3P A;  2Q0O A;  4XM3 A;  4M9S A;  3KCC A;  4FX0 A;  2V4J C;  1I5Z A;  4AIJ A;  2N8G A;  3EYI A;  2QLZ A;  3TW6 A;  2XKP A;  2GA1 A;  4HLY A;  2L7M P;  2O6G E;  2JA7 J;  1IRZ A;  1USS A;  3FXQ A;  1REP C;  4E6K G;  4DNC A;  3C18 A;  2X6W A;  1LFU P;  2IGK A;  4A2U A;  4G12 A;  4N0B A;  1HKT A;  1WGX A;  1W36 C;  2MFZ A;  1R49 A;  2JSC A;  1IG7 A;  1TLH B;  2L7K A;  4UVB A;  2LBF A;  4B8X A;  4CCM A;  5LRS A;  2CV2 A;  2ZME C;  4ZJZ A;  1RKW A;  5GPC A;  1TQI A;  4OWR B;  2CUE A;  3WG7 H;  1DGW Y;  1B72 B;  1W5S A;  3H0G J;  5L3F A;  1QQI A;  2ZSH B;  1D3Y A;  3RKX A;  1DDN A;  2KIQ A;  3HOS A;  2DYR H;  3ZQG A;  4D5F A;  5B66 C;  3WTT C;  3OS1 A;  1NK3 P;  1FY7 A;  3QWL A;  4ZYE A;  1XTA A;  2ICW G;  2X6Y A;  5EEH A;  5EEG A;  2O8X A;  1NH3 A;  3MQ0 A;  5IY5 H;  5HLG A;  2HI3 A;  1R00 A;  4M3D A;  2NNY A;  2XRO A;  3IRR A;  4WXH A;  5K5O A;  5CPR B;  1P7I A;  4AUX A;  1QHG A;  4XLA A;  3JW4 A;  1JUM A;  3I55 I;  2CUJ A;  1I27 A;  3QYF A;  4I2O A;  2Q8K A;  2F5E A;  1RUO A;  1R22 A;  3OY9 A;  1S9H A;  1Z0X A;  2P5K A;  2NVX J;  4HNT A;  2Z5U A;  1T38 A;  4IVN A;  1IN5 A;  3J80 K;  1D5Y A;  3IWF A;  3CC4 I;  5DTD A;  2CQK A;  1O3T A;  1IDZ A;  3K1M A;  3L09 A;  1OYI A;  4G94 A;  2W57 A;  4ESB A;  2DJI A;  4EJV A;  3V8J A;  4JYK A;  1Y39 A;  3DU6 A;  2IGN A;  2KZV A;  1AKH A;  3KZZ A;  5BPI A;  3KP4 A;  3FMR A;  2R5Y B;  3I4M J;  2DQR A;  3FK6 A;  4GRI A;  3ZMU A;  1D1C A;  3LMM A;  3ML6 A;  5FFX A;  3NWS A;  4XLC A;  1BI2 A;  3KEO A;  2GBY A;  1IAW A;  2YSR A;  1S5L C;  3BG6 A;  5EF6 A;  2R7W A;  2ID3 A;  2EFP A;  2BY1 A;  5DD8 A;  1HF0 A;  2D45 A;  2D1H A;  5IOZ A;  5F0H A;  3BZ6 A;  1A04 A;  3PUF A;  1R36 A;  2OCC H;  2XF7 A;  2BYV E;  4MFE A;  5CKT A;  3D5S C;  3LSJ A;  1MMS A;  2A69 F;  3TMO A;  5CYV A;  3SDB A;  3BT9 A;  2DTR A;  3OYC A;  4I99 C;  2ADU A;  4UB6 C;  2E71 A;  1CF7 A;  2HOT A;  3O8G A;  2GOM A;  1TTY A;  1QHH D;  5E79 C;  4RAZ A;  4BAC A;  2RVC A;  4D5C A;  1QZE A;  2HNH A;  4XKC A;  1A6I A;  1ON2 A;  3NWT A;  4EM1 A;  3FIW A;  4FT8 A;  4HV5 A;  3HOU J;  2IA1 A;  2XAG A;  5LD2 C;  1J5Y A;  2ZME A;  4L5J A;  4F3Q A;  3FHN A;  3LST A;  2DOE A;  2FOW A;  1U78 A;  5L3C A;  5IOY A;  2RDP A;  3FKI J;  2DDB A;  1FMV A;  1X19 A;  2XF5 A;  1QPM A;  2LY9 A;  3HGY A;  2PMZ A;  5LRR A;  4ENN A;  1YJN I;  2NOJ B;  3TW7 A;  2H1K A;  3RPU D;  1LEB A;  1PP8 F;  5BS6 A;  1U0J A;  2K85 A;  2VJ5 A;  2CO5 A;  3ERM A;  1L3L A;  3U1D A;  2O9L A;  2M45 A;  2DT5 A;  1FTZ A;  4OIQ F;  3FZV A;  1ZEL A;  2R7U A;  5J8C A;  4UHT A;  3DKW A;  4XRS G;  5IT9 K;  3TBI A;  2E34 A;  2LKX A;  1IN8 A;  3SEQ A;  1U9O A;  1JUS A;  4LB5 A;  4YFK F;  2O03 A;  2DOF A;  4GYI A;  3TP0 A;  3H3Z A;  3VDX A;  2MC3 A;  2YU3 A;  4BAY A;  2NRA C;  3S93 A;  5ICE A;  2XAH A;  4HF1 A;  2IS4 A;  3W6V A;  3DKY A;  1YJ9 I;  2A68 F;  3T8R A;  1YJW I;  4RS8 A;  1FEX A;  1PVE A;  3WU1 B;  1JE8 A;  2VJI A;  2XIG A;  2KPM A;  3ZQC A;  4IO9 F;  5M5Y J;  2WB1 N;  3LA7 A;  4F55 A;  4IXA A;  4G6T B;  1KU3 A;  2CQX A;  1F5T A;  4A3I J;  4QPO A;  3T5X A;  1U2W A;  4DZJ A;  3VYR B;  2W7N A;  2PI0 A;  4MTE A;  3KZI C;  3PFY A;  1R5G A;  3PIP F;  4IQJ A;  2HS5 A;  3GTJ J;  2DLL A;  1GV2 A;  4RM2 A;  3KP2 A;  5D6F A;  3HHG A;  5E1X A;  3KX2 A;  3S1Q J;  3P9C A;  2PJR B;  4DW6 A;  4C3J J;  3IP4 B;  3CD6 I;  1F1Z A;  2BHY A;  4ESF A;  1YFH A;  4LIT A;  1FYM A;  1H89 C;  2HYG D;  4U0V A;  3CQZ J;  3F8B A;  2KDO A;  4I0B A;  1B8I B;  2VAS A;  1MBF A;  2NAZ A;  2TRT A;  1HW1 A;  2K9M A;  2KJC A;  3L2C A;  2LKP A;  1VI0 A;  4LFU A;  4OIR F;  3M9A A;  4WF2 A;  2PX9 A;  1TT5 B;  1XSV A;  4F91 B;  1FBS A;  2JVG A;  4II2 A;  5E3N A;  1TWH J;  3CCE I;  1FOK A;  3QOD A;  3EDP A;  3CJQ B;  1EH6 A;  2QVO A;  5FRN A;  1WJC A;  