3U21A

Crystal structure of a fragment of nuclear factor related to kappa-b-binding protein (residues 370-495) (nfrkb) from homo sapiens at 2.18 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
104
Chain Sequence
INEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFETQQWLLGDNEELAALFQLWLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Novel Winged-Helix Like Domain from Human NFRKB Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation, dna binding
molecule keywords Nuclear factor related to kappa-B-binding protein
total genus 31
structure length 104
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14465 NFRKB_winged NFRKB Winged Helix-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3u21A00
3U21A
chains in the Genus database with same CATH superfamily
2FQ4A 2LDUA 2OZUA 4NC8A 5J1YA 2NVTJ 3WTUC 3OMYA 1IV6A 2NXNB 2QEXI 3C2BA 3ERMA 2COBA 1IAWA 2Y9YA 3F21A 2GA2A 1E2XA 2LRDA 5H2FC 3CJTB 3MN2A 1OCCH 2EA4A 4G7HF 1HSJA 2X0LA 2ECCA 1IF1A 2YSRA 1VQOI 4HG2A 1IN4A 4M74A 1W36D 2FF4A 2LNBA 3ZRGA 4BH9A 1G3WA 5C4XJ 2PQ8A 5LHIA 3EUKL 1KU2A 2R93J 3HOSA 3BG6A 1KYZA 2ESHA 1ZELA 4RM3A 2MFZA 1GHCA 3JAMZ 4AIHA 4HSRA 1DUXC 3DU5A 2FU4A 4NNJA 2ADUA 2L9NA 2VE8A 3HXLA 4BBRJ 1FYLA 3GF2A 4M3FA 5B5EC 2JA2A 2P4WA 2QSGX 4ON0A 3E6CC 2V6CA 2BE5F 3QPSA 1MMSA 2L5QA 1BIBA 3F72A 3REOA 2HI3A 4BUPA 3CLQA 2EZLA 2R7DA 5JLWA 1X4OA 4C2UA 3PNVA 1LJ9A 2QKLB 3RKQA 2LLKA 5FLXZ 1AOYA 1HW1A 1D1BA 3BJOA 2Z5UA 4B09A 1YI2I 1D5VA 4J19A 4A6DA 3ZQQA 3GTLJ 1FBUA 1MNMC 2LKPA 3CP8A 5GAEJ 2NRAC 2Y0SA 5B3SH 3AL0C 1I1SA 1S6LA 1U3EM 3GTQJ 4BE1A 1QZEA 1W4MA 2DAOA 2VOPA 3DPTA 3HIFA 1B9NA 1WRJA 2JT1A 2H27A 2O8XA 2EZHA 1ETQA 1CF7A 1MBKA 2XB5A 2WY8Q 3PNTA 4LIVA 3BTJA 3FIWA 3TEDA 5FRMA 1RKTA 1I27A 3S32A 3A0BC 3LAPA 4B1RA 3S3MA 1VNDA 2GAUA 3PM1A 1T8IA 1WZ2A 4R8HA 4LFUA 1P9QC 4AC0A 5BNGA 3LSJA 2P8TA 4LK0F 2ZJRF 3EPZA 3GTOJ 4N0BA 3DEWA 1SFKA 4XORA 3I54A 4A0YA 3LSGA 3SDGA 2OD5A 1MKMA 2CUJA 2CW8A 2E1CA 1R36A 1MNDA 4MLOA 4MHGA 4YIRX 3CCEI 2R5ZB 1V3FA 2ZFWA 1CQTA 4BQOA 3MZHA 5FO5A 3I56I 5FKMA 2K4JA 4BXFA 3NQOA 4BACA 2KIMA 4ETSA 3AKZA 4UUVA 1OCRH 3QYFA 2CW0F 4F7ZA 4MQVA 4U7BA 1WVRA 3E0JB 3GZ6A 3OS2A 1JTXA 2VKDA 2I8DA 5DCMB 2VIXA 2V9PA 4NBQA 3JR9A 5EF6A 3F8MA 2GQQA 3F0CA 1TT5B 2JUGA 1POGA 3BC8A 3ECOA 1ZGAA 1WJCA 2V1XA 2V7FA 3L2RA 2FEZA 2H1KA 1G6NA 1QPMA 2DYRH 4EVIA 4BGDA 4J01A 5LHGA 3SYTA 1XGOA 2L54A 2L7KA 4G94A 2DT5A 4L0YB 5D4RA 4B3AA 3OY9A 4G6DA 3WGHA 5D4SA 4UVBA 2XAGA 3I0TA 2XF6A 5HLHA 5EG0A 2A61A 2O03A 4UXNA 3O8HA 5J47A 1IJWC 4Y7NJ 4PZJA 1ERDA 2VN2A 2M0CA 4AIDA 2QQAA 3HUGB 1XDSA 3UNGC 2RQQA 1UELB 1RI7A 2H8RA 2FJ1A 3JRIA 1YTYA 5IT3A 1XN7A 3U21A 4WX9A 3OL3A 2VXZA 1H89C 3WTVC 5J6XA 3NWSA 1J09A 2DK5A 2VUMJ 1VQLI 1WI3A 2FMLA 4LOCA 2JRTA 3EYYA 2W84A 1A04A 3RJPA 1D1AA 2BBYA 5AIQA 1XMXA 3G1LA 1DDNA 3V7SA 3I9V2 5FLXK 2QUFA 1YS7A 1LNWA 1QVUA 3LQQA 2VE9A 1V5FA 1YIJI 5EDNA 2RNJA 1T38A 4B43A 5L3GA 2L02A 3FXOA 3MQ0A 4MTEA 4YIIA 5EZGA 4OIPF 2HVRA 3WHCA 1ON2A 3AAFA 3PUFA 4LG3A 2QSFX 1E3HA 2QBYA 4LMYA 1D1CA 3TKYA 4DQ2A 3IV5A 2L4MA 1RESA 2M87A 3G3ZA 1FMVA 4RAYA 3OYKA 3TW6A 3TQNA 4P55A 4AVPA 2M4GA 4JX5A 5DUIA 2IS4A 2VBWA 3ERED 1RR7A 2OC6A 2XRNA 3BZKA 2GXAA 2OU2A 1DPRA 4E7IA 2IGMA 2VC1A 4AVZA 4GDFA 4WXCA 3HRSA 2HXIA 3I3LA 1I5ZA 1FPQA 2DA4A 2CV1A 4GGGA 3KYLA 4ANJA 2HWVA 5GAHJ 3ZMZA 2M0MA 1WJBA 4A93J 3RSNA 1S7EA 2KJBA 1R1VA 1BC8C 4CHUA 1R5ID 5BPIA 2XAHA 3JTHA 2Y0SN 1XSVA 1DP7P 2K7LA 2VOOA 2M1BA 4ZYEA 1FZPB 3LL7A 2A07F 1TW2A 2EIMH 3F8NA 5FKNA 5IPAA 2K4BA 2K40A 1E0EA 3ZN1A 3ULQB 1DU6A 1WGXA 2DT6A 2DBBA 2M8EA 2LY1A 1MW7A 5JR3A 4ESBA 4KDPA 3OR2C 2MD5A 3TDZC 1FOKA 1QPIA 3QPHA 3MZYA 4BNCA 2A5WA 2GXBA 2J5PA 3IH4A 4XLFA 3SZTA 3H9GA 2JK3A 5B1BH 3TBIA 4BYYA 5M3MJ 2PBIA 4NUBA 4GFBA 2HTJA 3T8TA 4HEA2 4OMZA 2FNPA 2MSYA 2ZMEC 5D6FA 4Y33A 3CJQB 4PJNA 1KQ8A 3WTWC 1D5YA 3QP5A 4E70A 4R79A 3MAJA 2ELKA 3ONQA 1ZRFA 5CYVA 4CCNA 3TOBA 1Z67A 1TNTA 2DMUA 3LA3A 1N75A 1F4KA 1OMIA 3W6KB 4EM1A 2IS2A 1OLTA 4IRHA 2NYXA 3D5RC 2R7UA 2OCEA 1YFHA 1JT0A 3ZQGA 1APLC 3FMSA 1ETXA 3OR1C 2N8GA 3ABTA 3VPRA 5DEQA 4F92B 1VQ8I 1I3AA 1MH4A 1WJ5A 3QYEA 3DEUA 2VJJA 3L09A 4I01A 5FRNA 2VJ4A 1J5YA 1U2WA 2QZ8A 2LVSA 3KIOA 2XAJA 3C2GA 3FBIB 3PO3J 1IRXA 3BJ6A 3VYTB 1S5LC 4CGZA 3MMYB 1MD0A 5DCFA 4BDZA 2I10A 1XDUA 3ZQIA 3DXJF 3M1EA 3M8FA 2A3SA 3F9KA 1SAUA 2BW3A 3H5AA 2HQ5A 5CVRA 1R4NB 3BR3A 1CF7B 2EFPA 4ITVA 5K5OA 4J00A 4GYIA 4L9NA 2KKOA 3GTKJ 3L9FA 2K9NA 3SHFA 1BW6A 1X3ZB 1RUNA 2DXIA 2Q8KA 1UZCA 3PIOF 1HDPA 1R1UA 1Z3XA 2B0LA 4L18B 3BG5A 1A6QA 1UHMA 1FIAA 5KAIC 1JKPC 5F08A 3K10A 4X1EA 5HNFA 1U78A 2LTPA 5IY5H 1JHHA 4E7SA 4JQFA 5CVJA 4BU2A 2H8WA 5D5VB 3GTPJ 2MG4A 5D6EA 1P6RA 2KRCA 2LBFB 1QU3A 1OCOH 3Q0VA 4O6JA 3OYLA 1YJNI 1RRJA 3L1PA 3OOPA 1LVAA 2AS5F 3JRBA 4HX4A 5E20A 2VQGA 4CCMA 1X4PA 4LB6B 2VKHA 1QHGA 3AG2H 4G6TB 2TCTA 3I64A 3Q0WA 1B8IA 2G7UA 2W00A 5IYCJ 2OTJI 2D1VA 2CQQA 1ETVA 3OYFA 1Z0XA 1UCRA 3E6BA 5EEHA 1EKEA 3OYEA 1VQNI 5B66C 2J5OA 1G8XA 4M6VA 3Q3SA 3V7CA 4BEHB 4A3LJ 4EQQA 4A6EA 1IN6A 1BI3A 2O7OA 4I76A 2QGUA 3TOAA 4V2FA 4YFKF 2COMA 2OV7A 4KFCA 3WTTC 3KLNA 4KUMA 1BN5A 5E79C 3PJRA 2DFEA 5E18F 3ABUA 1OJLA 4FX4A 4D7NA 3G2BA 2IT0A 4Y15A 2VONA 4A3DJ 1YW9A 4IHTA 1BM9A 1TQPA 3W2WA 2IVMA 1X1DA 3JRAA 2DDBA 2MGQA 3HRUA 2ZFUA 5BOXA 4XLNF 1TTYA 3DTEA 2WB1N 3HOUJ 2VXDA 3JSPA 3ZQ7A 4EGZA 4Y4RA 2IA1A 2ISYA 2EPFA 2HFHA 4C3IJ 4DBRA 2FNAA 3CTAA 3I53A 1WJFA 3LSMA 3BR1A 1QVTA 2DMQA 3BWGA 2XPVA 2TDXA 4HNTA 1SFUA 4CA0A 3F22A 3X2QH 1DP3A 3ZXSA 2OQRA 4OAYA 3SEQA 5LGUA 1KQ0A 4OOIA 2QM3A 3JRGA 4XRFA 2VBYA 4IRGA 1EF4A 1P7JA 3GBGA 4LG0A 3N05A 3VB2A 2MW8A 3QU3A 3LSRA 4I2OA 1JI8A 4XLHA 2LD5A 1J9IA 4MIMA 1PYVA 3OSFA 2XC7A 3KP3A 2QKMB 1MMDA 1YS6A 2XAFA 1Y8RB 4MO7A 2LREA 3VWBA 1JHFA 3MWMA 3J7YJ 2EFNA 5IOYA 2OUMA 1S8NA 4BJ5C 1O7LA 2BY2A 3IRRA 1ZYRF 1QZZA 2DI3A 4RDUA 2NVYJ 2WC2A 4XIDA 3J81Z 3JCUC 4HX7A 4M73A 3HRTA 2WBMA 1FEXA 3LFUA 4U88A 2GM4A 3TGNA 4M3BA 1U0JA 1Z3YA 1RC9A 1K78A 2RGVA 1O4XA 1UAAA 2FMYA 1J7KA 2E1OA 3I5UA 1OYIA 2ZSIB 2CJJA 4XKBA 4BKXA 4DJAA 2W7NA 2G9WA 1LE8B 3GW2A 2Y48A 1OKRA 2A05A 3RI4A 3HGGA 1Y39A 4PSXA 1TBXA 2PMZA 3LA2A 4RA2A 4V2GA 2EFWA 4W97A 3DKWA 2ECBA 3D5SC 4UUTA 5EZHA 2BY0A 1JGSA 3FM3A 3F23A 1XSDA 3HOYJ 3FWEA 4HBLA 2KHMA 4BQAA 2LY2A 2M2EA 3BJAA 3L2UA 1AKHB 3S14J 4D5CA 3U1KA 3GZNB 3NWTA 2AQEA 2HQAA 4RAGA 3JREA 2D1HA 5LLQA 4XR6A 1J2XA 4UV9A 4Y13A 1S72I 1Y1VJ 2ZMEA 3KZYA 3DKYA 4FX0A 2KRFA 5CVVA 4WWCA 1O57A 5ED4A 3BR2A 4WCGA 2F2EA 2KJCA 2EJRA 1HXDA 4I0AA 1QHHD 1FOWA 1DPUA 4GCVA 1VZ0A 4V19K 3E7LA 3SFIA 5ERIA 3LNQA 4BE0A 4FETA 3ABLH 1NK3P 1XGSA 3N97A 3TP0A 3CJRB 5TGTA 3B02A 5J3LA 4AUXA 1HW2A 5FJ8J 2E71A 2HVQA 1T0FC 4FCYA 3W6JB 2GOMA 4IX7A 2LBFA 3FXLA 2M7AA 2XVCA 3LFKA 2R7QA 2ZKZA 1YG2A 3KE2A 1FX7A 4CCLA 4II2A 1EJ9A 3BR5A 1YITI 2Y31A 1D8JA 3H3VK 1HCRA 4BS9A 4L5IA 1F5TA 1QNTA 1WI9A 1MMGA 3ZMTA 3V7RA 3D1NI 2ETHA 3HSEA 4C3JJ 3GTMJ 2ME0A 1I1GA 1X3WB 2VASA 3DEEA 5K7ZA 4B47A 1UHWA 4HNVA 4XMYA 1SC7A 2ICWG 2MBFA 2WAFA 3LQRA 1YRNA 4CSWA 1I6HJ 4BBSJ 3DPUA 1PVEA 5LRRA 2M5WA 3ABMH 1QQIA 3VDXA 2L7ZA 1VQ6I 2ZJPF 5C3EJ 3RYPA 2YU3A 3FM5A 1W36C 2O3FA 5IT9K 1ZG3A 1OR7A 4EJUA 4A3IJ 4R1HA 3KZZA 1MGTA 1WSUA 3GX4X 4OINF 4DYQA 2A5YB 3ZGKA 2KFDA 1PUEE 2Z1DA 1FC3A 1T0FA 3MKLA 3DKXA 2DMPA 2F48A 3HUGA 1X2MA 3VYRB 5DM7F 3L2CA 2AHQA 2L2OA 3LMMA 1AKHA 2F5EA 2HKXA 3ZMUA 4LGWA 1ETOA 2ELHA 3DPLC 4L9TA 2V1UA 3OYNA 2EH3A 1ZGWA 3RPUA 4E7JA 1V4RA 3HHHA 3D5LA 2XGXA 1ODDA 1IN7A 3CUQA 1IN5A 2HGCA 