3U21A

Crystal structure of a fragment of nuclear factor related to kappa-b-binding protein (residues 370-495) (nfrkb) from homo sapiens at 2.18 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
104
Chain Sequence
b'INEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFETQQWLLGDNEELAALFQLWLETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear factor related to kappa-B-binding protein
publication title Structure of a Novel Winged-Helix Like Domain from Human NFRKB Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation, dna binding
total genus 31
structure length 104
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14465 NFRKB_winged NFRKB Winged Helix-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3u21A00
3U21A
chains in the Genus database with same CATH superfamily
2OBPA 4U0WA 3RKYA 1MKMA 3Q9SA 2I10A 3WODF 3BPVA 4E7KA 1JUPA 4PK4A 2LH9A 2R7TA 1Y8QB 1ZR4A 2D5VA 2H8WA 2IJLA 1ZG3A 2H27A 3R61A 3LWFA 2CUFA 4PUSA 3B6CA 4HV5A 2NYXA 4E7LA 1GLNA 2DODA 2JVGA 1ZR2A 4W1UA 1Y6IA 4ENMA 2RQQA 2KDZA 2F5CA 2XGCA 3BPXA 4XRSG 3BT9A 1RETA 2PJRB 4RAYA 3FDYA 2ZJPF 4OINF 1X1CA 2WA0A 3HSRA 5CQGA 2EFQA 3M9AA 1YYVA 2COBA 3IWZA 1IAWA 2JRTA 1PYVA 2IA1A 4DYCA 4Y4RA 1MNEA 1IUFA 3V42A 3FXMA 2R7XA 3QPTA 2NVUB 5IP7J 2XAJA 3BOQA 1WFXA 3QOPA 3CCYA 4I09A 1VQ8I 2LF8A 4OIOF 1FT9A 2EIJH 2VJIA 3CC4I 2KIMA 4CXFA 2MLGA 4E7ZA 3EYYA 2HKXA 2DQLA 3OYAA 3CCLI 3ECOA 4HQMA 2E2HJ 1V4RA 5E1ZB 4LFUA 2PQ8A 1G59A 3DEUA 5BPIA 1JGGA 2XAGA 4HG2A 3NEUA 5C44J 2ZMEC 1ETQA 2L9NA 4NC6A 1H9GA 2EZLA 1V55H 3G1MA 3KX2A 2HDCA 1ZTRA 3KYDB 4A3LJ 2XF5A 2A5WA 1IRGA 4C2MJ 2OTLI 4LIUA 5EF6A 5DCMA 2WAQN 2H6BA 3KYCB 3DQVC 1QPMA 4WXHA 4M6YA 5LRRA 2IS1A 5JR3A 2KL4A 5K5OA 3I5UA 2W25A 3A02A 3LSPA 3I9V2 4V2GA 2QSFX 4ZTFA 1YS6A 1M1EB 4A69C 3MKLA 2DFEA 1LE8B 4CUGA 2QWWA 2ZKZA 1TTYA 1VQPI 2VOPA 5K5QA 2LBFB 2ZNZA 1A6QA 1I39A 3ZQLA 4PJ0C 2D45A 2OA4A 1YTYA 2VBWA 1V5GA 4HSTA 3HDDA 4PCQA 1V54H 4EMSA 4HSRA 1RNLA 1X2MA 2UUZA 3GMEA 1QHGA 5FRNA 4BJTA 1DGWY 3DLAA 4O3MA 3FMQA 2K85A 4N9IA 3I55I 1ZK8A 1I27A 4N0BA 1VQ5I 2W57A 2A05A 4F93B 4HQEA 2MC4A 3GLXA 1MSEC 2DLLA 3BJAA 1VQ7I 2XPWA 3OOPA 3DFGA 1ZLKA 2JA8J 4IXAA 2QKLB 2X48A 2E5NA 1HOMA 2X6YA 3R60A 2R7SA 2NOGA 2FXAA 2LMDA 3E7LA 3GBGA 4IHWA 4XKVA 1W5CC 3R6SA 2BBYA 4ZYHA 3EETA 1B9MA 4P5OA 1V5FA 1OQYA 1LNWA 2XSJC 5GAGJ 3PUFA 5LGNA 1I1GA 1ZGAA 3BDDA 2JVHA 1Y39A 2GXGA 3DKWA 3F8NA 4H4KC 3PIPF 1CF7A 3W2AA 2FRHA 3K2AA 3DKXA 5L3EA 4NUBA 3S3OA 1ON1A 2LNBA 4HV6A 3OS2A 1KQ8A 1UHMA 4B48A 1U9OA 5C3EJ 2HKOA 2L5QA 5E8IA 3K70D 2A07F 2EFWA 1FEXA 5HDGA 3ZMUA 3WGHA 2GA1A 2DCEA 1HXDA 1FSEA 4BXFA 3MQ0A 3O2PE 1BA5A 1E0EA 1B8IB 4IKFA 4KT5C 5FKMA 4NC7A 4DZJA 1T98A 2HOSA 2Q2EA 1XMKA 3H5AA 4IJAA 1APLC 4OAZA 1PDNC 3LSKA 1AOYA 3LSGA 4IHSA 1SAXA 1HC8A 2LY9A 2QM3A 4A0YA 2IAIA 1O3RA 4HEA2 4LJZF 1FOWA 2QQAA 4XLEA 1QVTA 1UJ8A 3HOXJ 3GLLA 4L5IA 2V7FA 5H6RA 2R7RA 1XGNA 2A5YB 2K3PA 4G9YA 3J80K 3GCMA 2UZKA 2Q1ZB 1OCPA 4EJVA 2BHYA 1R23A 1U0JA 3CJQB 3CC7I 1RUNA 3F21A 1JJ6C 1WPKA 2PX9A 5J1YA 4LB5A 1FOKA 3SZGA 3ML6A 5K7HA 2WADA 3I4PA 4IL6C 2WB1A 3KP2A 2HNHA 1W5TA 1FJLA 5F6FA 2Y0MA 4II2A 5CPRB 1YG2A 4HDUA 1X2NA 4JOMA 4PGGA 4BQOA 1I1SA 5E8GA 1X1PA 2LREA 1KYZA 4L5EA 1CQTA 3TP0A 1NHAA 1JXSA 4DGWB 1HW2A 1R6RA 2DAOA 3ERMA 1Q1HA 1RIOH 2W7NA 3TKYA 1T8IA 2QVOA 3HOVJ 1ON2A 2RKHA 1BR4A 5DV5A 1T6SA 3SZTA 1K78A 3ZCOA 1ZRFA 3DP7A 3TMOA 3HKZA 3FXOA 1OCOH 1JI8A 3HOYJ 1J9IA 2CJJA 3BG3A 4XLNF 1S9HA 4F52A 1MBKA 1R58A 3RPUA 1P4AA 1IZ1A 2M0MA 2FJ1A 4XRSA 2GXBA 2LSOA 1VQNI 1RKWA 4G12A 2XGXA 5J47A 4QPOA 3M8JA 4ZZLA 1WQ2A 2WV1A 2YUSA 2HYGD 3CD6I 3RKWA 1D8JA 3L2UA 1DPRA 2ZMEB 3SYTA 5ICCA 4MIMA 3BY6A 3CMAI 3MZYA 2JTVA 1Z77A 2PN6A 1VFCA 4U7DA 2KZVA 2XB5A 4C2TA 2FUG2 2EV0A 2W24A 4M3DA 1MMGA 3SQNA 4YIRX 4OIRF 5FO5A 3SZPA 2K5CA 2HDWA 4HA8A 1OR7C 1QHHD 3GTLJ 2HOAA 5L3DA 4BACA 2XRLA 1MW7A 1POGA 1BM9A 4XLCA 3E6BA 2CQ7A 2V1DA 4EJOA 3SFIA 2NVYJ 3WGIA 1MBGA 2A68F 2FX0A 2XAUA 4H0EA 4I76A 1YJWI 2HGCA 1MMAA 3V7RA 2CW8A 2PI0A 3H3UA 4U7BA 3EPZA 4CICA 3F3XA 3IWFA 3U9GA 3K4LA 4P9UA 2M34A 1FMVA 2P5LC 3WTTC 3VODA 2K86A 2R7DA 1D8KA 5JFRA 1XPXA 4IQJA 3LFUA 2E2IJ 5IP9J 5F0HA 3JRCA 2E19A 2VQCA 4EJTA 3LQRA 4GXOA 2XGDA 1YX5A 2HQAA 1O57A 2HPIA 2Y0SN 3MEXA 1XGOA 1TWAJ 3EUHA 2ZBKA 3M07A 4CYCB 1GHCA 4LD5A 4AU7A 2EILH 3I3LA 3R0JA 2RQPA 4AUXA 5DS9A 3BZKA 2YU3A 1QVUA 4B43A 2CV1A 3GZ5A 4QPQA 1BIBA 2RDPA 3N4MA 5HDNA 1D1AA 3K0LA 3LAPA 2DQRA 2HVQA 2O9LA 1BOBA 2NNYA 1TW2A 2OQRA 5GADJ 1Y1VJ 4HNUA 2ZJ2A 3AG3H 1Z3YA 3L2CA 1W5SA 4NC8A 3KETA 2IA0A 3B02A 3FIWA 1IN5A 3LA2A 2COMA 1RR8C 1HDDC 4YRVA 4R1HA 2JK3A 3RZDJ 2DMTA 3VOEA 5B5EC 1OFCX 1GUUA 2MBFA 4L9TA 4ZYGA 2HZTA 3K4BA 3BQZA 2BEOA 1LDKB 4KICA 3P9KA 4JP0A 5TISC 2OC6A 4G6DA 4KFCA 3EQLF 2STWA 4IQ4A 5DD8A 2OUMA 2M7BA 3JREA 1J5YA 3M8FA 2FU4A 3RPUD 4ETSA 2FEZA 4IPAA 1ULYA 1EF4A 2X1DA 2XDVA 2YX4A 3E6DA 3BR2A 2QBYA 3SEQA 3GVAA 4XONA 4ESBA 4YG2F 1TT0A 5IT9K 4DOZA 1MMNA 4D0PA 2EBIA 3MZ8A 3OR1C 2HEOA 1XC5A 5J6XA 1ZYRF 1ZELA 2IS2A 2L7FP 4FQGA 3LA3A 2BYVE 3L09A 5GPAA 4YEJA 3CJRB 1SD7A 2M3AA 5J4YA 2DDAA 5FGMA 2M9HA 3S1NJ 3E5QA 1YITI 4EGZA 1R4MB 2DPUA 2F5DA 4LLLA 3J7ZI 3ONQA 1SMTA 5B1BH 3OY9A 4KNYA 3ZMVA 4FCYA 4FETA 1UELB 2BVMA 1EKEA 1Z6TA 2FBIA 3QP5A 3J80Z 2K7LA 2KZGA 2EZIA 3V8KA 3E6MA 2ZNYA 4ZC3A 5LHGA 1IGNA 2NOJB 1AKHA 3RCOA 5ILVA 3G3ZA 3OIQA 2A69F 1IDYA 4OMZA 3WE2A 4CGZA 4IO9F 1Z7LA 1RKTA 4BUPA 4NQWB 4U88A 1IUYA 2EFOA 2OZUA 1G6NA 2IGNA 2LKSA 1AU7A 5HS9A 1FZPB 3BROA 3OYJA 4A3DJ 4E7IA 4IOAF 2J5OA 1SFXA 1X19A 1FBQA 4A6EA 2Z33A 1U8RA 3PO3J 3HPGA 5HVQC 2VLAA 2ZSIB 1XMXA 2LFBA 2VB6A 2M8EA 1TWFJ 5D5WB 1T0FA 3U1KA 1FOYA 2W82A 1DDNA 4IRGA 2M4KA 2OU2A 5HLGA 3OL4A 2GOMA 3O8HA 3QPHA 1GVJA 1B6AA 4WXDA 2FOKA 1IN8A 2NVTJ 3W2VA 2IS4A 2OPTA 2P4WA 2XAQA 3H92A 3QPSA 1FYKA 1P9QC 4S05A 3SDGA 4PDKA 3NWTA 1NK2P 3C2HA 1TT5B 3ELKA 1QZEA 2NAZA 2EZKA 4GYGA 4HW0A 3IL2A 2KRFA 3DPTA 3HBLA 4BL0B 5GTIC 1OISA 1XN7A 2FQ3A 2MH9A 1K6YA 3M7GA 3BWGA 1IXCA 1NH3A 3FXLA 4XSZF 2G7HA 1UG0A 2K4JA 2QZ8A 2D2WA 3F8FA 3HRUA 5JLWA 3S1MJ 1YW8A 2A3SA 2V26A 5IPAA 3OYNA 3SXYA 3Q9VA 2DMUA 4WXCA 5F0FA 2NVQJ 1W36D 2VKDA 4FX4A 4HDVA 4M9XA 1WJ5A 1XDSA 3ROUA 1STZA 1B9NA 3IH4A 2ELKA 1N25A 2EV6A 1HBXG 1L0OC 4U0VA 4PJJA 1MIJA 3HB9A 3J7YJ 1R5ID 3DEWA 3TW7A 3WTVC 4ABZA 5DM6F 3CDLA 1U78A 1HCRA 3A0HC 2OAZA 1T38A 3G1LA 3OSGA 4M73A 5J1RA 1V3FA 5JVGF 2DOAA 3OYBA 2H8RA 3L2RA 1W0UA 1I5ZA 5JVTA 3TGNA 2LG4A 2ZXIA 2VE9A 2WBMA 4XOPA 3TBIA 4IRIA 3HG9A 2CYYA 2X6WA 5FKKA 3GYHX 4IX7A 4KDPA 2X0LA 1S8NA 1H0MA 4XN3A 4BXUA 2JUCA 4S0HB 5JLXA 4EATA 1G8XA 4BE0A 2KPMA 1ZHFA 2FA5A 3K4MA 4RM3A 5L3GA 3QYFA 1ETWA 2P0WA 5ICFA 4Y7NJ 2H1KA 1JKRC 1LE8A 3V7SA 1WVRA 3JAMZ 1AA7A 3GTPJ 5F27A 2A61A 2G7UA 4UV8A 2YU9J 1S7OA 2CW7A 2LF7A 3FBNB 2M30A 4BH9A 2PLYA 2LVSA 1JJ8C 4BE1A 2DMNA 1P92A 3BCBA 1OKRA 5BS6A 3CF5F 4A5NA 3CC2I 1WRJA 3WTXC 2KIFA 1K61A 1S7EA 4ITVA 2R5ZB 1R71A 3CP2A 1PUFB 5AONA 1FTTA 4XKCA 2BW3B 3ZQ7A 2VT3A 4G7ZF 5DM7F 1XTAA 3CZ6A 2IGOA 5E3MA 5J8FA 3KEQA 5FLMJ 1K79A 1EH7A 2W1OA 1HQCA 3TQNA 2M8GX 3OL3A 2K27A 5DCFA 2WWYA 1Q1VA 2V9VA 5HS8A 1YFHA 3S14J 1WCMJ 2RGVA 3IUOA 3C1DA 4I2OA 1XGSA 3OYCA 3H3ZA 3HEFA 2KQRA 3BZ6A 3MZHA 2OJED 4EGYA 2L7ZA 1SVLA 3FXRA 3FX3A 2EFPA 1LFPA 1K4SA 2LKPA 2VJ5A 1PJRA 2VC1A 3HRMA 3I4MJ 3P9IA 4I0BA 2YSRA 4L9VA 4F3QA 1D1BA 1KU7A 3CMEI 2H6CA 3OS1A 2DO7A 1GT0C 1OJLA 4Q47A 4G7HF 1B72B 3G4SI 1MH4A 4M72A 4MQVA 1MDMB 4MGRA 2G9WA 5DUIA 1B8IA 3GFJA 1HKQA 4BHCA 1USTA 4UUVA 4U87A 