3RQ4 A;  3G73 A;  2VJJ A;  1HSJ A;  2JUC A;  4NC7 A;  3MZH A;  3K4J A;  3PSF A;  4IX7 A;  2LBF B;  1SD4 A;  2G7U A;  4DJA A;  1G4D A;  2LNB A;  3H92 A;  5FKK A;  2PMU A;  1MJ9 A;  4KA4 A;  3SJM A;  5LLQ A;  4EVI A;  4MQ9 F;  3JRA A;  1ONV A;  5E1W A;  4MO7 A;  3KP5 A;  3HIF A;  1F43 A;  2MD5 A;  1BR4 A;  1MJB A;  2JZY A;  1FNN A;  4PCQ A;  5DEQ A;  2BBY A;  5ILU A;  5C4X J;  4MHG A;  2JMW A;  1HDD C;  3QU6 A;  2Y48 A;  4CCJ A;  1C0W A;  4PGG A;  3LSK A;  3IKT A;  5KK1 A;  1IXS B;  1R1U A;  2O8K A;  1FPQ A;  1HXD A;  1FC3 A;  4P1W A;  3OSG A;  3E1S A;  3CTA A;  3HOX J;  2IAI A;  1S72 I;  1TWF J;  1WH7 A;  2RNG A;  1EKE A;  2RQQ A;  3H5R A;  1IN7 A;  2DPU A;  1RET A;  1RR7 A;  4CXF A;  2JUG A;  4BJ6 C;  2OPT A;  4UUS B;  4O6J A;  3CUQ B;  2VL8 A;  3MKW B;  4C2U A;  4MTD A;  3ZP5 A;  2V26 A;  3DEW A;  1SVM A;  2DW4 A;  1B9N A;  1V5F A;  3ZQF A;  3DF8 A;  5DUI A;  4PSX A;  1A5J A;  5TRD A;  4FQG A;  1TWG J;  1H9T A;  2OV7 A;  2KKO A;  2P5L C;  2B0L A;  4B47 A;  1XS9 A;  1BIA A;  1MDM A;  2ZJR F;  4B3X A;  2M7A A;  1TQM A;  4UVC A;  4CSW A;  4A12 A;  4RAY A;  3G2B A;  4BHP A;  2JJ7 A;  2KJB A;  2ME0 A;  4HSR A;  3EPZ A;  1FBQ A;  3S3M A;  2QA4 I;  3MCZ A;  2LRD A;  2MC4 A;  4MIM A;  1ETO A;  4DQ2 A;  2V6E A;  1Z05 A;  2R7D A;  3CES A;  3RDI A;  3N05 A;  1WJ5 A;  2VKD A;  3F6O A;  1YHQ I;  2E1O A;  2KP6 A;  4V2F A;  5L3D A;  1ZG1 A;  2R5Z A;  3FXM A;  5KCM A;  3O6B B;  2XGX A;  3E6D A;  2F5D A;  2QUF A;  2E1N A;  4NC8 A;  3BJA A;  5HLH A;  3WTV C;  2COM A;  2PN6 A;  3W6K B;  3GTQ J;  3D5R C;  2A6E F;  3OV8 A;  4L9J A;  3GTG J;  1QPI A;  3GZN B;  2MAB A;  1WJB A;  5F6F A;  3K0L A;  1BW5 A;  2LC2 A;  1IN6 A;  5EGO B;  5IP9 J;  4FHT A;  1G3S A;  3J81 Z;  2LD5 A;  1U3E M;  2L7F P;  3U2R A;  1WKM A;  3R61 A;  3BR5 A;  3HPH A;  4BEH A;  5LHI A;  4XLE A;  2BVM A;  3RZD J;  4EM2 A;  1N78 A;  4XBF A;  3CF2 A;  3KLO A;  1VQ6 I;  3R0A A;  1VQO I;  3RKW A;  2Q2E A;  4A5M A;  4DBQ A;  4RB2 C;  4R1H A;  3PQK A;  2XGE A;  5HNH A;  4L9V A;  2FD5 A;  5CQE A;  5JHU A;  2K40 A;  5ILV A;  4PUS A;  3F21 A;  5E3O A;  1MW7 A;  4ANJ A;  3H3V K;  4ZC3 A;  2RAE A;  5HDG A;  1DP7 P;  4BXX J;  2DFF A;  2BY0 A;  5DCM B;  3QPS A;  4OAZ A;  4PJN A;  3HOZ J;  4PJL A;  1ETW A;  1W5C C;  1T39 A;  1XG1 A;  4Q48 A;  2V1N A;  3H36 A;  4LIU A;  2Z16 A;  1FWZ A;  1I1G A;  3S14 J;  3WU0 A;  4D9J A;  3B6C A;  1LDD A;  1SAU A;  5FLX Z;  1UG2 A;  2BVL A;  2Z99 A;  5EG0 B;  2V9V A;  3BZC A;  3MAJ A;  2W85 A;  4HST A;  1ZLK A;  2CV0 A;  2LF8 A;  2X1C A;  3GTK J;  1ZGA A;  2YPR A;  3TDU C;  3B6A A;  2FEZ A;  2DN0 A;  1SVO A;  3FMQ A;  1SMT A;  3DFG A;  4CIC A;  1W0T A;  2IS6 A;  4LLL A;  3DU5 A;  4M3B A;  1PUF B;  1DGR M;  4IQ4 A;  1GXQ A;  1ETX A;  2O3F A;  2R3S A;  2UWM A;  1MMD A;  2HXO A;  5HLI A;  2V9P A;  1JXS A;  2FSW A;  1GHC A;  5K5R A;  4RGS A;  2NOG A;  1YQA A;  3LL7 A;  3OYB A;  1WCM J;  2RQP A;  2M1B A;  1BOB A;  4D7N A;  2HGC A;  1WFX A;  3BOQ A;  2PMZ N;  5D5X B;  4CA0 A;  2EWN A;  3ZMV A;  2RN7 A;  4B44 A;  1U6G A;  5J3L A;  3TOB A;  4ZDL A;  2LY1 A;  3GZ5 A;  4YEJ A;  3DTI A;  4UVA A;  4ZYA A;  3U9G A;  3TO6 A;  2ZFW A;  1T95 A;  4F93 B;  1LJ9 A;  2VBW A;  3H5N A;  3QPH A;  1YS6 A;  3RCO A;  1T33 A;  4XOP A;  2DJN A;  2ME6 A;  3FDY A;  4XOR A;  1N75 A;  2ZBK A;  1JGG A;  2R7V A;  1SFU A;  1L0O C;  1UHS A;  1D0Z A;  1W5T A;  1XMA A;  2WC2 A;  3ZQQ A;  5M3M J;  4X6A J;  2QCO A;  1TNS A;  1Y1W J;  3OYH A;  3I71 A;  4LK1 F;  4E7H A;  4IHY A;  3BWG A;  2MD0 A;  2QGU A;  3M1C A;  1S6L A;  2BZT A;  3OWT A;  2D1V A;  1YW8 A;  4HAM A;  4ITV A;  4ZYG A;  2HWV A;  3DTK A;  3F8F A;  3MZY A;  1OCO H;  4UV8 A;  5E8I A;  2KDZ A;  3R4K A;  4CYC A;  3ZOB A;  2STT A;  4K2E A;  4AIK A;  2E5N A;  3AG3 H;  3LSI A;  