3U21A

Crystal structure of a fragment of nuclear factor related to kappa-b-binding protein (residues 370-495) (nfrkb) from homo sapiens at 2.18 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
104
Chain Sequence
INEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFETQQWLLGDNEELAALFQLWLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Novel Winged-Helix Like Domain from Human NFRKB Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation, dna binding
molecule keywords Nuclear factor related to kappa-B-binding protein
total genus 31
structure length 104
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14465 NFRKB_winged NFRKB Winged Helix-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3u21A00
3U21A
chains in the Genus database with same CATH superfamily
2VE8A 4PJLA 4DNCA 5D6EA 1VQLI 1ZTRA 2DFEA 1ZH5A 2X6OA 2IA2A 1O3SA 3F23A 2JJ7A 5GPCA 2CRGA 3FXUA 2A69F 1JJ8C 1JT0A 5HS9A 4L9VA 1OCOH 1SD4A 5F0CA 4NQWB 2Z33A 3BZCA 3P9CA 1UCRA 1YOVB 2EPFA 3FMSA 3L2QA 3OYBA 5K7ZA 5JR3A 5E8GA 4S04A 4IF4A 1BL0A 1ZRDA 1S9HA 1WJCA 2H27A 3LQQA 5DCFA 1IDZA 2M1BA 3H0GJ 1Y39A 4M6XA 2W1OA 2E5ZA 4RLQA 2E5NA 5HLHA 5KAIC 3OWTA 3A4CA 3C18A 3AKZA 3WGHA 2UXNA 2ZKZA 5DDGA 1D1CA 3A01B 4E7LA 4XN3A 2MC3A 1RKWA 1OJLA 3W6KB 4ESFA 4RAGA 5D5WB 5FLXZ 2WTEA 4D0PA 3HIFA 2VLAA 2NXNB 3HRMA 3ZQIA 3NARA 3FXRA 2Z1DA 2CYYA 1PUEE 1MD0A 1DDNA 5KCMA 3CCLI 4DJAA 2K4JA 2D45A 4JX6A 2K5CA 1EA3A 2Z16A 4AWXB 4WF2A 1ZLKA 2HVRA 5E1XA 2DN0A 1ZYRF 1FP2A 3ABKH 2EFPA 3DCFA 3IKVA 1IG7A 3CCUI 3AFHA 1FSEA 2KIFA 4RAFA 3BPVA 5C44J 5CPRB 1UHSA 4MHGA 1H8AC 4NHJA 3DFGA 4I98B 1SAXA 1TZLA 2VQHA 2VN2A 2DT5A 3OYFA 2XAQA 2HXOA 1ZKGA 5F1RA 4MIMA 2K86A 1ZHFA 3F8CA 1FX7A 1RPWA 2ZMEB 4HBLA 3BLYA 3LA3A 1P9QC 1TQMA 4KN4X 5CVIA 2RC4A 3BDDA 5B3SH 3ZGKA 2R7TA 3HGYA 4B8XA 5K5RA 5CJ9A 5EEAA 1GUUA 3CUQB 1S29A 4IRHA 5AONA 2NNYA 1ENHA 4RM2A 4HX7A 3FMRA 1BI3A 1OCRH 3L2RA 2FE3A 1WZ2A 3JTHA 3ZQGA 4PZJA 1R7JA 2BE5F 3OYNA 3I64A 4O6JA 5JFRA 2F6CA 3I9V2 2BBYA 3CMAI 5TRDA 3BZ6A 1IDYA 3J7AO 4MGRA 3MKWB 1Y8QB 2L7FP 5DM6F 2HOAA 4M3GA 3LSJA 1AKHA 5HVQC 2STTA 1I6HJ 2HU9A 1Z6TA 3BOQA 5JLWA 3DBLB 4E7IA 1WH5A 3KE2A 1TNSA 4RGSA 2BZTA 3D0SA 3ZQQA 3IWFA 3WU2C 5EG0A 3DBRB 5JLXA 2XGXA 1Y1WJ 2M7AA 5KNLA 3IAM2 1G6NA 2ICWG 4CYCA 2X1DA 3VSKA 5KHDA 1U0JA 2CFOA 4IRIA 4RBOA 3O8GA 4XBFA 4C2TA 3K9TA 2YU9J 3DKWA 4HG2A 2IS6A 2TRTA 3R0JA 1E3HA 2Y9ZA 1K4SA 1XSDA 2K27A 2QSHX 4EJUA 1SMTA 2R5YA 3BCBA 2CUEA 2KHMA 3WTVC 2UUZA 4A0XA 4PSXA 1BOBA 1Z67A 4P5OA 3SFZA 5IP7J 2ZNYA 4P96A 3V42A 1T2KA 1DU6A 5GP9A 3E5UA 4M74A 2FRHA 2HFHA 3CP8A 1QHGA 3M8JA 3KZZA 4L18B 2FSWA 3U9GA 2PJRB 3HHHA 1DP3A 1X1BA 2KLOA 3H1CA 2H6BA 1K6YA 2DA6A 1T0FC 4HDUA 4HEA2 1TWAJ 2WAQA 3E97A 4V19K 2MABA 1X2MA 1G3YA 4PUSA 1QRYA 3AL0C 5D5UB 3ASOH 2LK2A 1KU7A 1O57A 5JI6A 3D5SC 3VDXA 5LGNA 2RREA 4WCGA 1BW6A 4I2OA 3GTQJ 1RIOH 3P9IA 1K79A 4B44A 2P6TA 4PJ0C 1SVMA 4BUPA 3A1YA 1IN5A 2F5CA 3HPHA 2WY8Q 4BXUA 4NDLA 4NNJA 4HSTA 3OSFA 2HGCA 5ILVA 4IO9F 5EGOB 1IXCA 1YIOA 2COMA 2FQ4A 1RR8C 3TMOA 3WTWC 3PNTA 4H4KC 1JGGA 2EZHA 2YS9A 4LFUA 2MFZA 5EG0B 4D9JA 2FXAA 3FXKA 1I6XA 4RS8A 3A02A 2XGEA 1P7IA 3BQZA 1TQIA 2EJRA 2J5PA 4I76A 5HLIA 4BGDA 2JUCA 4HNUA 1ZG1A 1HA8A 1FWZA 4A5NA 1N75A 3LAPA 3I0TA 1ETXA 2HYFA 1U9OA 3H5RA 1VF9A 2F48A 4PK4A 1XC5A 1J9IA 3H3ZA 1IXSB 1MNDA 1ERDA 2IP2A 4NQWA 3TEDA 2GA1A 5CKTA 1KU2A 3R4KA 3SFIA 2EZIA 2VI6A 1OQYA 4F52A 4G7HF 2W7NA 4AU7A 3CC2I 4HA8A 4KISA 1Z1DA 4L5IA 3DU6A 3TW6A 3EUKL 2R7OA 3VFZA 2P7CB 4KFCA 1N78A 2VB6A 4A3EJ 3FHNA 3BTLA 4Q4ZF 4A12A 4AYBA 2R93J 2IA1A 2W48A 1UJ8A 5EGOA 4E7ZA 3FM5A 2Z5UA 1YI2I 4CH7A 3ERED 4I09A 2R7RA 4A3FJ 2HNHA 4XONA 2O7OA 3N4MA 3P7NA 4RGUA 3HUGA 3BTJA 4A5MA 4CGZA 3LWFA 2LD5A 4KMUX 5ED4A 3HYIA 5EEHA 4RB2C 4J00A 1EV7A 2DO7A 4LLNA 1HSJA 3JW4A 2YPRA 3EYIA 4KIFA 2DT6A 1T39A 2WV1A 2XB5A 2JUGA 1ZK8A 2JMWA 3E1SA 3M1EA 4EJOA 1I1GA 3MQ0A 1MSEC 3CD6I 2KJBA 4N9HA 1X1AA 3KP5A 2O8XA 2V9VA 4QSHA 2H09A 4K2EA 2E60A 1A35A 4RGRA 2K9QA 2V26A 2R5YB 4U88A 1VQ9I 4AM3A 1MBJA 2LTPA 2PMUA 3E6MA 4E7JA 1R1VA 1TT5B 5TJJA 4B3AA 4IOAF 2H8RA 3EDPA 2FU4A 3FBIB 2J5OA 4GFBA 2BHZA 2QZ8A 3HB9A 4F3QA 1ZREA 1P6RA 2HDWA 3QPHA 3VPRA 2L02A 3VYUB 2EB7A 5DEQA 4ESJA 2LY9A 1I50J 3G71I 5CLSA 4I6ZA 1FEXA 2M5WA 1MSFC 4M9ZA 2ESHA 5D5VB 1W1WE 4ZH4F 5FLMJ 4EV0A 5F27A 3U1DA 2QYOA 5EZGA 2LKSA 4YIRX 4XRSG 1JJ6C 1JKOC 3W2AA 3HSRA 2A3SA 4L9NA 3K6GA 3HZJA 2HQRA 1DGRM 1QVUA 2BY0A 4JK1X 4IHVA 2VJ5A 4ZJZA 3K1MA 2YR2A 2W85A 4I0BA 2KKOA 4A69C 5B66C 2NVQJ 2DQLA 3BY6A 4E4HA 1EJ9A 2UV1A 4PJNA 3HJEA 3LQRA 2CS3A 