2JUGA 5IYBJ 2KKOA 2MW8A 2VASA 3FXQA 4MTEA 1G2HA 3Q5FA 1MZBA 3T5XA 4C2UA 3DPUA 1O3TA 3S2HJ 3P9CA 4A12A 3FBIB 3KZYA 4A3JJ 3CCMI 2R7UA 1HLVA 2DPDA 2PG4A 5IYDJ 4A5MA 5FB2A 1AWCA 3PL8A 4KYWA 4IF4A 3IRQA 3A2KA 3MAJA 3TEDA 2VQHA 1IN7A 1TNSA 2E60A 5LD2C 1XD7A 3FMRA 1KGSA 4P96A 2HR3A 2B63J 1WJCA 1ODDA 3BR1A 5FLVA 4KN4X 1MNDA 1GV2A 3K10A 2B0LA 5ERIA 3T8TA 1D1CA 3FKIJ 2JSPA 1XCBA 3PFYA 4M9SA 4EVIA 2R7ZJ 2JZYA 2OCEA 2KLOA 5F0CA 2QA4I 4ENNA 1LJ9A 5FJ8J 3OYIA 2RV8A 4BDYA 3N05A 2HYFA 5KHDA 2HTJA 5EZGA 4B44A 5KK1A 3JRHA 2RREA 2D1VA 1XSVA 4L0ZB 3OSFA 2VONA 5EEAA 4E7HA 3EUAA 4A93J 2CMPA 5IY5H 2M4GA 4RB2C 1IRXA 1I3AA 3FF5A 2DTRA 1ZQ3P 1K7AA 3K4NA 5K5RA 4ZYEA 1VZ0A 2R0QC 5TRDA 3HOWJ 2FMYA 4HNTA 3G6EI 3M1CA 5HNHA 4ENKA 1N75A 2LLKA 2JQ7A 1RRJA 2R4GA 3PO2J 4JX5A 3WU2C 2P6TA 3OYFA 2EV5A 3CCUI 1MBHA 3BTCA 5DEQA 1V5EA 4CCKA 2HZDA 2JPCA 3OWTA 1A36A 3V8LA 1E2XA 4UUSA 1R1TA 2QF7A 1EH8A 2MG4A 2ZMEA 3LSHA 3V4GA 4HNVA 2JWTA 3SEZA 3LSJA 4XRFA 4CCNA 5LFAA 2ELHA 1X1AA 3KFWX 3DTKA 5LGUA 2DA4A 3QODA 1RZ4A 3C2GA 3JRGA 4AWXB 2V6CA 1R7JA 1E3OC 3DEEA 2KIQA 3NAUA 2P7VB 4L5JA 3F8BA 5DTDA 1LEBA 4LK1F 4OOIA 3F72A 5D8KB 1WH7A 1YS7A 4KMUX 4RLFA 3RI4A 2FQ4A 4LOCA 4J00A 4OAYA 1XS9A 2DA5A 2DT6A 5J4VA 2AQEA 4YIFA 1YOVB 1K6OA 1SD5A 2EJRA 2V4JC 3IRRA 2DOEA 4AD9A 3I59B 1FWZA 1NG6A 2OQGA 4XKWA 3VDXA 3WU0A 1BR1A 2QLZA 4LG0A 3CCRI 1YW9A 5EJCA 1JT0A 3QYEA 2DFFA 4YIIA 3R4KA 2BY0A 2F4OB 1O4XA 1JKQC 1BJAA 2L0KA 3HGYA 2HWVA 5ICGA 5CLSA 1MSFC 3MKWB 3R0AA 2FE3A 3BTLA 2VT2A 1FYLA 5A2QK 3ABUA 1MBEA 1O3QA 4W97A 1A6IA 2AO9A 1F36A 4CYCA 2ZC2A 4I0AA 4MNUA 4XLFA 5C4JJ 2VKVA 4QLCU 4YFNF 5FLXK 3LSRA 5H6QA 3H0GJ 3H5NA 2W4SA 4XOTA 1FP1D 2RN7A 1PUEE 3J81Z 3QOEA 3AG1H 2IGKA 2K40A 3CUQC 1G3TA 1I6XA 4UV9A 3U1DA 4CHUA 3AL0C 4DIQA 2QGUA 4FT8A 2LOOA 1EJ9A 2VOOA 2ESHA 2QSHX 3CMYA 5B3SH 1Y0UA 2EIKH 3WG9A 3KP3A 3LQQA 3MKYB 3HRTA 3HOZJ 2EQRA 3OYLA 4A6DA 3CMMA 3WTWC 2HXIA 2R7VA 3DF8A 1YHQI 4KIBA 3VYRB 5E3NA 2KIUA 5J3LA 2BXYA 3V7CA 3HUGB 1BR2A 2HQNA 1X3WB 2HQRA 2AHQA 5BPDA 4KT6A 2A6HF 4BE2A 2LD5A 1S7AA 1VF9A 3LA7A 1X3ZB 2Y9YA 4G6TB 2VC0A 5CVVA 2BZTA 1R4NB 2PEXA 2IPQX 4OWRB 4A2UA 2LC2A 2JN6A 3IAS2 1R36A 4BQQA 4E7JA 1HW1A 3A01B 2NXNB 1TP4A 5IOZA 1OCTC 5GAEJ 2VN2A 1ZGWA 3ZN0A 1XMAA 3FXKA 3VFZA 4RGSA 1X1BA 4IRHA 3ZXSA 2YPRA 3H35A 1BC8C 3QQAA 2HOTA 1LQ1A 2F5EA 2IGMA 1BL0A 5IOYA 1HKSA 3OIOA 3J7AY 1RI7A 4HRIA 3C2BA 3ZN1A 3S1RJ 2HPMA 3HOUJ 1D0XA 2ZXJA 2XRNA 1H9TA 2DOFA 1E3HA 5LEKA 3SFZA 5FFXA 4BY7J 3DLLF 4XICA 3HYIA 2QSGX 2PJPA 2ICWG 3G71I 4XORA 3CTAA 3BC8A 5JI6A 4AVZA 1TL8A 2NS8A 3I71A 3KP5A 4NQWA 2UWMA 3W6VA 2Z99A 4I6ZA 1X58A 1CGPA 5ICEA 4BS9A 3IH3A 1USSA 1YJNI 1JUSA 2VPRA 2E1CA 4Z6YA 1UG2A 1P4WA 3EUHC 2L7MP 3SDBA 5EGOB 3ASNH 1YI2I 1G4DA 3TW6A 4A3BJ 1K83J 2VJJA 3BR6A 4JX6A 3F6VA 2PFBA 3MMYB 1I6HJ 2P81A 1L3LA 2QYOA 3IHUA 5KVRA 3IH2A 2DA3A 3RQIA 4IOCF 2DTZA 4XM3A 2XPUA 1FNNA 2YR2A 2DA6A 2Z3YA 3ZQHA 2ID3A 4LGWA 4CO8A 5F08A 3OIPA 4OIPF 2N8GA 4HX7A 1UMQA 4CZCA 4HX4A 1O7FA 3IKVA 2KDOA 1VQOI 1SFKA 4O6JA 4X6AJ 3DCFA 1W7PB 3BR0A 2DW4A 4IHTA 2MFZA 1J59A 2F5VA 1DGRM 3GTKJ 2WB1N 3LNQA 1UZCA 1Z21A 2B9SA 2RC4A 3MVPA 2HVSA 5E3LA 3BCAA 2D1HA 2GOXB 1YIJI 4XIDA 4DYQA 2PMZA 1SAUA 5LHHA 1R1UA 4UVAA 3GFMA 4UXNA 1YQAA 4LG3A 4HLXA 3N97A 2Z1DA 5M5XJ 2R3SA 1HSJA 5F04A 3O8GA 3ZMSA 1VNDA 2OCCH 4CCOA 5J40A 5D6EA 4CDGA 5LBQA 2Q0OA 3X2QH 2JA7J 2JA2A 2ZCWA 1EH6A 4ESFA 4D7MA 1TQPA 4DBRA 4UVCA 3HKZN 5IP6A 1F5TA 1MMDA 3DTIA 1LDJA 2V1NA 2CS3A 4EM0B 2KT0A 1SFUA 2P8TA 3ABMH 2ID6A 3CUQB 2FNAA 3NRVA 4BEHB 3PM1A 5DYMA 2MGQA 1KONA 5E1XA 4Y15A 3UNGC 4FTHA 1GXQA 2K9MA 2R7OA 1SANA 5A2QZ 2E2JJ 1IO2A 3BG5A 4G8XA 1LFUP 2IP2A 3LOCA 2Y75A 3KP4A 1ZGJA 3OV8A 1SVMA 3HOSA 5LEJA 5E3OA 4D1QA 1B4AA 2GA2A 5GTHC 1ZG5A 1J09A 4S04A 3HIFA 2Y9ZA 2B7EA 3HL2A 1J75A 2A6EF 2ZFUA 3GFLA 4B8XA 3CCSI 3F0CA 3K1MA 2M87A 4BJ5C 2CQQA 2V9KA 4BGDA 5E17F 4MFEA 5E20A 2Y30A 2Y69H 1WGXA 3FM5A 3ESWB 3IAM2 1Z05A 4EEFG 6PAXA 2CH0A 1ZG1A 4KISA 2QUFA 2XV4S 3JRBA 3VWBA 4MQ9F 2R5ZA 1XCVA 5EG0A 5F1JA 4QTRA 4AYBA 1SVOA 2VE8A 2Z9OA 1IW7F 5K7FA 2L01A 4N4NB 2VBXA 2QENA 5M5WJ 3QU3A 2VJ4A 3FK7A 4D7NA 4AIJA 3H3VK 3PSIA 1OYYA 1P4XA 1H89C 2QKMB 2HTSA 1SD4A 2L2OA 5HS7A 3K4KA 2FSWA 1XB4A 1XG1A 3MCZA 3JSOA 2R7FA 3FM3A 1OCZH 3HRSA 4GYIA 1JE8A 1IXSB 1RESA 2BY3A 3A03A 4HF2A 4XNFA 1I3QJ 3QYBA 3MFKA 2DU9A 1VQ4I 3P5JA 2MH2A 3H9JA 2TDXA 5IT3A 3OS0A 3GTJJ 1BI1A 2RAEA 4Q5SF 2KRCA 1QNTA 2LR8A 2VQLA 3RJPA 2KP6A 3GF2A 1JKOC 1KU2A 4B3AA 3NQOA 1P6RA 1ZRDA 3M3YJ 2LDUA 1D0YA 1B72A 1BJZA 1YRNB 1VI0A 1MDMA 4A3CJ 2E36A 2X9DA 1ORKA 2Z2SB 4F92B 4P1WA 5LGTA 1W0TA 4YFKF 1ZARA 2PMZN 2KJBA 2LKXA 4TV7A 4ZYAA 3CLOA 3NARA 2O61A 2X1EA 1QA6A 1N78A 2NNNA 1S29A 4PFPA 4EJUA 2O8KA 3VPRA 2XIGA 3U2RA 3Q3SA 2PJRA 1SD6A 3F23A 3F8CA 5BMZA 3ZQCA 1B1BA 3RYRA 1WH5A 2DA1A 1OCRH 5HOOA 1EV7A 1W1WE 3ZMDA 1HDPA 4MFDA 4BDZA 3K4JA 1DU6A 3CLQA 1X1DA 4LLGF 5C4XJ 3GXOA 5JHUA 2MA3A 4IZZA 3HOTA 4PFOA 3FZVA 3HHGA 4PSXA 3ZQFA 1U5TC 4PJNA 3KZZA 5B66C 2KRHA 1T39A 2VQGA 3D5LA 3GWZA 2WY8Q 4WWCA 4CCLA 4AIKA 2ETHA 2EK5A 1MJ9A 1Z67A 4WF2A 3CJTB 2CSOA 3FHNA 3GUDA 5AIPA 1A35A 4F7ZA 2EA2A 3PNVA 4G7OF 3LMMA 2ZFWA 3DBRB 4XLAA 1XDUA 1IJWC 3WE3A 1BI3A 3B73A 2R5YB 5KCMA 4XR6A 1WJAA 1KA8A 4CA0A 1X3UA 3K2ZA 3C18A 1MJBA 1R5GA 3DV8A 3E1SA 3WGGA 3Q0WA 1FBUA 1KZHA 3UR3C 2M0CA 2LBFA 2X6XA 3HTUA 4G94A 4GO1A 1OYIA 3PUBA 4PZJA 4RGXA 4B4CA 3H0DA 4HZFA 2XAHA 3DU6A 4DW6A 1BC7C 5M3FJ 3GW2A 1O7LA 4AYBN 2XASA 3PNYA 3OYGA 4GDFA 2HXOA 2EA4A 3D0SA 2DFIA 2FNPA 4A0ZA 1U8BA 4XK4A 1R1VA 2JJ7A 3GTMJ 2DA2A 5E79C 3JW4A 3GZNB 1IG7A 3CCVI 2XAFA 2CFOA 3ABKH 3D5RC 2H1LA 2LY1A 2WAQA 1NG7A 4I99C 4KIGA 3WHCA 4AM3A 1LB2A 2E1MC 2CGPA 4WCGA 1Y1WJ 4UY8I 1R22A 3JTGA 2JA6J 2DBBA 1FX7A 5LLQA 2MC3A 4ESJA 3CQZJ 3C7JA 1FIAA 1JGSA 3ABTA 3TO7A 3CCQI 1OCCH 4A3FJ 2P7CB 2V1XA 3CDHA 3DXJF 4UVBA 1ZREA 3U21A 3HZJA 3FHZA 5IT9Z 1ETKA 3RQ4A 2HQ5A 5L3CA 1QQIA 1R9TJ 4C3JJ 2MYSA 3JRFA 2O3FA 3ABLH 2UXXA 2KMUA 1O3SA 1U9NA 3KEYA 1XGMA 5K1YA 3AFHA 2JPBA 2X6OA 1BIAA 3MKZA 1FYMA 2BVLA 1VQLI 2MLKA 3BP8A 3K70C 4RS8A 3L00A 3JRDA 2ECCA 2JRMA 3P7NA 1QZZA 1MNMC 2JMWA 2MABA 5ED4A 2WAFA 4BJ6C 2HI3A 2XC7A 4B3XA 1LVKA 4P55A 2DYSH 3ZP5A 4XRMA 3S8PA 3HXLA 4DYRA 5L3BA 1LKXA 2DK5A 4NNJA 4P9FA 3T8RA 2O0YA 1RUOA 2M7AA 3ZRGA 3CP8A 4D9JA 3W3CA 1VQ6I 9ANTA 4MO7A 5GP9A 2X1CA 3OYMA 3H9GA 5BOXA 5HLIA 3CCEI 4EQQA 4BQNA 1U3EM 3ZOBA 3LFKA 4B47A 1MBFA 2A6TA 2ZSHB 2M45A 4WX9A 3TO9A 3WTSC 5DD4A 3G1OA 4DQ2A 1WI3A 2VKHA 4ANJA 1QBJA 3S2DJ 1WWXA 4ZYDA 5CJ9A 1P7JA 3JR9A 1D0ZA 4KA4A 2ISZA 1IN6A 1JHFA 2QCOA 1REPC 4XQFA 4RDUA 3E5UA 2V1UA 5ILUA 2XVCA 1VTNC 2X4HA 1Z0XA 2LY2A 2ZJQF 3CESA 5J8CA 1YJ9I 3DBLB 2AXTC 3KZIC 4DBQA 1WJFA 5FKLA 4CSWA 3CO7C 2ACJA 1JT6A 3HUGA 5KAIC 1E3PA 5CQEA 3OOUA 1Z91A 1GVDA 1QPIA 4GCVA 4EJWA 2FBKA 1C0WA 4M74A 4MEXF 4MLOA 1T95A 4ZDLA 4E7SA 2BV6A 3RIRA 3I64A 3GFIA 1PP8F 4WK8F 4HAMA 2WY7Q 4G6QA 3A01A 2OD5A 2V9PA 4YFXF 1KQ0A 4I01A 3ZPLA 3FXJA 4ZDOA 1U5TB 2BHZA 2DYRH 4E6KG 2DDBA 3S93A 3IKTA 2ME6A 2V6EA 4DZPA 3K7AJ 3KCCA 2L02A 3K9TA 1R49A 2LRDA 1D3YA 3KYLA 3UKGA 3O6BB 3RZOJ 1GV5A 2OV7A 1FP2A 2K9SA 4IEJA 4LITA 1DP7P 4CCMA 1LEAA 2EB7A 3GEZA 4UNOA 3F9KA 4IVNA 3KP7A 2DMQA 1KQ9A 1FY7A 1FBSA 5HLHA 2AS5F 5D4RA 2M2EA 5M5YJ 3K6GA 1R00A 3DWLE 3AKZA 2DI3A 2E5ZA 1IDZA 1WKMA 2CQKA 1HSTA 4A3EJ 1FSHA 1G3WA 2O6GE 2CWEA 1Z3XA 3RTRA 2K02A 4I98B 4RB1A 2PBIA 3SJMA 1UHWA 3FMSA 1VQ9I 2AQFA 2VUMJ 2P5KA 1P7IA 1Z6RA 4OU0A 2LTPA 4BU2A 5CVJA 2R93J 2L4MA 4EV0A 4A3KJ 5JHFA 4KJZA 2CQNA 