2V6C A;  3NRV A;  4PZJ A;  4LMY A;  3V8K A;  4G7H F;  4E7J A;  3EYY A;  3GFI A;  2FU4 A;  2VBY A;  4EM0 B;  3JAM Z;  2KRF A;  2EJR A;  5M5W J;  2IT0 A;  3FXL A;  3DBR B;  1QNT A;  2GAU A;  4ENJ A;  1WWX A;  1MSF C;  2K5C A;  1PUE E;  1KYW A;  4XLN F;  4HX4 A;  3I4N J;  2R92 J;  2GXG A;  3MZ8 A;  2W24 A;  4BKX A;  5C4J J;  1UMQ A;  3S8P A;  5BNG A;  2EFO A;  4Y15 A;  1ETY A;  2DMQ A;  3FXJ A;  2E2J J;  5GTH C;  1D1B A;  2H6C A;  2H09 A;  3GXO A;  2KRC A;  2ESH A;  3RKQ A;  1QVU A;  2HDW A;  1MDM B;  1BOA A;  5HLT A;  4YEL A;  4ABZ A;  1TQP A;  2K27 A;  2ZXI A;  4BQA A;  1T2K A;  3AG4 H;  3QPT A;  5H6R A;  1NK2 P;  2V1X A;  2EFW A;  2ZO4 A;  2YS9 A;  3EQL F;  5H6Q A;  5BOX A;  3JRE A;  1R9T J;  3HRS A;  3BG5 A;  3D0S A;  1QVT A;  2Z9O A;  1SD5 A;  3WTZ A;  1K4T A;  4B3A A;  4S0H B;  5IPA A;  2ACJ A;  4LGW A;  1E3H A;  2PJP A;  5EZG A;  2L02 A;  1YYV A;  1RIO H;  4XLF A;  5IP6 A;  4L9N A;  4M6Y A;  3BP8 A;  3DEU A;  1K79 A;  3K4C A;  5CLS A;  1ACI A;  1ZRF A;  2DA4 A;  1WH5 A;  3CC7 I;  1JJ6 C;  1X3U A;  1P4A A;  5JVT A;  1YLF A;  3ONQ A;  3X2Q H;  4MNU A;  4IOC F;  1A35 A;  2LR8 A;  1Z9C A;  4BEH B;  5FGM A;  1ITY A;  4V2G A;  2EA4 A;  2DPD A;  1TP4 A;  2H27 A;  3HBL A;  2CH0 A;  3W2W A;  3J7Y J;  3OS2 A;  2BEO A;  2ZXJ A;  1XMX A;  1VQK I;  1XCB A;  3PNT A;  1WJF A;  3GO5 A;  1S7E A;  4PDK A;  4ZZL A;  2Y2Z A;  1Q1V A;  4X1E A;  4HOB A;  4GO1 A;  5FJ8 J;  4MLO A;  4AIH A;  1DQU A;  4F7Z A;  1OCC H;  1BIB A;  1J09 A;  3CF5 F;  4LG0 B;  2A61 A;  1FOY A;  4CZC A;  3OYF A;  2YX7 A;  1GV5 A;  5F1J A;  4G7Z F;  3OMY A;  2FBK A;  2P7V B;  5ERI A;  2X6X A;  2CUF A;  4I6Z A;  2FJ1 A;  2WWY A;  3LWF A;  4HA8 A;  3BRO A;  1BBY A;  2I10 A;  3H35 A;  2HOE A;  5J40 A;  3E97 A;  2VOO A;  5BMZ A;  3A01 A;  5HDN A;  3BQZ A;  9ANT A;  1K4S A;  3SZT A;  1OYY A;  2TCT A;  2ZKZ A;  5IT3 A;  1HCR A;  3IKV A;  1D8J A;  1X2N A;  2EV0 A;  4BL0 B;  4E7Z A;  1FZP B;  2HDD A;  3WOD F;  3HL2 A;  2LF7 A;  4LJZ F;  1WI9 A;  2EQR A;  2LSO A;  3HDD A;  1OFC X;  4KIS A;  4U88 A;  1DPR A;  2I5U A;  2M87 A;  3DV8 A;  5GAG J;  3OS0 A;  1SAX A;  1D0Y A;  2JT1 A;  4G8X A;  2ETH A;  3CLQ A;  1J75 A;  2R7Q A;  3I9V 2;  5D4R A;  1B9M A;  3BC8 A;  3HSE A;  1T0F C;  1OJL A;  1ZK8 A;  2L3D A;  3F0C A;  2E5Z A;  4XL9 A;  3JRI A;  1RNL A;  4JOM A;  4QLC U;  5J4V A;  1MMA A;  2H1L A;  3PJR A;  1X58 A;  3RJP A;  2X51 A;  2OTJ I;  4HG2 A;  4EEF G;  5KHD A;  2D5V A;  3I56 I;  1KQ9 A;  3BTL A;  3W3C A;  4M9X A;  2MSY A;  1ORK A;  4BS9 A;  1EH7 A;  1MD0 A;  4RDU A;  2ESN A;  2VOP A;  3A1Y A;  2JRM A;  1MND A;  4BY7 J;  3QAH A;  1VQM I;  2DCE A;  2HOA A;  1A31 A;  1OR7 C;  5AIQ A;  5FRO A;  4EMS A;  3FBN B;  2ECC A;  1GLN A;  1SFK A;  4XON A;  4BXU A;  5F1R A;  3CDH A;  2YU9 J;  2XPU A;  2E7W A;  2VQL A;  2UV1 A;  4Z6Y A;  3HPG A;  4A3C J;  1R71 A;  3DLA A;  1BR2 A;  3OYM A;  1O7L A;  4XKB A;  3CC2 I;  2ELH A;  3K1N A;  1OKR A;  2NXN B;  3KIO A;  4DZP A;  4XQF A;  2GXB A;  3LA3 A;  5BPD A;  2L9R A;  4XOT A;  2R7R A;  3DXJ F;  2QKL B;  2WA0 A;  5JLX A;  1T56 A;  5L3G A;  4BDY A;  4E7I A;  2ZSI B;  1RPW A;  2ZNZ A;  4A3K J;  3C3W A;  3ZCO A;  1ZRC A;  1WJE A;  2MH9 A;  3J7Z I;  5AIP A;  1VQ9 I;  4NC6 A;  2LP0 A;  3C2H A;  1ERD A;  4A69 C;  1Z7L A;  3E5X A;  4B1R A;  1ULY A;  2FE3 A;  3GTP J;  4PJJ A;  1FSH A;  4OIP F;  4A3F J;  1DU6 A;  2F5V A;  1IO2 A;  2X1E A;  1IV8 A;  1LE8 A;  1D1A A;  4XMY A;  3L2U A;  3FWE A;  2QQA A;  3F72 A;  3OYE A;  3HC7 A;  5KVR A;  5L3B A;  1KQ0 A;  2O7O A;  1V54 H;  4Y7N J;  1W7P B;  3P9K A;  1QO0 D;  4M73 A;  3GFM A;  4RMN A;  3RKY A;  1XDS A;  4U0Y A;  3ZR8 X;  3VSK A;  1GXP A;  1EH8 A;  4A0Y A;  3CMM A;  3AL0 B;  1YG2 A;  3L2R A;  2PMH A;  3QRF F;  3IUO A;  3OYN A;  4KT6 A;  3E6C C;  