2W24A 3LOCA 3LAJA 4HDVA 2AS5F 4LD5A 3VYTB 1ZRCA 3L1PA 1D3YA 2XKOA 1JKPC 4XL9A 3LL7A 1OCZH 1ULYA 2VBZA 2BXYA 1R6RA 5FRNA 2CGPA 3HOWJ 3RKXA 2RNGA 3P5JA 3ZMUA 4M3EA 1J09A 1FYKA 3MD2A 1LJ9A 2ZSIB 2ZO4A 2OC6A 1BIAA 4DGWB 1W7PB 4IHTA 3G3ZA 3TOBA 3ERMA 2A07F 2FOWA 3F9KA 1X2NA 5GAHJ 4A0ZA 4XMYA 2E1NA 2LKPA 4BDYA 3CUQA 1WJAA 4V2GA 2DMNA 1HXDA 3KZIC 1F5TA 1MJBA 4LG0A 5GPAA 1ETQA 2XKPA 3UR3C 1YJNI 2ISZA 4AUXA 2VC1A 1YLFA 2CW8A 2CFXA 3R61A 2IAIA 1PVEA 1A31A 3FKJA 4MEXF 1ZGWA 5FFXA 1Z77A 5HNHA 3I71A 5LFAA 2WWYA 3OR1C 1B9NA 1WKMA 1W36D 3QRFF 4OMYA 2IPQX 2IS4A 2CO5A 3E3VA 2IBDA 4HYEA 4LMYA 3A01A 4BJTA 2DYSH 2DK8A 5IOZA 1TLHB 5LGTA 2VONA 2P81A 3S14J 4HOBA 2EK5A 4BXXJ 5B1BH 2PI0A 3G6EI 1RUNA 1B9MA 2KISA 1VQ5I 1R5ID 1DUXC 5IYDJ 1XMAA 3CESA 1X1DA 1S6LA 4E70A 1K78B 3OSGA 3IH2A 2Z99A 1FIPA 2YUSA 3H5AA 4OOIA 3MKLA 2LOOA 2L5QA 1K7AA 5HLTA 3ML6A 1HLVA 3AG4H 5J1UA 2K9NA 2P8TA 1QPMA 2KZGA 3HRSA 3S1NJ 1YW9A 2R7DA 1RKTA 1QBJA 4BE0A 1BBYA 2ME6A 5F1JA 2H1KA 1JXSA 2XHKA 3GMEA 3QPTA 4DZPA 3SXYA 1TP4A 3QOEA 1DP7P 1SANA 3RYPA 3S1MJ 1R5GA 4OIPF 4TV7A 2AQFA 3QP6A 1R22A 2M30A 1EKEA 4EM2A 3CQZJ 2VOPA 2WB1N 3O3KA 2DMPA 3FISA 1O3TA 1MGTA 4LOCA 3W3CA 2OPTA 3OYLA 1Y6IA 4XSZF 1WSUA 3F22A 1MMGA 4LK1F 4HF1A 1D5VA 2HYGD 1R58A 3MAJA 4BEHA 5LRSA 1FT9A 2B0LA 2V9KA 2Y30A 3ASNH 2A5WA 5CQGA 2XGDA 2CV2A 4YIIA 5HDKA 3VYRB 1REPC 1JTYA 2EINH 5BPIA 1SEUA 1IN4A 2D5VA 2W57A 4DBRA 2MYSA 3KP3A 4D1QA 4AYBN 4XQFA 4UVBA 4YELA 1WPKA 4XICA 2QBYB 3D5LA 4LLGF 2EIJH 1JE8A 3T8RA 1G3TA 2VE9A 1HOMA 2JRTA 1BI1A 1X4OA 2Y0MA 2ZNZA 1YRNA 2JPBA 2V1NA 1PUFA 2CU7A 1WJDA 2EILH 2XC7A 1TW3A 1F43A 3H9GA 1WJFA 2NRAC 2MA3A 3IAS2 2OJED 2BY3A 3L7WA 3C2HA 3BR2A 5J3LA 2KPMA 2K4BA 4AVPA 2CJJA 3DLAA 2O3FA 2QF7A 1WRJA 4MNUA 1C0WA 3CO6C 3TW7A 2XPVA 3ZOBA 1U8RA 4EJWA 1ACIA 2M0CA 2HDCA 2D1VA 3FXJA 4BKXA 2XUBA 4Q5SF 1I39A 4HV5A 3L2WA 2E1CA 1VTNC 1Z3YA 3Q0WA 2UZKA 2FEZA 3C2BA 4A3KJ 1B6AA 4HV6A 2B9SA 5FLXK 2K85A 4KT6A 1IN7A 4RLFA 2MD5A 2JA8J 1R4NB 4XKVA 2F5EA 3RPUD 2XPWA 3KLNA 2AHQA 4E7KA 2EQRA 1SAUA 1LDDA 4WXCA 2R7VA 2LP0A 4BH9A 1QPIA 3JCUC 1SD5A 5FGMA 4U7DA 3DF8A 2TDXA 4OWRB 4BQNA 3ABUA 3EUAA 5B5EC 2LH9A 2AQEA 1AWCA 3BJ6A 1TBXA 2OU2A 3RKYA 3CJRB 4UUTA 4BBSJ 1E0EA 2XPUA 2HPIA 4Q48A 5E3MA 3GTJJ 3K2AA 3SEZA 2FQ3A 3RJPA 1ZG3A 4E7SA 2YX7A 2F4MB 1IXRC 2Y0SA 3NRVA 2DFFA 2IEKA 2KQRA 3C3WA 3H9JA 3O2PE 2FA5A 4ETSA 2EV5A 3L2UA 4DYQA 2VBWA 3DKXA 1HC8A 3OOUA 2K9LA 3TOAA 2FBHA 5L3CA 1G3WA 1R1TA 2ME0A 4OIRF 4BQQA 1MBFA 3V8LA 1TL8A 4GCVA 4UB8C 2V4JC 3ULQB 1BC7C 5FB2A 3GCMA 4GO1A 4ZZLA 1V54H 2KJCA 2ID3A 3DTEA 4HRIA 2D2WA 3I58A 1D8KA 2F5DA 2VT3A 2ZMEC 2OA4A 3UNGC 4LGWA 1YRNB 5DCMA 4JBAA 4IL6C 3PIPF 3I54A 4EGYA 2CQNA 4F91B 3LSGA 2Z3YA 2ZFWA 1WI9A 4ZZDA 2R7WA 2YU3A 4UY8I 2G9WA 2DBBA 3OIOA 3RI4A 4LJZF 4JYKA 5M3MJ 4UUSB 3MVPA 4F55A 1ITYA 4XLEA 4BEHB 1J0RA 3JAMZ 1GV5A 2M2EA 3WHCA 3OYHA 3GTLJ 3T1BA 2BW3A 3CJTB 5CVRA 2RQPA 1D5YA 4QWQA 2DK5A 3A0HC 4EQQA 1U78A 5LHIA 3LSIA 1YW8A 5KVRA 4IHYA 4FX4A 5J40A 4M3BA 3HRUA 3HOZJ 2KRHA 2WAEA 3GZ5A 2DTRA 2P5VA 4P55A 3K7AJ 4HLYA 3K70C 2E34A 1A6IA 5L3GA 4UV9A 3KP7A 3QYEA 5FJ8J 4UUSA 1FLIA 2JA2A 1BJAA 2CQ7A 2XF7A 2K9SA 3E6DA 3KFWX 5DM7F 1UG0A 2KRCA 2NYXA 3RDIA 3HDDA 1JT6A 1MJ9A 4IEJA 1Y0NA 4HNTA 2F4OB 2OAZA 3SJMA 3HOUJ 2W25A 5FROA 4LLLA 3OV8A 1LEAA 4N4OB 4QIWN 4B3XA 2LKXA 1AKHB 1P4WA 3WU1B 4M9SA 3WTSC 2CUFA 1IUFA 3U2RA 1RRJA 1MNEA 4M3DA 3S16J 4LK0F 1FOXA 2PX9A 3VSLA 5DV5A 3GXOA 1WVRA 1ODDA 3H3VK 3ESWB 2IS2A 1LDKB 4A3GJ 3TBIA 3SYTA 4P9UA 1UFMA 3WGGA 2ELHA 2GA2A 5E18F 4DIQA 4RMNA 2OQGA 5J4VA 2ZMEA 2MLKA 2FMLA 4FT8A 1U5TB 1LUJB 1G2HA 1WHUA 4P1WA 5FD6A 2HQAA 5IT3A 1BJZA 2GXBA 1D0XA 2X85A 4UUVA 1WJEA 1B72A 1VQPI 3JTGA 3IHUA 1YX5A 3K4KA 4NC7A 3ZMTA 2FUG2 3S15J 2L7ZA 4IQ4A 3AAFA 4FCYA 2I8DA 4HW0A 5H6RA 1ZR4A 4WK8F 1IV6A 1BR1A 3VOEA 5M5XJ 1MBEA 2JZYA 4IQJA 4XLAA 3TP0A 4CSWA 1F36A 3I59A 3RQ4A 3SDBA 2CW0F 3V7RA 4B4CA 3CCEI 3K4LA 1IZ1A 2DI3A 3B6CA 4Y33A 4QTRA 2RVCA 3HOSA 1W7PA 3CUOA 1XGMA 3FIWA 3ISPA 3KEQA 3LFKA 4FX0A 1IRXA 4L9TA 3PO3J 2XDVA 4XKCA 2OCCH 4PFOA 2DA2A 4IZZA 4XM3A 1P4XA 5HS8A 4G12A 3DEEA 3DV8A 5M5WJ 1TWGJ 2IJLA 1S7AA 3R0AA 1CGPA 1JI8A 2NAZA 2M3AA 3KPHA 4YG2F 3S3OA 2X48A 3SZTA 3ZMDA 1SVLA 1UELB 1VQ8I 2IA0A 1Z7UA 4L9JA 4KITB 5C3EJ 5JHFA 3OYAA 4IXAA 3G2BA 4G9YA 1NHAA 4A3IJ 2ZXJA 2DODA 4I01A 1BW5A 2CSOA 1IRGA 2ACJA 1RI7A 3M9AA 2OUMA 3G1OA 5HDNA 2L9NA 3K69A 3RQIA 4A6EA 4HQMA 2B7EA 3AL0B 4A3JJ 3NQOA 4U0YA 1RC9A 2OBPA 4KICA 3F8FA 3JRAA 5F04A 2FOKA 3J80K 1UMQA 2E2IJ 2YSRA 4ZC3A 1T33A 5ICCA 1RESA 1EH8A 1K78A 1P92A 3B73A 1A04A 