2EH3A 1JTXA 5EGOA 1ETYA 1P2FA 2O5RA 5IYCJ 2GM4A 2V79A 1WI9A 2VODA 2QQBA 1MGTA 2JSCA 1ZAOA 1GDTA 2ZJRF 1T08B 2E1MB 1LVAA 1ZRCA 1D5VA 1DPUA 4BKXA 3JCUC 2EWNA 4BNCA 3TDZC 1JKPC 3KLOA 3VYUB 4CCJA 3ZMTA 2M5WA 4HF1A 3L9FA 2DN0A 3V8JA 3W6JB 5FKOA 1G3YA 1TZLA 2XROA 3TOBA 2QEXI 4BHBA 2F4MB 1QO0D 1W7PA 1UHSA 2KHMA 1LFBA 2JT1A 4YELA 2XHKA 3BTJA 4JK1X 3T0YA 3FKJA 3H36A 3BLYA 2P5VA 3QU6A 1MD0A 3PFIA 2EIMH 4B1RA 1UAAA 4XBFA 3FK6A 4L0YB 3JSPA 2O03A 3RKXA 4B09A 4KITB 3EYIA 4PGHA 2AXLA 2GBYA 2Y0SA 4N9HA 4Z2YA 2VPLA 1RR7A 1WZ2A 1J7KA 2HU9A 3M4OJ 4L18B 3F6OA 4C3IJ 2K9LA 5J1UA 3D5SC 3M1EA 5D5UB 4ZJZA 4BBSJ 4E4HA 2HYJA 1IF1A 3LL7A 2NRAC 4XKBA 3BZCA 1A31A 3L7WA 3I56I 3OYHA 1T33A 3L1PA 2I8DA 2W85A 3DTEA 4HX8A 4C3HJ 3GTGJ 2L7KA 3CUQA 3OYDA 3KPHA 4M6XA 1I50J 2L9VA 4F91B 1XX5A 4BEHA 4Y3OA 2HFHA 4NBQA 2R7QA 2XB0X 4HOBA 3I53A 4HBLA 3M8EA 4OIQF 2VKEA 3PJRA 2LP0A 4L9JA 3ZQIA 4FHTA 2EFNA 2W48A 4HYEA 2M1BA 1IN4A 4M3BA 4II3A 1DU0A 2FF4A 2MSYA 3IP4B 5DCMB 3F22A 1TWGJ 1ZKGA 3F8MA 4PSWA 5DUKA 2G0EA 2R92J 1MBJA 3J7AO 1PVEA 4N4OB 1D5YA 2BOLA 3FXUA 2DMPA 3BG7A 2Y2ZA 4Y17A 4JQFA 4JYKA 3JRAA 2O8XA 1MJAA 3WTZA 1X4PA 5EDNA 3ISPA 2ZXWH 1YE9A 5CYVA 4RB3C 3E97A 4BQAA 2DK8A 3GTOJ 2GWRA 2UV1A 4O5VA 1S5LC 3AG2H 4D5CA 1G3SA 4UUSB 3E6CC 3DBHB 3TDUC 3W6KB 2OZ6A 2WAEA 4ZH4F 3VYSB 1HKTA 1LDDA 3QAHA 4Q4ZF 1WJEA 2YS9A 2XSDC 2TRTA 2OF7A 3S32A 3IV5A 4JBAA 4MTDA 3BTIA 3KLNA 3L2VA 2FOWA 4AIHA 1LPQA 4LIVA 2E35A 3PNTA 3BQYA 4RAZA 1TQIA 1AHDP 1TWCJ 2CUZA 2DFHA 4UB6C 4NDLA 3HGGA 3HC7A 1BW5A 1KU3A 3A0BC 4R8HA 3G73A 1W7PD 1SEUA 2HDDA 5EEGA 3WU1B 4GFBA 1OR7A 2ESNA 4EM2A 3COAC 2DT7B 1CF7B 3JTHA 5TGTA 4LG0B 1Y0NA 1NTCA 4PJMA 3H1CA 5FROA 5EEHA 1TWHJ 1YRNA 2WV0A 1F1ZA 3GX4X 3HHHA 4K2EA 3HSFA 3HM5A 2CUJA 4XN0A 5CVUA 2IRFG 1E17A 3ZQQA 5HODA 2L54A 3MD2A 1S3JA 2CFXA 4DJAA 4A0XA 2KFDA 2Q2EB 3BG6A 3BG9A 4C9YA 4AC0A 1A04A 3CDIA 1UFMA 2W84A 3KIOA 2ECBA 4KN7X 4F55A 1W36C 5D4SA 4D5FA 4XMYA 1S72I 2GLOA 2VL8A 3JAMK 1FPQA 3DPLC 1MH3A 3I4NJ 2CQXA 3Q0VA 2E71A 5CVRA 3E0JB 1ETOA 2XKPA 5BQTA 2QQ9A 3K69A 2KISA 2E1OA 4ON0A 3WHBA 3CCJI 1QU3A 1XSXA 1WHUA 5KNLA 4AVPA 4FISA 1Z9CA 1DP3A 4IHYA 3E3VA 1MMSA 3AL0B 2K9QA 3S15J 3SHFA 1ITYA 4QSHA 1JTYA 3ERED 3S16J 1YIOA 1BW6A 3Q0UA 2IW5A 2PMHA 4GRIA 5KAFC 2F4IA 3GO5A 1SMYF 4IHVA 2IVMA 1KU9A 2ZXHA 2R5YA 4XL9A 1TBXA 2L9RA 2CV0A 3GZ6A 2YX7A 1F4KA 4M71A 4M3GA 5FLXZ 1TQMA 1QGPA 1WJDA 3ECHA 3HTSB 3C3WA 1K78B 3PIOF 3OYEA 2ZB9A 1BBYA 4XLPF 5CVIA 1QRYA 2EZHA 2CUEA 4FE7A 4A3GJ 2CV2A 1N77A 2E1NA 3WTUC 4RGRA 2VXZA 4EM1A 2J5PA 4BAYA 2O7OA 1PP7U 2CU7A 3PQJA 3HSEA 2ZO4A 2OTJI 5E18F 4RMNA 1S6LA 3VSLA 3BJ6A 3H9QA 4FX0A 1BN5A 4X0GA 1GXPA 3TO6A 1PUFA 5ILSA 2WTEA 1H8AC 3I58A 2BW3A 2XPVA 1DUXC 4RB0A 3S1QJ 5F64A 1FC3A 4FE4A 4V19K 3KP6A 1VQMI 1T0FC 4KIFA 3KEOA 3S17J 4RGUA 4Y13A 2C6YA 1F9NA 2K3FA 3K4CA 3S3MA 2XUBA 4I7HA 3RSNA 3QRFF 5GPCA 1HW5A 2VI6A 2DXIA 3A1YA 1WJBA 3D1NI 1ETXA 2E7XA 4KUMA 2IT0A 1TNTA 2Y31A 2K9NA 4JX4A 3BR5A 3ZR8X 3HJEA 3AAFA 1IV6A 5FD6A 1OYWA 1LUJB 3CUOA 5FKNA 2IA2A 4M3FA 1KYWA 1VQKI 2CW0F 5D5VB 4GGGA 2BE5F 4HF0A 4AIDA 3HPHA 4OMYA 5LRSA 5TJJA 1OLTA 4ZZDA 1IC8A 1ETVA 3RPQA 2XF7A 2IXSA 2VBYA 2BY2A 1SFOJ 1BI0A 3MN2A 2CRGA 3OMYA 1H88C 1HF0A 1JHHA 5H20A 4BHPA 4CZZA 4BY1J 2I5UA 2ADUA 4PJLA 2P6SA 3TL4X 2K4BA 5FFZA 2JA5J 3L2WA 2DJIA 1K4TA 5DDGA 4NB5A 4UUTA 2RNJA 3WG7H 3NWSA 3ZGKA 3EDPA 1BOAA 3BR3A 1Z1DA 4DNCA 2XF6A 2FBHA 2FD5A 1WSUA 2L3DA 2W00A 4QWQA 4X1EA 1X4OA 3K1NA 1J0RA 3BJOA 3VB2A 4A3IJ 5GAHJ 1R5HA 3KE2A 1F43A 1YO5C 4ASNA 4LB6B 2IBDA 4KMFA 4E70A 5D6FA 2GIZA 4Q48A 3ZMZA 3K1PA 4Y33A 3QP6A 2F5FA 3O3KA 3FWEA 4QIWN 3H5RA 3OYKA 3TP3A 2TCTA 3B6AA 2BY1A 3VYTB 1OMIA 3T1BA 2CO5A 4L9NA 3LSTA 2VBZA 2ISYA 4RA2A 1IXRC 1YLFA 1Y8RB 3LSIA 1RC9A 3PQKA 3W2WA 2NVXJ 3DU5A 1ENHA 4BBRJ 1IRFA 1IRZA 4I02A 3L2QA 2UXNA 3LAJA 1TLHB 2VXDA 2QBYB 2Q8KA 2EPFA 3AG4H 3GTQJ 1SFEA 3CJNA 3QPLA 5AIQA 1B59A 4RLQA 2MD0A 1HA8A 1ZLJA 2L9SA 2MD5A 2WC2A 1UB9A 2Z16A 5D8LB 2R7WA 3EUKL 1YW7A 2STTA 4BYYA 5LHIA 1ZN2A 2DT5A 2H94A 2ELJA 2LK2A 4CH7A 1YX3A 4HLYA 4U0YA 1EA3A 2X51A 5D5XB 2L4AA 4A3MJ 4UHTA 3FISA 2DA7A 2E7WA 2E34A 2KJCA 1U5TA 4BXXJ 1T56A 5E1WA 4XLHA 3OR2C 3CO6C 4ZDPA 5M3MJ 1FTZA 2HOEA 5HLTA 1NK3P 1ONVA 3WTYC 4HPQA 5FD5A 1TC3C 2DJNA 1U6GA 5B1AH 5CKTA 4R79A 4LMYA 2GAUA 1W4MA 1SC7A 4C30A 1IV8A 1FIPA 3A4CA 2BGCA 2QQ8A 1BI2A 1RPWA 5H2FC 5L3FA 4FASD 4UB8C 1XSDA 5EZHA 3RYPA 1UCRA 2BXZA 4M3EA 4RAFA 4LLNA 3TOAA 1AKHB 3ZQGA 4J01A 2XGEA 2NS0A 3DKYA 2Z5UA 3IC7A 2Y48A 1FMWA 2F48A 1QZYA 3ASOH 2GQQA 3S2WA 2CG4A 1J2XA 4RAGA 3J81K 5EG0B 4XSXF 5K7ZA 3RKQA 2IS6A 3LSMA 4CYDA 1ERDA 1JUMA 3VEPA 3MWMA 3JRIA 5F1RA 3VSKA 4M9ZA 2IEKA 3I54A 2EINH 4M6VA 4RM2A 4MEYF 1Z7UA 2HS5A 4RBOA 1OPCA 3I59A 1FOXA 2GIVA 3G2BA 3QWLA 2VIXA 2X85A 3CF2A 2RNGA 3I0TA 2NS7A 1TW3A 1DQUA 3E5XA 3PSFA 2F2EA 2H09A 2GZWA 2F6CA 4NHJA 1ZH5A 1A5JA 4ENJA 3RDIA 2PMUA 5FRMA 4LK0F 3ULQB 4IHXA 2ME0A 1FLIA 5HNFA 2LYCA 4Y52J 2FMLA 3S3NA 2GXAA 4J19A 5HDKA 5EYRA 3REOA 2XKOA 1T2KA 1U2WA 1ACIA 2HVRA 2RVCA 4MHGA 4ZTJA 4V2FA 1Y56A 5BNGA
chains in the Genus database with same CATH topology
1P9QC 3OIPA 3NWTA 1TZLA 3C2HA 4E7KA 4PK4A 2LH9A 4CZCA 2R7TA 2KDOA 1SFKA 3DPTA 4BL0B 4PUSA 2MFZA 2F5VA 2KHMA 1DGRM 1K6YA 4E7LA 4YELA 1GLNA 1UG0A 2JVGA 3FKJA 3BLYA 1Z21A 2HVSA 1Y6IA 2RQQA 3BCAA 2V26A 3OYNA 2GOXB 1UAAA 2PMZA 1W36D 2VKDA 4KITB 2PJRB 1SAUA 3FDYA 2Y0SA 2VPLA 1X1CA 1WJ5A 2WA0A 5CQGA 4LG3A 2Z1DA 2HU9A 4CCOA 1PYVA 4Y4RA 2K9LA 1MNEA 3V42A 2R7XA 4PJJA 3D5SC 2JA2A 4ZJZA 4E4HA 1WFXA 4DBRA 3LL7A 1MMDA 3DTIA 4XKBA 2VJIA 2V1NA 3OYHA 4E7ZA 2CS3A 2I8DA 3DTEA 3OYAA 2DOAA 3OYBA 2L7KA 3OYDA 3L2RA 4F91B 4BEHA 4BEHB 4Y3OA 1G59A 2LG4A 1KONA 2R7QA 2ZXIA 4HG2A 2WBMA 4XOPA 3TBIA 2K9MA 2R7OA 3UNGC 2L9NA 2X6WA 3HG9A 4IX7A 3KX2A 3PJRA 2XF5A 2A5WA 4XN3A 4LIUA 4II3A 3IP4B 3DQVC 4PSWA 4EATA 3HOSA 1G8XA 2IS1A 2KL4A 4D1QA 4BE0A 2KPMA 3K4MA 3I9V2 4N4OB 4RM3A 1J09A 2BOLA 3QYFA 4ZTFA 2P0WA 3HL2A 3BG7A 4CUGA 2ZFUA 4JQFA 4BJ5C 1AA7A 2V9KA 4BGDA 2LBFB 2CW7A 3IAM2 3FBNB 1X4PA 2CH0A 4BE1A 4KISA 3BCBA 1YE9A 4HSTA 1V5GA 4HSRA 2UUZA 2UV1A 1QHGA 3VWBA 4ITVA 3CP2A 5FRNA 4BJTA 4XKCA 2BW3B 1DGWY 3DLAA 4AYBA 2WAEA 3VYSB 1WJEA 3CZ6A 2IGOA 4N4NB 4F93B 2MC4A 2VJ4A 3S32A 3PSIA 2W1OA 3OL3A 2QKLB 3L2VA 2QKMB 2E5NA 2L2OA 2X6YA 2R7SA 3K4KA 4LIVA 3IUOA 3GBGA 3PNTA 4XKVA 3OYCA 2CUZA 4P5OA 3HC7A 2KQRA 4XNFA 1V5FA 3QYBA 2XSJC 1LFPA 2JVHA 2VJ5A 3H9JA 4H4KC 1PJRA 3OS0A 3W2AA 2DT7B 2KRCA 3DKXA 2VQLA 4NUBA 5TGTA 3S3OA 2KP6A 4F3QA 3OS2A 1D1BA 4B48A 2L5QA 4PJMA 3K70D 3OS1A 1D0YA 5FROA 2DCEA 2Z2SB 4BXFA 4F92B 4P1WA 1E0EA 4IKFA 2CUJA 4NC7A 4XN0A 4ZYAA 3ZQQA 2X1EA 1N78A 4U87A 2JUGA 3MD2A 2VASA 4PFPA 4DJAA 2Q2EB 3H5AA 3BG6A 4C2UA 4OAZA 3DPUA 3LSKA 3LSGA 3FBIB 2R7UA 4HEA2 4C9YA 4XLEA 2PJRA 3PL8A 4F55A 2V7FA 1W36C 4XMYA 2R7RA 2VL8A 3A2KA 5HOOA 2K3PA 2VQHA 3DPLC 2E60A 5LD2C 2Q1ZB 4BDZA 3K4JA 1X1DA 1U0JA 3CJQB 1WJCA 3E0JB 4IZZA 1MNDA 3K10A 3HOTA 4PFOA 1D1CA 2JSPA 3PFYA 4PSXA 3SZGA 4PJNA 1QU3A 5KNLA 2KRHA 2KLOA 2VQGA 2WADA 3D5LA 2WY8Q 2WB1A 4CCLA 2HNHA 1DP3A 3OYIA 4BDYA 4II2A 5CPRB 3N05A 3AL0B 3FHNA 5KHDA 4JOMA 4BQOA 4B44A 2LREA 3PNVA 3LMMA 4XLAA 4GRIA 4DGWB 2F4IA 2RREA 1R6RA 2ZXHA 5KCMA 4XL9A 2W7NA 2CV0A 4XR6A 1WJAA 4E7HA 3EUAA 2CMPA 4CA0A 2M4GA 1WJDA 1BR4A 1IRXA 3OYEA 3ZCOA 3K4NA 1VZ0A 3E1SA 3TMOA 3HKZA 3UR3C 2CV2A 1N77A 1JI8A 4HNTA 3M1CA 2LBFA 2X6XA 5HNHA 2VXZA 1N75A 3PUBA 3H0DA 1S9HA 4F52A 2R4GA 3DU6A 3OYGA 3OYFA 3PNYA 2M0MA 1V5EA 4CCKA 2HZDA 3M8JA 4QPOA 4RMNA 