2VJIA 3FXQA 1MBGA 4FE4A 1R1TA 2L3DA 3RZOJ 3B73A 1ZHFA 3RPQA 4D9JA 1PUFB 4KA4A 5F1RA 4IHYA 2M9HA 3TO7A 3BDDA 1XB4A 5F27A 1WH5A 2Y75A 5KHDA 4MTDA 4ZH4F 5AONA 3IWZA 3PFIA 4L0ZB 2LH9A 2V1DA 5GP9A 3P9IA 4A3KJ 3HL2A 4DZJA 4MGRA 2JA6J 2DOAA 3A4CA 3G1MA 4Z2YA 4EV0A 4A3GJ 3DQVC 2JMWA 3DF8A 4P1WA 2R5ZA 5DD8A 3FHNA 2VQCA 1TP4A 4RS8A 4I0BA 4ZTJA 5E17F 2F4MB 2GA1A 4MFDA 2IEKA 2CG4A 4UB8C 3WODF 4BQQA 1Z9CA 1NG6A 3R4KA 4L5JA 2QSHX 3CC4I 2JRMA 2Y9ZA 2CSOA 3KPHA 5CQEA 3BY6A 1MBJA 4EEFG 5HVQC 1Y56A 3HG9A 2IBDA 2JN6A 2R7VA 5CPRB 1DGRM 3O6BB 1MDMB 2HVSA 1FJLA 3CJNA 2HQRA 1CGPA 1A36A 3QU6A 3M1CA 4D1QA 3H0DA 5BPDA 1ZLKA 2K85A 4JBAA 2V79A 2CUZA 1FLIA 2FBHA 1MJAA 4A3FJ 4XRMA 1O7FA 4M6YA 5E1XA 5IP6A 5BQTA 1XD7A 3EYIA 2CFOA 2VJ5A 3JW4A 4N4OB 5C44J 5F0FA 3L7WA 2B63J 4DZPA 4ESFA 4HDUA 3CUOA 4PGHA 4CYDA 3FBNB 2MLKA 5C4JJ 1YX3A 3C2HA 4LLNA 2E19A 1RUOA 2EV5A 2BZTA 1QGPA 3PQJA 5CQGA 1Z91A 4N9IA 2VLAA 3E5QA 2AXTC 3HKZN 1UMQA 3LSKA 2RQPA 2XKOA 2YUSA 3KX2A 5JVTA 4OU0A 4MFEA 3LSHA 3K4LA 2XAUA 4HW0A 1JUMA 2VB6A 4HF1A 2KIFA 1S7AA 5ICGA 4BY1J 3CCYA 3WG9A 1JJ6C 3ZOBA 4I09A 2KIUA 3J7AY 3ZQCA 1R5HA 1R22A 1BI0A 3JRFA 3GO5A 3LOCA 4KISA 4X6AJ 4HOBA 3T0YA 2R7SA 2IW5A 2FQ3A 5J1UA 1H9TA 1BIAA 3BG3A 1MJ9A 4RGUA 1BI2A 2WV0A 4LJZF 4UHTA 4IQJA 1ETKA 4RBOA 3A01A 1WHUA 1IXCA 2GIVA 4C30A 3M8JA 3HYIA 4G7OF 2HPIA 3H0GJ 5HLGA 3OYAA 2EV0A 4Q5SF 2E5NA 2JUCA 3HJEA 4A5NA 4ESJA 1WFXA 4BXXJ 3DP7A 3IKVA 2JVGA 1LFUP 5HS8A 1P7IA 1AU7A 2CW7A 3GLLA 3BTIA 3K4JA 2QQ9A 4IL6C 4CCOA 3G4SI 1LDJA 1JTYA 4ZJZA 3KP4A 1GV2A 4HQEA 1ITYA 2HYJA 2XF5A 4HA8A 4EJVA 2M3AA 4RAFA 1VFCA 2ZNZA 3K1PA 4EJWA 4CO8A 2BEOA 4HNUA 2JWTA 2X6XA 2BW3B 2XSDC 2H6CA 1ZR4A 2V6EA 4UY8I 4AU7A 3EUHC 2P6TA 5L3BA 3CCUI 1UFMA 5EYRA 1Z21A 1KA8A 2ZB9A 1K6YA 2ZJQF 2IA2A 2ZXJA 3R60A 3LWFA 4Q47A 3FHZA 4PJ0C 4KT6A 3OV8A 3L2QA 1KZHA 1MJBA 3HOTA 4IHVA 2L7FP 3BQZA 2BHYA 1FOYA 4NC7A 3BCBA 5J1RA 3NRVA 2RC4A 2HOSA 3OYIA 2AXLA 4IOCF 2FXAA 4OAZA 3FMQA 2IGKA 2OZ6A 4IHSA 4PSWA 3WE3A 3G73A 5ILVA 2OCCH 5M5WJ 2O5RA 3CMAI 2MLGA 2NVUB 4RLFA 6PAXA 1SANA 1T6SA 4BJTA 2FA5A 3J80Z 3AG4H 3FISA 2Q1ZB 2PN6A 1D0XA 3OOUA 3Q9SA 4RGXA 2E7WA 3BG9A 3QQAA 1OYWA 3MD2A 4RAZA 2HDDA 3P9CA 3C18A 2G0EA 3SQNA 2EZIA 4W1UA 5KAFC 2WAEA 4IO9F 4AD9A 2K9LA 4WK8F 3OIPA 1H9GA 2EILH 2F5DA 2MC3A 3MKWB 4LLLA 2LYCA 5F1JA 1TC3C 5DUKA 5E8GA 5IP7J 3BROA 5JLXA 1YJ9I 3P7NA 3QOPA 1ZG5A 1IN8A 3UKGA 2X1EA 3TO9A 1KQ9A 4F52A 2RVCA 2M45A 1Z1DA 3IAS2 2X85A 4DOZA 1REPC 4HYEA 2M30A 1MSEC 4Q4ZF 1ENHA 5FROA 1YOVB 4C2MJ 1W0UA 3FDYA 2DFFA 2NVQJ 1TWFJ 2IXSA 1R00A 2XDVA 2H09A 1EH7A 3JSOA 1LKXA 2WV1A 1X1PA 4NB5A 5HDNA 4U7DA 1SD4A 1OFCX 1TLHB 2R7OA 4XM3A 2VI6A 4WF2A 2XSJC 4A2UA 1VQ7I 5H20A 2KPMA 1V5EA 4P5OA 1R9TJ 1U9NA 1B4AA 3HM5A 3OL4A 4F3QA 4B8XA 3M9AA 2DTZA 1FMWA 4M72A 4EMSA 1FSHA 3PFYA 5E3MA 3CDHA 5LBQA 3HHGA 2X6WA 2BHZA 2DK8A 5CVIA 1WJAA 2F5VA 5D8KB 3BTCA 2RV8A 1ETYA 3HSFA 3RIRA 4HV6A 3S3OA 3HOVJ 2WWYA 1RNLA 3I4PA 1HOMA 3P9KA 1LDKB 2ZXHA 4E4HA 4AYBA 5D5UB 4I98B 2KDOA 2BVMA 4L9VA 3PL8A 2DOFA 3ZCOA 2E1NA 2QWWA 2W4SA 5J8FA 2IA0A 4F91B 4HX8A 5EEAA 3PQKA 5F04A 2B9SA 2KZGA 4ENMA 2A68F 2EIKH 1Z6TA 1RIOH 1GVDA 3OIQA 2OQGA 4RM2A 2K3FA 3S1MJ 4P9FA 3FXRA 1BJZA 1B8IB 3I4NJ 4CYCB 2MD0A 1XGMA 3V8KA 3BR0A 2L9SA 4BE2A 2Y0MA 1JUPA 1HBXG 2OTLI 2F5FA 3R6SA 2DYSH 2DCEA 3R0JA 2DOEA 3HOZJ 5DTDA 5D8LB 4DW6A 4BAYA 5GPAA 5LGTA 2LF7A 4BHPA 2EWNA 3IL2A 3KEOA 5F0HA 3G71I 1W5TA 1ZKGA 2EV6A 4A0XA 4CUGA 1JE8A 4RB2C 3S1RJ 1IZ1A 2MA3A 2RKHA 2WY7Q 3BT9A 1O3RA 1D0YA 2Z2SB 5HDGA 2L7MP 3VODA 3S16J 1N78A 2ISZA 1HLVA 4MEXF 4KJZA 3CCJI 1LE8A 1YYVA 3KCCA 1IUFA 2DJNA 5F0CA 1SFXA 2X6OA 4KITB 3CC2I 3A2KA 2WAQA 1OCPA 3S17J 3DTIA 4QIWN 4FISA 4G12A 5J4VA 3GFIA 4M6XA 1XPXA 3VSLA 3GFMA 1RPWA 2IGNA 5J40A 1YX5A 3OWTA 4QSHA 2D2WA 4ZDOA 2VQHA 2PX9A 4M9ZA 2K02A 2R7XA 1B59A 3Q0UA 2WA0A 1BR1A 2CQ7A 3ZN0A 2FE3A 5D5WB 4N9HA 3F3XA 1LB2A 5AIPA 4G6QA 2NS8A 3NEUA 5FKLA 3WGGA 3KETA 1DGWY 3CESA 1GT0C 3ZQLA 3HKZA 5K5QA 4RB1A 2O0YA 1FIPA 4MQ9F 2KRHA 3FKJA 1K4TA 2FOWA 3F8FA 1Y0UA 2DA3A 4AYBN 1XSXA 2GIZA 5ICCA 2IS6A 1PUFA 1P4WA 3H92A 1SEUA 3G6EI 2HOTA 3OS0A 4NC6A 4A3CJ 2HPMA 3V8LA 3R61A 2FBKA 5DS9A 2CUFA 3E5XA 4YFNF 2NVXJ 2STWA 3S2DJ 2H6BA 2H94A 4RB3C 1BR4A 1WWXA 2QBYB 1M1EB 1W7PB 1EV7A 4I6ZA 1V55H 1E17A 1B72B 3KFWX 2R7RA 1B1BA 2Q2EB 4EJOA 2F6CA 1IXRC 1Q1VA 5FKKA 1G3SA 3CMEI 2F5CA 1OR7C 1S7OA 2DMTA 1J59A 2ZSHB 4E7KA 4G9YA 2BGCA 1T08B 3WU1B 2R7FA 3ESWB 1T98A 1MMAA 4B44A 2NOJB 1HC8A 1O3SA 5L3EA 1SD5A 4IZZA 1X3UA 4XKWA 2P7CB 1K4SA 1K7AA 2R3SA 2MC4A 2ZCWA 2LMDA 4XSZF 1L0OC 5LD2C 1NG7A 2RN7A 5IYDJ 1FBQA 2K27A 2Y30A 2IS1A 2YR2A 2BY1A 1IO2A 3ELKA 1OCZH 1TWHJ 4PFPA 3A0HC 1GUUA 3ZMVA 2GXGA 1D8KA 3QPLA 3BZCA 2EA2A 2FSWA 3FKIJ 1VQ4I 2EZKA 3SEZA 1JJ8C 1IV8A 4PDKA 3Q9VA 4S04A 4Y3OA 1MNEA 2M34A 2R7WA 3BP8A 4CCJA 1U5TA 1TZLA 2TRTA 2PFBA 3LSTA 2FD5A 1IUYA 4ZZLA 2I5UA 3GTJJ 1HW5A 4AWXB 2VL8A 4P9UA 1JKQC 3KEYA 2XHKA 1BBYA 3FF5A 1MMNA 4RMNA 1YJWI 5F6FA 3K70D 3KP6A 4B4CA 4XLAA 1UB9A 3V8JA 2X1CA 3HPGA 5EJCA 3KP5A 3CDIA 3GTGJ 3C1DA 1U5TB 1LVKA 4A69C 4BXUA 5IP9J 4AIKA 4IQ4A 2KP6A 2XKPA 4XN0A 1DU0A 2OA4A 4HPQA 4EM0B 3ECHA 3MZ8A 1ZK8A 1NK2P 1XGNA 1BI1A 2Z99A 1FP1D 3MKZA 2OF7A 4G8XA 5LHHA 1TQIA 3MKYB 1IDYA 1OYYA 1SVOA 3B6CA 2YS9A 1H0MA 2CUEA 3IC7A 3GFLA 2UZKA 3WTZA 2G7HA 3A01B 1MSFC 3TP3A 3CCQI 1W0TA 3RCOA 1ZH5A 2VBZA 3AG3H 4PUSA 1GV5A 3IUOA 4PFOA 2XRLA 1FT9A 3DLAA 2P5KA 2ELJA 3VFZA 2XASA 1WKMA 1Z7UA 1D3YA 4L5EA 2ZO4A 2ACJA 9ANTA 4DBQA 2VPLA 3OYMA 1JUSA 5DM6F 3I59B 1ONVA 5LFAA 2M7BA 4XOPA 2ZNYA 4II3A 1GDTA 1SD6A 3BPVA 3KEQA 1T2KA 4QWQA 4CXFA 4ABZA 2ID3A 3M07A 4Y17A 2QCOA 2R92J 4XK4A 5FD5A 2W57A 1PJRA 2W85A 3BG7A 2M4KA 3ROUA 3CUQB 1AWCA 1KYWA 3ZMDA 2M8GX 2K9MA 3WTSC 3CCLI 1H8AC 4ZYHA 1BA5A 1Y6IA 5HLTA 3S2HJ 2PMHA 3WTXC 2DA7A 4E6KG 4A3JJ 4L9JA 1FY7A 3DBLB 1ACIA 4XKCA 3JTGA 3O3KA 3T1BA 3I58A 2DFHA 2MH9A 2QA4I 3JAMK 4HLXA 1X19A 3MCZA 1VI0A 4DYCA 1N25A 3CLOA 1HKQA 2FUG2 5EEGA 2H1LA 3I55I 5DYMA 4PCQA 1YO5C 1Z05A 1IGNA 1NH3A 2HDWA 1G2HA 4CYCA 2NS7A 3HDDA 5FGMA 2VODA 2UV1A 3ML6A 4NDLA 3K4CA 1ZLJA 3L00A 1LFBA 2DPUA 3M8EA 2QF7A 2JPCA 4IKFA 1YW8A 4FT8A 1Y1WJ 2Q2EA 2PI0A 1ULYA 4ZYGA 1OCTC 3HGYA 3E6DA 3QP6A 1USTA 2DA5A 5FKOA 4B48A 2LY9A 2CU7A 2CYYA 4DGWB 2E36A 3E6MA 3TO6A 1SMYF 2KLOA 1SFEA 2BOLA 1FYKA 2LG4A 2K3PA 1I50J 1OISA 2KISA 1Z6RA 3VEPA 5HOOA 3CCSI 1XCVA 2IGOA 2PJPA 3TMOA 1Y0NA 2IP2A 2UXXA 3IP4B 3C7JA 1XCBA 1JKOC 3O8GA 5KCMA 5KK1A 2DTRA 3H9JA 2BXYA 2B7EA 1FBSA 1MIJA 2VC0A 2VQLA 3ZR8X 2HXOA 1VQKI 3K9TA 3QWLA 4KIBA 2V1NA 2A6TA 4PJJA 1YLFA 4U0WA 1Q1HA 4Q48A 1IW7F 2NOGA 4F93B 3BPXA 4JOMA 2LKXA 4HAMA 1U9OA 2L9RA 4QLCU 4BJ6C 5CLSA 2IRFG 1SFOJ 4WXHA 2HTSA 2C6YA 3CP2A 5BS6A 3BR6A 4OWRB 4LG0B 2JA8J 2JA7J 2HDCA 2AQFA 2JTVA 3NAUA 4BQNA 2HKOA 4GO1A 1XTAA 4UUSA 2CMPA 2HYFA 2R5YB 4HZFA 4YELA 4BY7J 1PP7U 1LEBA 2FBIA 3PNYA 1TT0A 1F36A 1BL0A 4KNYA 4I02A 4BHCA 4F55A 1LQ1A 4M3DA 5HLIA 4YEJA 1YE9A 2X9DA 2VT3A 2DN0A 4IXAA 3HSRA 3QRFF 5TISC 4XICA 2W82A 2L4AA 2XV4S 3PSIA 3J7AO 1ZQ3P 3DFGA 4LITA 3E5UA 2STTA 4RLQA 1MBEA 3K4NA 3K4KA 3ZQHA 2R5YA 3HC7A 3TDUC 3FMRA 1R71A 1C0WA 2HEOA 2E35A 4KMUX 3RQIA 5FLVA 2WADA 1HA8A 1FNNA 1HKSA 2JQ7A 4A0ZA 3GXOA 2E2IJ 3AL0B 2OPTA 4X0GA 1JXSA 5J4YA 1N77A 3I59A 4A5MA 1PP8F 1MBHA 1T56A 1LEAA 1P92A 3I71A 4KN7X 3FK6A 2PLYA 3IHUA 5KVRA 1E3PA 1OQYA 4D5FA 2BYVE 3S15J 3G1OA 4MNUA 3U1DA 2GLOA 1UHSA 3S8PA 2JA5J 4HF0A 5LEJA 2E5ZA 5K1YA 1WPKA 5E1ZB 2YX7A 2HZTA 4M9XA 3GUDA 1BJAA 3UR3C 4XRSG 2KMUA 3RPUD 