2QSH X;  1YW9 A;  4BE1 A;  4YIF A;  5B1B H;  4M6V A;  1T0F A;  2QWW A;  3E0J B;  5IYD J;  4A3M J;  3WHC A;  1J2X A;  3VYS B;  1K78 B;  3LSP A;  2RV8 A;  4WXD A;  4GCV A;  2JRT A;  1FYL A;  2DA3 A;  2E35 A;  2OZ6 A;  4IF4 A;  4L0Y B;  5DV5 A;  2HYJ A;  5H2F C;  2XSD C;  4J01 A;  3OYI A;  4QWQ A;  2MA3 A;  3OYJ A;  4AYB A;  4BQO A;  2KRH A;  4B48 A;  1BR1 A;  2P81 A;  4F92 B;  2NNN A;  3K4B A;  3A02 A;  3KP7 A;  3WGI A;  1JTY A;  2FBH A;  2CW7 A;  1ZR2 A;  5J1U A;  1B6A A;  1OR7 A;  4RGX A;  4N4N B;  3GTL J;  2DQL A;  3FX3 A;  1FP2 A;  3CO6 C;  3CCV I;  3F8N A;  1R4N B;  4L5E A;  4QPQ A;  1JHF A;  3HG9 A;  3JRD A;  1KYZ A;  1H88 C;  4EJO A;  1QZZ A;  1B1B A;  1EA3 A;  1K83 J;  2K4B A;  3S32 A;  2AO9 A;  4XRS A;  3CO7 C;  1IN4 A;  2XRL A;  1VQ7 I;  3GLX A;  1R5I D;  1P7J A;  3HJE A;  4RB1 A;  2XHK A;  3QU3 A;  1IRX A;  4XN3 A;  1J0R A;  3VYU B;  4ZH4 F;  4BGD A;  3HSF A;  3L00 A;  2M0M A;  2XKO A;  2JPC A;  4G7O F;  2A6H F;  2NS0 A;  2E36 A;  4GDF A;  2K9N A;  2LVS A;  2EIM H;  1ZRD A;  1R4M B;  2PEX A;  3C7J A;  1HLV A;  2ZJ2 A;  2FNP A;  2OA4 A;  3I0T A;  1FSE A;  3BPV A;  1EF4 A;  1NHA A;  1XB4 A;  3CP8 A;  5LFA A;  3GVA A;  1FOW A;  3QYB A;  4XNF A;  3SHF A;  2Y0S A;  4JBA A;  2RRE A;  1ZH5 A;  1OYW A;  1RRJ A;  5EJC A;  3QPL A;  2XDV A;  2E60 A;  2CQN A;  4N9I A;  2Z33 A;  4Y4R A;  2BY2 A;  2M5W A;  2R7F A;  3CUO A;  5TJJ A;  2XVC A;  4I98 B;  3N97 A;  3Q5F A;  2AS5 F;  3A01 B;  1UFM A;  4HRI A;  4I7H A;  4XKV A;  3LSR A;  1G8X A;  3RYP A;  2OCE A;  1LNW A;  3S2W A;  3IHU A;  3J81 K;  4OIN F;  2OQG A;  1YIO A;  4IHS A;  3PL8 A;  2CV1 A;  1T98 A;  2DOD A;  3WTY C;  4II3 A;  3J7A Y;  3FXO A;  5B3S H;  4WWC A;  1FTT A;  2XGD A;  5EEA A;  5IP7 J;  1H9G A;  1U5T C;  4LLG F;  3ZQI A;  3FM3 A;  4NB5 A;  3BR0 A;  2A07 F;  4MFD A;  2K7L A;  2XC7 A;  2MLG A;  4A3L J;  2IBD A;  3EET A;  4I76 A;  2YUS A;  5E3L A;  1BM9 A;  5JVG F;  3HOW J;  2BXY A;  2E1M C;  3H9G A;  2JTV A;  2JA5 J;  2X4H A;  3HZJ A;  2WAQ A;  3PSI A;  1BC7 C;  3UKG A;  4FE7 A;  2W00 A;  2JVH A;  3K69 A;  2LK2 A;  3WHB A;  1OPC A;  3G4S I;  1UHW A;  1O3R A;  3LNQ A;  5K5Q A;  2HFH A;  2MGQ A;  2LFB A;  4C2M J;  2X9D A;  2DMU A;  3WG9 A;  3ABL H;  4E70 A;  3COA C;  5EYR A;  3H9Q A;  2H8W A;  5J47 A;  5FLX K;  1T6S A;  3ASO H;  1JT0 A;  2E2I J;  2DXI A;  4CZZ A;  1XDU A;  3A03 A;  1WJD A;  2KL4 A;  2W4S A;  2FXA A;  4FE4 A;  2L9S A;  1Y8Q B;  3KFW X;  3JTH A;  2M34 A;  1PP7 U;  4FET A;  4CUG A;  5F0C A;  3CCL I;  1R23 A;  4X0G A;  2BOL A;  3Q0V A;  4PJ0 C;  1NG6 A;  2RKH A;  1J9I A;  4IKF A;  2C6Y A;  1AKH B;  3N4M A;  2GIV A;  3W2V A;  2VXD A;  3Q0U A;  3HYI A;  3DPT A;  3NAR A;  2M30 A;  1O4X A;  3GF2 A;  2HXI A;  1HKS A;  4JK1 X;  3PNV A;  4RM3 A;  1P2F A;  1ZLJ A;  2XAQ A;  2EH3 A;  2W84 A;  4J00 A;  2R7Z J;  3I64 A;  3ZXS A;  1BI0 A;  3BJO A;  3TO9 A;  2VUM J;  1GUU A;  1TBX A;  1HQC A;  3VPR A;  4RLF A;  4IPA A;  1ZHF A;  1Y0U A;  4KNY A;  2F4I A;  1Y0N A;  2CU7 A;  3IAS 2;  2L5Q A;  4HQM A;  4KIB A;  1YO5 C;  2PBI A;  3K2Z A;  5ILS A;  3MKZ A;  2KQR A;  3QYE A;  5BQT A;  1CGP A;  2IP2 A;  2FBI A;  3LQR A;  1IW7 F;  1CF7 B;  4Z2Y A;  1IGN A;  1UG0 A;  1IUF A;  2G0E A;  3OIP A;  1P9Q C;  4RBO A;  2EZH A;  3ZPL A;  3O8H A;  3Q0W A;  2M4G A;  1U5T A;  4R8H A;  5ICF A;  3RIR A;  5M5X J;  5FLV A;  2CJJ A;  2ZME B;  1LQ1 A;  4KMF A;  4CGZ A;  2HYF A;  4BBR J;  4EGY A;  1EV7 A;  4MQV A;  2OZU A;  1OMI A;  3CCJ I;  1LFB A;  2STW A;  2H8R A;  1ZYR F;  2DT7 B;  3WTU C;  4AM3 A;  4IJA A;  2P5V A;  5EDN A;  3O3K A;  2VC0 A;  5FLM J;  1SFX A;  4I0A A;  4XIC A;  3PM1 A;  3BG3 A;  2L9V A;  3VSL A;  1OCR H;  1QRY A;  2VIX A;  4KUM A;  1V5E A;  3DP7 A;  4ZDP A;  2Y9Z A;  1JJ8 C;  1X3W B;  2M8E A;  1XGN A;  4IHW A;  