4I02A 3OOPA 3TDZC 3QYFA 4MQ9F 4B09A 2ZJRF 3U21A 1HF0A 6PAXA 3OR2C 2VXDA 3ABLH 1K6OA 3QWLA 1BI2A 3GW2A 2A61A 3S2DJ 5KK1A 1P7JA 1FBSA 1MBHA 2WC2A 3T5XA 1NG7A 4II2A 5LLQA 2NS7A 3BG6A 2CQQA 1JTXA 1OCTC 3I4MJ 2BY1A 1Z6RA 1ZGAA 2DT7B 2PJPA 3OYEA 3HTUA 4HAMA 4KDPA 5CVJA 5D8KB 2IGKA 3IP4B 4QPOA 1AOYA 3QYBA 2KIUA 3DEWA 1Y1VJ 1YHQI 1KU9A 2JSPA 5E3OA 4NC6A 5E3LA 1FNNA 2CQXA 2GAUA 4FASD 3GEZA 2L7KA 3T0YA 1U5TA 5DCMB 3CMYA 2JN6A 5D5XB 2KDOA 3DXJF 1SFUA 5D6FA 1X58A 2GXGA 3K0LA 3JSOA 1H89C 4DYRA 2JPCA 4KIBA 3IKTA 4FISA 2R7FA 4A93J 2LREA 1ONVA 3SHFA 3OS0A 1IUYA 1MMDA 2O5RA 5GTIC 1KGSA 3I55I 3IWZA 4V2FA 2XAJA 1YG2A 3BJOA 1V3FA 1XN7A 2K40A 1W4MA 5J8CA 4CO8A 2LRDA 2KMUA 5H2FC 1KU3A 2LY2A 1HDPA 1L0OC 1WFXA 2IGOA 3RZOJ 2X9DA 2BV6A 2BY2A 3JRIA 2X6YA 4RGXA 2G7UA 4ON0A 3RCOA 1IRZA 2K3FA 3DBHB 4FHTA 4UV8A 3TKYA 4H0EA 4PGGA 1IJWC 2BXZA 1S5LC 4BQOA 1SC7A 3MCZA 4KN7X 4Y17A 4EEFG 4CDGA 1B59A 1I5ZA 1FJLA 3F8MA 1X1CA 3RPUA 1YITI 1BM9A 1P4AA 1PP8F 3G1LA 1QZZA 4BAYA 2Q0OA 1DPRA 1XCVA 4RAYA 1U2WA 3WTUC 4IPAA 3JSPA 3CCRI 1QO0D 2RNJA 4DW6A 3GVAA 3BTIA 3F8NA 3OYIA 3BR1A 1Y8RB 1D0YA 3GTGJ 3H35A 2NVUB 3OL4A 2JTVA 3K1NA 4DZJA 1XGOA 4AIJA 4HQEA 2ISYA 4X1EA 3W2WA 3CCJI 3ABTA 2WV0A 3CDIA 1FOKA 2FBIA 2QQBA 2QENA 4U0WA 5H20A 2P5LC 4FE4A 1VQKI 4X0GA 2HQNA 2HEOA 1JKQC 1IO2A 2BW3B 2STWA 4RB1A 4Z2YA 2FNAA 3WTZA 2QVOA 4C9YA 4C3JJ 5F6FA 1LFPA 2VKVA 4MO7A 4W1UA 2CUZA 2HVSA 1KA8A 4LIVA 2M34A 1RUOA 2HXIA 3KETA 1U5TC 1VQ7I 2I10A 1XSXA 3QOPA 3CF5F 3CCYA 4ZTFA 2P7VB 1V5EA 4PCQA 3A2KA 3Q3SA 3L00A 3PNYA 2DA7A 1AHDP 2EBIA 2ZC2A 1R36A 2X51A 3A0BC 2V79A 2MH9A 4GDFA 2IS1A 2WAFA 3EYYA 2W82A 2XV4S 2BOLA 3CCVI 4JQFA 1BI0A 3ZR8X 3S2WA 1G3SA 3Q0VA 1U6GA 3PQJA 3HHGA 1PUFB 5CQEA 3L2CA 2H6CA 4ABZA 3M8EA 5D8LB 4CCLA 4BHPA 2L54A 2AXTC 3S2HJ 1OYIA 3EUHC 1LVKA 4BY1J 2H1LA 4B1RA 2VL8A 2ZB9A 1HDDC 4CCKA 2Y75A 1YIJI 3K1PA 1DQUA 4PJMA 1W36C 1T38A 2CQKA 1XPXA 2Y31A 3FWEA 3DQVC 3ZN1A 3MN2A 1CQTA 2MW8A 3BPXA 3D1NI 1HSTA 1LE8B 1ZR2A 2JSCA 1R5HA 1Z3XA 2KFDA 4M3FA 2ID6A 2IVMA 5F0FA 3M8FA 3HC7A 4BY7J 5HOOA 1FTTA 1LFBA 2LLKA 1QQIA 3V7SA 3QQAA 2VJJA 4M72A 1NH3A 2ZXHA 1R1UA 1W5CC 3IRQA 1ETKA 2VBXA 4C3IJ 1AA7A 3KP4A 1HW2A 5E17F 3DEUA 1WWXA 3L09A 2V9PA 4Y3OA 2JK3A 1QZEA 3SZGA 4EJTA 1M1EB 4RB3C 2F5VA 2MC4A 2GIZA 3ZCOA 2PLYA 2UWMA 2EH3A 4OAZA 5E3NA 3MWMA 4PJJA 1VQOI 3U1KA 2HDDA 1MMAA 2XAFA 2PFBA 3PNVA 3OYDA 4I0AA 4XKWA 1LFUP 1B1BA 3HKZA 4P9FA 3F0CA 2DOFA 4A3MJ 2QQAA 5CVVA 1FMVA 2KP6A 2XF5A 2X1CA 3IL2A 5LEKA 2QQ9A 2FJ1A 1F1ZA 1YQAA 3HG9A 3PFYA 4PGHA 1SFKA 2VT2A 4B43A 2LMDA 3WTXC 1X1PA 2GLOA 1O4XA 1ZG5A 1JGSA 2H94A 3UKGA 2EIKH 2PBIA 3KLOA 4NB5A 2DPDA 1HW1A 4HX4A 5TISC 4CCMA 4XIDA 4CUGA 4R1HA 3MKZA 1H9TA 3K4BA 5H6QA 1GT0C 1OR7C 3E7LA 3G73A 1KYWA 2DXIA 2R4GA 1Q1VA 2HYJA 4C2UA 2DCEA 2CH0A 4ZDLA 2V6EA 2CV1A 4G7ZF 2HTSA 4CA0A 2DTZA 4IX7A 4L5EA 2FBKA 1YTYA 1HBXG 3I3LA 1OYYA 1QNTA 1BA5A 3HBLA 2OZ6A 3RPQA 2I5UA 1DU0A 4BS9A 4DQ2A 2RAEA 3M7GA 2DMUA 3RIRA 2R7ZJ 4XLCA 3LSKA 4RA2A 1LKXA 2FMYA 4E6KG 3H0DA 1F4KA 4A3BJ 3CZ6A 2HQ5A 2GBYA 3FBNB 3W6JB 3HRTA 3WHBA 1UHWA 3C1DA 1NK2P 4EJVA 1XX5A 2V1XA 3I59B 4LB6B 3RKWA 3LNQA 3BG3A 3K4MA 1V4RA 1O7LA 5ILSA 2RGVA 5K7FA 2MH2A 1YE9A 1TWFJ 2JA6J 2L7MP 4CICA 4GYGA 1W7PD 3OMYA 4BXFA 1J75A 4ZDOA 3GX4X 3MFKA 2VQGA 5J1YA 2MGQA 4ENNA 2Q2EB 3LSRA 1E3OC 5B1AH 2HTJA 1J59A 2LBFB 2NNNA 2OCEA 1WGXA 3LMMA 4MQVA 3BC8A 4ENMA 3GFIA 2QSGX 3N97A 1TW2A 3PM1A 1ZAOA 2ETHA 2QBYA 3TO6A 4YIFA 2KL4A 2ZXIA 3J80Z 1S3JA 3ZMZA 4QLCU 5HS7A 1GDTA 2R5ZB 2JA5J 3NEUA 2GQQA 1TT0A 1GVDA 5EDNA 3OS2A 2DAOA 5FKLA 5BS6A 4BQAA 3GTOJ 2HOEA 2JWTA 1LQ1A 4BJ5C 1V5GA 3WTYC 1KZHA 2O0YA 2CV0A 5EJCA 4NC8A 1S7EA 2IGMA 4NUBA 3CCQI 3F8BA 3ZQFA 5DUIA 3KYCB 4OAYA 1FZPB 1TWCJ 2G0EA 4UXNA 4Y4RA 4WXDA 4YEJA 2VIXA 1MIJA 5FKKA 5BPDA 2AO9A 1MH4A 1BOAA 2XVCA 4XKBA 4CCJA 3ZN0A 3K70D 2FF4A 3HEFA 3VWBA 2W00A 3QAHA 3SEQA 2VPLA 1LB2A 3LFUA 3E6CC 5LRRA 5ILUA 3BR6A 2HPMA 2Y0SN 1JUPA 4CCOA 2E36A 4I7HA 2EFQA 1YJ9I 2JRMA 3BG7A 2KDZA 4ZYGA 2XROA 5BQTA 1QGPA 1HKSA 2X4HA 1YJWI 1OR7A 1EH7A 1QHHD 5IP6A 1WQ2A 2BGCA 3GLXA 1OISA 3BG5A 4XR6A 2L9SA 3DWLE 3FX3A 4ITVA 1X4PA 4O3MA 2COBA 2ZBKA 2E7WA 1SMYF 3MEXA 5FKNA 5L3FA 1Z7LA 2LNBA 3L2VA 1FOYA 1ZRFA 2DPUA 3ZQHA 5IP9J 2QSFX 2RQQA 2DJIA 1G8XA 3KP6A 3RSNA 4G6TB 3MZHA 3WTTC 3IH4A 3H36A 3X2QH 3KP2A 2VC0A 2P0WA 4PSWA 2L9RA 2DA3A 2IW5A 2KIMA 1I27A 2ZSHB 3IH3A 3WE2A 3GTPJ 1D1AA 1HQCA 1N25A 2E1OA 2M4GA 3KZYA 5J8FA 3RKQA 3ZRGA 1I3AA 4M73A 3S3MA 4DYCA 3GTKJ 5E1ZB 5M3FJ 4MTEA 5HODA 3ZMVA 3CDLA 1RR7A 1APLC 1MH3A 3PUBA 2GXAA 4KYWA 4U87A 3AG1H 2FX0A 