4JK1X 1I39A 2MYSA 3W6VA 3VOEA 2LSOA 2W48A 4IRIA 4JYKA 3RKYA 2KDZA 5BMZA 3RYRA 1RETA 1XMAA 3C3WA 1SAXA 1FYMA 2QQ8A 2HZDA 3K69A 5K7FA 4XKVA 2LR8A 3ASOH 3E97A 2V4JC 1MH3A 3S1NJ 1ZAOA 5E3NA 4NHJA 5M5YJ 3RDIA 1WQ2A 1T95A 4LK1F 4A3BJ 4RGSA 2YX4A 3OIOA 1GLNA 1YHQI 2V26A 3CCVI 3DCFA 1XS9A 4UVCA 5D5XB 4ZYAA 4LD5A 1W5CC 2DW4A 1DQUA 2DFIA 2OJED 4XQFA 2LFBA 1A5JA 2IJLA 2W24A 2JZYA 3IH2A 1K79A 3EUAA 5HDKA 2EINH 5JI6A 4XONA 1B72A 2P5VA 5HS9A 1X1CA 3CO6C 1J75A 3QYBA 2CQXA 3SZGA 1D0ZA 3OS1A 1GXPA 2R7TA 3DTKA 4ZTFA 3L2WA 1Z7LA 5K7HA 4PJMA 3QOEA 4Z6YA 5CKTA 4HRIA 1IC8A 3K6GA 4JX6A 3OYBA 4E7LA 1YIOA 5IOZA 2KL4A 4IOAF 1ETWA 3FX3A 3CF2A 1U6GA 2O6GE 1F43A 4O5VA 1HSTA 3E3VA 1YRNB 1MDMA 1V54H 3FZVA 4GYGA 3RKXA 2Z9OA 3K0LA 2QQBA 2V9VA 2UXNA 2XAQA 3CUQC 3U2RA 3PSFA 2PJRB 2IPQX 5FFXA 4XLCA 3DU6A 4IEJA 5LRSA 3K1NA 2EB7A 2CQKA 4BL0B 3HPHA 4TV7A 4M3GA 2D5VA 1K83J 2RREA 5E1WA 1ZRDA 3FK7A 1P4AA 4HF2A 4WXDA 5F64A 1E3OC 2CWEA 2X51A 3O2PE 5TJJA 2X48A 5GTIC 4EJTA 2PJRA 3GVAA 2KT0A 4ZZDA 3HTSB 3MVPA 2EQRA 5JHUA 3OYDA 2RDPA 2YU9J 3W2AA 3DWLE 4RGRA 4NQWA 4XLPF 4HDVA 1J0RA 3WTYC 4FTHA 2Z3YA 2ZJ2A 3T8RA 2P7VB 2KIQA 2NAZA 3ASNH 4PK4A 2CS3A 3H3UA 2P5LC 5M5XJ 1HKTA 3S93A 3ZP5A 1L3LA 1KONA 4DNCA 1QRYA 4M71A 1FTZA 2X1DA 1AHDP 4EM2A 3L2VA 2WAQN 5FB2A 3P5JA 2HS5A 2EFQA 1R7JA 2RNGA 3LSIA 1W7PD 3F8CA 3IAM2 3TW7A 2HOAA 1ZARA 4S0HB 5B1AH 2HU9A 2OAZA 1ON1A 2VBXA 2MH2A 2D45A 4BEHA 3K7AJ 3V42A 1EA3A 4U0VA 1VQ5I 3H9QA 4G7ZF 3SDBA 3OSGA 3HTUA 1U8BA 1F9NA 1TW3A 1B6AA 3ISPA 4I99C 1KGSA 3M7GA 1X1AA 1SVLA 5M3FJ 1I6XA 4XNFA 2HQNA 2NS0A 1SVMA 2Y2ZA 2E1MC 3J81K 3EDPA 5GADJ 5ILSA 2K9QA 4QPOA 1R6RA 4MEYF 4DIQA 2XB0X 2DT7B 4IF4A 4A3EJ 4KYWA 4Y52J 2BXZA 1X2NA 4N4NB 1TWGJ 3F6OA 2EBIA 1QO0D 5EGOA 3IH3A 1MBFA 2XPUA 3KP2A 2XUBA 2CQNA 2E2JJ 3K1MA 5GAGJ 4KIFA 2K86A 1QA6A 3FXMA 1TWAJ 5ICFA 1HQCA 1BW5A 3D0SA 3KLOA 3R0AA 2A69F 1UG0A 2NNNA 2DO7A 3IKTA 3F8BA 4P96A 2L9VA 4CZCA 3S1QJ 1ZG1A 2JSPA 1KU3A 2E34A 3H3ZA 3VYUB 1HDDC 3K2AA 2DLLA 2XIGA 4EATA 1P2FA 5HODA 2R0QC 5DD4A 3T5XA 3WHBA 4ENNA 1O3QA 4O3MA 1NTCA 5TRDA 1VQ9I 1FTTA 3JRHA 4HV5A 1S3JA 4ENJA 4UVAA 4HSTA 3OYHA 2ZC2A 2W25A 3QPTA 4U0YA 2XGCA 1LUJB 2WTEA 5FFZA 2F4OB 1IRZA 1USSA 3H36A 1ZREA 1NHAA 4RB0A 2CGPA 1AA7A 4I7HA 2A6EF 1X1BA 5A2QK 2X6YA 4HQMA 1ORKA 3WG7H 2R4GA 5JFRA 4H0EA 2ID6A 1GXQA 1P4XA 1X58A 2LOOA 5ILUA 3BZ6A 2EIJH 2DQLA 1F1ZA 2VKVA 1G3TA 2ME6A 3K70C 3EUHA 2V9KA 2DU9A 4CH7A 4CZZA 2P0WA 3B6AA 5IYBJ 2QYOA 2DA1A 3AFHA 3HB9A 3SFZA 1VTNC 2DA2A 1VF9A 1XX5A 3GZ5A 1XMKA 4XBFA 5DDGA 1MZBA 1BR2A 1EH8A 3CDLA 2DDAA 1VQMI 1K78B 3ZQFA 2PG4A 1TNSA 4GXOA 3V4GA 4UB6C 2XROA 1H88C 4H4KC 3BQYA 1IRGA 2CV2A 3KYCB 3PUBA 3AG1H 3KZIC 4LLGF 3OYGA 3I4MJ 2P6SA 3SXYA 3LAJA 4OIOF 1SMTA 2DJIA 2IAIA 5LGNA 3COAC 1I3QJ 2QVOA 3TL4X 4XLEA 2LC2A 2JJ7A 1QZYA 5J8CA 1BOBA 3FXUA 2JPBA 1UG2A 3HRMA 5DV5A 3HOWJ 3CD6I 3WU0A 2NNYA 2UUZA 4BHBA 4D0PA 2E60A 2PMZN 3DV8A 3CMMA 5JHFA 2MABA 3E1SA 2CV0A 2ESNA 4KICA 3MFKA 3NARA 2ZBKA 3RTRA 4UV8A 3ZMSA 3IRQA 4ZC3A 4CCKA 4OIRF 1S9HA 1FP2A 1OPCA 3GYHX 4K2EA 1K6OA 3HBLA 3CF5F 1Z77A 4BDYA 2XF7A 4XN3A 2K9SA 4LB5A 4YIFA 1W7PA 4ZDPA 5H6RA 4E7ZA 2ZXWH 2X4HA 3DLLF 5E3OA 3S3NA 4CICA 4IJAA 5KNLA 1S29A 2KQRA 5A2QZ 1XC5A 4UUSB 3CO7C 5L3CA 3SJMA 2FX0A 1K61A 2K5CA 2GZWA 1Y8QB 3VSKA 4AIJA 3MEXA 4FQGA 1A35A 2CRGA 2YPRA 1GVJA 1JT6A 1R23A 4M9SA 3RQ4A 2O8KA 1T39A 3HOXJ 3DBRB 3J7ZI 1RZ4A 4QTRA 3OYJA 5CVUA 2Y69H 2DQRA 5JVGF 5E3LA 2LP0A 1EH6A 3J80K 1UJ8A 4GRIA 2ZXIA 1PDNC 4ASNA 1LDDA 1STZA 1JKRC 5IT9Z 3QAHA 2PEXA 1HF0A 5DCMA 3KYDB 3CZ6A 2RAEA 3K2ZA 4D7MA 3A1YA 3DBHB 4IPAA 1BOAA 3GEZA 2FOKA 2W1OA 5H6QA 2R7ZJ 4XRSA 3CC7I 2E7XA 2F4IA 2WB1A 4KN4X 1FSEA 3WE2A 1FWZA 2AO9A 2HNHA 3FXKA 5E8IA 2VKEA 3EETA 3W3CA 4S05A 1TWCJ 2A6HF 3F6VA 2UWMA 3RKWA 3ZPLA 2ZMEB 3CCMI 1WJDA 1ZR2A 5HNHA 3S2WA 3BTLA 1B9MA 2CH0A 4B3XA 5K5RA 4YRVA 2FRHA 2O9LA 2Z33A 2Z16A 3ABKH 2XGEA 3LSPA 2GBYA 1ZTRA 1R58A 2PMUA 3CQZJ 1A6IA 1ZN2A 3RZDJ 3LA7A 1JGGA 2DA6A 2L0KA 1XG1A 2BVLA 2VPRA 2VT2A 3JRCA 1IDZA 4NQWB 4KT5C 5L3DA 2DPDA 2XPWA 3JRDA 3PO2J 2CFXA 2DMNA 4JX4A 2CO5A 4A3MJ 4OIQF 5FLMJ 2EK5A 4DYRA 4C2TA 4FE7A 2GOXB 3KP7A 4C9YA 3WU2C 2JSCA 1W1WE 3GFJA 3N4MA 2EFOA 4ZDLA 1KU7A 4XSXF 4KIGA 1WH7A 3EQLF 4LIUA 2LKSA 1ZRCA 1G3YA 3A02A 4AM3A 2P81A 5HS7A 3BCAA 4EGYA 1VQPI 4PJLA 1RKWA 2KZVA 4CDGA 4PGGA 1A31A 1U5TC 5CJ9A 1G59A 2OBPA 1WJEA 4YFXF 2O61A 5EGOB 1W5SA 5LEKA 3GWZA 1WCMJ 5ICEA 4XL9A 1IXSB 4IHWA 1YW7A 1KU9A 5GTHC 1QBJA 4JP0A 4U87A 3H5RA 4KMFA 3FXJA 3Q5FA 2HYGD 3H35A 1ZGJA 3PIPF 3CMYA 4E7HA 1U8RA 2E1MB 4ENKA 5FD6A 2Q0OA 3WGIA 2GWRA 3HZJA 3HEFA 3U9GA 3CCRI 2LK2A 3BLYA 4YG2F 2LF8A 4ZYDA 1R5GA 2XGDA 1O3TA 1R49A 3A03A 3BOQA 1YQAA 2E2HJ 3OYCA 1LPQA 1G4DA 3GLXA 3H5NA 2QENA 4OMYA 1T33A 4FHTA 4M3EA 3SZPA 5EG0B 3W2VA 2HR3A 1SD7A 2HOEA 3IWFA 3M4OJ 1IG7A 3VYSB 4A12A 1TQMA 4HLYA 2QLZA 3K4BA 4UNOA 1BC7C 2JVHA 5GPCA 1IRFA 3QODA 3GMEA 1RR8C 3H1CA 3M3YJ 3K4MA 1R4MB 4FASD 1TL8A 2DODA 2BY3A 4IHXA 2L01A 4IVNA 4XOTA 5L3FA 1V5GA 1LFPA 4QPQA 4C3HJ 3GCMA 1FOXA 2BV6A
chains in the Genus database with same CATH topology
2OUMA 4NC8A 2MD0A 3EUAA 4BJ5C 2L9SA 4XONA 3OMYA 4BE2A 1X1CA 3QYBA 3SZGA 1D0ZA 3OS1A 2R7TA 2LRDA 3DTKA 4ZTFA 2DCEA 3L2WA 1Z7LA 4PJMA 2WBMA 3QOEA 4HRIA 5CKTA 3LFUA 3K6GA 3OYBA 1U0JA 1Z3YA 4E7LA 1UAAA 4HG2A 2KL4A 1W36D 2ZSIB 3CF2A 4XKBA 3ZRGA 4CUGA 4DJAA 2W7NA 2WY7Q 3EUKL 1D0YA 3HOSA 3BG6A 2Z2SB 4PSXA 1ZELA 2PMZA 4RM3A 1N78A 2MFZA 3D5SC 4KJZA 3PSFA 4HSRA 2PJRB 3DU5A 4NNJA 2L9NA 3HXLA 4XLCA 2KHMA 4KITB 2LY2A 3A2KA 3DU6A 3L2UA 2JA2A 2WAQA 3DTIA 3NWTA 2AQEA 2HQAA 2L5QA 3VSLA 4BL0B 3HPHA 4BUPA 4XR6A 2IGNA 1X4OA 2RREA 4C2UA 1YX5A 3PNVA 2QKLB 3OWTA 4ZDOA 3DKYA 2VQHA 1D1BA 2X51A 2R7XA 1QHHD 2WA0A 1BR1A 2PJRA 3ZQQA 3CP8A 1VZ0A 2Y0SA 3AL0C 4BE0A 4FETA 3OYDA 4BE1A 3DPTA 3DWLE 3CJRB 5TGTA 2HVQA 1DGWY 1T0FC 3CESA 3HKZA 2WY8Q 3PNTA 4LIVA 5FRMA 2GOMA 2KRHA 2LBFA 3FKJA 4PK4A 2M7AA 4IX7A 2CS3A 3S32A 3S93A 2R7QA 1KONA 3S3MA 2IS6A 4CCLA 4II2A 2X1DA 1P9QC 3OS0A 3L2VA 2HPMA 4BS9A 3W2AA 1MMGA 3EPZA 2RNGA 2VASA 1BR4A 3DEEA 3LSIA 4B47A 1SFKA 4XORA 3IAM2 3LSGA 4XMYA 2HU9A 2R7RA 2Q2EB 2WAFA 2CUJA 2F6CA 4BEHA 2CW8A 4CSWA 4MLOA 1MNDA 3V42A 3DPUA 1OR7C 1EA3A 4BQOA 3H9QA 2ZSHB 4E7KA 3SDBA 3VDXA 4BXFA 4BACA 1MMAA 4B44A 3AKZA 2NOJB 1X1AA 3QYFA 4XNFA 1W36C 4U7BA 4IZZA 3E0JB 4XKWA 2E1MC 3OS2A 2VKDA 2MC4A 2I8DA 2VIXA 4QPOA 1R6RA 4DIQA 2DT7B 5LD2C 2JUGA 3BC8A 3ZGKA 1NG7A 4N4NB 2Z1DA 1WJCA 2V7FA 3DKXA 3L2RA 2IS1A 3VYRB 4BGDA 4J01A 2L2OA 3LMMA 3SYTA 4PFPA 2L7KA 3DPLC 3OY9A 3OYNA 3SEZA 4E7JA 2XF6A 1UG0A 3D5LA 4Y3OA 1MNEA 2R7WA 4CCJA 2VJIA 1TZLA 4CZCA 2JSPA 1ERDA 3HUGB 3VYUB 3UNGC 2RQQA 1UELB 4D9JA 4EATA 2VL8A 3KEYA 3U21A 3OL3A 2VXZA 3NWSA 1J09A 1MMNA 5KHDA 4RMNA 4HSTA 3OYHA 2LH9A 3K70D 1D1AA 3HL2A 4XLAA 2X1CA 3HPGA 2DOAA 3I9V2 1AA7A 3A4CA 1LVKA 4IQ4A 2KP6A 3DQVC 1V5FA 4P1WA 1X1BA 4XN0A 2X6YA 4HPQA 4B43A 3FHNA 2VQCA 2R4GA 4ZTJA 2HVRA 2LOOA 4LG3A 3MKZA 3K70C 4BQQA 1D1CA 1NG6A 3MKYB 2V9KA 4CH7A 1FMVA 3OYKA 5CQEA 2P0WA 5HVQC 1Y56A 2M4GA 2IS4A 3HG9A 3AFHA 2R7VA 5CPRB 1DGRM 2HVSA 2OC6A 3RCOA 3M1CA 4PUSA 4D1QA 3H0DA 4E7IA 2IGMA 1BR2A 3IUOA 4PFOA 4AVZA 3DLAA 2CUZA 2ELJA 3I3LA 4H4KC 2CV1A 2CV2A 3PUBA 4DBQA 3KYLA 3OYMA 2VPLA 2CFOA 2VJ5A 4ANJA 4N4OB 5LFAA 3OYGA 2M7BA 4XOPA 4II3A 2M0MA 2DJIA 1WJBA 3TL4X 4XLEA 3RSNA 2LC2A 1BOBA 3FBNB 1YX3A 1PJRA 3C2HA 2UUZA 3BG7A 2E60A 3CMMA 2M4KA 5JHFA 2MABA 3E1SA 2CV0A 5CQGA 2K9MA 3LL7A 2VLAA 1Y6IA 3LSKA 5HLTA 3RTRA 4ZC3A 3KX2A 4CCKA 