5LGU A;  3PQJ A;  4HEA 2;  3JAM K;  4S04 A;  1VQP I;  1FJL A;  2COB A;  2M0C A;  2R7T A;  2OBP A;  4HX8 A;  1S3J A;  2E1C A;  3GW2 A;  2VPR A;  2IRF G;  3ZMT A;  1IJW C;  2AHQ A;  3CJT B;  2QBY A;  3P9I A;  2QZ8 A;  1S7A A;  2HVR A;  5E8G A;  1GVD A;  3MEX A;  5D8K B;  2HPM A;  3LFK A;  2XGC A;  1RI7 A;  3I54 A;  3M7G A;  3A0B C;  3KYC B;  4NQW A;  1I50 J;  1ZG5 A;  3G71 I;  2BW3 A;  2IGO A;  3L2Q A;  1I1S A;  3TO7 A;  4M72 A;  2VLA A;  1B59 A;  1Z3X A;  1BW6 A;  2LDU A;  3GCM A;  1GVJ A;  1LB2 A;  4Q47 A;  2R7O A;  2Y9Y A;  1KU9 A;  5LEK A;  4M74 A;  3CCU I;  4CYD A;  3OR2 C;  3QOE A;  1IF1 A;  5H20 A;  4KDP A;  5C3E J;  3M1E A;  3LQQ A;  2WV0 A;  2KIM A;  2DI3 A;  2QQ8 A;  2FA5 A;  2HKO A;  3BPX A;  2J5P A;  4A93 J;  1JKP C;  4WCG A;  5F04 A;  5KAF C;  5A2Q Z;  1JI8 A;  3B73 A;  3M4O J;  1UCR A;  4KN4 X;  1ZQ3 P;  2VKE A;  1IRF A;  3DWL E;  2L7Z A;  2VQG A;  2ZCW A;  3DPU A;  3HOT A;  2IJL A;  1P4X A;  2L2O A;  3JSP A;  2WTE A;  4M3F A;  2CG4 A;  3RPU A;  2A3S A;  2QSF X;  2BHZ A;  2IPQ X;  5JLW A;  4HW0 A;  3MVP A;  2UZK A;  4BBS J;  3KP3 A;  1B72 A;  2KIF A;  2HPI A;  4A6D A;  1IRG A;  2XB0 X;  3VOE A;  4AYB N;  3KEY A;  3A0H C;  2FQ3 A;  3L7W A;  4GYG A;  4O3M A;  4AID A;  3JRH A;  3A2K A;  3F9K A;  4CCL A;  2JWT A;  1J59 A;  4FAS D;  3HKZ A;  2Y30 A;  2VE9 A;  3CCR I;  5KNL A;  2FMY A;  3V42 A;  3HOV J;  4ASN A;  1ON1 A;  3BDD A;  2DTZ A;  1G3Y A;  3HEF A;  2EB7 A;  2EZI A;  4PK4 A;  2NVT J;  2PQ8 A;  2IS1 A;  3SFI A;  2OD5 A;  3LSG A;  3G6E I;  2VPL A;  2CWE A;  3S2D J;  3DKX A;  1MNM C;  1XD7 A;  3K6G A;  4P55 A;  2Z3Y A;  4U7B A;  2DK5 A;  1BA5 A;  4PGH A;  2Z2S B;  1D5V A;  2ZJQ F;  4CHU A;  1S29 A;  4PSW A;  5F0F A;  2G7H A;  2OAZ A;  3V4G A;  2W48 A;  4U0W A;  1KQ8 A;  1Z6T A;  2RNJ A;  3GYH X;  5D5V B;  1E0E A;  1HST A;  4BE0 A;  5FO5 A;  1YIT I;  2HQA A;  2XAJ A;  1N77 A;  6PAX A;  2KMU A;  3S1N J;  2UXN A;  3CMA I;  3OYG A;  2BV6 A;  2R5Y A;  1F36 A;  4IHT A;  2GLO A;  4ZZD A;  3L1P A;  3DBL B;  3F8M A;  4XRM A;  4A0X A;  2Y0S N;  3NEU A;  4BNC A;  5D4S A;  2P6S A;  1SVL A;  2EBI A;  2P6T A;  3E6B A;  3MN2 A;  3T1B A;  3CCS I;  1YS7 A;  2OU2 A;  2MYS A;  5GP9 A;  2GOX B;  2IGM A;  2FUG 2;  3RSN A;  5FRM A;  4KIC A;  3MWM A;  1I3Q J;  2QKM B;  2NVY J;  4FTH A;  2LTP A;  4JX4 A;  3QQA A;  3WTW C;  3L2W A;  3WE2 A;  4A3E J;  2K86 A;  4UB8 C;  5GAE J;  1XMK A;  1BI3 A;  2BY3 A;  1W0U A;  1Z67 A;  3GZ6 A;  3OIQ A;  3LOC A;  2DDA A;  4RB0 A;  2WAE A;  1Y6I A;  1U8B A;  2XAF A;  2YX4 A;  3MFK A;  1UEL B;  4RA2 A;  5FKL A;  1Q1H A;  3S1M J;  4IOA F;  3DTE A;  3ZN1 A;  2R5Z B;  1OCP A;  3V7S A;  1JGS A;  2VQH A;  1TZL A;  4CCK A;  3DEE A;  5K7H A;  3ZMD A;  5FKO A;  2XV4 S;  4I09 A;  2EPF A;  2RGV A;  2WAQ N;  2ELK A;  4N9H A;  1CQT A;  3AFH A;  3IH3 A;  3ABU A;  3M8F A;  3V7C A;  4BY1 J;  1LVA A;  2F5F A;  3L2V A;  2VC1 A;  3OOP A;  2GA2 A;  2HEO A;  1HDP A;  1V55 H;  3HGG A;  3SZP A;  3JSO A;  3VOD A;  1BJA A;  4PJM A;  2K9S A;  3OYK A;  1FOX A;  1UZC A;  3AG2 H;  2Q2E B;  1MMN A;  2K02 A;  3WGH A;  3ESW B;  3IL2 A;  1VND A;  4CO8 A;  2LOO A;  2W82 A;  2IW5 A;  3J7A O;  4HBL A;  4WX9 A;  3DPL C;  1G6N A;  3V8L A;  3CUQ C;  4C30 A;  2W1O A;  2HZD A;  1XGM A;  3RTR A;  5J8F A;  3D5L A;  3QOP A;  3VYT B;  1HC8 A;  2F2E A;  5HOD A;  1I6X A;  3HRM A;  3DLL F;  3ZRG A;  3CDI A;  4GGG A;  4YFX F;  4HNV A;  1K6O A;  2ID6 A;  1HOM A;  4LOC A;  5D5W B;  4L18 B;  2Z1D A;  1UJ8 A;  4BYY A;  1VQL I;  3PO2 J;  3FF5 A;  5FB2 A;  1FT9 A;  3JCU C;  2L4A A;  2AQE A;  1SMY F;  1Z7U A;  4HV6 A;  4G9Y A;  2PJR A;  3G3Z A;  4CH7 A;  5GAD J;  5B5E C;  1V5G A;  2BE5 F;  5IYC J;  2K3F A;  3PIO F;  3G1O A;  2IXS A;  4R79 A;  4EJT A;  2V1D A;  2QQ9 A;  3JRF A;  1X1P A;  3GBG A;  