2VJIA 2A5YB 1KQ0A 2GM4A 1LPQA 5D4SA 3C7JA 3DP7A 3SQNA 4W97A 2GWRA 3OY9A 2KZVA 1O3QA 3EETA 2DYRH 2K9MA 2R7SA 2XIGA 2DU9A 4D7MA 1NTCA 1ETYA 4BJ6C 1WH7A 2ZFUA 2VJ4A 1X19A 3LSHA 1KYZA 1X3ZB 2ELKA 1XG1A 5F08A 3QP5A 2VBYA 3JR9A 4R79A 1OPCA 1XDUA 3QPSA 2LC2A 2QUFA 3JRDA 5EZHA 3GFMA 3QU3A 3DTIA 4BHCA 1PDNC 2QM3A 2OTLI 3BP8A 4OIQF 1KONA 3JAMK 1NK3P 2M0MA 1W0TA 4G7OF 3HTSB 1JKRC 3IUOA 1V5FA 1VQMI 1D1BA 2JT1A 4Y13A 1X3UA 1IF1A 4YFXF 2OQRA 3J81Z 1XGSA 1UHMA 2CMPA 2QWWA 4HF2A 3JREA 2V1UA 2AXLA 4F7ZA 4C3HJ 1QU3A 2L01A 3CLQA 1IN6A 4LITA 4PFPA 5CYVA 1LNWA 2IT0A 4B48A 1K4TA 4FE7A 1A5JA 1X3WB 1KQ8A 1PJRA 2KT0A 4MEYF 1FSHA 4C2MJ 2DMQA 2DA5A 5DYMA 4AVZA 3B02A 3GZ6A 1SD7A 1GXPA 3OYKA 1B72B 3E0JB 2R7QA 1OCCH 2VOOA 5DD8A 3BR5A 2OV7A 2Y48A 5IT9K 1EF4A 4L0YB 2A05A 4ZYAA 4N4NB 1B4AA 3HXLA 4DOZA 1L3LA 1VI0A 4F93B 1LVAA 3PJRA 4FETA 2HZTA 1PP7U 2R7UA 4EATA 2OF7A 5IOYA 3KX2A 1USSA 5FKOA 4UVCA 3OL3A 4A0YA 3REOA 2ZXWH 1A36A 2NS8A 4N9IA 1MW7A 4AIDA 1YS7A 2KRFA 2Y2ZA 2FD5A 2A6HF 2QLZA 2O9LA 1U9NA 5ICFA 1WJ5A 4D7NA 4OINF 2NVYJ 4EGZA 2IGNA 4OMZA 4ANJA 3GUDA 2L3DA 1W5TA 4G6QA 5KAFC 1HKTA 2P6SA 2QKMB 1LDJA 1WCMJ 1UB9A 4A3LJ 2RDPA 2HS5A 1FY7A 2E2HJ 2NVXJ 4UNOA 5FRMA 3BZKA 3MKYB 3K4CA 3FXLA 2IRFG 4A3DJ 1FOWA 1B8IA 4XN0A 2JVGA 3ONQA 3QPLA 1T8IA 1E17A 1MMNA 1GV2A 2HVQA 4M9XA 1UZCA 3MZYA 4XOPA 2O03A 3JRGA 3BR0A 2DLLA 1R00A 4BE1A 2VPRA 2Z2SB 1DGWY 2ZJPF 2XB0X 5BOXA 1MJAA 4ZTJA 2A6TA 3OS1A 2L4AA 5AIPA 2EV0A 3G1MA 1JUSA 4IOCF 2QGUA 3RTRA 3AG2H 3S32A 1T98A 4EMSA 2F5FA 1R23A 4BL0B 1ON2A 5K5QA 2MLGA 4XLHA 1IC8A 5LEJA 5J47A 4J01A 1AU7A 4UHTA 1K83J 3K4NA 1BN5A 1IN8A 2RV8A 1ZQ3P 1JHHA 2VODA 3HPGA 4NBQA 3DPLC 2EZKA 1Y56A 1R4MB 4IKFA 1HCRA 4ZYEA 1HW5A 3K10A 5GADJ 3GZNB 3EQLF 4ZYDA 5GTHC 2BYVE 2GZWA 5E8IA 4EM0B 4Z6YA 3K2ZA 1XMKA 2JQ7A 3E5QA 2V6CA 4L5JA 1CF7A 4GXOA 2NVTJ 1QZYA 4HF0A 3TGNA 2XF6A 2CUJA 2CG4A 3GBGA 4M6YA 3ABMH 4ZDPA 4CYDA 4F92B 3V8KA 3HOYJ 2RKHA 3VEPA 2VUMJ 5M5YJ 2HI3A 1SD6A 4HNVA 4XRSA 1XS9A 1A6QA 1FBQA 2ECBA 1MDMA 1LEBA 5IYBJ 1S72I 4KA4A 3DKYA 2ECCA 2H8WA 4G8XA 4M6VA 2VKEA 4XRFA 2ZJ2A 4AIKA 2VASA 1R49A 3BJAA 2O61A 5IPAA 4HX8A 5EEGA 3PQKA 4CZCA 2EWNA 1ON1A 1GVJA 3E5XA 2BEOA 4ESBA 4JOMA 4CHUA 2XASA 1MNMC 1B8IB 1VNDA 4RDUA 3W2VA 2HKOA 4ASNA 4HLXA 1OKRA 5L3EA 1T08B 5K5OA 3FXQA 1ZLJA 5L3BA 4BE2A 1STZA 1TTYA 3LSMA 2K02A 1FMWA 2XAGA 1GLNA 1RETA 1VQ4I 1O7FA 1G4DA 1MBKA 2K7LA 1T6SA 2PMHA 5JHUA 3OYGA 3J7ZI 3H5NA 3VB2A 4IJAA 1H0MA 2E1MB 2QQ8A 3P9KA 5FKMA 2XSJC 1E3PA 5E1WA 5LBQA 2R3SA 4JX4A 3CCSI 3GO5A 3TDUC 3AG3H 1GXQA 2DDBA 2YX4A 4CCNA 5HLGA 3IC7A 2Z9OA 2HOTA 3PUFA 1XSVA 2HWVA 1UG2A 4BHBA 2R92J 4XLFA 3FXOA 2E2JJ 2LBFA 3VYSB 2ADUA 4KIGA 5A2QK 2QEXI 4RB0A 3Q5FA 1Z9CA 1OMIA 3WGIA 2GOXB 2M8GX 2PN6A 2E1MC 2JVHA 3EUHA 5DS9A 3TP3A 5L3DA 2EFWA 1T95A 5CVUA 3F3XA 1OLTA 4KJZA 4C30A 4CZZA 2O6GE 2V1DA 4Q47A 2LR8A 1TWHJ 3WE3A 4II3A 3FZVA 2L9VA 4LG0B 1XDSA 3H3UA 3OIPA 3GYHX 2PG4A 3H92A 2GOMA 5IT9Z 2ZCWA 1IRFA 3CJNA 1Z21A 2EV6A 3OIQA 4HZFA 5ERIA 4QPQA 2E7XA 2W84A 3ROUA 3V4GA 2M8EA 3JRFA 3TO7A 1W0UA 5DTDA 2EA4A 1JHFA 2OZUA 3ZQCA 2CWEA 4IRGA 3N05A 5J6XA 3BR3A 1IAWA 2DOAA 4ENKA 1BR2A 4O5VA 2WB1A 2WADA 3T8TA 3I4PA 4GGGA 4J19A 3HL2A 3J81K 5FD5A 3S17J 2QKLB 2FNPA 4BNCA 3L9FA 2R5ZA 1JUMA 5FO5A 4HPQA 2XGCA 3MMYB 3DLLF 1Z05A 4YRVA 1CF7B 3BCAA 3KYDB 1XCBA 2ZJQF 1I3QJ 2JA7J 4MLOA 3LA7A 3QU6A 3J7YJ 2EA2A 3FF5A 2XRLA 2WBMA 2R0QC 2L0KA 2M7BA 2X6WA 3GF2A 3CJQB 3GWZA 3FKIJ 3FK7A 4YFKF 1XGNA 4A6DA 3NWTA 1E2XA 1WI3A 1MKMA 2DFHA 3DPUA 5TGTA 3C2GA 3CTAA 5DD4A 2X1EA 1IW7F 1J5YA 4ENJA 2PMZN 1Z91A 3JRBA 3S1QJ 4EM1A 2LYCA 1W5SA 2DA4A 5F64A 2KIQA 1D8JA 3GLLA 4JX5A 5EYRA 1FPQA 3FDYA 2Q8KA 3V7CA 1H88C 2Q2EA 3DU5A 4KNYA 2V7FA 4S05A 1XB4A 3Q0UA 4RM3A 1ZN2A 3KCCA 1ZARA 1T56A 4G6DA 3COAC 3ZQ7A 3CCMI 2OTJI 1NG6A 4FQGA 1YFHA 1FP1D 3HM5A 4Y15A 5GAEJ 4IVNA 4CXFA 5FLVA 3LA2A 2BVMA 2DQRA 3DTKA 1XD7A 1RZ4A 1TQPA 3M1CA 3NWSA 2MG4A 4LIUA 2BHYA 3W6VA 5AIQA 3ELKA 2DMTA 1T0FA 1VFCA 1U8BA 5C4XJ 3D5RC 2F4IA 1PYVA 4WXHA 2HZDA 5F0HA 2E35A 4OU0A 3JRCA 3OYJA 4JP0A 2CW7A 3CC7I 3S93A 1FYLA 3WG9A 3BG9A 5JVTA 5IYCJ 2G7HA 3RYRA 3HKZN 5K1YA 2F2EA 3PL8A 3ZXSA 4D5CA 5E79C 3CUQC 3CP2A 3GFJA 3HUGB 5HDGA 2D1HA 4U0VA 2E19A 3Q9SA 1XMXA 2N8GA 2X6XA 3BQYA 2NS0A 3H9QA 2LF8A 3BTCA 3EPZA 2VKHA 5A2QZ 2LG4A 4LB5A 1RNLA 1TNTA 2LSOA 4AD9A 4BU2A 3F21A 2K3PA 2RN7A 3TO9A 3J7AY 5D4RA 1J7KA 5EF6A 3I56I 5E20A 3KEOA 1YX3A 4ZYHA 3HOVJ 4XLNF 3I4NJ 2ESNA 3HSFA 4DBQA 1IGNA 3FM3A 1ORKA 4UB6C 1Y0UA 3SZPA 2XRNA 1V55H 2VQLA 2DFIA 4BYYA 2L4MA 1SFOJ 2XAUA 1S8NA 4XRMA 2Y9YA 2WY7Q 3R60A 