1S9HA 4E6KG 1E0EA 3LSHA 3K4LA 2XAUA 2DT6A 2VB6A 4XKCA 2LY1A 1MW7A 4BDYA 3OR2C 2XF7A 4XN3A 3J7AY 1X19A 2A5WA 4ZDPA 4E7ZA 3S3NA 4XLFA 4KISA 3H9GA 3TBIA 2R7SA 2FUG2 5KNLA 2KQRA 4NUBA 4HEA2 2K5CA 3VSKA 2HDWA 4IQJA 4Y33A 3CJQB 4PJNA 4C30A 3RQ4A 3M8JA 2UV1A 2HPIA 3K4CA 4R79A 3OYAA 3OYJA 3ONQA 2E5NA 4CCNA 4GRIA 1WFXA 2ZXIA 4IKFA 1N75A 2JVGA 3CZ6A 2IS2A 1OLTA 2CW7A 3A1YA 3K4JA 3D5RC 4B48A 2R7UA 2W1OA 4CCOA 4DGWB 4ZJZA 2F4IA 2WB1A 3OR1C 2XF5A 4F92B 2KLOA 2M3AA 2BOLA 1WJ5A 3QYEA 2LG4A 2HNHA 2K3PA 2VJJA 5FRNA 2VJ4A 4HNUA 5HOOA 2X6XA 2IGOA 2BW3B 3W3CA 3C2GA 3FBIB 3TMOA 1IRXA 3IP4B 2V6EA 3VYTB 3MMYB 3EUHC 4AU7A 4BDZA 2UWMA 5KCMA 3H9JA 1Z21A 2VQLA 3ZR8X 3F9KA 1SAUA 1WJDA 1K6YA 2BW3A 3H5AA 5HNHA 2CH0A 2V1NA 2A6TA 4B3XA 4PJJA 4ITVA 4KT6A 4YRVA 4J00A 3L2QA 3HOTA 4NC7A 4F93B 2Z16A 3BCBA 4JOMA 2DXIA 4BJ6C 1Z3XA 3OYIA 4OAZA 2IGKA 3CP2A 4OWRB 4PSWA 2BVLA 3K10A 5HNFA 2AQFA 4BQNA 2O5RA 4NQWB 4E7SA 4JQFA 2CMPA 4BU2A 4YELA 4RLFA 4BJTA 3PNYA 2KRCA 2Q1ZB 1TT0A 2LBFB 1QU3A 1D0XA 3OOUA 4F55A 3OYLA 3MD2A 4YEJA 1YE9A 4C2TA 2GOXB 4C9YA 4ZDLA 2VQGA 2WAEA 1X4PA 2W82A 4CCMA 2K9LA 3OIPA 2VKHA 1QHGA 3PSIA 4LIUA 4G6TB 4LITA 2W00A 3BCAA 3MKWB 4PJLA 2LYCA 4RLQA 3K4NA 3K4KA 3OYFA 2KZVA 3HC7A 3OYEA 1G59A 1G8XA 1WJEA 4BEHB 2X1EA 4F52A 2WADA 3IAS2 4DOZA 2X85A 1HA8A 4XL9A 5FROA 4U87A 4X0GA 3H5RA 3AL0B 1N77A 3FDYA 2IXSA 2OV7A 2XDVA 3H35A 3PJRA 4E7HA 1LKXA 2E1MB 3G2BA 4XM3A 2R7OA 2XSJC 3W2WA 2KPMA 1V5EA 3BLYA 4P5OA 3S8PA 1X1DA 3OL4A 4F3QA 2ZFUA 2E5ZA 3DTEA 1FMWA 2VXDA 3PFYA 3UR3C 2KMUA 4Y4RA 2X6WA 3RPUD 2MYSA 1WJAA 2F5VA 4DBRA 3OYCA 3S3OA 1WJFA 3LSMA 3H5NA 4HNTA 2HZDA 4CA0A 1LDKB 4XKVA 3W2VA 3ZXSA 1DP3A 4OAYA 3SEQA 2ZXHA 3VYSB 4E4HA 2V4JC 4AYBA 3K4BA 2JVHA 2KDOA 2BVMA 3QODA 3PL8A 1T95A 3ZCOA 3GBGA 3K4MA 3N05A 1GLNA 2W4SA 2V26A 1JI8A 4XLHA 4F91B 1PYVA 4FASD 2XC7A 2QKMB 1MMDA 4XOTA 4ZYAA 2LREA 1V5GA 1LFPA 3OIQA 4RM2A 3VWBA 4QPQA 1DQUA 4XQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U21 A; 
#chains in the Genus database with same CATH topology
 2FQ4 A;  2LDU A;  2OZU A;  4NC8 A;  5J1Y A;  2NVT J;  3WTU C;  3OMY A;  1IV6 A;  2NXN B;  2QEX I;  3C2B A;  3ERM A;  2COB A;  1IAW A;  2Y9Y A;  3F21 A;  2GA2 A;  1E2X A;  2LRD A;  5H2F C;  3CJT B;  3MN2 A;  1OCC H;  2EA4 A;  4G7H F;  1HSJ A;  2X0L A;  2ECC A;  1IF1 A;  2YSR A;  1VQO I;  4HG2 A;  1IN4 A;  4M74 A;  1W36 D;  2FF4 A;  2LNB A;  3ZRG A;  4BH9 A;  1G3W A;  5C4X J;  2PQ8 A;  5LHI A;  3EUK L;  1KU2 A;  2R93 J;  3HOS A;  3BG6 A;  1KYZ A;  2ESH A;  1ZEL A;  4RM3 A;  2MFZ A;  1GHC A;  3JAM Z;  4AIH A;  4HSR A;  1DUX C;  3DU5 A;  2FU4 A;  4NNJ A;  2ADU A;  2L9N A;  2VE8 A;  3HXL A;  4BBR J;  1FYL A;  3GF2 A;  4M3F A;  5B5E C;  2JA2 A;  2P4W A;  2QSG X;  4ON0 A;  3E6C C;  2V6C A;  2BE5 F;  3QPS A;  1MMS A;  2L5Q A;  1BIB A;  3F72 A;  3REO A;  2HI3 A;  4BUP A;  3CLQ A;  2EZL A;  2R7D A;  5JLW A;  1X4O A;  4C2U A;  3PNV A;  1LJ9 A;  2QKL B;  3RKQ A;  2LLK A;  5FLX Z;  1AOY A;  1HW1 A;  1D1B A;  3BJO A;  2Z5U A;  4B09 A;  1YI2 I;  1D5V A;  4J19 A;  4A6D A;  3ZQQ A;  3GTL J;  1FBU A;  1MNM C;  2LKP A;  3CP8 A;  5GAE J;  2NRA C;  2Y0S A;  5B3S H;  3AL0 C;  1I1S A;  1S6L A;  1U3E M;  3GTQ J;  4BE1 A;  1QZE A;  1W4M A;  2DAO A;  2VOP A;  3DPT A;  3HIF A;  1B9N A;  1WRJ A;  2JT1 A;  2H27 A;  2O8X A;  2EZH A;  1ETQ A;  1CF7 A;  1MBK A;  2XB5 A;  2WY8 Q;  3PNT A;  4LIV A;  3BTJ A;  3FIW A;  3TED A;  5FRM A;  1RKT A;  1I27 A;  3S32 A;  3A0B C;  3LAP A;  4B1R A;  3S3M A;  1VND A;  2GAU A;  3PM1 A;  1T8I A;  1WZ2 A;  4R8H A;  4LFU A;  1P9Q C;  4AC0 A;  5BNG A;  3LSJ A;  2P8T A;  4LK0 F;  2ZJR F;  3EPZ A;  3GTO J;  4N0B A;  3DEW A;  1SFK A;  4XOR A;  3I54 A;  4A0Y A;  3LSG A;  3SDG A;  2OD5 A;  1MKM A;  2CUJ A;  2CW8 A;  2E1C A;  1R36 A;  1MND A;  4MLO A;  4MHG A;  4YIR X;  3CCE I;  2R5Z B;  1V3F A;  2ZFW A;  1CQT A;  4BQO A;  3MZH A;  5FO5 A;  3I56 I;  5FKM A;  2K4J A;  4BXF A;  3NQO A;  4BAC A;  2KIM A;  4ETS A;  3AKZ A;  4UUV A;  1OCR H;  3QYF A;  2CW0 F;  4F7Z A;  4MQV A;  4U7B A;  1WVR A;  3E0J B;  3GZ6 A;  3OS2 A;  1JTX A;  2VKD A;  2I8D A;  5DCM B;  2VIX A;  2V9P A;  4NBQ A;  3JR9 A;  5EF6 A;  3F8M A;  2GQQ A;  3F0C A;  1TT5 B;  2JUG A;  1POG A;  3BC8 A;  3ECO A;  1ZGA A;  1WJC A;  2V1X A;  2V7F A;  3L2R A;  2FEZ A;  2H1K A;  1G6N A;  1QPM A;  2DYR H;  4EVI A;  4BGD A;  4J01 A;  5LHG A;  3SYT A;  1XGO A;  2L54 A;  2L7K A;  4G94 A;  2DT5 A;  4L0Y B;  5D4R A;  4B3A A;  3OY9 A;  4G6D A;  3WGH A;  5D4S A;  4UVB A;  2XAG A;  3I0T A;  2XF6 A;  5HLH A;  5EG0 A;  2A61 A;  2O03 A;  4UXN A;  3O8H A;  5J47 A;  1IJW C;  4Y7N J;  4PZJ A;  1ERD A;  2VN2 A;  2M0C A;  4AID A;  2QQA A;  3HUG B;  1XDS A;  3UNG C;  2RQQ A;  1UEL B;  1RI7 A;  2H8R A;  2FJ1 A;  3JRI A;  1YTY A;  5IT3 A;  1XN7 A;  3U21 A;  4WX9 A;  3OL3 A;  2VXZ A;  1H89 C;  3WTV C;  5J6X A;  3NWS A;  1J09 A;  2DK5 A;  2VUM J;  1VQL I;  1WI3 A;  2FML A;  4LOC A;  2JRT A;  3EYY A;  2W84 A;  1A04 A;  3RJP A;  1D1A A;  2BBY A;  5AIQ A;  1XMX A;  3G1L A;  1DDN A;  3V7S A;  3I9V 2;  5FLX K;  2QUF A;  1YS7 A;  1LNW A;  1QVU A;  3LQQ A;  2VE9 A;  1V5F A;  1YIJ I;  5EDN A;  2RNJ A;  1T38 A;  4B43 A;  5L3G A;  2L02 A;  3FXO A;  3MQ0 A;  4MTE A;  4YII A;  5EZG A;  4OIP F;  2HVR A;  3WHC A;  1ON2 A;  3AAF A;  3PUF A;  4LG3 A;  2QSF X;  1E3H A;  2QBY A;  4LMY A;  1D1C A;  3TKY A;  4DQ2 A;  3IV5 A;  2L4M A;  1RES A;  2M87 A;  3G3Z A;  1FMV A;  4RAY A;  3OYK A;  3TW6 A;  3TQN A;  4P55 A;  4AVP A;  2M4G A;  4JX5 A;  5DUI A;  2IS4 A;  2VBW A;  3ERE D;  1RR7 A;  2OC6 A;  2XRN A;  3BZK A;  2GXA A;  2OU2 A;  1DPR A;  4E7I A;  2IGM A;  2VC1 A;  4AVZ A;  4GDF A;  4WXC A;  3HRS A;  2HXI A;  3I3L A;  1I5Z A;  1FPQ A;  2DA4 A;  2CV1 A;  4GGG A;  3KYL A;  4ANJ A;  2HWV A;  5GAH J;  3ZMZ A;  2M0M A;  1WJB A;  4A93 J;  3RSN A;  1S7E A;  2KJB A;  1R1V A;  1BC8 C;  4CHU A;  1R5I D;  5BPI A;  2XAH A;  3JTH A;  2Y0S N;  1XSV A;  1DP7 P;  2K7L A;  2VOO A;  2M1B A;  4ZYE A;  1FZP B;  3LL7 A;  2A07 F;  1TW2 A;  2EIM H;  3F8N A;  5FKN A;  5IPA A;  2K4B A;  2K40 A;  1E0E A;  3ZN1 A;  3ULQ B;  1DU6 A;  1WGX A;  2DT6 A;  2DBB A;  2M8E A;  2LY1 A;  1MW7 A;  5JR3 A;  4ESB A;  4KDP A;  3OR2 C;  2MD5 A;  3TDZ C;  1FOK A;  1QPI A;  3QPH A;  3MZY A;  4BNC A;  2A5W A;  2GXB A;  2J5P A;  3IH4 A;  4XLF A;  3SZT A;  3H9G A;  2JK3 A;  5B1B H;  3TBI A;  4BYY A;  5M3M J;  2PBI A;  4NUB A;  4GFB A;  2HTJ A;  3T8T A;  4HEA 2;  4OMZ A;  2FNP A;  2MSY A;  2ZME C;  5D6F A;  4Y33 A;  3CJQ B;  4PJN A;  1KQ8 A;  3WTW C;  1D5Y A;  3QP5 A;  4E70 A;  4R79 A;  3MAJ A;  2ELK A;  3ONQ A;  1ZRF A;  5CYV A;  4CCN A;  3TOB A;  1Z67 A;  1TNT A;  2DMU A;  3LA3 A;  1N75 A;  1F4K A;  1OMI A;  3W6K B;  4EM1 A;  2IS2 A;  1OLT A;  4IRH A;  2NYX A;  3D5R C;  2R7U A;  2OCE A;  1YFH A;  1JT0 A;  3ZQG A;  1APL C;  3FMS A;  1ETX A;  3OR1 C;  2N8G A;  3ABT A;  3VPR A;  5DEQ A;  4F92 B;  1VQ8 I;  1I3A A;  1MH4 A;  1WJ5 A;  3QYE A;  3DEU A;  2VJJ A;  3L09 A;  4I01 A;  5FRN A;  2VJ4 A;  1J5Y A;  1U2W A;  2QZ8 A;  2LVS A;  3KIO A;  2XAJ A;  3C2G A;  3FBI B;  3PO3 J;  1IRX A;  3BJ6 A;  3VYT B;  1S5L C;  4CGZ A;  3MMY B;  1MD0 A;  5DCF A;  4BDZ A;  2I10 A;  1XDU A;  3ZQI A;  3DXJ F;  3M1E A;  3M8F A;  2A3S A;  3F9K A;  1SAU A;  2BW3 A;  3H5A A;  2HQ5 A;  5CVR A;  1R4N B;  3BR3 A;  1CF7 B;  2EFP A;  4ITV A;  5K5O A;  4J00 A;  4GYI A;  4L9N A;  2KKO A;  3GTK