3VSLA 3OWTA 3H9QA 4X0GA 3L2UA 2BW3A 3LSHA 2CFOA 3SYTA 3D5RC 3SEZA 5LFAA 1T0FC 2LY1A 1NG7A 2WAQA 4CCNA 4C2TA 2KZVA 2FUG2 2E1MC 1X1AA 1MMGA 2K5CA 2HDWA 3DTKA 3K4CA 3S3MA 1OR7C 3RSNA 1QHHD 3QODA 4BACA 3C2GA 3U21A 1MW7A 2DXIA 3A1YA 1WJBA 4XLCA 3DEEA 3RQ4A 3ZR8X 2XAUA 2MYSA 4RLFA 1MMAA 4J00A 2CW8A 4OAYA 2DT6A 2KMUA 2AQEA 3HPHA 3KEYA 4U7BA 3EPZA 2V4JC 1OLTA 3K4LA 3AFHA 1NG6A 4XKWA 2XF7A 3VDXA 1FMVA 1BR1A 2IXSA 3MKZA 3QYEA 3OMYA 2BVLA 3K70C 4IQJA 3LFUA 3MKWB 2VQCA 4PJLA 2MABA 2WAFA 3TL4X 1YX5A 2HQAA 2HPIA 4BJ6C 2XC7A 3L2WA 4B3XA 1LVKA 2DJIA 3S8PA 3HXLA 1LKXA 3NWSA 4NNJA 4XLFA 3ZGKA 4AU7A 3I3LA 2M7AA 3ZRGA 3CP8A 4D9JA 3H5NA 2W4SA 3W3CA 4B43A 4XOTA 2CV1A 3QOEA 2XF6A 4QPQA 2X1CA 3OYMA 3H9GA 1D1AA 2IGKA 2HVQA 2W00A 4BQNA 4B47A 2A6TA 2ZSHB 1BOBA 1X4OA 3AL0C 4DIQA 2VKHA 4ANJA 4HNUA 2LOOA 1Z3YA 4NC8A 1D0ZA 4Y33A 4XQFA 4YRVA 3OYKA 3MKYB 3H5RA 3VYTB 3OYLA 3K4BA 2LY2A 3CMMA 3CESA 1LDKB 2OC6A 2R7VA 4IQ4A 4DBQA 3LSIA 3VYRB 2OUMA 1WJFA 4CSWA 2M7BA 3W2WA 3DU5A 3HUGB 3RPUD 1BR2A 2X1DA 2XDVA 3L2QA 5CQEA 2VXDA 3OOUA 3SEQA 4KT6A 4XONA 4BE2A 1TT0A 4RLQA 2MD0A 1HA8A 2L9SA 2Z16A 4G6TB 4DOZA 1MMNA 2R7WA 3EUKL 4MLOA 3OR1C 1T95A 4OWRB 4ZDLA 2LC2A 1ZELA 3IAS2 2IS2A 2ELJA 4E7SA 4BQQA 4E7JA 4CH7A 1YX3A 1EA3A 2WY7Q 2X51A 4YEJA 3CJRB 4ZDOA 2M3AA 4E6KG 4XLHA 3OR2C 3S93A 2V6EA 4ZDPA 5HLTA 1X1BA 3ZXSA 3H35A 2LRDA 3KYLA 4HPQA 3ONQA 2IGMA 5CKTA 3OY9A 4R79A 4C30A 4FETA 2OV7A 1UELB 2BVMA 4LITA 3A4CA 3J7AY 4CCMA 4HRIA 4FASD 2HPMA 3F9KA 4ZC3A 1D0XA 2NOJB 3K6GA 3DWLE 3RCOA 3AKZA 4J01A 2E5ZA 3DKYA 3OIQA 1FMWA 4XORA 3BC8A 2IS6A 1Z3XA 3RTRA 3LSMA 4AVZA 1ERDA 1Z7LA 4BUPA 2UWMA 4NQWB 3VSKA 2AQFA 2IGNA 4RM2A 3OYJA 4BU2A 4BS9A 4E7IA 1X19A 3G2BA 5JHFA 2VIXA 2X85A 3CF2A 2RNGA 4KJZA 3EUHC 3SDBA 3HPGA 1DQUA 2O5RA 5HVQC 3PSFA 2F6CA 2VLAA 2ZSIB 2VJJA 2VB6A 5FRMA 2W82A 3MMYB 2M4KA 2E1MB 5HNFA 2LYCA 3OL4A 2GOMA 3S3NA 4XM3A 3W2VA 2IS4A 2HVRA 3VYUB 4CCJA 4ZTJA 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U21 A; 
#chains in the Genus database with same CATH topology
 2OBP A;  4U0W A;  3RKY A;  1MKM A;  3Q9S A;  2I10 A;  3WOD F;  3BPV A;  4E7K A;  1JUP A;  4PK4 A;  2LH9 A;  2R7T A;  1Y8Q B;  1ZR4 A;  2D5V A;  2H8W A;  2IJL A;  1ZG3 A;  2H27 A;  3R61 A;  3LWF A;  2CUF A;  4PUS A;  3B6C A;  4HV5 A;  2NYX A;  4E7L A;  1GLN A;  2DOD A;  2JVG A;  1ZR2 A;  4W1U A;  1Y6I A;  4ENM A;  2RQQ A;  2KDZ A;  2F5C A;  2XGC A;  3BPX A;  4XRS G;  3BT9 A;  1RET A;  2PJR B;  4RAY A;  3FDY A;  2ZJP F;  4OIN F;  1X1C A;  2WA0 A;  3HSR A;  5CQG A;  2EFQ A;  3M9A A;  1YYV A;  2COB A;  3IWZ A;  1IAW A;  2JRT A;  1PYV A;  2IA1 A;  4DYC A;  4Y4R A;  1MNE A;  1IUF A;  3V42 A;  3FXM A;  2R7X A;  3QPT A;  2NVU B;  5IP7 J;  2XAJ A;  3BOQ A;  1WFX A;  3QOP A;  3CCY A;  4I09 A;  1VQ8 I;  2LF8 A;  4OIO F;  1FT9 A;  2EIJ H;  2VJI A;  3CC4 I;  2KIM A;  4CXF A;  2MLG A;  4E7Z A;  3EYY A;  2HKX A;  2DQL A;  3OYA A;  3CCL I;  3ECO A;  4HQM A;  2E2H J;  1V4R A;  5E1Z B;  4LFU A;  2PQ8 A;  1G59 A;  3DEU A;  5BPI A;  1JGG A;  2XAG A;  4HG2 A;  3NEU A;  5C44 J;  2ZME C;  1ETQ A;  2L9N A;  4NC6 A;  1H9G A;  2EZL A;  1V55 H;  3G1M A;  3KX2 A;  2HDC A;  1ZTR A;  3KYD B;  4A3L J;  2XF5 A;  2A5W A;  1IRG A;  4C2M J;  2OTL I;  4LIU A;  5EF6 A;  5DCM A;  2WAQ N;  2H6B A;  3KYC B;  3DQV C;  1QPM A;  4WXH A;  4M6Y A;  5LRR A;  2IS1 A;  5JR3 A;  2KL4 A;  5K5O A;  3I5U A;  2W25 A;  3A02 A;  3LSP A;  3I9V 2;  4V2G A;  2QSF X;  4ZTF A;  1YS6 A;  1M1E B;  4A69 C;  3MKL A;  2DFE A;  1LE8 B;  4CUG A;  2QWW A;  2ZKZ A;  1TTY A;  1VQP I;  2VOP A;  5K5Q A;  2LBF B;  2ZNZ A;  1A6Q A;  1I39 A;  3ZQL A;  4PJ0 C;  2D45 A;  2OA4 A;  1YTY A;  2VBW A;  1V5G A;  4HST A;  3HDD A;  4PCQ A;  1V54 H;  4EMS A;  4HSR A;  1RNL A;  1X2M A;  2UUZ A;  3GME A;  1QHG A;  5FRN A;  4BJT A;  1DGW Y;  3DLA A;  4O3M A;  3FMQ A;  2K85 A;  4N9I A;  3I55 I;  1ZK8 A;  1I27 A;  4N0B A;  1VQ5 I;  2W57 A;  2A05 A;  4F93 B;  4HQE A;  2MC4 A;  3GLX A;  1MSE C;  2DLL A;  3BJA A;  1VQ7 I;  2XPW A;  3OOP A;  3DFG A;  1ZLK A;  2JA8 J;  4IXA A;  2QKL B;  2X48 A;  2E5N A;  1HOM A;  2X6Y A;  3R60 A;  2R7S A;  2NOG A;  2FXA A;  2LMD A;  3E7L A;  3GBG A;  4IHW A;  4XKV A;  1W5C C;  3R6S A;  2BBY A;  4ZYH A;  3EET A;  1B9M A;  4P5O A;  1V5F A;  1OQY A;  1LNW A;  2XSJ C;  5GAG J;  3PUF A;  5LGN A;  1I1G A;  1ZGA A;  3BDD A;  2JVH A;  1Y39 A;  2GXG A;  3DKW A;  3F8N A;  4H4K C;  3PIP F;  1CF7 A;  3W2A A;  2FRH A;  3K2A A;  3DKX A;  5L3E A;  4NUB A;  3S3O A;  1ON1 A;  2LNB A;  4HV6 A;  3OS2 A;  1KQ8 A;  1UHM A;  4B48 A;  1U9O A;  5C3E J;  2HKO A;  2L5Q A;  5E8I A;  3K70 D;  2A07 F;  2EFW A;  1FEX A;  5HDG A;  3ZMU A;  3WGH A;  2GA1 A;  2DCE A;  1HXD A;  1FSE A;  4BXF A;  3MQ0 A;  3O2P E;  1BA5 A;  1E0E A;  1B8I B;  4IKF A;  4KT5 C;  5FKM A;  4NC7 A;  4DZJ A;  1T98 A;  2HOS A;  2Q2E A;  1XMK A;  3H5A A;  4IJA A;  1APL C;  4OAZ A;  1PDN C;  3LSK A;  1AOY A;  3LSG A;  4IHS A;  1SAX A;  1HC8 A;  2LY9 A;  2QM3 A;  4A0Y A;  2IAI A;  1O3R A;  4HEA 2;  4LJZ F;  1FOW A;  2QQA A;  4XLE A;  1QVT A;  1UJ8 A;  3HOX J;  3GLL A;  4L5I A;  2V7F A;  5H6R A;  2R7R A;  1XGN A;  2A5Y B;  2K3P A;  4G9Y A;  3J80 K;  3GCM A;  2UZK A;  2Q1Z B;  1OCP A;  4EJV A;  2BHY A;  1R23 A;  1U0J A;  3CJQ B;  3CC7 I;  1RUN A;  3F21 A;  1JJ6 C;  1WPK A;  2PX9 A;  5J1Y A;  4LB5 A;  1FOK A;  3SZG A;  3ML6 A;  5K7H A;  2WAD A;  3I4P A;  4IL6 C;  2WB1 A;  3KP2 A;  2HNH A;  1W5T A;  1FJL A;  5F6F A;  2Y0M A;  4II2 A;  5CPR B;  1YG2 A;  4HDU A;  1X2N A;  4JOM A;  4PGG A;  4BQO A;  1I1S A;  5E8G A;  1X1P A;  2LRE A;  1KYZ A;  4L5E A;  1CQT A;  3TP0 A;  1NHA A;  1JXS A;  4DGW B;  1HW2 A;  1R6R A;  2DAO A;  3ERM A;  1Q1H A;  1RIO H;  2W7N A;  3TKY A;  1T8I A;  2QVO A;  3HOV J;  1ON2 A;  2RKH A;  1BR4 A;  5DV5 A;  1T6S A;  3SZT A;  1K78 A;  3ZCO A;  1ZRF A;  3DP7 A;  3TMO A;  3HKZ A;  3FXO A;  1OCO H;  1JI8 A;  3HOY J;  1J9I A;  2CJJ A;  3BG3 A;  4XLN F;  1S9H A;  4F52 A;  1MBK A;  1R58 A;  3RPU A;  1P4A A;  1IZ1 A;  2M0M A;  2FJ1 A;  4XRS A;  2GXB A;  2LSO A;  1VQN I;  1RKW A;  4G12 A;  2XGX A;  5J47 A;  4QPO A;  3M8J A;  4ZZL A;  1WQ2 A;  2WV1 A;  2YUS A;  2HYG D;  3CD6 I;  3RKW A;  1D8J A;  3L2U A;  1DPR A;  2ZME B;  3SYT A;  5ICC A;  4MIM A;  3BY6 A;  3CMA I;  3MZY A;  2JTV A;  1Z77 A;  2PN6 A;  1VFC A;  4U7D A;  2KZV A;  2XB5 A;  4C2T A;  2FUG 2;  2EV0 A;  2W24 A;  4M3D A;  1MMG A;  3SQN A;  4YIR X;  4OIR F;  5FO5 A;  3SZP A;  2K5C A;  2HDW A;  4HA8 A;  1OR7 C;  1QHH D;  3GTL J;  2HOA A;  5L3D A;  4BAC A;  2XRL A;  1MW7 A;  1POG A;  1BM9 A;  4XLC A;  3E6B A;  2CQ7 A;  2V1D A;  4EJO A;  3SFI A;  2NVY J;  3WGI A;  1MBG A;  2A68 F;  2FX0 A;  2XAU A;  4H0E A;  4I76 A;  1YJW I;  2HGC A;  1MMA A;  3V7R A;  2CW8 A;  2PI0 A;  3H3U A;  4U7B A;  3EPZ A;  4CIC A;  3F3X A;  3IWF A;  3U9G A;  3K4L A;  4P9U A;  2M34 A;  1FMV A;  2P5L C;  3WTT C;  3VOD A;  2K86 A;  2R7D A;  1D8K A;  5JFR A;  1XPX A;  4IQJ A;  3LFU A;  2E2I J;  5IP9 J;  5F0H A;  3JRC A;  2E19 A;  2VQC A;  4EJT A;  3LQR A;  4GXO A;  2XGD A;  1YX5 A;  2HQA A;  1O57 A;  2HPI A;  2Y0S N;  3MEX A;  1XGO A;  1TWA J;  3EUH A;  2ZBK A;  3M07 A;  4CYC B;  1GHC A;  4LD5 A;  4AU7 A;  2EIL H;  3I3L A;  3R0J A;  2RQP A;  4AUX A;  5DS9 A;  3BZK A;  2YU3 A;  1QVU A;  4B43 A;  2CV1 A;  3GZ5 A;  4QPQ A;  1BIB A;  2RDP A;  3N4M A;  5HDN A;  1D1A A;  3K0L A;  3LAP A;  2DQR A;  2HVQ A;  