3AAF A;  1B8I A;  4A3D J;  2HTJ A;  2JA2 A;  2O61 A;  3BTJ A;  4S05 A;  1D0X A;  5DM6 F;  1R5H A;  2JSP A;  4NDL A;  1PDN C;  4M9Z A;  3B02 A;  2HQN A;  2EA2 A;  3GFJ A;  3FXU A;  2BGC A;  4HPQ A;  3S3N A;  3CLO A;  3FK7 A;  2HVS A;  5LHH A;  3KYL A;  3MD2 A;  2R7X A;  1ODD A;  3ASN H;  4L5I A;  5TGT A;  1G3T A;  1YE9 A;  1O3S A;  1XSD A;  4RB3 C;  5HS8 A;  2XPW A;  3E5U A;  1P6R A;  2X85 A;  5DM7 F;  2DO7 A;  1LEA A;  5DS9 A;  1ETV A;  2PG4 A;  4Q4Z F;  3KZY A;  2ZXW H;  3K1P A;  4FX4 A;  2RC4 A;  4EJW A;  2QEX I;  2ELJ A;  2ZB9 A;  5CVV A;  1WJA A;  4EQQ A;  4V19 K;  4BU2 A;  4HDU A;  2OQR A;  1IXC A;  3ULQ B;  4HF0 A;  2MBF A;  4EJU A;  5E3M A;  4FIS A;  3GTO J;  1JTX A;  1V3F A;  1LDJ A;  2R4G A;  4P5O A;  3LAJ A;  5HNF A;  5LEJ A;  4H4K C;  1RR8 C;  5EZH A;  3CMY A;  3OYD A;  4CCN A;  3TED A;  4P9U A;  1X1B A;  1OCZ H;  3CME I;  4AVP A;  1TWA J;  2CQ7 A;  4L0Z B;  1LUJ B;  3MKL A;  2WBM A;  2DMN A;  2EZL A;  1LDK B;  2AQF A;  1U8R A;  1G2H A;  1YRN A;  2EV6 A;  1X1A A;  4UUS A;  3CUQ A;  2R0Q C;  1T8I A;  4XK4 A;  1QGP A;  4M3G A;  4P96 A;  3HSR A;  2M9H A;  1ZR4 A;  2K4J A;  3HRT A;  3WU2 C;  1P92 A;  3GLL A;  4KIG A;  4CYC B;  1SFE A;  1SEU A;  3F3X A;  4XLH A;  4KIF A;  1TT0 A;  2ISY A;  5FKM A;  3K4K A;  3JRC A;  1MIJ A;  2B63 J;  1NG7 A;  4DBR A;  3IH4 A;  3IAM 2;  1LFP A;  3M07 A;  1XN7 A;  1YW7 A;  2WAD A;  3OIO A;  3UR3 C;  2DA7 A;  2DA6 A;  4XSX F;  3LSH A;  2VOD A;  1AWC A;  2DBB A;  4DYR A;  4LIV A;  3JTG A;  2M4K A;  4BH9 A;  5D6E A;  1HKQ A;  2GZW A;  3HTU A;  3W2A A;  2CFX A;  2QYO A;  2Y31 A;  1XGO A;  3KEQ A;  4BE2 A;  1RZ4 A;  1MBG A;  2X6O A;  1TL8 A;  4A3J J;  3ELK A;  3MMY B;  1F4K A;  3TKY A;  1NTC A;  2F6C A;  2MG4 A;  5DCF A;  2X1D A;  2ISZ A;  2CUZ A;  3TQN A;  1ETK A;  3GTM J;  4MEX F;  1R6R A;  2EFQ A;  4PFO A;  3SEZ A;  1X3Z B;  4A3B J;  2GWR A;  3CCY A;  1JKR C;  3DBH B;  4ETS A;  1Y1V J;  1VQ4 I;  3S15 J;  1FP1 D;  3HKZ N;  5EGO A;  5LBQ A;  2AXL A;  4BHB A;  1MSE C;  2IA2 A;  2W25 A;  3FXR A;  5L3E A;  3WTX C;  3A4C A;  3F8C A;  3UNG C;  1G59 A;  1BC8 C;  2JA8 J;  3BG7 A;  5E18 F;  1MMG A;  2G9W A;  4BXF A;  1G3W A;  3GWZ A;  4NHJ A;  1POG A;  1VZ0 A;  5JFR A;  1H0M A;  4E7K A;  2JA6 J;  3EUH C;  1M1E B;  1MGT A;  2M7B A;  5J1Y A;  2HVQ A;  3BR6 A;  3IV5 A;  3F6V A;  2QEN A;  4C3H J;  1VQ5 I;  2KIU A;  4XRF A;  4HX7 A;  4IRI A;  3NAU A;  2VON A;  1XGS A;  3EUK L;  3R60 A;  3CDL A;  2LH9 A;  3ISP A;  5DCM A;  2FRH A;  2LLK A;  3M3Y J;  1MH3 A;  1WI3 A;  2DAO A;  4XKW A;  3BQY A;  4HZF A;  1UST A;  2ECB A;  1YTY A;  2F4O B;  4D1Q A;  2D2W A;  1SD7 A;  2VE8 A;  1KA8 A;  1YX3 A;  2LG4 A;  3MKY B;  2UXX A;  1MKM A;  1SD6 A;  5EG0 A;  1Y56 A;  4I01 A;  4DYQ A;  5CVI A;  1XC5 A;  3J80 Z;  3E6M A;  4KIT B;  1AA7 A;  2DFI A;  2DMP A;  1MBE A;  2DA5 A;  4UV9 A;  1SFO J;  3Q9S A;  3KET A;  1K7A A;  4H0E A;  2XAU A;  5F27 A;  2V7F A;  2DU9 A;  3FM5 A;  3WTS C;  4IL6 C;  5B1A H;  1OLT A;  1R1V A;  4YIR X;  1PUF A;  1W7P D;  3HHH A;  1S8N A;  2NYX A;  2DMT A;  4OIO F;  3IWZ A;  3ZQ7 A;  2ZC2 A;  2KFD A;  2CQQ A;  2IVM A;  1DP3 A;  2IA0 A;  1MBK A;  3Q9V A;  1YI2 I;  2V79 A;  1AOY A;  5HS9 A;  3RZO J;  2H6B A;  1TC3 C;  1RUN A;  2FNA A;  4G6D A;  3CZ6 A;  2XAS A;  2CW8 A;  5CJ9 A;  5FKN A;  3TDZ C;  2VBX A;  2B9S A;  5ICG A;  2E19 A;  3K4N A;  2VJ4 A;  3CJN A;  3KYD B;  5E20 A;  2YR2 A;  4I02 A;  2A6T A;  2UUZ A;  2WAF A;  2EIL H;  4DOZ A;  5FD6 A;  2IS2 A;  3BY6 A;  1STZ A;  1AHD P;  1GDT A;  1MNE A;  1XCV A;  1QBJ A;  3I4P A;  2K9L A;  1TWC J;  4F52 A;  1RES A;  4HNU A;  1ZG3 A;  3ECH A;  4DYC A;  3ZGK A;  2MLK A;  3M8J A;  1TW2 A;  4KYW A;  1T08 B;  2EIJ H;  1OCT C;  4JP0 A;  3EUH A;  1DPU A;  2CRG A;  3QP6 A;  4E7S A;  1U9N A;  4ZYH A;  