J;  3L9F A;  2K9N A;  3SHF A;  1BW6 A;  1X3Z B;  1RUN A;  2DXI A;  2Q8K A;  1UZC A;  3PIO F;  1HDP A;  1R1U A;  1Z3X A;  2B0L A;  4L18 B;  3BG5 A;  1A6Q A;  1UHM A;  1FIA A;  5KAI C;  1JKP C;  5F08 A;  3K10 A;  4X1E A;  5HNF A;  1U78 A;  2LTP A;  5IY5 H;  1JHH A;  4E7S A;  4JQF A;  5CVJ A;  4BU2 A;  2H8W A;  5D5V B;  3GTP J;  2MG4 A;  5D6E A;  1P6R A;  2KRC A;  2LBF B;  1QU3 A;  1OCO H;  3Q0V A;  4O6J A;  3OYL A;  1YJN I;  1RRJ A;  3L1P A;  3OOP A;  1LVA A;  2AS5 F;  3JRB A;  4HX4 A;  5E20 A;  2VQG A;  4CCM A;  1X4P A;  4LB6 B;  2VKH A;  1QHG A;  3AG2 H;  4G6T B;  2TCT A;  3I64 A;  3Q0W A;  1B8I A;  2G7U A;  2W00 A;  5IYC J;  2OTJ I;  2D1V A;  2CQQ A;  1ETV A;  3OYF A;  1Z0X A;  1UCR A;  3E6B A;  5EEH A;  1EKE A;  3OYE A;  1VQN I;  5B66 C;  2J5O A;  1G8X A;  4M6V A;  3Q3S A;  3V7C A;  4BEH B;  4A3L J;  4EQQ A;  4A6E A;  1IN6 A;  1BI3 A;  2O7O A;  4I76 A;  2QGU A;  3TOA A;  4V2F A;  4YFK F;  2COM A;  2OV7 A;  4KFC A;  3WTT C;  3KLN A;  4KUM A;  1BN5 A;  5E79 C;  3PJR A;  2DFE A;  5E18 F;  3ABU A;  1OJL A;  4FX4 A;  4D7N A;  3G2B A;  2IT0 A;  4Y15 A;  2VON A;  4A3D J;  1YW9 A;  4IHT A;  1BM9 A;  1TQP A;  3W2W A;  2IVM A;  1X1D A;  3JRA A;  2DDB A;  2MGQ A;  3HRU A;  2ZFU A;  5BOX A;  4XLN F;  1TTY A;  3DTE A;  2WB1 N;  3HOU J;  2VXD A;  3JSP A;  3ZQ7 A;  4EGZ A;  4Y4R A;  2IA1 A;  2ISY A;  2EPF A;  2HFH A;  4C3I J;  4DBR A;  2FNA A;  3CTA A;  3I53 A;  1WJF A;  3LSM A;  3BR1 A;  1QVT A;  2DMQ A;  3BWG A;  2XPV A;  2TDX A;  4HNT A;  1SFU A;  4CA0 A;  3F22 A;  3X2Q H;  1DP3 A;  3ZXS A;  2OQR A;  4OAY A;  3SEQ A;  5LGU A;  1KQ0 A;  4OOI A;  2QM3 A;  3JRG A;  4XRF A;  2VBY A;  4IRG A;  1EF4 A;  1P7J A;  3GBG A;  4LG0 A;  3N05 A;  3VB2 A;  2MW8 A;  3QU3 A;  3LSR A;  4I2O A;  1JI8 A;  4XLH A;  2LD5 A;  1J9I A;  4MIM A;  1PYV A;  3OSF A;  2XC7 A;  3KP3 A;  2QKM B;  1MMD A;  1YS6 A;  2XAF A;  1Y8R B;  4MO7 A;  2LRE A;  3VWB A;  1JHF A;  3MWM A;  3J7Y J;  2EFN A;  5IOY A;  2OUM A;  1S8N A;  4BJ5 C;  1O7L A;  2BY2 A;  3IRR A;  1ZYR F;  1QZZ A;  2DI3 A;  4RDU A;  2NVY J;  2WC2 A;  4XID A;  3J81 Z;  3JCU C;  4HX7 A;  4M73 A;  3HRT A;  2WBM A;  1FEX A;  3LFU A;  4U88 A;  2GM4 A;  3TGN A;  4M3B A;  1U0J A;  1Z3Y A;  1RC9 A;  1K78 A;  2RGV A;  1O4X A;  1UAA A;  2FMY A;  1J7K A;  2E1O A;  3I5U A;  1OYI A;  2ZSI B;  2CJJ A;  4XKB A;  4BKX A;  4DJA A;  2W7N A;  2G9W A;  1LE8 B;  3GW2 A;  2Y48 A;  1OKR A;  2A05 A;  3RI4 A;  3HGG A;  1Y39 A;  4PSX A;  1TBX A;  2PMZ A;  3LA2 A;  4RA2 A;  4V2G A;  2EFW A;  4W97 A;  3DKW A;  2ECB A;  3D5S C;  4UUT A;  5EZH A;  2BY0 A;  1JGS A;  3FM3 A;  3F23 A;  1XSD A;  3HOY J;  3FWE A;  4HBL A;  2KHM A;  4BQA A;  2LY2 A;  2M2E A;  3BJA A;  3L2U A;  1AKH B;  3S14 J;  4D5C A;  3U1K A;  3GZN B;  3NWT A;  2AQE A;  2HQA A;  4RAG A;  3JRE A;  2D1H A;  5LLQ A;  4XR6 A;  1J2X A;  4UV9 A;  4Y13 A;  1S72 I;  1Y1V J;  2ZME A;  3KZY A;  3DKY A;  4FX0 A;  2KRF A;  5CVV A;  4WWC A;  1O57 A;  5ED4 A;  3BR2 A;  4WCG A;  2F2E A;  2KJC A;  2EJR A;  1HXD A;  4I0A A;  1QHH D;  1FOW A;  1DPU A;  4GCV A;  1VZ0 A;  4V19 K;  3E7L A;  3SFI A;  5ERI A;  3LNQ A;  4BE0 A;  4FET A;  3ABL H;  1NK3 P;  1XGS A;  3N97 A;  3TP0 A;  3CJR B;  5TGT A;  3B02 A;  5J3L A;  4AUX A;  1HW2 A;  5FJ8 J;  2E71 A;  2HVQ A;  1T0F C;  4FCY A;  3W6J B;  2GOM A;  4IX7 A;  2LBF A;  3FXL A;  2M7A A;  2XVC A;  3LFK A;  2R7Q A;  2ZKZ A;  1YG2 A;  3KE2 A;  1FX7 A;  4CCL A;  4II2 A;  1EJ9 A;  3BR5 A;  1YIT I;  2Y31 A;  1D8J A;  3H3V K;  1HCR A;  4BS9 A;  4L5I A;  1F5T A;  1QNT A;  1WI9 A;  1MMG A;  3ZMT A;  3V7R A;  3D1N I;  2ETH A;  3HSE A;  4C3J J;  3GTM J;  2ME0 A;  1I1G A;  1X3W B;  2VAS A;  3DEE A;  5K7Z A;  4B47 A;  1UHW A;  4HNV A;  4XMY A;  1SC7 A;  2ICW G;  2MBF A;  2WAF A;  3LQR A;  1YRN A;  4CSW A;  1I6H J;  4BBS J;  3DPU A;  1PVE A;  5LRR A;  2M5W A;  3ABM H;  1QQI A;  3VDX A;  2L7Z A;  1VQ6 I;  2ZJP F;  5C3E J;  3RYP A;  2YU3 A;  3FM5 A;  1W36 C;  2O3F A;  5IT9 K;  1ZG3 A;  1OR7 A;  4EJU A;  4A3I J;  4R1H A;  3KZZ A;  1MGT A;  1WSU A;  3GX4 X;  4OIN F;  4DYQ A;  2A5Y B;  3ZGK A;  2KFD A;  1PUE E;  2Z1D A;  1FC3 A;  1T0F A;  3MKL A;  3DKX A;  2DMP A;  2F48 A;  3HUG A;  1X2M A;  3VYR B;  5DM7 F;  3L2C A;  2AHQ A;  2L2O A;  3LMM A;  1AKH A;  2F5E A;  2HKX A;  3ZMU A;  4LGW A;  1ETO A;  2ELH A;  3DPL C;  4L9T A;  2V1U A;  3OYN A;  2EH3 A;  1ZGW A;  3RPU A;  4E7J A;  1V4R A;  3HHH A;  3D5L A;  2XGX A;  1ODD A;  1IN7 A;  3CUQ A;  1IN5 A;  2HGC A;  2VJI A;  3FXQ A;  1MBG A;  4FE4 A;  1R1T A;  2L3D A;  3RZO J;  3B73 A;  1ZHF A;  3RPQ A;  4D9J A;  1PUF B;  4KA4 A;  5F1R A;  4IHY A;  2M9H A;  3TO7 A;  3BDD A;  1XB4 A;  5F27 A;  1WH5 A;  2Y75 A;  5KHD A;  4MTD A;  4ZH4 F;  5AON A;  3IWZ A;  3PFI A;  4L0Z B;  2LH9 A;  2V1D A;  5GP9 A;  3P9I A;  4A3K J;  3HL2 A;  4DZJ A;  4MGR A;  2JA6 J;  2DOA A;  3A4C A;  3G1M A;  4Z2Y A;  4EV0 A;  4A3G J;  3DQV C;  2JMW A;  3DF8 A;  4P1W A;  2R5Z A;  5DD8 A;  3FHN A;  2VQC A;  1TP4 A;  4RS8 A;  4I0B A;  4ZTJ A;  5E17 F;  2F4M B;  2GA1 A;  4MFD A;  2IEK A;  2CG4 A;  4UB8 C;  3WOD F;  4BQQ A;  1Z9C A;  1NG6 A;  3R4K A;  4L5J A;  2QSH X;  3CC4 I;  2JRM A;  2Y9Z A;  2CSO A;  3KPH A;  5CQE A;  3BY6 A;  1MBJ A;  4EEF G;  5HVQ C;  1Y56 A;  3HG9 A;  2IBD A;  2JN6 A;  2R7V A;  5CPR B;  1DGR M;  3O6B B;  1MDM B;  2HVS A;  1FJL A;  3CJN A;  2HQR A;  1CGP A;  1A36 A;  3QU6 A;  3M1C A;  4D1Q A;  3H0D A;  5BPD A;  1ZLK A;  2K85 A;  4JBA A;  2V79 A;  2CUZ A;  1FLI A;  2FBH A;  1MJA A;  4A3F J;  4XRM A;  1O7F A;  4M6Y A;  5E1X A;  5IP6 A;  5BQT A;  1XD7 A;  3EYI A;  2CFO A;  2VJ5 A;  3JW4 A;  4N4O B;  5C44 J;  5F0F A;  3L7W A;  2B63 J;  4DZP A;  4ESF A;  4HDU A;  3CUO A;  4PGH A;  4CYD A;  3FBN B;  2MLK A;  5C4J J;  1YX3 A;  3C2H A;  4LLN A;  2E19 A;  1RUO A;  2EV5 A;  2BZT A;  1QGP A;  3PQJ A;  5CQG A;  1Z91 A;  4N9I A;  2VLA A;  3E5Q A;  2AXT C;  3HKZ N;  1UMQ A;  3LSK A;  2RQP A;  2XKO A;  2YUS A;  3KX2 A;  5JVT A;  4OU0 A;  4MFE A;  3LSH A;  3K4L A;  2XAU A;  4HW0 A;  1JUM A;  2VB6 A;  4HF1 A;  2KIF A;  1S7A A;  5ICG A;  4BY1 J;  3CCY A;  3WG9 A;  1JJ6 C;  3ZOB A;  4I09 A;  2KIU A;  3J7A Y;  3ZQC A;  1R5H A;  1R22 A;  1BI0 A;  3JRF A;  3GO5 A;  3LOC A;  4KIS A;  4X6A J;  4HOB A;  3T0Y A;  2R7S A;  2IW5 A;  2FQ3 A;  5J1U A;  1H9T A;  1BIA A;  3BG3 A;  1MJ9 A;  4RGU A;  1BI2 A;  2WV0 A;  4LJZ F;  4UHT A;  4IQJ A;  1ETK A;  4RBO A;  3A01 A;  1WHU A;  1IXC A;  2GIV A;  4C30 A;  3M8J A;  3HYI A;  4G7O F;  2HPI A;  3H0G J;  5HLG A;  3OYA A;  2EV0 A;  4Q5S F;  2E5N A;  2JUC A;  3HJE A;  4A5N A;  4ESJ A;  1WFX A;  4BXX J;  3DP7 A;  3IKV A;  2JVG A;  1LFU P;  5HS8 A;  1P7I A;  1AU7 A;  2CW7 A;  3GLL A;  3BTI A;  3K4J A;  2QQ9 A;  4IL6 C;  4CCO A;  3G4S I;  1LDJ A;  1JTY A;  4ZJZ A;  3KP4 A;  1GV2 A;  4HQE A;  1ITY A;  2HYJ A;  2XF5 A;  4HA8 A;  4EJV A;  2M3A A;  4RAF A;  1VFC A;  2ZNZ A;  3K1P A;  4EJW A;  4CO8 A;  2BEO A;  4HNU A;  2JWT A;  2X6X A;  2BW3 B;  2XSD C;  2H6C A;  1ZR4 A;  2V6E A;  4UY8 I;  4AU7 A;  3EUH C;  2P6T A;  5L3B A;  3CCU I;  1UFM A;  5EYR A;  1Z21 A;  1KA8 A;  2ZB9 A;  1K6Y A;  2ZJQ F;  2IA2 A;  2ZXJ A;  3R60 A;  3LWF A;  4Q47 A;  3FHZ A;  4PJ0 C;  4KT6 A;  3OV8 A;  3L2Q A;  1KZH A;  1MJB A;  3HOT A;  4IHV A;  2L7F P;  3BQZ A;  2BHY A;  1FOY A;  4NC7 A;  3BCB A;  5J1R A;  3NRV A;  2RC4 A;  2HOS A;  3OYI A;  2AXL A;  4IOC F;  