2O9L A;  1BOB A;  2NNY A;  1TW2 A;  2OQR A;  5GAD J;  1Y1V J;  4HNU A;  2ZJ2 A;  3AG3 H;  1Z3Y A;  3L2C A;  1W5S A;  4NC8 A;  3KET A;  2IA0 A;  3B02 A;  3FIW A;  1IN5 A;  3LA2 A;  2COM A;  1RR8 C;  1HDD C;  4YRV A;  4R1H A;  2JK3 A;  3RZD J;  2DMT A;  3VOE A;  5B5E C;  1OFC X;  1GUU A;  2MBF A;  4L9T A;  4ZYG A;  2HZT A;  3K4B A;  3BQZ A;  2BEO A;  1LDK B;  4KIC A;  3P9K A;  4JP0 A;  5TIS C;  2OC6 A;  4G6D A;  4KFC A;  3EQL F;  2STW A;  4IQ4 A;  5DD8 A;  2OUM A;  2M7B A;  3JRE A;  1J5Y A;  3M8F A;  2FU4 A;  3RPU D;  4ETS A;  2FEZ A;  4IPA A;  1ULY A;  1EF4 A;  2X1D A;  2XDV A;  2YX4 A;  3E6D A;  3BR2 A;  2QBY A;  3SEQ A;  3GVA A;  4XON A;  4ESB A;  4YG2 F;  1TT0 A;  5IT9 K;  4DOZ A;  1MMN A;  4D0P A;  2EBI A;  3MZ8 A;  3OR1 C;  2HEO A;  1XC5 A;  5J6X A;  1ZYR F;  1ZEL A;  2IS2 A;  2L7F P;  4FQG A;  3LA3 A;  2BYV E;  3L09 A;  5GPA A;  4YEJ A;  3CJR B;  1SD7 A;  2M3A A;  5J4Y A;  2DDA A;  5FGM A;  2M9H A;  3S1N J;  3E5Q A;  1YIT I;  4EGZ A;  1R4M B;  2DPU A;  2F5D A;  4LLL A;  3J7Z I;  3ONQ A;  1SMT A;  5B1B H;  3OY9 A;  4KNY A;  3ZMV A;  4FCY A;  4FET A;  1UEL B;  2BVM A;  1EKE A;  1Z6T A;  2FBI A;  3QP5 A;  3J80 Z;  2K7L A;  2KZG A;  2EZI A;  3V8K A;  3E6M A;  2ZNY A;  4ZC3 A;  5LHG A;  1IGN A;  2NOJ B;  1AKH A;  3RCO A;  5ILV A;  3G3Z A;  3OIQ A;  2A69 F;  1IDY A;  4OMZ A;  3WE2 A;  4CGZ A;  4IO9 F;  1Z7L A;  1RKT A;  4BUP A;  4NQW B;  4U88 A;  1IUY A;  2EFO A;  2OZU A;  1G6N A;  2IGN A;  2LKS A;  1AU7 A;  5HS9 A;  1FZP B;  3BRO A;  3OYJ A;  4A3D J;  4E7I A;  4IOA F;  2J5O A;  1SFX A;  1X19 A;  1FBQ A;  4A6E A;  2Z33 A;  1U8R A;  3PO3 J;  3HPG A;  5HVQ C;  2VLA A;  2ZSI B;  1XMX A;  2LFB A;  2VB6 A;  2M8E A;  1TWF J;  5D5W B;  1T0F A;  3U1K A;  1FOY A;  2W82 A;  1DDN A;  4IRG A;  2M4K A;  2OU2 A;  5HLG A;  3OL4 A;  2GOM A;  3O8H A;  3QPH A;  1GVJ A;  1B6A A;  4WXD A;  2FOK A;  1IN8 A;  2NVT J;  3W2V A;  2IS4 A;  2OPT A;  2P4W A;  2XAQ A;  3H92 A;  3QPS A;  1FYK A;  1P9Q C;  4S05 A;  3SDG A;  4PDK A;  3NWT A;  1NK2 P;  3C2H A;  1TT5 B;  3ELK A;  1QZE A;  2NAZ A;  2EZK A;  4GYG A;  4HW0 A;  3IL2 A;  2KRF A;  3DPT A;  3HBL A;  4BL0 B;  5GTI C;  1OIS A;  1XN7 A;  2FQ3 A;  2MH9 A;  1K6Y A;  3M7G A;  3BWG A;  1IXC A;  1NH3 A;  3FXL A;  4XSZ F;  2G7H A;  1UG0 A;  2K4J A;  2QZ8 A;  2D2W A;  3F8F A;  3HRU A;  5JLW A;  3S1M J;  1YW8 A;  2A3S A;  2V26 A;  5IPA A;  3OYN A;  3SXY A;  3Q9V A;  2DMU A;  4WXC A;  5F0F A;  2NVQ J;  1W36 D;  2VKD A;  4FX4 A;  4HDV A;  4M9X A;  1WJ5 A;  1XDS A;  3ROU A;  1STZ A;  1B9N A;  3IH4 A;  2ELK A;  1N25 A;  2EV6 A;  1HBX G;  1L0O C;  4U0V A;  4PJJ A;  1MIJ A;  3HB9 A;  3J7Y J;  1R5I D;  3DEW A;  3TW7 A;  3WTV C;  4ABZ A;  5DM6 F;  3CDL A;  1U78 A;  1HCR A;  3A0H C;  2OAZ A;  1T38 A;  3G1L A;  3OSG A;  4M73 A;  5J1R A;  1V3F A;  5JVG F;  2DOA A;  3OYB A;  2H8R A;  3L2R A;  1W0U A;  1I5Z A;  5JVT A;  3TGN A;  2LG4 A;  2ZXI A;  2VE9 A;  2WBM A;  4XOP A;  3TBI A;  4IRI A;  3HG9 A;  2CYY A;  2X6W A;  5FKK A;  3GYH X;  4IX7 A;  4KDP A;  2X0L A;  1S8N A;  1H0M A;  4XN3 A;  4BXU A;  2JUC A;  4S0H B;  5JLX A;  4EAT A;  1G8X A;  4BE0 A;  2KPM A;  1ZHF A;  2FA5 A;  3K4M A;  4RM3 A;  5L3G A;  3QYF A;  1ETW A;  2P0W A;  5ICF A;  4Y7N J;  2H1K A;  1JKR C;  1LE8 A;  3V7S A;  1WVR A;  3JAM Z;  1AA7 A;  3GTP J;  5F27 A;  2A61 A;  2G7U A;  4UV8 A;  2YU9 J;  1S7O A;  2CW7 A;  2LF7 A;  3FBN B;  2M30 A;  4BH9 A;  2PLY A;  2LVS A;  1JJ8 C;  4BE1 A;  2DMN A;  1P92 A;  3BCB A;  1OKR A;  5BS6 A;  3CF5 F;  4A5N A;  3CC2 I;  1WRJ A;  3WTX C;  2KIF A;  1K61 A;  1S7E A;  4ITV A;  2R5Z B;  1R71 A;  3CP2 A;  1PUF B;  5AON A;  1FTT A;  4XKC A;  2BW3 B;  3ZQ7 A;  2VT3 A;  4G7Z F;  5DM7 F;  1XTA A;  3CZ6 A;  2IGO A;  5E3M A;  5J8F A;  3KEQ A;  5FLM J;  1K79 A;  1EH7 A;  2W1O A;  1HQC A;  3TQN A;  2M8G X;  3OL3 A;  2K27 A;  5DCF A;  2WWY A;  1Q1V A;  2V9V A;  5HS8 A;  1YFH A;  3S14 J;  1WCM J;  2RGV A;  3IUO A;  3C1D A;  4I2O A;  1XGS A;  3OYC A;  3H3Z A;  3HEF A;  2KQR A;  3BZ6 A;  3MZH A;  2OJE D;  4EGY A;  2L7Z A;  1SVL A;  3FXR A;  3FX3 A;  2EFP A;  1LFP A;  1K4S A;  2LKP A;  2VJ5 A;  1PJR A;  2VC1 A;  3HRM A;  3I4M J;  3P9I A;  4I0B A;  2YSR A;  4L9V A;  4F3Q A;  1D1B A;  1KU7 A;  3CME I;  2H6C A;  3OS1 A;  2DO7 A;  1GT0 C;  1OJL A;  4Q47 A;  4G7H F;  1B72 B;  3G4S I;  1MH4 A;  4M72 A;  4MQV A;  1MDM B;  4MGR A;  2G9W A;  5DUI A;  1B8I A;  3GFJ A;  1HKQ A;  4BHC A;  1UST A;  4UUV A;  4U87 A;  2JUG A;  5IYB J;  2KKO A;  2MW8 A;  2VAS A;  3FXQ A;  4MTE A;  1G2H A;  3Q5F A;  1MZB A;  3T5X A;  4C2U A;  3DPU A;  1O3T A;  3S2H J;  3P9C A;  4A12 A;  3FBI B;  3KZY A;  4A3J J;  3CCM I;  2R7U A;  1HLV A;  2DPD A;  2PG4 A;  5IYD J;  4A5M A;  5FB2 A;  1AWC A;  3PL8 A;  4KYW A;  4IF4 A;  3IRQ A;  3A2K A;  3MAJ A;  3TED A;  2VQH A;  1IN7 A;  1TNS A;  2E60 A;  5LD2 C;  1XD7 A;  3FMR A;  1KGS A;  4P96 A;  2HR3 A;  2B63 J;  1WJC A;  1ODD A;  3BR1 A;  5FLV A;  4KN4 X;  1MND A;  1GV2 A;  3K10 A;  2B0L A;  5ERI A;  3T8T A;  1D1C A;  3FKI J;  2JSP A;  1XCB A;  3PFY A;  4M9S A;  4EVI A;  2R7Z J;  2JZY A;  2OCE A;  2KLO A;  5F0C A;  2QA4 I;  4ENN A;  1LJ9 A;  5FJ8 J;  3OYI A;  2RV8 A;  4BDY A;  3N05 A;  2HYF A;  5KHD A;  2HTJ A;  5EZG A;  4B44 A;  5KK1 A;  3JRH A;  2RRE A;  2D1V A;  1XSV A;  4L0Z B;  3OSF A;  2VON A;  5EEA A;  4E7H A;  3EUA A;  4A93 J;  2CMP A;  5IY5 H;  2M4G A;  4RB2 C;  1IRX A;  1I3A A;  3FF5 A;  2DTR A;  1ZQ3 P;  1K7A A;  3K4N A;  5K5R A;  4ZYE A;  1VZ0 A;  2R0Q C;  5TRD A;  3HOW J;  2FMY A;  4HNT A;  3G6E I;  3M1C A;  5HNH A;  4ENK A;  1N75 A;  2LLK A;  2JQ7 A;  1RRJ A;  2R4G A;  3PO2 J;  4JX5 A;  3WU2 C;  2P6T A;  3OYF A;  2EV5 A;  3CCU I;  1MBH A;  3BTC A;  5DEQ A;  1V5E A;  4CCK A;  2HZD A;  2JPC A;  3OWT A;  1A36 A;  3V8L A;  1E2X A;  4UUS A;  1R1T A;  2QF7 A;  1EH8 A;  2MG4 A;  2ZME A;  3LSH A;  3V4G A;  4HNV A;  2JWT A;  3SEZ A;  3LSJ A;  4XRF A;  4CCN A;  5LFA A;  2ELH A;  1X1A A;  3KFW X;  3DTK A;  5LGU A;  2DA4 A;  3QOD A;  1RZ4 A;  3C2G A;  3JRG A;  4AWX B;  2V6C A;  1R7J A;  1E3O C;  3DEE A;  2KIQ A;  3NAU A;  2P7V B;  4L5J A;  3F8B A;  5DTD A;  1LEB A;  4LK1 F;  4OOI A;  3F72 A;  5D8K B;  1WH7 A;  1YS7 A;  4KMU X;  4RLF A;  3RI4 A;  2FQ4 A;  4LOC A;  4J00 A;  4OAY A;  1XS9 A;  2DA5 A;  2DT6 A;  5J4V A;  2AQE A;  4YIF A;  1YOV B;  1K6O A;  1SD5 A;  2EJR A;  2V4J C;  3IRR A;  2DOE A;  4AD9 A;  3I59 B;  1FWZ A;  1NG6 A;  2OQG A;  4XKW A;  3VDX A;  3WU0 A;  1BR1 A;  2QLZ A;  4LG0 A;  3CCR I;  1YW9 A;  5EJC A;  1JT0 A;  3QYE A;  2DFF A;  4YII A;  3R4K A;  2BY0 A;  2F4O B;  1O4X A;  1JKQ C;  1BJA A;  2L0K A;  3HGY A;  2HWV A;  5ICG A;  5CLS A;  1MSF C;  3MKW B;  3R0A A;  2FE3 A;  3BTL A;  2VT2 A;  1FYL A;  5A2Q K;  3ABU A;  1MBE A;  1O3Q A;  4W97 A;  1A6I A;  2AO9 A;  1F36 A;  4CYC A;  2ZC2 A;  4I0A A;  4MNU A;  4XLF A;  5C4J J;  2VKV A;  4QLC U;  4YFN F;  5FLX K;  3LSR A;  5H6Q A;  3H0G J;  3H5N A;  2W4S A;  4XOT A;  1FP1 D;  2RN7 A;  1PUE E;  3J81 Z;  3QOE A;  3AG1 H;  2IGK A;  2K40 A;  3CUQ C;  1G3T A;  1I6X A;  4UV9 A;  3U1D A;  4CHU A;  3AL0 C;  4DIQ A;  2QGU A;  4FT8 A;  2LOO A;  1EJ9 A;  2VOO A;  2ESH A;  2QSH X;  3CMY A;  5B3S H;  1Y0U A;  2EIK H;  3WG9 A;  3KP3 A;  3LQQ A;  3MKY B;  3HRT A;  3HOZ J;  2EQR A;  3OYL A;  4A6D A;  3CMM A;  3WTW C;  2HXI A;  2R7V A;  3DF8 A;  1YHQ I;  4KIB A;  3VYR B;  5E3N A;  