2DJNA 2DA1A 4XK4A 1QA6A 4XSXF 2EZLA 3S3NA 3TL4X 5ICGA 3SDGA 4LG3A 4MFDA 3JRHA 2HOSA 3HGGA 1IV8A 3O8HA 5K7HA 2VQCA 1BC8C 1BR4A 3CDHA 2MD0A 2IXSA 2A68F 5C4JJ 3HOTA 1POGA 1LE8A 3CF2A 2XSDC 3ECHA 2L2OA 4Y7NJ 2O8KA 3KEYA 5GAGJ 3ZP5A 1FBUA 1ZGJA 3O6BB 2M45A 3HSEA 4BACA 3PO2J 3OYCA 3PSIA 3LSTA 3ZQLA 3V8JA 1J2XA 2E71A 4KT5C 2QCOA 2WAQN 4GYIA 3TQNA 2R7XA 5HNFA 4I99C 4BBRJ 3ZMSA 1VZ0A 1K61A 2LVSA 3LSPA 1MBGA 3WG7H 1MDMB 4AC0A 1H9GA 3Q9VA 1SVOA 3KIOA 4RAZA 3CMMA 5ICEA 4IHSA 1YW7A 5IY5H 1ETWA 2P5KA 9ANTA 3IRRA 2WA0A 4U7BA 1N77A 4IHXA 2PQ8A 5BMZA 3FK6A 3M07A 2M9HA 2Y69H 1ZELA 4E7HA 2PJRA 1R9TJ 4BDZA 3OYMA 1EH6A 5J4YA 2HR3A 2MBFA 1YYVA 3QODA 4X6AJ 2DDAA 2QA4I 5LHHA 3FMQA 4WX9A 5JVGF 4XLPF 3KYLA 2NOGA 3K4JA 4XOTA 1HKQA 3NAUA 1SFEA 1OFCX 3IV5A 4XNFA 1ETVA 2EFOA 2GIVA 4OIOF 2VKDA 1GHCA 1DPUA 1KQ9A 1BIBA 1FC3A 3F6OA 3A03A 5LHGA 4FTHA 1UAAA 3GFLA 4CYCB 1I1SA 5BNGA 2EIMH 1MMSA 1OYWA 3CMEI 2XAHA 2VXZA 4UVAA 5J1RA 3PFIA 4HSRA 3HOXJ 4IHWA 2MSYA 4MFEA 3I5UA 4EVIA 4B47A 4AIHA 3CC4I 2P4WA 4KUMA 4G94A 4PDKA 5LD2C 2DOEA 3ECOA 2B63J 1P2FA 2HKXA 3E6BA 1Q1HA 2LF7A 4KMFA 5LGUA 1MZBA 2ELJA 1Z0XA 2LDUA 3BWGA 4A2UA 1QVTA 3S1RJ 3GTMJ 3PIOF 3M3YJ 4MTDA 4A3CJ 3VODA 3G4SI 1VQ6I 3PSFA 1VQNI 4GRIA 3F72A 2UXXA 4N0BA 1OCPA 1ETOA 2PMZA 3BT9A 3F6VA 1R71A 1U3EM 2C6YA 2TCTA 5FFZA 1SFXA 1XTAA 3M4OJ 1USTA 4XORA 2LY1A 5DUKA 3DPTA 2EFNA 1FTZA 2M87A 3I53A 3WU0A 1YO5C 2DW4A 2Q1ZB 3FXMA 3FHZA 3ZPLA 3B6AA 2M4KA 3BROA 2BVLA 4M71A 4D5FA 1S7OA 1WJBA 3S8PA 1TC3C 3CLOA 4L0ZB 2W4SA 4R8HA 1FIAA 2X0LA 1FYMA 1G59A 1D0ZA 2LFBA 2OD5A 2A6EF 1F9NA 4S0HB 3R6SA 1O3RA 2NOJB 4YFNF 4WWCA 1YS6A 3RZDJ 3MZ8A 3WODF 4Y52J 2PEXA 3CO7C
chains in the Genus database with same CATH topology
3H35A 3OL4A 4PJLA 3QOEA 4BL0B 2AQFA 3W2WA 4XLHA 4J01A 3K4NA 4X0GA 3W3CA 4NQWB 3OYLA 2BW3B 1Y6IA 1MMGA 3L2QA 4C9YA 1LFPA 3HPGA 3OYBA 4BEHA 2CUZA 2HVSA 3DPLC 4LIVA 2V9KA 1Y56A 2A5WA 5CQGA 4IKFA 2CV2A 1S9HA 1WJCA 3K10A 3VYRB 4ZTFA 4DBRA 1V5EA 2MYSA 4D1QA 4XQFA 3A2KA 2W1OA 4YELA 2E5ZA 4RLQA 2E5NA 3D5LA 3PNYA 3OWTA 3A4CA 3AKZA 2XF6A 1X4OA 2CUJA 2X51A 1D1CA 3GBGA 4ZDPA 4F92B 2IS1A 2WAFA 2W82A 4XN3A 4E7LA 2V1NA 2BOLA 4JQFA 1WJDA 3ZR8X 2XC7A 3H9GA 1WJFA 2VLAA 5CQEA 3IAS2 2Z1DA 4CCLA 3C2HA 3DKYA 2KPMA 5KCMA 4DJAA 3EUHC 1LVKA 3DLAA 2VL8A 2K5CA 1EA3A 2VASA 2Z16A 4CCKA 1DQUA 4PJMA 1W36C 2HVRA 4CZCA 3DQVC 4JOMA 3AFHA 3W2VA 3L2WA 1Z3XA 1Z3YA 3HC7A 5HOOA 4BE2A 5CPRB 3LSMA 1FMWA 2VJJA 1GLNA 2ZXHA 1TZLA 2VQHA 4KT6A 4RLFA 3OYFA 3OYGA 4XKVA 3H5NA 1AA7A 3RPUD 2E1MB 4E7KA 1SAUA 2R7VA 2XSJC 4Y3OA 3BLYA 1P9QC 4OWRB 4BQNA 3SZGA 3EUAA 3ZGKA 2F5VA 2LH9A 2R7TA 2AQEA 2MC4A 3ZCOA 4CCNA 2UWMA 4OAZA 4RM2A 3CJRB 4PJJA 1E0EA 3L2RA 1MMAA 3PNVA 4XLFA 3OYDA 2LBFA 3VYSB 4XKWA 2HPIA 3HKZA 3SEZA 3OYNA 2GOXB 4E7SA 2F6CA 3I9V2 1FMVA 2KP6A 2XF5A 2X1CA 2Y0SA 2E1MC 2JVHA 3MKWB 3HG9A 3PFYA 2KQRA 1T95A 1SFKA 4B43A 4C30A 1OLTA 3H9JA 4KJZA 5HVQC 2HU9A 3L2UA 4II3A 4E7IA 3DKXA 3ZQQA 3OOUA 3OIPA 2K9LA 4CCMA 4CUGA 2M7AA 2GOMA 3MKZA 5KNLA 3K4BA 4BQQA 3OIQA 1Z21A 3IAM2 1OR7C 4QPQA 2DXIA 2R4GA 2V4JC 2X1DA 4C2UA 3VSKA 2DCEA 2CH0A 4ZDLA 5KHDA 1U0JA 2CFOA 2CV1A 2V6EA 3N05A 4CA0A 4IX7A 4C2TA 2DOAA 2IS6A 4HG2A 1BR2A 3DTEA 4HRIA 3I3LA 2WB1A 2WADA 3HL2A 3BCBA 2KHMA 3UNGC 2UUZA 4PSXA 2QKLB 4BS9A 1BOBA 4P5OA 4HPQA 4XLCA 3MMYB 3LSKA 3V42A 1LKXA 4E6KG 4YRVA 3H0DA 3BCAA 3CZ6A 3CP8A 3FBNB 1QHGA 3LSGA 3M8JA 4F91B 2PJRB 4MLOA 1DP3A 1X1BA 2KLOA 2R7WA 1K6YA 1T0FC 4HEA2 2WBMA 2WAQA 2MABA 4F55A 2M7BA 2X6WA 4XLEA 4BEHB 3CJQB 4PUSA 3AL0C 3K4MA 3OYHA 3NWTA 2BW3A 3D5SC 3VDXA 2RREA 1YE9A 3DPUA 5TGTA 3C2GA 2X1EA 3LSIA 4B44A 4BUPA 3OMYA 3A1YA 4BXFA 4ZDOA 3HPHA 2WY8Q 2KRHA 2WAEA 2LYCA 2VQGA 4NNJA 4HSTA 3K70C 2Q2EB 3QYEA 2LBFB 3TMOA 2JA2A 3PNTA 3LMMA 4H4KC 2XF7A 3BC8A 3FDYA 1UG0A 2KRCA 2MFZA 3DU5A 2V7FA 4RM3A 2KL4A 2ZXIA 4D9JA 4HNTA 1NG6A 5FROA 4N4OB 4B3XA 1TT0A 4BGDA 4HNUA 3OS2A 1HA8A 1MNEA 2BVMA 3DTKA 3M1CA 3NWSA 4LIUA 1N75A 3VSLA 4BJ5C 1V5GA 3H5RA 2CV0A 4PK4A 1MNDA 1ERDA 4NC8A 2IGMA 4NUBA 5CKTA 2IS2A 3D5RC 2F4IA 1LDKB 4OAYA 1PYVA 2HZDA 3TBIA 3SYTA 4Y4RA 4F52A 4YEJA 2VIXA 3OYJA 2W7NA 4AU7A 2CW7A 4KISA 3S93A 4DIQA 3DU6A 3EUKL 4XKBA 4CCJA 2R7OA 4RMNA 3K70D 1N78A 2VB6A 3FHNA 3VWBA 2W00A 3PL8A 3SEQA 3ZXSA 4AYBA 2VPLA 3LFUA 3CP2A 3HUGB 2HPMA 4P1WA 2HQAA 1D0XA 4E7ZA 2X85A 4CCOA 1WJEA 2X6XA 3H9QA 3BG7A 4CH7A 1YX5A 3EPZA 3K4KA 2VKHA 4NC7A 2FUG2 4IQ4A 2LG4A 2R7RA 2I8DA 2HNHA 4XONA 4BU2A 1BR1A 1QHHD 2K3PA 4IQJA 3J7AY 4XLAA 4XR6A 4CSWA 3RQ4A 2L9SA 4J00A 3DWLE 4ITVA 1X4PA 3SDBA 3K4LA 2DT6A 1Z7LA 1YX3A 4Y33A 3L2VA 2JUGA 