2FXA A;  4OAZ A;  3FMQ A;  2IGK A;  2OZ6 A;  4IHS A;  4PSW A;  3WE3 A;  3G73 A;  5ILV A;  2OCC H;  5M5W J;  2O5R A;  3CMA I;  2MLG A;  2NVU B;  4RLF A;  6PAX A;  1SAN A;  1T6S A;  4BJT A;  2FA5 A;  3J80 Z;  3AG4 H;  3FIS A;  2Q1Z B;  2PN6 A;  1D0X A;  3OOU A;  3Q9S A;  4RGX A;  2E7W A;  3BG9 A;  3QQA A;  1OYW A;  3MD2 A;  4RAZ A;  2HDD A;  3P9C A;  3C18 A;  2G0E A;  3SQN A;  2EZI A;  4W1U A;  5KAF C;  2WAE A;  4IO9 F;  4AD9 A;  2K9L A;  4WK8 F;  3OIP A;  1H9G A;  2EIL H;  2F5D A;  2MC3 A;  3MKW B;  4LLL A;  2LYC A;  5F1J A;  1TC3 C;  5DUK A;  5E8G A;  5IP7 J;  3BRO A;  5JLX A;  1YJ9 I;  3P7N A;  3QOP A;  1ZG5 A;  1IN8 A;  3UKG A;  2X1E A;  3TO9 A;  1KQ9 A;  4F52 A;  2RVC A;  2M45 A;  1Z1D A;  3IAS 2;  2X85 A;  4DOZ A;  1REP C;  4HYE A;  2M30 A;  1MSE C;  4Q4Z F;  1ENH A;  5FRO A;  1YOV B;  4C2M J;  1W0U A;  3FDY A;  2DFF A;  2NVQ J;  1TWF J;  2IXS A;  1R00 A;  2XDV A;  2H09 A;  1EH7 A;  3JSO A;  1LKX A;  2WV1 A;  1X1P A;  4NB5 A;  5HDN A;  4U7D A;  1SD4 A;  1OFC X;  1TLH B;  2R7O A;  4XM3 A;  2VI6 A;  4WF2 A;  2XSJ C;  4A2U A;  1VQ7 I;  5H20 A;  2KPM A;  1V5E A;  4P5O A;  1R9T J;  1U9N A;  1B4A A;  3HM5 A;  3OL4 A;  4F3Q A;  4B8X A;  3M9A A;  2DTZ A;  1FMW A;  4M72 A;  4EMS A;  1FSH A;  3PFY A;  5E3M A;  3CDH A;  5LBQ A;  3HHG A;  2X6W A;  2BHZ A;  2DK8 A;  5CVI A;  1WJA A;  2F5V A;  5D8K B;  3BTC A;  2RV8 A;  1ETY A;  3HSF A;  3RIR A;  4HV6 A;  3S3O A;  3HOV J;  2WWY A;  1RNL A;  3I4P A;  1HOM A;  3P9K A;  1LDK B;  2ZXH A;  4E4H A;  4AYB A;  5D5U B;  4I98 B;  2KDO A;  2BVM A;  4L9V A;  3PL8 A;  2DOF A;  3ZCO A;  2E1N A;  2QWW A;  2W4S A;  5J8F A;  2IA0 A;  4F91 B;  4HX8 A;  5EEA A;  3PQK A;  5F04 A;  2B9S A;  2KZG A;  4ENM A;  2A68 F;  2EIK H;  1Z6T A;  1RIO H;  1GVD A;  3OIQ A;  2OQG A;  4RM2 A;  2K3F A;  3S1M J;  4P9F A;  3FXR A;  1BJZ A;  1B8I B;  3I4N J;  4CYC B;  2MD0 A;  1XGM A;  3V8K A;  3BR0 A;  2L9S A;  4BE2 A;  2Y0M A;  1JUP A;  1HBX G;  2OTL I;  2F5F A;  3R6S A;  2DYS H;  2DCE A;  3R0J A;  2DOE A;  3HOZ J;  5DTD A;  5D8L B;  4DW6 A;  4BAY A;  5GPA A;  5LGT A;  2LF7 A;  4BHP A;  2EWN A;  3IL2 A;  3KEO A;  5F0H A;  3G71 I;  1W5T A;  1ZKG A;  2EV6 A;  4A0X A;  4CUG A;  1JE8 A;  4RB2 C;  3S1R J;  1IZ1 A;  2MA3 A;  2RKH A;  2WY7 Q;  3BT9 A;  1O3R A;  1D0Y A;  2Z2S B;  5HDG A;  2L7M P;  3VOD A;  3S16 J;  1N78 A;  2ISZ A;  1HLV A;  4MEX F;  4KJZ A;  3CCJ I;  1LE8 A;  1YYV A;  3KCC A;  1IUF A;  2DJN A;  5F0C A;  1SFX A;  2X6O A;  4KIT B;  3CC2 I;  3A2K A;  2WAQ A;  1OCP A;  3S17 J;  3DTI A;  4QIW N;  4FIS A;  4G12 A;  5J4V A;  3GFI A;  4M6X A;  1XPX A;  3VSL A;  3GFM A;  1RPW A;  2IGN A;  5J40 A;  1YX5 A;  3OWT A;  4QSH A;  2D2W A;  4ZDO A;  2VQH A;  2PX9 A;  4M9Z A;  2K02 A;  2R7X A;  1B59 A;  3Q0U A;  2WA0 A;  1BR1 A;  2CQ7 A;  3ZN0 A;  2FE3 A;  5D5W B;  4N9H A;  3F3X A;  1LB2 A;  5AIP A;  4G6Q A;  2NS8 A;  3NEU A;  5FKL A;  3WGG A;  3KET A;  1DGW Y;  3CES A;  1GT0 C;  3ZQL A;  3HKZ A;  5K5Q A;  4RB1 A;  2O0Y A;  1FIP A;  4MQ9 F;  2KRH A;  3FKJ A;  1K4T A;  2FOW A;  3F8F A;  1Y0U A;  2DA3 A;  4AYB N;  1XSX A;  2GIZ A;  5ICC A;  2IS6 A;  1PUF A;  1P4W A;  3H92 A;  1SEU A;  3G6E I;  2HOT A;  3OS0 A;  4NC6 A;  4A3C J;  2HPM A;  3V8L A;  3R61 A;  2FBK A;  5DS9 A;  2CUF A;  3E5X A;  4YFN F;  2NVX J;  2STW A;  3S2D J;  2H6B A;  2H94 A;  4RB3 C;  1BR4 A;  1WWX A;  2QBY B;  1M1E B;  1W7P B;  1EV7 A;  4I6Z A;  1V55 H;  1E17 A;  1B72 B;  3KFW X;  2R7R A;  1B1B A;  2Q2E B;  4EJO A;  2F6C A;  1IXR C;  1Q1V A;  5FKK A;  1G3S A;  3CME I;  2F5C A;  1OR7 C;  1S7O A;  2DMT A;  1J59 A;  2ZSH B;  4E7K A;  4G9Y A;  2BGC A;  1T08 B;  3WU1 B;  2R7F A;  3ESW B;  1T98 A;  1MMA A;  4B44 A;  2NOJ B;  1HC8 A;  1O3S A;  5L3E A;  1SD5 A;  4IZZ A;  1X3U A;  4XKW A;  2P7C B;  1K4S A;  1K7A A;  2R3S A;  2MC4 A;  2ZCW A;  2LMD A;  4XSZ F;  1L0O C;  5LD2 C;  1NG7 A;  2RN7 A;  5IYD J;  1FBQ A;  2K27 A;  2Y30 A;  2IS1 A;  2YR2 A;  2BY1 A;  1IO2 A;  3ELK A;  1OCZ H;  1TWH J;  4PFP A;  3A0H C;  1GUU A;  3ZMV A;  2GXG A;  1D8K A;  3QPL A;  3BZC A;  2EA2 A;  2FSW A;  3FKI J;  1VQ4 I;  2EZK A;  3SEZ A;  1JJ8 C;  1IV8 A;  4PDK A;  3Q9V A;  4S04 A;  4Y3O A;  1MNE A;  2M34 A;  2R7W A;  3BP8 A;  4CCJ A;  1U5T A;  1TZL A;  2TRT A;  2PFB A;  3LST A;  2FD5 A;  1IUY A;  4ZZL A;  2I5U A;  3GTJ J;  1HW5 A;  4AWX B;  2VL8 A;  4P9U A;  1JKQ C;  3KEY A;  2XHK A;  1BBY A;  3FF5 A;  1MMN A;  4RMN A;  1YJW I;  5F6F A;  3K70 D;  3KP6 A;  4B4C A;  4XLA A;  1UB9 A;  3V8J A;  2X1C A;  3HPG A;  5EJC A;  3KP5 A;  3CDI A;  3GTG J;  3C1D A;  1U5T B;  1LVK A;  4A69 C;  4BXU A;  5IP9 J;  4AIK A;  4IQ4 A;  2KP6 A;  2XKP A;  4XN0 A;  1DU0 A;  2OA4 A;  4HPQ A;  4EM0 B;  3ECH A;  3MZ8 A;  1ZK8 A;  1NK2 P;  1XGN A;  1BI1 A;  2Z99 A;  1FP1 D;  3MKZ A;  2OF7 A;  4G8X A;  5LHH A;  1TQI A;  3MKY B;  1IDY A;  1OYY A;  1SVO A;  3B6C A;  2YS9 A;  1H0M A;  2CUE A;  3IC7 A;  3GFL A;  2UZK A;  3WTZ A;  2G7H A;  3A01 B;  1MSF C;  3TP3 A;  3CCQ I;  1W0T A;  3RCO A;  1ZH5 A;  2VBZ A;  3AG3 H;  4PUS A;  1GV5 A;  3IUO A;  4PFO A;  2XRL A;  1FT9 A;  3DLA A;  2P5K A;  2ELJ A;  3VFZ A;  2XAS A;  1WKM A;  1Z7U A;  1D3Y A;  4L5E A;  2ZO4 A;  2ACJ A;  9ANT A;  4DBQ A;  2VPL A;  3OYM A;  1JUS A;  5DM6 F;  3I59 B;  1ONV A;  5LFA A;  2M7B A;  4XOP A;  2ZNY A;  4II3 A;  1GDT A;  1SD6 A;  3BPV A;  3KEQ A;  1T2K A;  4QWQ A;  4CXF A;  4ABZ A;  2ID3 A;  3M07 A;  4Y17 A;  2QCO A;  2R92 J;  4XK4 A;  5FD5 A;  2W57 A;  1PJR A;  2W85 A;  3BG7 A;  2M4K A;  3ROU A;  3CUQ B;  1AWC A;  1KYW A;  3ZMD A;  2M8G X;  2K9M A;  3WTS C;  3CCL I;  1H8A C;  4ZYH A;  1BA5 A;  1Y6I A;  5HLT A;  3S2H J;  2PMH A;  3WTX C;  2DA7 A;  4E6K G;  4A3J J;  4L9J A;  1FY7 A;  3DBL B;  1ACI A;  4XKC A;  3JTG A;  3O3K A;  3T1B A;  3I58 A;  2DFH A;  2MH9 A;  2QA4 I;  3JAM K;  4HLX A;  1X19 A;  3MCZ A;  1VI0 A;  4DYC A;  1N25 A;  3CLO A;  1HKQ A;  2FUG 2;  5EEG A;  2H1L A;  3I55 I;  5DYM A;  4PCQ A;  1YO5 C;  1Z05 A;  1IGN A;  1NH3 A;  2HDW A;  1G2H A;  4CYC A;  2NS7 A;  3HDD A;  5FGM A;  2VOD A;  2UV1 A;  3ML6 A;  4NDL A;  3K4C A;  1ZLJ A;  3L00 A;  1LFB A;  2DPU A;  3M8E A;  2QF7 A;  2JPC A;  4IKF A;  1YW8 A;  4FT8 A;  1Y1W J;  2Q2E A;  2PI0 A;  1ULY A;  4ZYG A;  1OCT C;  3HGY A;  3E6D A;  3QP6 A;  1UST A;  2DA5 A;  5FKO A;  4B48 A;  2LY9 A;  2CU7 A;  2CYY A;  4DGW B;  2E36 A;  3E6M A;  3TO6 A;  1SMY F;  2KLO A;  1SFE A;  2BOL A;  1FYK A;  2LG4 A;  2K3P A;  1I50 J;  1OIS A;  2KIS A;  1Z6R A;  3VEP A;  5HOO A;  3CCS I;  1XCV A;  2IGO A;  2PJP A;  3TMO A;  1Y0N A;  2IP2 A;  2UXX A;  3IP4 B;  3C7J A;  1XCB A;  1JKO C;  3O8G A;  5KCM A;  5KK1 A;  2DTR A;  3H9J A;  2BXY A;  2B7E A;  1FBS A;  1MIJ A;  2VC0 A;  2VQL A;  3ZR8 X;  2HXO A;  1VQK I;  3K9T A;  3QWL A;  4KIB A;  2V1N A;  2A6T A;  4PJJ A;  1YLF A;  4U0W A;  1Q1H A;  4Q48 A;  1IW7 F;  2NOG A;  4F93 B;  3BPX A;  4JOM A;  2LKX A;  4HAM A;  1U9O A;  2L9R A;  4QLC U;  4BJ6 C;  5CLS A;  2IRF G;  1SFO J;  4WXH A;  2HTS A;  2C6Y A;  3CP2 A;  5BS6 A;  3BR6 A;  4OWR B;  4LG0 B;  2JA8 J;  2JA7 J;  2HDC A;  2AQF A;  2JTV A;  3NAU A;  4BQN A;  2HKO A;  4GO1 A;  1XTA A;  4UUS A;  2CMP A;  2HYF A;  2R5Y B;  4HZF A;  4YEL A;  4BY7 J;  1PP7 U;  1LEB A;  2FBI A;  3PNY A;  1TT0 A;  1F36 A;  1BL0 A;  4KNY A;  4I02 A;  4BHC A;  4F55 A;  1LQ1 A;  4M3D A;  5HLI A;  4YEJ A;  1YE9 A;  2X9D A;  2VT3 A;  2DN0 A;  