2KIU A;  5J3L A;  2BXY A;  3V7C A;  3HUG B;  1BR2 A;  2HQN A;  1X3W B;  2HQR A;  2AHQ A;  5BPD A;  4KT6 A;  2A6H F;  4BE2 A;  2LD5 A;  1S7A A;  1VF9 A;  3LA7 A;  1X3Z B;  2Y9Y A;  4G6T B;  2VC0 A;  5CVV A;  2BZT A;  1R4N B;  2PEX A;  2IPQ X;  4OWR B;  4A2U A;  2LC2 A;  2JN6 A;  3IAS 2;  1R36 A;  4BQQ A;  4E7J A;  1HW1 A;  3A01 B;  2NXN B;  1TP4 A;  5IOZ A;  1OCT C;  5GAE J;  2VN2 A;  1ZGW A;  3ZN0 A;  1XMA A;  3FXK A;  3VFZ A;  4RGS A;  1X1B A;  4IRH A;  3ZXS A;  2YPR A;  3H35 A;  1BC8 C;  3QQA A;  2HOT A;  1LQ1 A;  2F5E A;  2IGM A;  1BL0 A;  5IOY A;  1HKS A;  3OIO A;  3J7A Y;  1RI7 A;  4HRI A;  3C2B A;  3ZN1 A;  3S1R J;  2HPM A;  3HOU J;  1D0X A;  2ZXJ A;  2XRN A;  1H9T A;  2DOF A;  1E3H A;  5LEK A;  3SFZ A;  5FFX A;  4BY7 J;  3DLL F;  4XIC A;  3HYI A;  2QSG X;  2PJP A;  2ICW G;  3G71 I;  4XOR A;  3CTA A;  3BC8 A;  5JI6 A;  4AVZ A;  1TL8 A;  2NS8 A;  3I71 A;  3KP5 A;  4NQW A;  2UWM A;  3W6V A;  2Z99 A;  4I6Z A;  1X58 A;  1CGP A;  5ICE A;  4BS9 A;  3IH3 A;  1USS A;  1YJN I;  1JUS A;  2VPR A;  2E1C A;  4Z6Y A;  1UG2 A;  1P4W A;  3EUH C;  2L7M P;  3SDB A;  5EGO B;  3ASN H;  1YI2 I;  1G4D A;  3TW6 A;  4A3B J;  1K83 J;  2VJJ A;  3BR6 A;  4JX6 A;  3F6V A;  2PFB A;  3MMY B;  1I6H J;  2P81 A;  1L3L A;  2QYO A;  3IHU A;  5KVR A;  3IH2 A;  2DA3 A;  3RQI A;  4IOC F;  2DTZ A;  4XM3 A;  2XPU A;  1FNN A;  2YR2 A;  2DA6 A;  2Z3Y A;  3ZQH A;  2ID3 A;  4LGW A;  4CO8 A;  5F08 A;  3OIP A;  4OIP F;  2N8G A;  4HX7 A;  1UMQ A;  4CZC A;  4HX4 A;  1O7F A;  3IKV A;  2KDO A;  1VQO I;  1SFK A;  4O6J A;  4X6A J;  3DCF A;  1W7P B;  3BR0 A;  2DW4 A;  4IHT A;  2MFZ A;  1J59 A;  2F5V A;  1DGR M;  3GTK J;  2WB1 N;  3LNQ A;  1UZC A;  1Z21 A;  2B9S A;  2RC4 A;  3MVP A;  2HVS A;  5E3L A;  3BCA A;  2D1H A;  2GOX B;  1YIJ I;  4XID A;  4DYQ A;  2PMZ A;  1SAU A;  5LHH A;  1R1U A;  4UVA A;  3GFM A;  4UXN A;  1YQA A;  4LG3 A;  4HLX A;  3N97 A;  2Z1D A;  5M5X J;  2R3S A;  1HSJ A;  5F04 A;  3O8G A;  3ZMS A;  1VND A;  2OCC H;  4CCO A;  5J40 A;  5D6E A;  4CDG A;  5LBQ A;  2Q0O A;  3X2Q H;  2JA7 J;  2JA2 A;  2ZCW A;  1EH6 A;  4ESF A;  4D7M A;  1TQP A;  4DBR A;  4UVC A;  3HKZ N;  5IP6 A;  1F5T A;  1MMD A;  3DTI A;  1LDJ A;  2V1N A;  2CS3 A;  4EM0 B;  2KT0 A;  1SFU A;  2P8T A;  3ABM H;  2ID6 A;  3CUQ B;  2FNA A;  3NRV A;  4BEH B;  3PM1 A;  5DYM A;  2MGQ A;  1KON A;  5E1X A;  4Y15 A;  3UNG C;  4FTH A;  1GXQ A;  2K9M A;  2R7O A;  1SAN A;  5A2Q Z;  2E2J J;  1IO2 A;  3BG5 A;  4G8X A;  1LFU P;  2IP2 A;  3LOC A;  2Y75 A;  3KP4 A;  1ZGJ A;  3OV8 A;  1SVM A;  3HOS A;  5LEJ A;  5E3O A;  4D1Q A;  1B4A A;  2GA2 A;  5GTH C;  1ZG5 A;  1J09 A;  4S04 A;  3HIF A;  2Y9Z A;  2B7E A;  3HL2 A;  1J75 A;  2A6E F;  2ZFU A;  3GFL A;  4B8X A;  3CCS I;  3F0C A;  3K1M A;  2M87 A;  4BJ5 C;  2CQQ A;  2V9K A;  4BGD A;  5E17 F;  4MFE A;  5E20 A;  2Y30 A;  2Y69 H;  1WGX A;  3FM5 A;  3ESW B;  3IAM 2;  1Z05 A;  4EEF G;  6PAX A;  2CH0 A;  1ZG1 A;  4KIS A;  2QUF A;  2XV4 S;  3JRB A;  3VWB A;  4MQ9 F;  2R5Z A;  1XCV A;  5EG0 A;  5F1J A;  4QTR A;  4AYB A;  1SVO A;  2VE8 A;  2Z9O A;  1IW7 F;  5K7F A;  2L01 A;  4N4N B;  2VBX A;  2QEN A;  5M5W J;  3QU3 A;  2VJ4 A;  3FK7 A;  4D7N A;  4AIJ A;  3H3V K;  3PSI A;  1OYY A;  1P4X A;  1H89 C;  2QKM B;  2HTS A;  1SD4 A;  2L2O A;  5HS7 A;  3K4K A;  2FSW A;  1XB4 A;  1XG1 A;  3MCZ A;  3JSO A;  2R7F A;  3FM3 A;  1OCZ H;  3HRS A;  4GYI A;  1JE8 A;  1IXS B;  1RES A;  2BY3 A;  3A03 A;  4HF2 A;  4XNF A;  1I3Q J;  3QYB A;  3MFK A;  2DU9 A;  1VQ4 I;  3P5J A;  2MH2 A;  3H9J A;  2TDX A;  5IT3 A;  3OS0 A;  3GTJ J;  1BI1 A;  2RAE A;  4Q5S F;  2KRC A;  1QNT A;  2LR8 A;  2VQL A;  3RJP A;  2KP6 A;  3GF2 A;  1JKO C;  1KU2 A;  4B3A A;  3NQO A;  1P6R A;  1ZRD A;  3M3Y J;  2LDU A;  1D0Y A;  1B72 A;  1BJZ A;  1YRN B;  1VI0 A;  1MDM A;  4A3C J;  2E36 A;  2X9D A;  1ORK A;  2Z2S B;  4F92 B;  4P1W A;  5LGT A;  1W0T A;  4YFK F;  1ZAR A;  2PMZ N;  2KJB A;  2LKX A;  4TV7 A;  4ZYA A;  3CLO A;  3NAR A;  2O61 A;  2X1E A;  1QA6 A;  1N78 A;  2NNN A;  1S29 A;  4PFP A;  4EJU A;  2O8K A;  3VPR A;  2XIG A;  3U2R A;  3Q3S A;  2PJR A;  1SD6 A;  3F23 A;  3F8C A;  5BMZ A;  3ZQC A;  1B1B A;  3RYR A;  1WH5 A;  2DA1 A;  1OCR H;  5HOO A;  1EV7 A;  1W1W E;  3ZMD A;  1HDP A;  4MFD A;  4BDZ A;  3K4J A;  1DU6 A;  3CLQ A;  1X1D A;  4LLG F;  5C4X J;  3GXO A;  5JHU A;  2MA3 A;  4IZZ A;  3HOT A;  4PFO A;  3FZV A;  3HHG A;  4PSX A;  3ZQF A;  1U5T C;  4PJN A;  3KZZ A;  5B66 C;  2KRH A;  1T39 A;  2VQG A;  3D5L A;  3GWZ A;  2WY8 Q;  4WWC A;  4CCL A;  4AIK A;  2ETH A;  2EK5 A;  1MJ9 A;  1Z67 A;  4WF2 A;  3CJT B;  2CSO A;  3FHN A;  3GUD A;  5AIP A;  1A35 A;  4F7Z A;  2EA2 A;  3PNV A;  4G7O F;  3LMM A;  2ZFW A;  3DBR B;  4XLA A;  1XDU A;  1IJW C;  3WE3 A;  1BI3 A;  3B73 A;  2R5Y B;  5KCM A;  4XR6 A;  1WJA A;  1KA8 A;  4CA0 A;  1X3U A;  3K2Z A;  3C18 A;  1MJB A;  1R5G A;  3DV8 A;  3E1S A;  3WGG A;  3Q0W A;  1FBU A;  1KZH A;  3UR3 C;  2M0C A;  2LBF A;  2X6X A;  3HTU A;  4G94 A;  4GO1 A;  1OYI A;  3PUB A;  4PZJ A;  4RGX A;  4B4C A;  3H0D A;  4HZF A;  2XAH A;  3DU6 A;  4DW6 A;  1BC7 C;  5M3F J;  3GW2 A;  1O7L A;  4AYB N;  2XAS A;  3PNY A;  3OYG A;  4GDF A;  2HXO A;  2EA4 A;  3D0S A;  2DFI A;  2FNP A;  4A0Z A;  1U8B A;  4XK4 A;  1R1V A;  2JJ7 A;  3GTM J;  2DA2 A;  5E79 C;  3JW4 A;  3GZN B;  1IG7 A;  3CCV I;  2XAF A;  2CFO A;  3ABK H;  3D5R C;  2H1L A;  2LY1 A;  2WAQ A;  1NG7 A;  4I99 C;  4KIG A;  3WHC A;  4AM3 A;  1LB2 A;  2E1M C;  2CGP A;  4WCG A;  1Y1W J;  4UY8 I;  1R22 A;  3JTG A;  2JA6 J;  2DBB A;  1FX7 A;  5LLQ A;  2MC3 A;  4ESJ A;  3CQZ J;  3C7J A;  1FIA A;  1JGS A;  3ABT A;  3TO7 A;  3CCQ I;  1OCC H;  4A3F J;  2P7C B;  2V1X A;  3CDH A;  3DXJ F;  4UVB A;  1ZRE A;  3U21 A;  3HZJ A;  3FHZ A;  5IT9 Z;  1ETK A;  3RQ4 A;  2HQ5 A;  5L3C A;  1QQI A;  1R9T J;  4C3J J;  2MYS A;  3JRF A;  2O3F A;  3ABL H;  2UXX A;  2KMU A;  1O3S A;  1U9N A;  3KEY A;  1XGM A;  5K1Y A;  3AFH A;  2JPB A;  2X6O A;  1BIA A;  3MKZ A;  1FYM A;  2BVL A;  1VQL I;  2MLK A;  3BP8 A;  3K70 C;  4RS8 A;  3L00 A;  3JRD A;  2ECC A;  2JRM A;  3P7N A;  1QZZ A;  1MNM C;  2JMW A;  2MAB A;  5ED4 A;  2WAF A;  4BJ6 C;  2HI3 A;  2XC7 A;  4B3X A;  1LVK A;  4P55 A;  2DYS H;  3ZP5 A;  4XRM A;  3S8P A;  3HXL A;  4DYR A;  5L3B A;  1LKX A;  2DK5 A;  4NNJ A;  4P9F A;  3T8R A;  2O0Y A;  1RUO A;  2M7A A;  3ZRG A;  3CP8 A;  4D9J A;  3W3C A;  1VQ6 I;  9ANT A;  4MO7 A;  5GP9 A;  2X1C A;  3OYM A;  3H9G A;  5BOX A;  5HLI A;  3CCE I;  4EQQ A;  4BQN A;  1U3E M;  3ZOB A;  3LFK A;  4B47 A;  1MBF A;  2A6T A;  2ZSH B;  2M45 A;  4WX9 A;  3TO9 A;  3WTS C;  5DD4 A;  3G1O A;  4DQ2 A;  1WI3 A;  2VKH A;  4ANJ A;  1QBJ A;  3S2D J;  1WWX A;  4ZYD A;  5CJ9 A;  1P7J A;  3JR9 A;  1D0Z A;  4KA4 A;  2ISZ A;  1IN6 A;  1JHF A;  2QCO A;  1REP C;  4XQF A;  4RDU A;  3E5U A;  2V1U A;  5ILU A;  2XVC A;  1VTN C;  2X4H A;  1Z0X A;  2LY2 A;  2ZJQ F;  3CES A;  5J8C A;  1YJ9 I;  3DBL B;  2AXT C;  3KZI C;  4DBQ A;  1WJF A;  5FKL A;  4CSW A;  3CO7 C;  2ACJ A;  1JT6 A;  3HUG A;  5KAI C;  1E3P A;  5CQE A;  3OOU A;  1Z91 A;  1GVD A;  1QPI A;  4GCV A;  4EJW A;  2FBK A;  1C0W A;  4M74 A;  4MEX F;  4MLO A;  1T95 A;  4ZDL A;  4E7S A;  2BV6 A;  3RIR A;  3I64 A;  3GFI A;  1PP8 F;  4WK8 F;  4HAM A;  2WY7 Q;  4G6Q A;  3A01 A;  2OD5 A;  2V9P A;  4YFX F;  1KQ0 A;  4I01 A;  3ZPL A;  3FXJ A;  4ZDO A;  1U5T B;  2BHZ A;  2DYR H;  4E6K