3E1SA 2RQQA 2DJIA 1G8XA 4DBQA 3HOSA 3RSNA 4G6TB 2VQLA 1IRXA 2P0WA 2XDVA 4PSWA 1X1AA 2XAUA 4XKCA 4PFOA 2E60A 2ZSHB 4IZZA 4XM3A 2WY7Q 1D1AA 2V26A 3DEEA 2M4GA 3S3NA 3TL4X 3ZRGA 4E7JA 3S3MA 1JI8A 4LG3A 2M3AA 3S3OA 3FBIB 1UELB 2VQCA 3PUBA 1BR4A 2MD0A 2IXSA 4U87A 4F3QA 4KITB 2HDWA 2VJIA 5JHFA 3OYAA 3HOTA 3CF2A 2L2OA 3VYUB 3KEYA 3OY9A 3G2BA 2KZVA 3S32A 2K9MA 4BACA 2R7SA 3OYCA 3PSIA 4BJ6C 2OUMA 2ZFUA 2L9NA 2VJ4A 3AL0B 1X19A 3LSHA 2R7XA 5HNFA 1VZ0A 3W2AA 4R79A 3CMMA 3K6GA 2LC2A 1DGRM 4ZC3A 2WA0A 2VJ5A 3DTIA 4ZJZA 4U7BA 1N77A 1KONA 2M0MA 4BE0A 3QYFA 3IUOA 1V5FA 1D1BA 4E4HA 3U21A 2UV1A 4PJNA 3OR2C 1ZELA 4E7HA 2PJRA 2CS3A 4BDZA 3OYMA 2VXDA 3QODA 2CMPA 3VYTB 1QU3A 1NG7A 4II2A 4XL9A 3BG6A 3LL7A 4LITA 4PFPA 3KYLA 3K4JA 4XOTA 1R6RA 2DT7B 4B48A 5FRNA 3OYEA 2RNGA 4XNFA 1PJRA 2VKDA 1J09A 2IGKA 3IP4B 3MD2A 4AVZA 4QPOA 3QYBA 2ZSIB 3OYKA 2OC6A 4DGWB 1UAAA 3E0JB 2JSPA 2R7QA 2OV7A 3F9KA 4FASD 2VXZA 4HSRA 2L7KA 4XMYA 4ZYAA 4N4NB 4BDYA 2KDOA 4B47A 3HXLA 1WJAA 4DOZA 4F93B 3PJRA 4FETA 2R7UA 4EATA 3KX2A 3UR3C 5LD2C 3OL3A 2LREA 2CW8A 3OS0A 1MW7A 3FKJA 1MMDA 2O5RA 5HNHA 5LFAA 2ELJA 3OR1C 1WJ5A 2IGNA 4ANJA 1W36D 3PSFA 2IS4A 2QKMB 4GRIA 2PMZA 2LRDA 2KMUA 2LY2A 4BJTA 5FRMA 3MKYB 1WFXA 2IGOA 3K4CA 4XN0A 2JVGA 2X6YA 3ONQA 3RCOA 1MMNA 4XORA 2LY1A 3DPTA 2HVQA 4BQOA 3CESA 4XOPA 1X1DA 2Q1ZB 1X1CA 2M4KA 2BVLA 1WJBA 3S8PA 4BE1A 2W4SA 2Z2SB 1DGWY 3H5AA 1G59A 1D0ZA 2LOOA 2L5QA 4ZTJA 2A6TA 5HLTA 3OS1A 2NOJB 3RTRA 3OYIA 1D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U21 A; 
#chains in the Genus database with same CATH topology
 2VE8 A;  4PJL A;  4DNC A;  5D6E A;  1VQL I;  1ZTR A;  2DFE A;  1ZH5 A;  2X6O A;  2IA2 A;  1O3S A;  3F23 A;  2JJ7 A;  5GPC A;  2CRG A;  3FXU A;  2A69 F;  1JJ8 C;  1JT0 A;  5HS9 A;  4L9V A;  1OCO H;  1SD4 A;  5F0C A;  4NQW B;  2Z33 A;  3BZC A;  3P9C A;  1UCR A;  1YOV B;  2EPF A;  3FMS A;  3L2Q A;  3OYB A;  5K7Z A;  5JR3 A;  5E8G A;  4S04 A;  4IF4 A;  1BL0 A;  1ZRD A;  1S9H A;  1WJC A;  2H27 A;  3LQQ A;  5DCF A;  1IDZ A;  2M1B A;  3H0G J;  1Y39 A;  4M6X A;  2W1O A;  2E5Z A;  4RLQ A;  2E5N A;  5HLH A;  5KAI C;  3OWT A;  3A4C A;  3C18 A;  3AKZ A;  3WGH A;  2UXN A;  2ZKZ A;  5DDG A;  1D1C A;  3A01 B;  4E7L A;  4XN3 A;  2MC3 A;  1RKW A;  1OJL A;  3W6K B;  4ESF A;  4RAG A;  5D5W B;  5FLX Z;  2WTE A;  4D0P A;  3HIF A;  2VLA A;  2NXN B;  3HRM A;  3ZQI A;  3NAR A;  3FXR A;  2Z1D A;  2CYY A;  1PUE E;  1MD0 A;  1DDN A;  5KCM A;  3CCL I;  4DJA A;  2K4J A;  2D45 A;  4JX6 A;  2K5C A;  1EA3 A;  2Z16 A;  4AWX B;  4WF2 A;  1ZLK A;  2HVR A;  5E1X A;  2DN0 A;  1ZYR F;  1FP2 A;  3ABK H;  2EFP A;  3DCF A;  3IKV A;  1IG7 A;  3CCU I;  3AFH A;  1FSE A;  2KIF A;  4RAF A;  3BPV A;  5C44 J;  5CPR B;  1UHS A;  4MHG A;  1H8A C;  4NHJ A;  3DFG A;  4I98 B;  1SAX A;  1TZL A;  2VQH A;  2VN2 A;  2DT5 A;  3OYF A;  2XAQ A;  2HXO A;  1ZKG A;  5F1R A;  4MIM A;  2K86 A;  1ZHF A;  3F8C A;  1FX7 A;  1RPW A;  2ZME B;  4HBL A;  3BLY A;  3LA3 A;  1P9Q C;  1TQM A;  4KN4 X;  5CVI A;  2RC4 A;  3BDD A;  5B3S H;  3ZGK A;  2R7T A;  3HGY A;  4B8X A;  5K5R A;  5CJ9 A;  5EEA A;  1GUU A;  3CUQ B;  1S29 A;  4IRH A;  5AON A;  2NNY A;  1ENH A;  4RM2 A;  4HX7 A;  3FMR A;  1BI3 A;  1OCR H;  3L2R A;  2FE3 A;  1WZ2 A;  3JTH A;  3ZQG A;  4PZJ A;  1R7J A;  2BE5 F;  3OYN A;  3I64 A;  4O6J A;  5JFR A;  2F6C A;  3I9V 2;  2BBY A;  3CMA I;  5TRD A;  3BZ6 A;  1IDY A;  3J7A O;  4MGR A;  3MKW B;  1Y8Q B;  2L7F P;  5DM6 F;  2HOA A;  4M3G A;  3LSJ A;  1AKH A;  5HVQ C;  2STT A;  1I6H J;  2HU9 A;  1Z6T A;  3BOQ A;  5JLW A;  3DBL B;  4E7I A;  1WH5 A;  3KE2 A;  1TNS A;  4RGS A;  2BZT A;  3D0S A;  3ZQQ A;  3IWF A;  3WU2 C;  5EG0 A;  3DBR B;  5JLX A;  2XGX A;  1Y1W J;  2M7A A;  5KNL A;  3IAM 2;  1G6N A;  2ICW G;  4CYC A;  2X1D A;  3VSK A;  5KHD A;  1U0J A;  2CFO A;  4IRI A;  4RBO A;  3O8G A;  4XBF A;  4C2T A;  3K9T A;  2YU9 J;  3DKW A;  4HG2 A;  2IS6 A;  2TRT A;  3R0J A;  1E3H A;  2Y9Z A;  1K4S A;  1XSD A;  2K27 A;  2QSH X;  4EJU A;  1SMT A;  2R5Y A;  3BCB A;  2CUE A;  2KHM A;  3WTV C;  2UUZ A;  4A0X A;  4PSX A;  1BOB A;  1Z67 A;  4P5O A;  3SFZ A;  5IP7 J;  2ZNY A;  4P96 A;  3V42 A;  1T2K A;  1DU6 A;  5GP9 A;  3E5U A;  4M74 A;  2FRH A;  2HFH A;  3CP8 A;  1QHG A;  3M8J A;  3KZZ A;  4L18 B;  2FSW A;  3U9G A;  2PJR B;  3HHH A;  1DP3 A;  1X1B A;  2KLO A;  3H1C A;  2H6B A;  1K6Y A;  2DA6 A;  1T0F C;  4HDU A;  4HEA 2;  1TWA J;  2WAQ A;  3E97 A;  4V19 K;  2MAB A;  1X2M A;  1G3Y A;  4PUS A;  1QRY A;  3AL0 C;  5D5U B;  3ASO H;  2LK2 A;  