4IXA A;  3HSR A;  3QRF F;  5TIS C;  4XIC A;  2W82 A;  2L4A A;  2XV4 S;  3PSI A;  3J7A O;  1ZQ3 P;  3DFG A;  4LIT A;  3E5U A;  2STT A;  4RLQ A;  1MBE A;  3K4N A;  3K4K A;  3ZQH A;  2R5Y A;  3HC7 A;  3TDU C;  3FMR A;  1R71 A;  1C0W A;  2HEO A;  2E35 A;  4KMU X;  3RQI A;  5FLV A;  2WAD A;  1HA8 A;  1FNN A;  1HKS A;  2JQ7 A;  4A0Z A;  3GXO A;  2E2I J;  3AL0 B;  2OPT A;  4X0G A;  1JXS A;  5J4Y A;  1N77 A;  3I59 A;  4A5M A;  1PP8 F;  1MBH A;  1T56 A;  1LEA A;  1P92 A;  3I71 A;  4KN7 X;  3FK6 A;  2PLY A;  3IHU A;  5KVR A;  1E3P A;  1OQY A;  4D5F A;  2BYV E;  3S15 J;  3G1O A;  4MNU A;  3U1D A;  2GLO A;  1UHS A;  3S8P A;  2JA5 J;  4HF0 A;  5LEJ A;  2E5Z A;  5K1Y A;  1WPK A;  5E1Z B;  2YX7 A;  2HZT A;  4M9X A;  3GUD A;  1BJA A;  3UR3 C;  4XRS G;  2KMU A;  3RPU D;  4JK1 X;  1I39 A;  2MYS A;  3W6V A;  3VOE A;  2LSO A;  2W48 A;  4IRI A;  4JYK A;  3RKY A;  2KDZ A;  5BMZ A;  3RYR A;  1RET A;  1XMA A;  3C3W A;  1SAX A;  1FYM A;  2QQ8 A;  2HZD A;  3K69 A;  5K7F A;  4XKV A;  2LR8 A;  3ASO H;  3E97 A;  2V4J C;  1MH3 A;  3S1N J;  1ZAO A;  5E3N A;  4NHJ A;  5M5Y J;  3RDI A;  1WQ2 A;  1T95 A;  4LK1 F;  4A3B J;  4RGS A;  2YX4 A;  3OIO A;  1GLN A;  1YHQ I;  2V26 A;  3CCV I;  3DCF A;  1XS9 A;  4UVC A;  5D5X B;  4ZYA A;  4LD5 A;  1W5C C;  2DW4 A;  1DQU A;  2DFI A;  2OJE D;  4XQF A;  2LFB A;  1A5J A;  2IJL A;  2W24 A;  2JZY A;  3IH2 A;  1K79 A;  3EUA A;  5HDK A;  2EIN H;  5JI6 A;  4XON A;  1B72 A;  2P5V A;  5HS9 A;  1X1C A;  3CO6 C;  1J75 A;  3QYB A;  2CQX A;  3SZG A;  1D0Z A;  3OS1 A;  1GXP A;  2R7T A;  3DTK A;  4ZTF A;  3L2W A;  1Z7L A;  5K7H A;  4PJM A;  3QOE A;  4Z6Y A;  5CKT A;  4HRI A;  1IC8 A;  3K6G A;  4JX6 A;  3OYB A;  4E7L A;  1YIO A;  5IOZ A;  2KL4 A;  4IOA F;  1ETW A;  3FX3 A;  3CF2 A;  1U6G A;  2O6G E;  1F43 A;  4O5V A;  1HST A;  3E3V A;  1YRN B;  1MDM A;  1V54 H;  3FZV A;  4GYG A;  3RKX A;  2Z9O A;  3K0L A;  2QQB A;  2V9V A;  2UXN A;  2XAQ A;  3CUQ C;  3U2R A;  3PSF A;  2PJR B;  2IPQ X;  5FFX A;  4XLC A;  3DU6 A;  4IEJ A;  5LRS A;  3K1N A;  2EB7 A;  2CQK A;  4BL0 B;  3HPH A;  4TV7 A;  4M3G A;  2D5V A;  1K83 J;  2RRE A;  5E1W A;  1ZRD A;  3FK7 A;  1P4A A;  4HF2 A;  4WXD A;  5F64 A;  1E3O C;  2CWE A;  2X51 A;  3O2P E;  5TJJ A;  2X48 A;  5GTI C;  4EJT A;  2PJR A;  3GVA A;  2KT0 A;  4ZZD A;  3HTS B;  3MVP A;  2EQR A;  5JHU A;  3OYD A;  2RDP A;  2YU9 J;  3W2A A;  3DWL E;  4RGR A;  4NQW A;  4XLP F;  4HDV A;  1J0R A;  3WTY C;  4FTH A;  2Z3Y A;  2ZJ2 A;  3T8R A;  2P7V B;  2KIQ A;  2NAZ A;  3ASN H;  4PK4 A;  2CS3 A;  3H3U A;  2P5L C;  5M5X J;  1HKT A;  3S93 A;  3ZP5 A;  1L3L A;  1KON A;  4DNC A;  1QRY A;  4M71 A;  1FTZ A;  2X1D A;  1AHD P;  4EM2 A;  3L2V A;  2WAQ N;  5FB2 A;  3P5J A;  2HS5 A;  2EFQ A;  1R7J A;  2RNG A;  3LSI A;  1W7P D;  3F8C A;  3IAM 2;  3TW7 A;  2HOA A;  1ZAR A;  4S0H B;  5B1A H;  2HU9 A;  2OAZ A;  1ON1 A;  2VBX A;  2MH2 A;  2D45 A;  4BEH A;  3K7A J;  3V42 A;  1EA3 A;  4U0V A;  1VQ5 I;  3H9Q A;  4G7Z F;  3SDB A;  3OSG A;  3HTU A;  1U8B A;  1F9N A;  1TW3 A;  1B6A A;  3ISP A;  4I99 C;  1KGS A;  3M7G A;  1X1A A;  1SVL A;  5M3F J;  1I6X A;  4XNF A;  2HQN A;  2NS0 A;  1SVM A;  2Y2Z A;  2E1M C;  3J81 K;  3EDP A;  5GAD J;  5ILS A;  2K9Q A;  4QPO A;  1R6R A;  4MEY F;  4DIQ A;  2XB0 X;  2DT7 B;  4IF4 A;  4A3E J;  4KYW A;  4Y52 J;  2BXZ A;  1X2N A;  4N4N B;  1TWG J;  3F6O A;  2EBI A;  1QO0 D;  5EGO A;  3IH3 A;  1MBF A;  2XPU A;  3KP2 A;  2XUB A;  2CQN A;  2E2J J;  3K1M A;  5GAG J;  4KIF A;  2K86 A;  1QA6 A;  3FXM A;  1TWA J;  5ICF A;  1HQC A;  1BW5 A;  3D0S A;  3KLO A;  3R0A A;  2A69 F;  1UG0 A;  2NNN A;  2DO7 A;  3IKT A;  3F8B A;  4P96 A;  2L9V A;  4CZC A;  3S1Q J;  1ZG1 A;  2JSP A;  1KU3 A;  2E34 A;  3H3Z A;  3VYU B;  1HDD C;  3K2A A;  2DLL A;  2XIG A;  4EAT A;  1P2F A;  5HOD A;  2R0Q C;  5DD4 A;  3T5X A;  3WHB A;  4ENN A;  1O3Q A;  4O3M A;  1NTC A;  5TRD A;  1VQ9 I;  1FTT A;  3JRH A;  4HV5 A;  1S3J A;  4ENJ A;  4UVA A;  4HST A;  3OYH A;  2ZC2 A;  2W25 A;  3QPT A;  4U0Y A;  2XGC A;  1LUJ B;  2WTE A;  5FFZ A;  2F4O B;  1IRZ A;  1USS A;  3H36 A;  1ZRE A;  1NHA A;  4RB0 A;  2CGP A;  1AA7 A;  4I7H A;  2A6E F;  1X1B A;  5A2Q K;  2X6Y A;  4HQM A;  1ORK A;  3WG7 H;  2R4G A;  5JFR A;  4H0E A;  2ID6 A;  1GXQ A;  1P4X A;  1X58 A;  2LOO A;  5ILU A;  3BZ6 A;  2EIJ H;  2DQL A;  1F1Z A;  2VKV A;  1G3T A;  2ME6 A;  3K70 C;  3EUH A;  2V9K A;  2DU9 A;  4CH7 A;  4CZZ A;  2P0W A;  3B6A A;  5IYB J;  2QYO A;  2DA1 A;  3AFH A;  3HB9 A;  3SFZ A;  1VTN C;  2DA2 A;  1VF9 A;  1XX5 A;  3GZ5 A;  1XMK A;  4XBF A;  5DDG A;  1MZB A;  1BR2 A;  1EH8 A;  3CDL A;  2DDA A;  1VQM I;  1K78 B;  3ZQF A;  2PG4 A;  1TNS A;  4GXO A;  3V4G A;  4UB6 C;  2XRO A;  1H88 C;  4H4K C;  3BQY A;  1IRG A;  2CV2 A;  3KYC B;  3PUB A;  3AG1 H;  3KZI C;  4LLG F;  3OYG A;  3I4M J;  2P6S A;  3SXY A;  3LAJ A;  4OIO F;  1SMT A;  2DJI A;  2IAI A;  5LGN A;  3COA C;  1I3Q J;  2QVO A;  3TL4 X;  4XLE A;  2LC2 A;  2JJ7 A;  1QZY A;  5J8C A;  1BOB A;  3FXU A;  2JPB A;  1UG2 A;  3HRM A;  5DV5 A;  3HOW J;  3CD6 I;  3WU0 A;  2NNY A;  2UUZ A;  4BHB A;  4D0P A;  2E60 A;  2PMZ N;  3DV8 A;  3CMM A;  5JHF A;  2MAB A;  3E1S A;  2CV0 A;  2ESN A;  4KIC A;  3MFK A;  3NAR A;  2ZBK A;  3RTR A;  4UV8 A;  3ZMS A;  3IRQ A;  4ZC3 A;  4CCK A;  4OIR F;  1S9H A;  1FP2 A;  1OPC A;  3GYH X;  4K2E A;  1K6O A;  3HBL A;  3CF5 F;  1Z77 A;  4BDY A;  2XF7 A;  4XN3 A;  2K9S A;  4LB5 A;  4YIF A;  1W7P A;  4ZDP A;  5H6R A;  4E7Z A;  2ZXW H;  2X4H A;  3DLL F;  5E3O A;  3S3N A;  4CIC A;  4IJA A;  5KNL A;  1S29 A;  2KQR A;  5A2Q Z;  1XC5 A;  4UUS B;  3CO7 C;  5L3C A;  3SJM A;  2FX0 A;  1K61 A;  2K5C A;  2GZW A;  1Y8Q B;  3VSK A;  4AIJ A;  3MEX A;  4FQG A;  1A35 A;  2CRG A;  2YPR A;  1GVJ A;  1JT6 A;  1R23 A;  4M9S A;  3RQ4 A;  2O8K A;  1T39 A;  3HOX J;  3DBR B;  3J7Z I;  1RZ4 A;  4QTR A;  3OYJ A;  5CVU A;  2Y69 H;  2DQR A;  5JVG F;  5E3L A;  2LP0 A;  1EH6 A;  3J80 K;  1UJ8 A;  4GRI A;  2ZXI A;  1PDN C;  4ASN A;  1LDD A;  1STZ A;  1JKR C;  5IT9 Z;  3QAH A;  2PEX A;  1HF0 A;  5DCM A;  3KYD B;  3CZ6 A;  2RAE A;  3K2Z A;  4D7M A;  3A1Y A;  3DBH B;  4IPA A;  1BOA A;  3GEZ A;  2FOK A;  2W1O A;  5H6Q A;  2R7Z J;  4XRS A;  3CC7 I;  2E7X A;  2F4I A;  2WB1 A;  4KN4 X;  1FSE A;  3WE2 A;  1FWZ A;  2AO9 A;  2HNH A;  3FXK A;  5E8I A;  2VKE A;  3EET A;  3W3C A;  4S05 A;  1TWC J;  2A6H F;  3F6V A;  2UWM A;  3RKW A;  3ZPL A;  2ZME B;  3CCM I;  1WJD A;  1ZR2 A;  5HNH A;  3S2W A;  3BTL A;  1B9M A;  2CH0 A;  4B3X A;  5K5R A;  4YRV A;  2FRH A;  2O9L A;  2Z33 A;  2Z16 A;  3ABK H;  2XGE A;  3LSP A;  2GBY A;  1ZTR A;  1R58 A;  2PMU A;  3CQZ J;  1A6I A;  1ZN2 A;  3RZD J;  3LA7 A;  1JGG A;  2DA6 A;  2L0K A;  1XG1 A;  2BVL A;  2VPR A;  2VT2 A;  3JRC A;  1IDZ A;  4NQW B;  4KT5 C;  5L3D A;  2DPD A;  2XPW A;  3JRD A;  3PO2 J;  2CFX A;  2DMN A;  4JX4 A;  2CO5 A;  4A3M J;  4OIQ F;  5FLM J;  2EK5 A;  4DYR A;  4C2T A;  4FE7 A;  2GOX B;  3KP7 A;  4C9Y A;  3WU2 C;  2JSC A;  1W1W E;  3GFJ A;  3N4M A;  2EFO A;  4ZDL A;  1KU7 A;  4XSX F;  4KIG A;  1WH7 A;  3EQL F;  4LIU A;  2LKS A;  1ZRC A;  1G3Y A;  3A02 A;  4AM3 A;  2P81 A;  5HS7 A;  3BCA A;  4EGY A;  1VQP I;  4PJL A;  1RKW A;  2KZV A;  4CDG A;  4PGG A;  1A31 A;  1U5T C;  5CJ9 A;  1G59 A;  2OBP A;  1WJE A;  4YFX F;  2O61 A;  5EGO B;  1W5S A;  5LEK A;  3GWZ A;  1WCM J;  5ICE A;  4XL9 A;  1IXS B;  4IHW A;  1YW7 A;  1KU9 A;  5GTH C;  1QBJ A;  4JP0 A;  4U87 A;  3H5R A;  4KMF A;  3FXJ A;  3Q5F A;  2HYG D;  3H35 A;  1ZGJ A;  3PIP F;  3CMY A;  4E7H A;  1U8R A;  2E1M B;  4ENK A;  5FD6 A;  2Q0O A;  3WGI A;  2GWR A;  3HZJ A;  3HEF A;  3U9G A;  3CCR I;  2LK2 A;  3BLY A;  4YG2 F;  2LF8 A;  4ZYD A;  1R5G A;  2XGD A;  1O3T A;  1R49 A;  3A03 A;  3BOQ A;  1YQA A;  2E2H J;  3OYC A;  1LPQ A;  1G4D A;  3GLX A;  3H5N A;  2QEN A;  4OMY A;  1T33 A;  4FHT A;  4M3E A;  3SZP A;  5EG0 B;  3W2V A;  2HR3 A;  1SD7 A;  2HOE A;  3IWF A;  3M4O J;  1IG7 A;  3VYS B;  4A12 A;  1TQM A;  4HLY A;  2QLZ A;  3K4B A;  4UNO A;  1BC7 C;  2JVH A;  5GPC A;  1IRF A;  3QOD A;  3GME A;  1RR8 C;  3H1C A;  3M3Y J;  3K4M A;  1R4M B;  4FAS D;  1TL8 A;  2DOD A;  2BY3 A;  4IHX A;  2L01 A;  4IVN A;  4XOT A;  5L3F A;  1V5G A;  1LFP A;  4QPQ A;  4C3H J;  3GCM A;  1FOX A;  2BV6 A; 