2XB5 A;  4WK8 F;  1VF9 A;  3O2P E;  4XID A;  4B4C A;  3H9J A;  3HTS B;  3E7L A;  1MBJ A;  1JT6 A;  4UUT A;  1WHU A;  3I59 A;  3E3V A;  3K9T A;  3K70 D;  3P5J A;  3T0Y A;  1Z1D A;  4JQF A;  1IV6 A;  1O7F A;  1FYK A;  3OYA A;  3KLN A;  5IT9 Z;  5A2Q K;  2NS7 A;  1Z77 A;  3GME A;  2F48 A;  3HB9 A;  3HOY J;  2V1U A;  1YRN B;  2R93 J;  4XR6 A;  1IUY A;  1I6H J;  4GFB A;  4XSZ F;  1JUP A;  2HTS A;  1A6Q A;  4RGU A;  3F22 A;  1IZ1 A;  1K61 A;  1OQY A;  2EZK A;  3FBI B;  1BN5 A;  2A5Y B;  3ZMS A;  5HOO A;  2CYY A;  2M2E A;  5CVU A;  1LE8 B;  2KIS A;  5DD4 A;  4UY8 I;  3EUA A;  2ZFU A;  1FIP A;  3P7N A;  3TOA A;  5LGT A;  3CCQ I;  2HQ5 A;  1R7J A;  1FMW A;  3OR1 C;  4KMU X;  2E7X A;  2L0K A;  2DYS H;  2VBZ A;  5FFZ A;  5HS7 A;  5DDG A;  2QQB A;  5D8L B;  4IZZ A;  3TL4 X;  3I53 A;  1ZTR A;  3KPH A;  4Y13 A;  3S1R J;  5E17 F;  2Q1Z B;  5AON A;  1WPK A;  4XLP F;  5TIS C;  4IRG A;  4AD9 A;  1RKT A;  1Z3Y A;  1VFC A;  5LGN A;  1KU7 A;  3IRQ A;  3ABM H;  2F5C A;  4W97 A;  5CVR A;  4M6X A;  3D1N I;  1TW3 A;  1J7K A;  4ENM A; 
#chains in the Genus database with same CATH homology
 2KPM A;  2HQA A;  1N77 A;  4JOM A;  4YRV A;  2KMU A;  1MMA A;  2CS3 A;  4F55 A;  3PJR A;  2X51 A;  4G6T B;  3OYG A;  4HG2 A;  5KHD A;  4BJ5 C;  2I8D A;  4QPO A;  3W3C A;  4BS9 A;  3PUB A;  4XN0 A;  3VYR B;  2W7N A;  5HVQ C;  3A1Y A;  3OYL A;  1X4P A;  1LKX A;  1MND A;  3PFY A;  4IQJ A;  2DCE A;  4E4H A;  4RM2 A;  2MYS A;  1OR7 C;  3KX2 A;  5FRO A;  3H5A A;  2GOX B;  2IGM A;  3FBN B;  4DIQ A;  2FUG 2;  3RSN A;  5FRM A;  2PJR B;  4RLQ A;  2QKM B;  3IP4 B;  1GLN A;  3L2W A;  1SFK A;  2OUM A;  4XON A;  4LIT A;  2VQL A;  2UV1 A;  3BCB A;  2L9N A;  2KDO A;  3HPG A;  2VAS A;  3DLA A;  1BR2 A;  3OIQ A;  3OYM A;  1LVK A;  2K9M A;  2WAE A;  4XKB A;  1Y6I A;  2LYC A;  4XQF A;  2HVS A;  4XOT A;  2R7R A;  1UEL B;  2QKL B;  2WA0 A;  4BDY A;  4E7I A;  2ZSI B;  4F91 B;  2JVG A;  4II2 A;  3ZCO A;  3DTE A;  1X1C A;  3PNY A;  3QOD A;  1X1D A;  1WJE A;  4Y3O A;  4BUP A;  3CJQ B;  2VQH A;  4C2T A;  5FRN A;  1WJC A;  1TZL A;  3C2H A;  3DEE A;  3BLY A;  3RQ4 A;  2VJJ A;  4CCK A;  1ERD A;  1Z7L A;  2WY8 Q;  4NC7 A;  3K4J A;  3PSF A;  4IX7 A;  4PJJ A;  2LBF B;  3H0D A;  2DT6 A;  4LG3 A;  4DJA A;  2F5V A;  2VQC A;  3AFH A;  2X1E A;  3C2G A;  1D1A A;  4XMY A;  3L2U A;  3SYT A;  3OYE A;  3HC7 A;  4AVZ A;  3L2V A;  2LRE A;  1KON A;  1BR4 A;  4BDZ A;  4RMN A;  3AL0 C;  4ZTF A;  4PJM A;  3ZR8 X;  3VSK A;  2CFO A;  4CCJ A;  3OYK A;  2DOA A;  3CMM A;  3LSK A;  2Q2E B;  1MMN A;  1YX5 A;  3AL0 B;  3L2R A;  4BQN A;  4P1W A;  2V9K A;  3IUO A;  4ZDO A;  3E1S A;  2LOO A;  3OYN A;  2W82 A;  4KT6 A;  4U87 A;  3OL3 A;  4EAT A;  2RNG A;  4BE1 A;  2LY2 A;  2RQQ A;  3DPL C;  4N4O B;  4C30 A;  2W1O A;  3H5R A;  4NUB A;  1Z21 A;  2HZD A;  3E0J B;  3RTR A;  3D5L A;  2JUG A;  4BJ6 C;  3VYS B;  3VYT B;  2VL8 A;  3MKW B;  3ZRG A;  4C2U A;  2V26 A;  1HA8 A;  1V5F A;  3LFU A;  4J01 A;  2Z1D A;  3OYI A;  1W36 D;  3OL4 A;  4PSX A;  3FKJ A;  3OYJ A;  4AYB A;  4BQO A;  2KRH A;  3K4L A;  4B48 A;  1BR1 A;  4F92 B;  2OV7 A;  2AQE A;  3K4B A;  4B47 A;  2CW7 A;  2KHM A;  1K6Y A;  4CH7 A;  2PJR A;  3VWB A;  1V5G A;  4B3X A;  2M7A A;  2ZXH A;  4N4N B;  4CSW A;  1PYV A;  3G2B A;  4AU7 A;  4HSR A;  3EPZ A;  4QPQ A;  3K70 C;  3S3M A;  2XSJ C;  2IXS A;  2CMP A;  4R79 A;  3HG9 A;  2LRD A;  3GBG A;  2MC4 A;  2JA2 A;  1EA3 A;  3I3L A;  2V6E A;  4E7L A;  3S32 A;  3CES A;  1D0X A;  3N05 A;  1WJ5 A;  2JSP A;  2VKD A;  1PJR A;  4HPQ A;  3S3N A;  3OOU A;  1IRX A;  2KP6 A;  4XN3 A;  3KYL A;  3MD2 A;  2R7X A;  3VYU B;  4PFP A;  2VKH A;  5KCM A;  4BGD A;  5TGT A;  4OAY A;  1YE9 A;  2O5R A;  3U21 A;  2M0M A;  4NC8 A;  2WY7 Q;  2X85 A;  2WB1 A;  3D5R C;  2MAB A;  4NNJ A;  1WJB