1KU7 A;  1O57 A;  5JI6 A;  3D5S C;  3VDX A;  5LGN A;  2RRE A;  4WCG A;  1BW6 A;  4I2O A;  3GTQ J;  1RIO H;  3P9I A;  1K79 A;  4B44 A;  2P6T A;  4PJ0 C;  1SVM A;  4BUP A;  3A1Y A;  1IN5 A;  2F5C A;  3HPH A;  2WY8 Q;  4BXU A;  4NDL A;  4NNJ A;  4HST A;  3OSF A;  2HGC A;  5ILV A;  4IO9 F;  5EGO B;  1IXC A;  1YIO A;  2COM A;  2FQ4 A;  1RR8 C;  3TMO A;  3WTW C;  3PNT A;  4H4K C;  1JGG A;  2EZH A;  2YS9 A;  4LFU A;  2MFZ A;  5EG0 B;  4D9J A;  2FXA A;  3FXK A;  1I6X A;  4RS8 A;  3A02 A;  2XGE A;  1P7I A;  3BQZ A;  1TQI A;  2EJR A;  2J5P A;  4I76 A;  5HLI A;  4BGD A;  2JUC A;  4HNU A;  1ZG1 A;  1HA8 A;  1FWZ A;  4A5N A;  1N75 A;  3LAP A;  3I0T A;  1ETX A;  2HYF A;  1U9O A;  3H5R A;  1VF9 A;  2F48 A;  4PK4 A;  1XC5 A;  1J9I A;  3H3Z A;  1IXS B;  1MND A;  1ERD A;  2IP2 A;  4NQW A;  3TED A;  2GA1 A;  5CKT A;  1KU2 A;  3R4K A;  3SFI A;  2EZI A;  2VI6 A;  1OQY A;  4F52 A;  4G7H F;  2W7N A;  4AU7 A;  3CC2 I;  4HA8 A;  4KIS A;  1Z1D A;  4L5I A;  3DU6 A;  3TW6 A;  3EUK L;  2R7O A;  3VFZ A;  2P7C B;  4KFC A;  1N78 A;  2VB6 A;  4A3E J;  3FHN A;  3BTL A;  4Q4Z F;  4A12 A;  4AYB A;  2R93 J;  2IA1 A;  2W48 A;  1UJ8 A;  5EGO A;  4E7Z A;  3FM5 A;  2Z5U A;  1YI2 I;  4CH7 A;  3ERE D;  4I09 A;  2R7R A;  4A3F J;  2HNH A;  4XON A;  2O7O A;  3N4M A;  3P7N A;  4RGU A;  3HUG A;  3BTJ A;  4A5M A;  4CGZ A;  3LWF A;  2LD5 A;  4KMU X;  5ED4 A;  3HYI A;  5EEH A;  4RB2 C;  4J00 A;  1EV7 A;  2DO7 A;  4LLN A;  1HSJ A;  3JW4 A;  2YPR A;  3EYI A;  4KIF A;  2DT6 A;  1T39 A;  2WV1 A;  2XB5 A;  2JUG A;  1ZK8 A;  2JMW A;  3E1S A;  3M1E A;  4EJO A;  1I1G A;  3MQ0 A;  1MSE C;  3CD6 I;  2KJB A;  4N9H A;  1X1A A;  3KP5 A;  2O8X A;  2V9V A;  4QSH A;  2H09 A;  4K2E A;  2E60 A;  1A35 A;  4RGR A;  2K9Q A;  2V26 A;  2R5Y B;  4U88 A;  1VQ9 I;  4AM3 A;  1MBJ A;  2LTP A;  2PMU A;  3E6M A;  4E7J A;  1R1V A;  1TT5 B;  5TJJ A;  4B3A A;  4IOA F;  2H8R A;  3EDP A;  2FU4 A;  3FBI B;  2J5O A;  4GFB A;  2BHZ A;  2QZ8 A;  3HB9 A;  4F3Q A;  1ZRE A;  1P6R A;  2HDW A;  3QPH A;  3VPR A;  2L02 A;  3VYU B;  2EB7 A;  5DEQ A;  4ESJ A;  2LY9 A;  1I50 J;  3G71 I;  5CLS A;  4I6Z A;  1FEX A;  2M5W A;  1MSF C;  4M9Z A;  2ESH A;  5D5V B;  1W1W E;  4ZH4 F;  5FLM J;  4EV0 A;  5F27 A;  3U1D A;  2QYO A;  5EZG A;  2LKS A;  4YIR X;  4XRS G;  1JJ6 C;  1JKO C;  3W2A A;  3HSR A;  2A3S A;  4L9N A;  3K6G A;  3HZJ A;  2HQR A;  1DGR M;  1QVU A;  2BY0 A;  4JK1 X;  4IHV A;  2VJ5 A;  4ZJZ A;  3K1M A;  2YR2 A;  2W85 A;  4I0B A;  2KKO A;  4A69 C;  5B66 C;  2NVQ J;  2DQL A;  3BY6 A;  4E4H A;  1EJ9 A;  2UV1 A;  4PJN A;  3HJE A;  3LQR A;  2CS3 A;  2W24 A;  3LOC A;  3LAJ A;  4HDV A;  2AS5 F;  4LD5 A;  3VYT B;  1ZRC A;  3L1P A;  1D3Y A;  2XKO A;  1JKP C;  4XL9 A;  3LL7 A;  1OCZ H;  1ULY A;  2VBZ A;  2BXY A;  1R6R A;  5FRN A;  2CGP A;  3HOW J;  3RKX A;  2RNG A;  3P5J A;  3ZMU A;  4M3E A;  1J09 A;  1FYK A;  3MD2 A;  1LJ9 A;  2ZSI B;  2ZO4 A;  2OC6 A;  1BIA A;  4DGW B;  1W7P B;  4IHT A;  3G3Z A;  3TOB A;  3ERM A;  2A07 F;  2FOW A;  3F9K A;  1X2N A;  5GAH J;  4A0Z A;  4XMY A;  2E1N A;  2LKP A;  4BDY A;  3CUQ A;  1WJA A;  4V2G A;  2DMN A;  1HXD A;  3KZI C;  1F5T A;  1MJB A;  4LG0 A;  5GPA A;  1ETQ A;  2XKP A;  3UR3 C;  1YJN I;  2ISZ A;  4AUX A;  2VC1 A;  1YLF A;  2CW8 A;  2CFX A;  3R61 A;  2IAI A;  1PVE A;  1A31 A;  3FKJ A;  4MEX F;  1ZGW A;  5FFX A;  1Z77 A;  5HNH A;  3I71 A;  5LFA A;  2WWY A;  3OR1 C;  1B9N A;  1WKM A;  1W36 D;  3QRF F;  4OMY A;  2IPQ X;  2IS4 A;  2CO5 A;  3E3V A;  2IBD A;  4HYE A;  4LMY A;  3A01 A;  4BJT A;  2DYS H;  2DK8 A;  5IOZ A;  1TLH B;  5LGT A;  2VON A;  2P81 A;  3S14 J;  4HOB A;  2EK5 A;  4BXX J;  5B1B H;  2PI0 A;  3G6E I;  1RUN A;  1B9M A;  2KIS A;  1VQ5 I;  1R5I D;  1DUX C;  5IYD J;  1XMA A;  3CES A;  1X1D A;  1S6L A;  4E70 A;  1K78 B;  3OSG A;  3IH2 A;  2Z99 A;  1FIP A;  2YUS A;  3H5A A;  4OOI A;  3MKL A;  2LOO A;  2L5Q A;  1K7A A;  5HLT A;  3ML6 A;  1HLV A;  3AG4 H;  5J1U A;  2K9N A;  2P8T A;  1QPM A;  2KZG A;  3HRS A;  3S1N J;  1YW9 A;  2R7D A;  1RKT A;  1QBJ A;  4BE0 A;  1BBY A;  2ME6 A;  5F1J A;  2H1K A;  1JXS A;  2XHK A;  3GME A;  3QPT A;  4DZP A;  3SXY A;  1TP4 A;  3QOE A;  1DP7 P;  1SAN A;  3RYP A;  3S1M J;  1R5G A;  4OIP F;  4TV7 A;  2AQF A;  3QP6 A;  1R22 A;  2M30 A;  1EKE A;  4EM2 A;  3CQZ J;  2VOP A;  2WB1 N;  3O3K A;  2DMP A;  3FIS A;  1O3T A;  1MGT A;  4LOC A;  3W3C A;  2OPT A;  3OYL A;  1Y6I A;  4XSZ F;  1WSU A;  3F22 A;  1MMG A;  4LK1 F;  4HF1 A;  1D5V A;  2HYG D;  1R58 A;  3MAJ A;  4BEH A;  5LRS