#chains in the Genus database with same CATH homology
 2OUM A;  4NC8 A;  2MD0 A;  3EUA A;  4BJ5 C;  2L9S A;  4XON A;  3OMY A;  4BE2 A;  1X1C A;  3QYB A;  3SZG A;  1D0Z A;  3OS1 A;  2R7T A;  2LRD A;  3DTK A;  4ZTF A;  2DCE A;  3L2W A;  1Z7L A;  4PJM A;  2WBM A;  3QOE A;  4HRI A;  5CKT A;  3LFU A;  3K6G A;  3OYB A;  1U0J A;  1Z3Y A;  4E7L A;  1UAA A;  4HG2 A;  2KL4 A;  1W36 D;  2ZSI B;  3CF2 A;  4XKB A;  3ZRG A;  4CUG A;  4DJA A;  2W7N A;  2WY7 Q;  3EUK L;  1D0Y A;  3HOS A;  3BG6 A;  2Z2S B;  4PSX A;  1ZEL A;  2PMZ A;  4RM3 A;  1N78 A;  2MFZ A;  3D5S C;  4KJZ A;  3PSF A;  4HSR A;  2PJR B;  3DU5 A;  4NNJ A;  2L9N A;  3HXL A;  4XLC A;  2KHM A;  4KIT B;  2LY2 A;  3A2K A;  3DU6 A;  3L2U A;  2JA2 A;  2WAQ A;  3DTI A;  3NWT A;  2AQE A;  2HQA A;  2L5Q A;  3VSL A;  4BL0 B;  3HPH A;  4BUP A;  4XR6 A;  2IGN A;  1X4O A;  2RRE A;  4C2U A;  1YX5 A;  3PNV A;  2QKL B;  3OWT A;  4ZDO A;  3DKY A;  2VQH A;  1D1B A;  2X51 A;  2R7X A;  1QHH D;  2WA0 A;  1BR1 A;  2PJR A;  3ZQQ A;  3CP8 A;  1VZ0 A;  2Y0S A;  3AL0 C;  4BE0 A;  4FET A;  3OYD A;  4BE1 A;  3DPT A;  3DWL E;  3CJR B;  5TGT A;  2HVQ A;  1DGW Y;  1T0F C;  3CES A;  3HKZ A;  2WY8 Q;  3PNT A;  4LIV A;  5FRM A;  2GOM A;  2KRH A;  2LBF A;  3FKJ A;  4PK4 A;  2M7A A;  4IX7 A;  2CS3 A;  3S32 A;  3S93 A;  2R7Q A;  1KON A;  3S3M A;  2IS6 A;  4CCL A;  4II2 A;  2X1D A;  1P9Q C;  3OS0 A;  3L2V A;  2HPM A;  4BS9 A;  3W2A A;  1MMG A;  3EPZ A;  2RNG A;  2VAS A;  1BR4 A;  3DEE A;  3LSI A;  4B47 A;  1SFK A;  4XOR A;  3IAM 2;  3LSG A;  4XMY A;  2HU9 A;  2R7R A;  2Q2E B;  2WAF A;  2CUJ A;  2F6C A;  4BEH A;  2CW8 A;  4CSW A;  4MLO A;  1MND A;  3V42 A;  3DPU A;  1OR7 C;  1EA3 A;  4BQO A;  3H9Q A;  2ZSH B;  4E7K A;  3SDB A;  3VDX A;  4BXF A;  4BAC A;  1MMA A;  4B44 A;  3AKZ A;  2NOJ B;  1X1A A;  3QYF A;  4XNF A;  1W36 C;  4U7B A;  4IZZ A;  3E0J B;  4XKW A;  2E1M C;  3OS2 A;  2VKD A;  2MC4 A;  2I8D A;  2VIX A;  4QPO A;  1R6R A;  4DIQ A;  2DT7 B;  5LD2 C;  2JUG A;  3BC8 A;  3ZGK A;  1NG7 A;  4N4N B;  2Z1D A;  1WJC A;  2V7F A;  3DKX A;  3L2R A;  2IS1 A;  3VYR B;  4BGD A;  4J01 A;  2L2O A;  3LMM A;  3SYT A;  4PFP A;  2L7K A;  3DPL C;  3OY9 A;  3OYN A;  3SEZ A;  4E7J A;  2XF6 A;  1UG0 A;  3D5L A;  4Y3O A;  1MNE A;  2R7W A;  4CCJ A;  2VJI A;  1TZL A;  4CZC A;  2JSP A;  1ERD A;  3HUG B;  3VYU B;  3UNG C;  2RQQ A;  1UEL B;  4D9J A;  4EAT A;  2VL8 A;  3KEY A;  3U21 A;  3OL3 A;  2VXZ A;  3NWS A;  1J09 A;  1MMN A;  5KHD A;  4RMN A;  4HST A;  3OYH A;  2LH9 A;  3K70 D;  1D1A A;  3HL2 A;  4XLA A;  2X1C A;  3HPG A;  2DOA A;  3I9V 2;  1AA7 A;  3A4C A;  1LVK A;  4IQ4 A;  2KP6 A;  3DQV C;  1V5F A;  4P1W A;  1X1B A;  4XN0 A;  2X6Y A;  4HPQ A;  4B43 A;  3FHN A;  2VQC A;  2R4G A;  4ZTJ A;  2HVR A;  2LOO A;  4LG3 A;  3MKZ A;  3K70 C;  4BQQ A;  1D1C A;  1NG6 A;  3MKY B;  2V9K A;  4CH7 A;  1FMV A;  3OYK A;  5CQE A;  2P0W A;  5HVQ C;  1Y56 A;  2M4G A;  2IS4 A;  3HG9 A;  3AFH A;  2R7V A;  5CPR B;  1DGR M;  2HVS A;  2OC6 A;  3RCO A;  3M1C A;  4PUS A;  4D1Q A;  3H0D A;  4E7I A;  2IGM A;  1BR2 A;  3IUO A;  4PFO A;  4AVZ A;  3DLA A;  2CUZ A;  2ELJ A;  3I3L A;  4H4K C;  2CV1 A;  2CV2 A;  3PUB A;  4DBQ A;  3KYL A;  3OYM A;  2VPL A;  2CFO A;  2VJ5 A;  4ANJ A;  4N4O B;  5LFA A;  3OYG A;  2M7B A;  4XOP A;  4II3 A;  2M0M A;  2DJI A;  1WJB A;  3TL4 X;  4XLE A;  3RSN A;  2LC2 A;  1BOB A;  3FBN B;  1YX3 A;  1PJR A;  3C2H A;  2UUZ A;  3BG7 A;  2E60 A;  3CMM A;  2M4K A;  5JHF A;  2MAB A;  3E1S A;  2CV0 A;  5CQG A;  2K9M A;  3LL7 A;  2VLA A;  1Y6I A;  3LSK A;  5HLT A;  3RTR A;  4ZC3 A;  3KX2 A;  4CCK A;  1S9H A;  4E6K G;  1E0E A;  3LSH A;  3K4L A;  2XAU A;  2DT6 A;  2VB6 A;  4XKC A;  2LY1 A;  1MW7 A;  4BDY A;  3OR2 C;  2XF7 A;  4XN3 A;  3J7A Y;  1X19 A;  2A5W A;  4ZDP A;  4E7Z A;  3S3N A;  4XLF A;  4KIS A;  3H9G A;  3TBI A;  2R7S A;  2FUG 2;  5KNL A;  2KQR A;  4NUB A;  4HEA 2;  2K5C A;  3VSK A;  2HDW A;  4IQJ A;  4Y33 A;  3CJQ B;  4PJN A;  4C30 A;  3RQ4 A;  3M8J A;  2UV1 A;  2HPI A;  3K4C A;  4R79 A;  3OYA A;  3OYJ A;  3ONQ A;  2E5N A;  4CCN A;  4GRI A;  1WFX A;  2ZXI A;  4IKF A;  1N75 A;  2JVG A;  3CZ6 A;  2IS2 A;  1OLT A;  2CW7 A;  3A1Y A;  3K4J A;  3D5R C;  4B48 A;  2R7U A;  2W1O A;  4CCO A;  4DGW B;  4ZJZ A;  2F4I A;  2WB1 A;  3OR1 C;  2XF5 A;  4F92 B;  2KLO A;  2M3A A;  2BOL A;  1WJ5 A;  3QYE A;  2LG4 A;  2HNH A;  2K3P A;  2VJJ A;  5FRN A;  2VJ4 A;  4HNU A;  5HOO A;  2X6X A;  2IGO A;  2BW3 B;  3W3C A;  3C2G A;  3FBI B;  3TMO A;  1IRX A;  3IP4 B;  2V6E A;  3VYT B;  3MMY B;  3EUH C;  4AU7 A;  4BDZ A;  2UWM A;  5KCM A;  3H9J A;  1Z21 A;  2VQL A;  3ZR8 X;  3F9K A;  1SAU A;  1WJD A;  1K6Y A;  2BW3 A;  3H5A A;  5HNH A;  2CH0 A;  2V1N A;  2A6T A;  4B3X A;  4PJJ A;  4ITV A;  4KT6 A;  4YRV A;  4J00 A;  3L2Q A;  3HOT A;  4NC7 A;  4F93 B;  2Z16 A;  3BCB A;  4JOM A;  2DXI A;  4BJ6 C;  1Z3X A;  3OYI A;  4OAZ A;  2IGK A;  3CP2 A;  4OWR B;  4PSW A;  2BVL A;  3K10 A;  5HNF A;  2AQF A;  4BQN A;  2O5R A;  4NQW B;  4E7S A;  4JQF A;  2CMP A;  4BU2 A;  4YEL A;  4RLF A;  4BJT A;  3PNY A;  2KRC A;  2Q1Z B;  1TT0 A;  2LBF B;  1QU3 A;  1D0X A;  3OOU A;  4F55 A;  3OYL A;  3MD2 A;  4YEJ A;  1YE9 A;  4C2T A;  2GOX B;  4C9Y A;  4ZDL A;  2VQG A;  2WAE A;  1X4P A;  2W82 A;  4CCM A;  2K9L A;  3OIP A;  2VKH A;  1QHG A;  3PSI A;  4LIU A;  4G6T B;  4LIT A;  2W00 A;  3BCA A;  3MKW B;  4PJL A;  2LYC A;  4RLQ A;  3K4N A;  3K4K A;  3OYF A;  2KZV A;  3HC7 A;  3OYE A;  1G59 A;  1G8X A;  1WJE A;  4BEH B;  2X1E A;  4F52 A;  2WAD A;  3IAS 2;  4DOZ A;  2X85 A;  1HA8 A;  4XL9 A;  5FRO A;  4U87 A;  4X0G A;  3H5R A;  3AL0 B;  1N77 A;  3FDY A;  2IXS A;  2OV7 A;  2XDV A;  3H35 A;  3PJR A;  4E7H A;  1LKX A;  2E1M B;  3G2B A;  4XM3 A;  2R7O A;  2XSJ C;  3W2W A;  2KPM A;  1V5E A;  3BLY A;  4P5O A;  3S8P A;  1X1D A;  3OL4 A;  4F3Q A;  2ZFU A;  2E5Z A;  3DTE A;  1FMW A;  2VXD A;  3PFY A;  3UR3 C;  2KMU A;  4Y4R A;  2X6W A;  3RPU D;  2MYS A;  1WJA A;  2F5V A;  4DBR A;  3OYC A;  3S3O A;  1WJF A;  3LSM A;  3H5N A;  4HNT A;  2HZD A;  4CA0 A;  1LDK B;  4XKV A;  3W2V A;  3ZXS A;  1DP3 A;  4OAY A;  3SEQ A;  2ZXH A;  3VYS B;  4E4H A;  2V4J C;  4AYB A;  3K4B A;  2JVH A;  2KDO A;  2BVM A;  3QOD A;  3PL8 A;  1T95 A;  3ZCO A;  3GBG A;  3K4M A;  3N05 A;  1GLN A;  2W4S A;  2V26 A;  1JI8 A;  4XLH A;  4F91 B;  1PYV A;  4FAS D;  2XC7 A;  2QKM B;  1MMD A;  4XOT A;  4ZYA A;  2LRE A;  1V5G A;  1LFP A;  3OIQ A;  4RM2 A;  3VWB A;  4QPQ A;  1DQU A;  4XQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...