G;  2DDB A;  3S93 A;  3IKT A;  2ME6 A;  2V6E A;  4DZP A;  3K7A J;  3KCC A;  2L02 A;  3K9T A;  1R49 A;  2LRD A;  1D3Y A;  3KYL A;  3UKG A;  3O6B B;  3RZO J;  1GV5 A;  2OV7 A;  1FP2 A;  2K9S A;  4IEJ A;  4LIT A;  1DP7 P;  4CCM A;  1LEA A;  2EB7 A;  3GEZ A;  4UNO A;  3F9K A;  4IVN A;  3KP7 A;  2DMQ A;  1KQ9 A;  1FY7 A;  1FBS A;  5HLH A;  2AS5 F;  5D4R A;  2M2E A;  5M5Y J;  3K6G A;  1R00 A;  3DWL E;  3AKZ A;  2DI3 A;  2E5Z A;  1IDZ A;  1WKM A;  2CQK A;  1HST A;  4A3E J;  1FSH A;  1G3W A;  2O6G E;  2CWE A;  1Z3X A;  3RTR A;  2K02 A;  4I98 B;  4RB1 A;  2PBI A;  3SJM A;  1UHW A;  3FMS A;  1VQ9 I;  2AQF A;  2VUM J;  2P5K A;  1P7I A;  1Z6R A;  4OU0 A;  2LTP A;  4BU2 A;  5CVJ A;  2R93 J;  2L4M A;  4EV0 A;  4A3K J;  5JHF A;  4KJZ A;  2CQN A;  2EH3 A;  1JTX A;  5EGO A;  1ETY A;  1P2F A;  2O5R A;  5IYC J;  2GM4 A;  2V79 A;  1WI9 A;  2VOD A;  2QQB A;  1MGT A;  2JSC A;  1ZAO A;  1GDT A;  2ZJR F;  1T08 B;  2E1M B;  1LVA A;  1ZRC A;  1D5V A;  1DPU A;  4BKX A;  3JCU C;  2EWN A;  4BNC A;  3TDZ C;  1JKP C;  3KLO A;  3VYU B;  4CCJ A;  3ZMT A;  2M5W A;  4HF1 A;  3L9F A;  2DN0 A;  3V8J A;  3W6J B;  5FKO A;  1G3Y A;  1TZL A;  2XRO A;  3TOB A;  2QEX I;  4BHB A;  2F4M B;  1QO0 D;  1W7P A;  1UHS A;  2KHM A;  1LFB A;  2JT1 A;  4YEL A;  2XHK A;  3BTJ A;  4JK1 X;  3T0Y A;  3FKJ A;  3H36 A;  3BLY A;  2P5V A;  3QU6 A;  1MD0 A;  3PFI A;  2EIM H;  4B1R A;  1UAA A;  4XBF A;  3FK6 A;  4L0Y B;  3JSP A;  2O03 A;  3RKX A;  4B09 A;  4KIT B;  3EYI A;  4PGH A;  2AXL A;  2GBY A;  2Y0S A;  4N9H A;  4Z2Y A;  2VPL A;  1RR7 A;  1WZ2 A;  1J7K A;  2HU9 A;  3M4O J;  4L18 B;  3F6O A;  4C3I J;  2K9L A;  5J1U A;  3D5S C;  3M1E A;  5D5U B;  4ZJZ A;  4BBS J;  4E4H A;  2HYJ A;  1IF1 A;  3LL7 A;  2NRA C;  4XKB A;  3BZC A;  1A31 A;  3L7W A;  3I56 I;  3OYH A;  1T33 A;  3L1P A;  2I8D A;  2W85 A;  3DTE A;  4HX8 A;  4C3H J;  3GTG J;  2L7K A;  3CUQ A;  3OYD A;  3KPH A;  4M6X A;  1I50 J;  2L9V A;  4F91 B;  1XX5 A;  4BEH A;  4Y3O A;  2HFH A;  4NBQ A;  2R7Q A;  2XB0 X;  4HOB A;  3I53 A;  4HBL A;  3M8E A;  4OIQ F;  2VKE A;  3PJR A;  2LP0 A;  4L9J A;  3ZQI A;  4FHT A;  2EFN A;  2W48 A;  4HYE A;  2M1B A;  1IN4 A;  4M3B A;  4II3 A;  1DU0 A;  2FF4 A;  2MSY A;  3IP4 B;  5DCM B;  3F22 A;  1TWG J;  1ZKG A;  3F8M A;  4PSW A;  5DUK A;  2G0E A;  2R92 J;  1MBJ A;  3J7A O;  1PVE A;  4N4O B;  1D5Y A;  2BOL A;  3FXU A;  2DMP A;  3BG7 A;  2Y2Z A;  4Y17 A;  4JQF A;  4JYK A;  3JRA A;  2O8X A;  1MJA A;  3WTZ A;  1X4P A;  5EDN A;  3ISP A;  2ZXW H;  1YE9 A;  5CYV A;  4RB3 C;  3E97 A;  4BQA A;  2DK8 A;  3GTO J;  2GWR A;  2UV1 A;  4O5V A;  1S5L C;  3AG2 H;  4D5C A;  1G3S A;  4UUS B;  3E6C C;  3DBH B;  3TDU C;  3W6K B;  2OZ6 A;  2WAE A;  4ZH4 F;  3VYS B;  1HKT A;  1LDD A;  3QAH A;  4Q4Z F;  1WJE A;  2YS9 A;  2XSD C;  2TRT A;  2OF7 A;  3S32 A;  3IV5 A;  4JBA A;  4MTD A;  3BTI A;  3KLN A;  3L2V A;  2FOW A;  4AIH A;  1LPQ A;  4LIV A;  2E35 A;  3PNT A;  3BQY A;  4RAZ A;  1TQI A;  1AHD P;  1TWC J;  2CUZ A;  2DFH A;  4UB6 C;  4NDL A;  3HGG A;  3HC7 A;  1BW5 A;  1KU3 A;  3A0B C;  4R8H A;  3G73 A;  1W7P D;  1SEU A;  2HDD A;  5EEG A;  3WU1 B;  4GFB A;  1OR7 A;  2ESN A;  4EM2 A;  3COA C;  2DT7 B;  1CF7 B;  3JTH A;  5TGT A;  4LG0 B;  1Y0N A;  1NTC A;  4PJM A;  3H1C A;  5FRO A;  5EEH A;  1TWH J;  1YRN A;  2WV0 A;  1F1Z A;  3GX4 X;  3HHH A;  4K2E A;  3HSF A;  3HM5 A;  2CUJ A;  4XN0 A;  5CVU A;  2IRF G;  1E17 A;  3ZQQ A;  5HOD A;  2L54 A;  3MD2 A;  1S3J A;  2CFX A;  4DJA A;  4A0X A;  2KFD A;  2Q2E B;  3BG6 A;  3BG9 A;  4C9Y A;  4AC0 A;  1A04 A;  3CDI A;  1UFM A;  2W84 A;  3KIO A;  2ECB A;  4KN7 X;  4F55 A;  1W36 C;  5D4S A;  4D5F A;  4XMY A;  1S72 I;  2GLO A;  2VL8 A;  3JAM K;  1FPQ A;  3DPL C;  1MH3 A;  3I4N J;  2CQX A;  3Q0V A;  2E71 A;  5CVR A;  3E0J B;  1ETO A;  2XKP A;  5BQT A;  2QQ9 A;  3K69 A;  2KIS A;  2E1O A;  4ON0 A;  3WHB A;  3CCJ I;  1QU3 A;  1XSX A;  1WHU A;  5KNL A;  4AVP A;  4FIS A;  1Z9C A;  1DP3 A;  4IHY A;  3E3V A;  1MMS A;  3AL0 B;  2K9Q A;  3S15 J;  3SHF A;  1ITY A;  4QSH A;  1JTY A;  3ERE D;  3S16 J;  1YIO A;  1BW6 A;  3Q0U A;  2IW5 A;  2PMH A;  4GRI A;  5KAF C;  2F4I A;  3GO5 A;  1SMY F;  4IHV A;  2IVM A;  1KU9 A;  2ZXH A;  2R5Y A;  4XL9 A;  1TBX A;  2L9R A;  2CV0 A;  3GZ6 A;  2YX7 A;  1F4K A;  4M71 A;  4M3G A;  5FLX Z;  1TQM A;  1QGP A;  1WJD A;  3ECH A;  3HTS B;  3C3W A;  1K78 B;  3PIO F;  3OYE A;  2ZB9 A;  1BBY A;  4XLP F;  5CVI A;  1QRY A;  2EZH A;  2CUE A;  4FE7 A;  4A3G J;  2CV2 A;  1N77 A;  2E1N A;  3WTU C;  4RGR A;  2VXZ A;  4EM1 A;  2J5P A;  4BAY A;  2O7O A;  1PP7 U;  2CU7 A;  3PQJ A;  3HSE A;  2ZO4 A;  2OTJ I;  5E18 F;  4RMN A;  1S6L A;  3VSL A;  3BJ6 A;  3H9Q A;  4FX0 A;  1BN5 A;  4X0G A;  1GXP A;  3TO6 A;  1PUF A;  5ILS A;  2WTE A;  1H8A C;  3I58 A;  2BW3 A;  2XPV A;  1DUX C;  4RB0 A;  3S1Q J;  5F64 A;  1FC3 A;  4FE4 A;  4V19 K;  3KP6 A;  1VQM I;  1T0F C;  4KIF A;  3KEO A;  3S17 J;  4RGU A;  4Y13 A;  2C6Y A;  1F9N A;  2K3F A;  3K4C A;  3S3M A;  2XUB A;  4I7H A;  3RSN A;  3QRF F;  5GPC A;  1HW5 A;  2VI6 A;  2DXI A;  3A1Y A;  1WJB A;  3D1N I;  1ETX A;  2E7X A;  4KUM A;  2IT0 A;  1TNT A;  2Y31 A;  2K9N A;  4JX4 A;  3BR5 A;  3ZR8 X;  3HJE A;  3AAF A;  1IV6 A;  5FD6 A;  1OYW A;  1LUJ B;  3CUO A;  5FKN A;  2IA2 A;  4M3F A;  1KYW A;  1VQK I;  2CW0 F;  5D5V B;  4GGG A;  2BE5 F;  4HF0 A;  4AID A;  3HPH A;  4OMY A;  5LRS A;  5TJJ A;  1OLT A;  4ZZD A;  1IC8 A;  1ETV A;  3RPQ A;  2XF7 A;  2IXS A;  2VBY A;  2BY2 A;  1SFO J;  1BI0 A;  3MN2 A;  2CRG A;  3OMY A;  1H88 C;  1HF0 A;  1JHH A;  5H20 A;  4BHP A;  4CZZ A;  4BY1 J;  2I5U A;  2ADU A;  4PJL A;  2P6S A;  3TL4 X;  2K4B A;  5FFZ A;  2JA5 J;  3L2W A;  2DJI A;  1K4T A;  5DDG A;  4NB5 A;  4UUT A;  2RNJ A;  3WG7 H;  3NWS A;  3ZGK A;  3EDP A;  1BOA A;  3BR3 A;  1Z1D A;  4DNC A;  2XF6 A;  2FBH A;  2FD5 A;  1WSU A;  2L3D A;  2W00 A;  4QWQ A;  4X1E A;  1X4O A;  3K1N A;  1J0R A;  3BJO A;  3VB2 A;  4A3I J;  5GAH J;  1R5H A;  3KE2 A;  1F43 A;  1YO5 C;  4ASN A;  4LB6 B;  2IBD A;  4KMF A;  4E70 A;  5D6F A;  2GIZ A;  4Q48 A;  3ZMZ A;  3K1P A;  4Y33 A;  3QP6 A;  2F5F A;  3O3K A;  3FWE A;  4QIW N;  3H5R A;  3OYK A;  3TP3 A;  2TCT A;  3B6A A;  2BY1 A;  3VYT B;  1OMI A;  3T1B A;  2CO5 A;  4L9N A;  3LST A;  2VBZ A;  2ISY A;  4RA2 A;  1IXR C;  1YLF A;  1Y8R B;  3LSI A;  1RC9 A;  3PQK A;  3W2W A;  2NVX J;  3DU5 A;  1ENH A;  4BBR J;  1IRF A;  1IRZ A;  4I02 A;  3L2Q A;  2UXN A;  3LAJ A;  1TLH B;  2VXD A;  2QBY B;  2Q8K A;  2EPF A;  3AG4 H;  3GTQ J;  1SFE A;  3CJN A;  3QPL A;  5AIQ A;  1B59 A;  4RLQ A;  2MD0 A;  1HA8 A;  1ZLJ A;  2L9S A;  2MD5 A;  2WC2 A;  1UB9 A;  2Z16 A;  5D8L B;  2R7W A;  3EUK L;  1YW7 A;  2STT A;  4BYY A;  5LHI A;  1ZN2 A;  2DT5 A;  2H94 A;  2ELJ A;  2LK2 A;  4CH7 A;  1YX3 A;  4HLY A;  4U0Y A;  1EA3 A;  2X51 A;  5D5X B;  2L4A A;  4A3M J;  4UHT A;  3FIS A;  2DA7 A;  2E7W A;  2E34 A;  2KJC A;  1U5T A;  4BXX J;  1T56 A;  5E1W A;  4XLH A;  3OR2 C;  3CO6 C;  4ZDP A;  5M3M J;  1FTZ A;  2HOE A;  5HLT A;  1NK3 P;  1ONV A;  3WTY C;  4HPQ A;  5FD5 A;  1TC3 C;  2DJN A;  1U6G A;  5B1A H;  5CKT A;  4R79 A;  4LMY A;  2GAU A;  1W4M A;  1SC7 A;  4C30 A;  1IV8 A;  1FIP A;  3A4C A;  2BGC A;  2QQ8 A;  1BI2 A;  1RPW A;  5H2F C;  5L3F A;  4FAS D;  4UB8 C;  1XSD A;  5EZH A;  3RYP A;  1UCR A;  2BXZ A;  4M3E A;  4RAF A;  4LLN A;  3TOA A;  1AKH B;  3ZQG A;  4J01 A;  2XGE A;  2NS0 A;  3DKY A;  2Z5U A;  3IC7 A;  2Y48 A;  1FMW A;  2F48 A;  1QZY A;  3ASO H;  2GQQ A;  3S2W A;  2CG4 A;  1J2X A;  4RAG A;  3J81 K;  5EG0 B;  4XSX F;  5K7Z A;  3RKQ A;  2IS6 A;  3LSM A;  4CYD A;  1ERD A;  1JUM A;  3VEP A;  3MWM A;  3JRI A;  5F1R A;  3VSK A;  4M9Z A;  2IEK A;  3I54 A;  2EIN H;  4M6V A;  4RM2 A;  4MEY F;  1Z7U A;  2HS5 A;  4RBO A;  1OPC A;  3I59 A;  1FOX A;  2GIV A;  3G2B A;  3QWL A;  2VIX A;  2X85 A;  3CF2 A;  2RNG A;  3I0T A;  2NS7 A;  1TW3 A;  1DQU A;  3E5X A;  3PSF A;  2F2E A;  2H09 A;  2GZW A;  2F6C A;  4NHJ A;  1ZH5 A;  1A5J A;  4ENJ A;  3RDI A;  2PMU A;  5FRM A;  4LK0 F;  3ULQ B;  4IHX A;  2ME0 A;  1FLI A;  5HNF A;  2LYC A;  4Y52 J;  2FML A;  3S3N A;  2GXA A;  4J19 A;  5HDK A;  5EYR A;  3REO A;  2XKO A;  1T2K A;  1U2W A;  1ACI A;  2HVR A;  2RVC A;  4MHG A;  4ZTJ A;  4V2F A;  1Y56 A;  5BNG A; 