A;  2LC2 A;  3CP8 A;  5LFA A;  1UAA A;  3QYB A;  2ELJ A;  4XNF A;  3CP2 A;  1WJA A;  2Y0S A;  4BU2 A;  3HPH A;  4BEH A;  4ZTJ A;  2RRE A;  4XLE A;  2BVM A;  1N78 A;  2XDV A;  2E60 A;  3CF2 A;  4DGW B;  4Y4R A;  2R4G A;  4P5O A;  5HNF A;  4H4K C;  2VB6 A;  4DBQ A;  3OYD A;  4CCN A;  3BCA A;  4HRI A;  1X1B A;  5HNH A;  4XKV A;  5CQE A;  1G8X A;  4PUS A;  4C9Y A;  2WBM A;  3HXL A;  1MW7 A;  3PL8 A;  2M3A A;  4ANJ A;  4ZC3 A;  1LDK B;  2AQF A;  2CV1 A;  3K4M A;  3K10 A;  2OC6 A;  4II3 A;  1X1A A;  3J7A Y;  3LSM A;  4OAZ A;  1X4O A;  4PJN A;  4PJL A;  4CCO A;  2HU9 A;  4XLH A;  2XC7 A;  4BQQ A;  1TT0 A;  2V1N A;  3K4K A;  4LIU A;  2Z16 A;  1NG7 A;  4DBR A;  2E1M C;  3H9G A;  3DQV C;  4D9J A;  3AKZ A;  3IAM 2;  1SAU A;  1LFP A;  2WAD A;  2WAQ A;  3PSI A;  2BVL A;  3UR3 C;  3SZG A;  2E1M B;  3LSH A;  4HST A;  2W00 A;  2JVH A;  2CV0 A;  2X1C A;  4LIV A;  2M4K A;  3W2A A;  2VXZ A;  2IS6 A;  3DU5 A;  4BE2 A;  1DGR M;  3H9Q A;  4IQ4 A;  4KJZ A;  3MMY B;  2F6C A;  2DXI A;  3HUG B;  2UWM A;  1MMD A;  1WJD A;  2X1D A;  5CQG A;  2KL4 A;  2W4S A;  2CUZ A;  2L9S A;  3LL7 A;  3OYB A;  2R7S A;  4FET A;  4BJT A;  4CUG A;  4X0G A;  1BOB A;  1R6R A;  2BOL A;  4Y33 A;  4PFO A;  3SEZ A;  2XF6 A;  1NG6 A;  1WFX A;  3CJR B;  4CA0 A;  4NQW B;  4IKF A;  4B43 A;  4B44 A;  2BW3 B;  2P0W A;  5JHF A;  4ZDL A;  3W2V A;  2VXD A;  1QU3 A;  2LY1 A;  4YEJ A;  3DPT A;  3DTI A;  4ZYA A;  3A4C A;  2KLO A;  1T95 A;  4F93 B;  3H5N A;  3PNV A;  4RM3 A;  3UNG C;  1G59 A;  3S3O A;  4J00 A;  2A5W A;  3BG7 A;  3RCO A;  1MMG A;  2K3P A;  4XOP A;  3ZXS A;  4BXF A;  4XM3 A;  2V4J C;  1VZ0 A;  3FDY A;  4XOR A;  1N75 A;  4RLF A;  4E7K A;  2R7V A;  3EUH C;  2F4I A;  1D0Z A;  3ZQQ A;  2M7B A;  2HVQ A;  3OYH A;  3IAS 2;  2L5Q A;  4E6K G;  4E7H A;  3MKZ A;  2KQR A;  2X6W A;  2MD0 A;  3M1C A;  2IGK A;  3QYE A;  3OWT A;  4ITV A;  3EUK L;  1UG0 A;  2LH9 A;  1W36 C;  2MFZ A;  3OIP A;  1P9Q C;  2L7K A;  3DTK A;  2LBF A;  4CCM A;  2CV2 A;  4ZJZ A;  4XKW A;  4OWR B;  2E5N A;  3LSI A;  4E7J A;  2M4G A;  4D1Q A;  1DGW Y;  1YX3 A;  2LG4 A;  2ZSH B;  3MKY B;  3HOS A;  2DT7 B;  3OS1 A;  1Y56 A;  2K5C A;  4BE0 A;  2X6Y A;  4KIT B;  1AA7 A;  3S8P A;  5CPR B;  4ZDP A;  2VIX A;  3VSL A;  1V5E A;  2XAU A;  2V7F A;  1QHG A;  4XLA A;  1D1B A;  1OLT A;  4HEA 2;  2CUJ A;  2KRC A;  2HDW A;  5HLT A;  4YEL A;  2R7T A;  3QYF A;  2ZXI A;  3OY9 A;  1S9H A;  4HNT A;  1DP3 A;  2HVR A;  3CZ6 A;  2CW8 A;  2DJI A;  3K4N A;  2VJ4 A;  2BW3 A;  2IGN A;  3DU6 A;  2IGO A;  2KZV A;  3L2Q A;  2VLA A;  1Z3X A;  4GRI A;  2A6T A;  2R7O A;  1D1C A;  2UUZ A;  3LMM A;  4XLF A;  2WAF A;  3NWS A;  4XLC A;  4DOZ A;  2IS2 A;  3K4C A;  3OR2 C;  3QOE A;  1MNE A;  3BG6 A;  2K9L A;  4F52 A;  4HNU A;  2R7W A;  3ONQ A;  3ZGK A;  3M8J A;  2XF7 A;  1JI8 A;  5CKT A;  4BEH B;  3D5S C;  4E7S A;  3TMO A;  3SDB A;  3DWL E;  3OYC A;  2CH0 A;  3H9J A;  3W2W A;  3OS2 A;  2VQG A;  3DPU A;  3HOT A;  3PNT A;  3K70 D;  1WJF A;  2GOM A;  2L2O A;  1QHH D;  4JQF A;  4BAC A;  3OYA A;  2HNH A;  4XKC A;  4MLO A;  3NWT A;  1DQU A;  1J09 A;  5LD2 C;  2HPI A;  4CZC A;  4F3Q A;  3OYF A;  3FHN A;  4XR6 A;  3OMY A;  3KEY A;  2X6X A;  1FMV A;  1X19 A;  2XF5 A;  3F9K A;  3A2K A;  2PMZ A;  4CCL A;  4FAS D;  2NOJ B;  3HKZ A;  3RPU D;  3H35 A;  5KNL A;  1U0J A;  3V42 A;  3FBI B;  2VJ5 A;  4PK4 A;  5HOO A;  2IS1 A;  3EUA A;  2ZFU A;  3LSG A;  2R7U A;  2VPL A;  1ZEL A;  3DKX A;  4BL0 B;  3TBI A;  4E7Z A;  1FMW A;  3OR1 C;  2HPM A;  3HL2 A;  4IZZ A;  3K6G A;  3SEQ A;  4U7B A;  3TL4 X;  4KIS A;  2Z2S B;  2Q1Z B;  3VDX A;  3OS0 A;  1D0Y A;  1Z3Y A;  3S93 A;  4PSW A;  2IS4 A;  2R7Q A;  3DKY A;  3I9V 2;  3BC8 A;  1T0F C;  1E0E A;  4XL9 A;  2E5Z A;  2VJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...