#chains in the Genus database with same CATH homology
 1P9Q C;  3OIP A;  3NWT A;  1TZL A;  3C2H A;  4E7K A;  4PK4 A;  2LH9 A;  4CZC A;  2R7T A;  2KDO A;  1SFK A;  3DPT A;  4BL0 B;  4PUS A;  2MFZ A;  2F5V A;  2KHM A;  1DGR M;  1K6Y A;  4E7L A;  4YEL A;  1GLN A;  1UG0 A;  2JVG A;  3FKJ A;  3BLY A;  1Z21 A;  2HVS A;  1Y6I A;  2RQQ A;  3BCA A;  2V26 A;  3OYN A;  2GOX B;  1UAA A;  2PMZ A;  1W36 D;  2VKD A;  4KIT B;  2PJR B;  1SAU A;  3FDY A;  2Y0S A;  2VPL A;  1X1C A;  1WJ5 A;  2WA0 A;  5CQG A;  4LG3 A;  2Z1D A;  2HU9 A;  4CCO A;  1PYV A;  4Y4R A;  2K9L A;  1MNE A;  3V42 A;  2R7X A;  4PJJ A;  3D5S C;  2JA2 A;  4ZJZ A;  4E4H A;  1WFX A;  4DBR A;  3LL7 A;  1MMD A;  3DTI A;  4XKB A;  2VJI A;  2V1N A;  3OYH A;  4E7Z A;  2CS3 A;  2I8D A;  3DTE A;  3OYA A;  2DOA A;  3OYB A;  2L7K A;  3OYD A;  3L2R A;  4F91 B;  4BEH A;  4BEH B;  4Y3O A;  1G59 A;  2LG4 A;  1KON A;  2R7Q A;  2ZXI A;  4HG2 A;  2WBM A;  4XOP A;  3TBI A;  2K9M A;  2R7O A;  3UNG C;  2L9N A;  2X6W A;  3HG9 A;  4IX7 A;  3KX2 A;  3PJR A;  2XF5 A;  2A5W A;  4XN3 A;  4LIU A;  4II3 A;  3IP4 B;  3DQV C;  4PSW A;  4EAT A;  3HOS A;  1G8X A;  2IS1 A;  2KL4 A;  4D1Q A;  4BE0 A;  2KPM A;  3K4M A;  3I9V 2;  4N4O B;  4RM3 A;  1J09 A;  2BOL A;  3QYF A;  4ZTF A;  2P0W A;  3HL2 A;  3BG7 A;  4CUG A;  2ZFU A;  4JQF A;  4BJ5 C;  1AA7 A;  2V9K A;  4BGD A;  2LBF B;  2CW7 A;  3IAM 2;  3FBN B;  1X4P A;  2CH0 A;  4BE1 A;  4KIS A;  3BCB A;  1YE9 A;  4HST A;  1V5G A;  4HSR A;  2UUZ A;  2UV1 A;  1QHG A;  3VWB A;  4ITV A;  3CP2 A;  5FRN A;  4BJT A;  4XKC A;  2BW3 B;  1DGW Y;  3DLA A;  4AYB A;  2WAE A;  3VYS B;  1WJE A;  3CZ6 A;  2IGO A;  4N4N B;  4F93 B;  2MC4 A;  2VJ4 A;  3S32 A;  3PSI A;  2W1O A;  3OL3 A;  2QKL B;  3L2V A;  2QKM B;  2E5N A;  2L2O A;  2X6Y A;  2R7S A;  3K4K A;  4LIV A;  3IUO A;  3GBG A;  3PNT A;  4XKV A;  3OYC A;  2CUZ A;  4P5O A;  3HC7 A;  2KQR A;  4XNF A;  1V5F A;  3QYB A;  2XSJ C;  1LFP A;  2JVH A;  2VJ5 A;  3H9J A;  4H4K C;  1PJR A;  3OS0 A;  3W2A A;  2DT7 B;  2KRC A;  3DKX A;  2VQL A;  4NUB A;  5TGT A;  3S3O A;  2KP6 A;  4F3Q A;  3OS2 A;  1D1B A;  4B48 A;  2L5Q A;  4PJM A;  3K70 D;  3OS1 A;  1D0Y A;  5FRO A;  2DCE A;  2Z2S B;  4BXF A;  4F92 B;  4P1W A;  1E0E A;  4IKF A;  2CUJ A;  4NC7 A;  4XN0 A;  4ZYA A;  3ZQQ A;  2X1E A;  1N78 A;  4U87 A;  2JUG A;  3MD2 A;  2VAS A;  4PFP A;  4DJA A;  2Q2E B;  3H5A A;  3BG6 A;  4C2U A;  4OAZ A;  3DPU A;  3LSK A;  3LSG A;  3FBI B;  2R7U A;  4HEA 2;  4C9Y A;  4XLE A;  2PJR A;  3PL8 A;  4F55 A;  2V7F A;  1W36 C;  4XMY A;  2R7R A;  2VL8 A;  3A2K A;  5HOO A;  2K3P A;  2VQH A;  3DPL C;  2E60 A;  5LD2 C;  2Q1Z B;  4BDZ A;  3K4J A;  1X1D A;  1U0J A;  3CJQ B;  1WJC A;  3E0J B;  4IZZ A;  1MND A;  3K10 A;  3HOT A;  4PFO A;  1D1C A;  2JSP A;  3PFY A;  4PSX A;  3SZG A;  4PJN A;  1QU3 A;  5KNL A;  2KRH A;  2KLO A;  2VQG A;  2WAD A;  3D5L A;  2WY8 Q;  2WB1 A;  4CCL A;  2HNH A;  1DP3 A;  3OYI A;  4BDY A;  4II2 A;  5CPR B;  3N05 A;  3AL0 B;  3FHN A;  5KHD A;  4JOM A;  4BQO A;  4B44 A;  2LRE A;  3PNV A;  3LMM A;  4XLA A;  4GRI A;  4DGW B;  2F4I A;  2RRE A;  1R6R A;  2ZXH A;  5KCM A;  4XL9 A;  2W7N A;  2CV0 A;  4XR6 A;  1WJA A;  4E7H A;  3EUA A;  2CMP A;  4CA0 A;  2M4G A;  1WJD A;  1BR4 A;  1IRX A;  3OYE A;  3ZCO A;  3K4N A;  1VZ0 A;  3E1S A;  3TMO A;  3HKZ A;  3UR3 C;  2CV2 A;  1N77 A;  1JI8 A;  4HNT A;  3M1C A;  2LBF A;  2X6X A;  5HNH A;  2VXZ A;  1N75 A;  3PUB A;  3H0D A;  1S9H A;  4F52 A;  2R4G A;  3DU6 A;  3OYG A;  3OYF A;  3PNY A;  2M0M A;  1V5E A;  4CCK A;  2HZD A;  3M8J A;  4QPO A;  4RMN A;  3VSL A;  3OWT A;  3H9Q A;  4X0G A;  3L2U A;  2BW3 A;  3LSH A;  2CFO A;  3SYT A;  3D5R C;  3SEZ A;  5LFA A;  1T0F C;  2LY1 A;  1NG7 A;  2WAQ A;  4CCN A;  4C2T A;  2KZV A;  2FUG 2;  2E1M C;  1X1A A;  1MMG A;  2K5C A;  2HDW A;  3DTK A;  3K4C A;  3S3M A;  1OR7 C;  3RSN A;  1QHH D;  3QOD A;  4BAC A;  3C2G A;  3U21 A;  1MW7 A;  2DXI A;  3A1Y A;  1WJB A;  4XLC A;  3DEE A;  3RQ4 A;  3ZR8 X;  2XAU A;  2MYS A;  4RLF A;  1MMA A;  4J00 A;  2CW8 A;  4OAY A;  2DT6 A;  2KMU A;  2AQE A;  3HPH A;  3KEY A;  4U7B A;  3EPZ A;  2V4J C;  1OLT A;  3K4L A;  3AFH A;  1NG6 A;  4XKW A;  2XF7 A;  3VDX A;  1FMV A;  1BR1 A;  2IXS A;  3MKZ A;  3QYE A;  3OMY A;  2BVL A;  3K70 C;  4IQJ A;  3LFU A;  3MKW B;  2VQC A;  4PJL A;  2MAB A;  2WAF A;  3TL4 X;  1YX5 A;  2HQA A;  2HPI A;  4BJ6 C;  2XC7 A;  3L2W A;  4B3X A;  1LVK A;  2DJI A;  3S8P A;  3HXL A;  1LKX A;  3NWS A;  4NNJ A;  4XLF A;  3ZGK A;  4AU7 A;  3I3L A;  2M7A A;  3ZRG A;  3CP8 A;  4D9J A;  3H5N A;  2W4S A;  3W3C A;  4B43 A;  4XOT A;  2CV1 A;  3QOE A;  2XF6 A;  4QPQ A;  2X1C A;  3OYM A;  3H9G A;  1D1A A;  2IGK A;  2HVQ A;  2W00 A;  4BQN A;  4B47 A;  2A6T A;  2ZSH B;  1BOB A;  1X4O A;  3AL0 C;  4DIQ A;  2VKH A;  4ANJ A;  4HNU A;  2LOO A;  1Z3Y A;  4NC8 A;  1D0Z A;  4Y33 A;  4XQF A;  4YRV A;  3OYK A;  3MKY B;  3H5R A;  3VYT B;  3OYL A;  3K4B A;  2LY2 A;  3CMM A;  3CES A;  1LDK B;  2OC6 A;  2R7V A;  4IQ4 A;  4DBQ A;  3LSI A;  3VYR B;  2OUM A;  1WJF A;  4CSW A;  2M7B A;  3W2W A;  3DU5 A;  3HUG B;  3RPU D;  1BR2 A;  2X1D A;  2XDV A;  3L2Q A;  5CQE A;  2VXD A;  3OOU A;  3SEQ A;  4KT6 A;  4XON A;  4BE2 A;  1TT0 A;  4RLQ A;  2MD0 A;  1HA8 A;  2L9S A;  2Z16 A;  4G6T B;  4DOZ A;  1MMN A;  2R7W A;  3EUK L;  4MLO A;  3OR1 C;  1T95 A;  4OWR B;  4ZDL A;  2LC2 A;  1ZEL A;  3IAS 2;  2IS2 A;  2ELJ A;  4E7S A;  4BQQ A;  4E7J A;  4CH7 A;  1YX3 A;  1EA3 A;  2WY7 Q;  2X51 A;  4YEJ A;  3CJR B;  4ZDO A;  2M3A A;  4E6K G;  4XLH A;  3OR2 C;  3S93 A;  2V6E A;  4ZDP A;  5HLT A;  1X1B A;  3ZXS A;  3H35 A;  2LRD A;  3KYL A;  4HPQ A;  3ONQ A;  2IGM A;  5CKT A;  3OY9 A;  4R79 A;  4C30 A;  4FET A;  2OV7 A;  1UEL B;  2BVM A;  4LIT A;  3A4C A;  3J7A Y;  4CCM A;  4HRI A;  4FAS D;  2HPM A;  3F9K A;  4ZC3 A;  1D0X A;  2NOJ B;  3K6G A;  3DWL E;  3RCO A;  3AKZ A;  4J01 A;  2E5Z A;  3DKY A;  3OIQ A;  1FMW A;  4XOR A;  3BC8 A;  2IS6 A;  1Z3X A;  3RTR A;  3LSM A;  4AVZ A;  1ERD A;  1Z7L A;  4BUP A;  2UWM A;  4NQW B;  3VSK A;  2AQF A;  2IGN A;  4RM2 A;  3OYJ A;  4BU2 A;  4BS9 A;  4E7I A;  1X19 A;  3G2B A;  5JHF A;  2VIX A;  2X85 A;  3CF2 A;  2RNG A;  4KJZ A;  3EUH C;  3SDB A;  3HPG A;  1DQU A;  2O5R A;  5HVQ C;  3PSF A;  2F6C A;  2VLA A;  2ZSI B;  2VJJ A;  2VB6 A;  5FRM A;  2W82 A;  3MMY B;  2M4K A;  2E1M B;  5HNF A;  2LYC A;  3OL4 A;  2GOM A;  3S3N A;  4XM3 A;  3W2V A;  2IS4 A;  2HVR A;  3VYU B;  4CCJ A;  4ZTJ A;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...