A;  1FT9 A;  2B0L A;  2V9K A;  2Y30 A;  3ASN H;  2A5W A;  5CQG A;  2XGD A;  2CV2 A;  4YII A;  5HDK A;  3VYR B;  1REP C;  1JTY A;  2EIN H;  5BPI A;  1SEU A;  1IN4 A;  2D5V A;  2W57 A;  4DBR A;  2MYS A;  3KP3 A;  4D1Q A;  4AYB N;  4XQF A;  4UVB A;  4YEL A;  1WPK A;  4XIC A;  2QBY B;  3D5L A;  4LLG F;  2EIJ H;  1JE8 A;  3T8R A;  1G3T A;  2VE9 A;  1HOM A;  2JRT A;  1BI1 A;  1X4O A;  2Y0M A;  2ZNZ A;  1YRN A;  2JPB A;  2V1N A;  1PUF A;  2CU7 A;  1WJD A;  2EIL H;  2XC7 A;  1TW3 A;  1F43 A;  3H9G A;  1WJF A;  2NRA C;  2MA3 A;  3IAS 2;  2OJE D;  2BY3 A;  3L7W A;  3C2H A;  3BR2 A;  5J3L A;  2KPM A;  2K4B A;  4AVP A;  2CJJ A;  3DLA A;  2O3F A;  2QF7 A;  1WRJ A;  4MNU A;  1C0W A;  3CO6 C;  3TW7 A;  2XPV A;  3ZOB A;  1U8R A;  4EJW A;  1ACI A;  2M0C A;  2HDC A;  2D1V A;  3FXJ A;  4BKX A;  2XUB A;  4Q5S F;  1I39 A;  4HV5 A;  3L2W A;  2E1C A;  1VTN C;  1Z3Y A;  3Q0W A;  2UZK A;  2FEZ A;  3C2B A;  4A3K J;  1B6A A;  4HV6 A;  2B9S A;  5FLX K;  2K85 A;  4KT6 A;  1IN7 A;  4RLF A;  2MD5 A;  2JA8 J;  1R4N B;  4XKV A;  2F5E A;  3RPU D;  2XPW A;  3KLN A;  2AHQ A;  4E7K A;  2EQR A;  1SAU A;  1LDD A;  4WXC A;  2R7V A;  2LP0 A;  4BH9 A;  1QPI A;  3JCU C;  1SD5 A;  5FGM A;  4U7D A;  3DF8 A;  2TDX A;  4OWR B;  4BQN A;  3ABU A;  3EUA A;  5B5E C;  2LH9 A;  2AQE A;  1AWC A;  3BJ6 A;  1TBX A;  2OU2 A;  3RKY A;  3CJR B;  4UUT A;  4BBS J;  1E0E A;  2XPU A;  2HPI A;  4Q48 A;  5E3M A;  3GTJ J;  3K2A A;  3SEZ A;  2FQ3 A;  3RJP A;  1ZG3 A;  4E7S A;  2YX7 A;  2F4M B;  1IXR C;  2Y0S A;  3NRV A;  2DFF A;  2IEK A;  2KQR A;  3C3W A;  3H9J A;  3O2P E;  2FA5 A;  4ETS A;  2EV5 A;  3L2U A;  4DYQ A;  2VBW A;  3DKX A;  1HC8 A;  3OOU A;  2K9L A;  3TOA A;  2FBH A;  5L3C A;  1G3W A;  1R1T A;  2ME0 A;  4OIR F;  4BQQ A;  1MBF A;  3V8L A;  1TL8 A;  4GCV A;  4UB8 C;  2V4J C;  3ULQ B;  1BC7 C;  5FB2 A;  3GCM A;  4GO1 A;  4ZZL A;  1V54 H;  2KJC A;  2ID3 A;  3DTE A;  4HRI A;  2D2W A;  3I58 A;  1D8K A;  2F5D A;  2VT3 A;  2ZME C;  2OA4 A;  3UNG C;  4LGW A;  1YRN B;  5DCM A;  4JBA A;  4IL6 C;  3PIP F;  3I54 A;  4EGY A;  2CQN A;  4F91 B;  3LSG A;  2Z3Y A;  2ZFW A;  1WI9 A;  4ZZD A;  2R7W A;  2YU3 A;  4UY8 I;  2G9W A;  2DBB A;  3OIO A;  3RI4 A;  4LJZ F;  4JYK A;  5M3M J;  4UUS B;  3MVP A;  4F55 A;  1ITY A;  4XLE A;  4BEH B;  1J0R A;  3JAM Z;  1GV5 A;  2M2E A;  3WHC A;  3OYH A;  3GTL J;  3T1B A;  2BW3 A;  3CJT B;  5CVR A;  2RQP A;  1D5Y A;  4QWQ A;  2DK5 A;  3A0H C;  4EQQ A;  1U78 A;  5LHI A;  3LSI A;  1YW8 A;  5KVR A;  4IHY A;  4FX4 A;  5J40 A;  4M3B A;  3HRU A;  3HOZ J;  2KRH A;  2WAE A;  3GZ5 A;  2DTR A;  2P5V A;  4P55 A;  3K7A J;  4HLY A;  3K70 C;  2E34 A;  1A6I A;  5L3G A;  4UV9 A;  3KP7 A;  3QYE A;  5FJ8 J;  4UUS A;  1FLI A;  2JA2 A;  1BJA A;  2CQ7 A;  2XF7 A;  2K9S A;  3E6D A;  3KFW X;  5DM7 F;  1UG0 A;  2KRC A;  2NYX A;  3RDI A;  3HDD A;  1JT6 A;  1MJ9 A;  4IEJ A;  1Y0N A;  4HNT A;  2F4O B;  2OAZ A;  3SJM A;  3HOU J;  2W25 A;  5FRO A;  4LLL A;  3OV8 A;  1LEA A;  4N4O B;  4QIW N;  4B3X A;  2LKX A;  1AKH B;  1P4W A;  3WU1 B;  4M9S A;  3WTS C;  2CUF A;  1IUF A;  3U2R A;  1RRJ A;  1MNE A;  4M3D A;  3S16 J;  4LK0 F;  1FOX A;  2PX9 A;  3VSL A;  5DV5 A;  3GXO A;  1WVR A;  1ODD A;  3H3V K;  3ESW B;  2IS2 A;  1LDK B;  4A3G J;  3TBI A;  3SYT A;  4P9U A;  1UFM A;  3WGG A;  2ELH A;  2GA2 A;  5E18 F;  4DIQ A;  4RMN A;  2OQG A;  5J4V A;  2ZME A;  2MLK A;  2FML A;  4FT8 A;  1U5T B;  1LUJ B;  1G2H A;  1WHU A;  4P1W A;  5FD6 A;  2HQA A;  5IT3 A;  1BJZ A;  2GXB A;  1D0X A;  2X85 A;  4UUV A;  1WJE A;  1B72 A;  1VQP I;  3JTG A;  3IHU A;  1YX5 A;  3K4K A;  4NC7 A;  3ZMT A;  2FUG 2;  3S15 J;  2L7Z A;  4IQ4 A;  3AAF A;  4FCY A;  2I8D A;  4HW0 A;  5H6R A;  1ZR4 A;  4WK8 F;  1IV6 A;  1BR1 A;  3VOE A;  5M5X J;  1MBE A;  2JZY A;  4IQJ A;  4XLA A;  3TP0 A;  4CSW A;  1F36 A;  3I59 A;  3RQ4 A;  3SDB A;  2CW0 F;  3V7R A;  4B4C A;  3CCE I;  3K4L A;  1IZ1 A;  2DI3 A;  3B6C A;  4Y33 A;  4QTR A;  2RVC A;  3HOS A;  1W7P A;  3CUO A;  1XGM A;  3FIW A;  3ISP A;  3KEQ A;  3LFK A;  4FX0 A;  1IRX A;  4L9T A;  3PO3 J;  2XDV A;  4XKC A;  2OCC H;  4PFO A;  2DA2 A;  4IZZ A;  4XM3 A;  1P4X A;  5HS8 A;  4G12 A;  3DEE A;  3DV8 A;  5M5W J;  1TWG J;  2IJL A;  1S7A A;  3R0A A;  1CGP A;  1JI8 A;  2NAZ A;  2M3A A;  3KPH A;  4YG2 F;  3S3O A;  2X48 A;  3SZT A;  3ZMD A;  1SVL A;  1UEL B;  1VQ8 I;  2IA0 A;  1Z7U A;  4L9J A;  4KIT B;  5C3E J;  5JHF A;  3OYA A;  4IXA A;  3G2B A;  4G9Y A;  1NHA A;  4A3I J;  2ZXJ A;  2DOD A;  4I01 A;  1BW5 A;  2CSO A;  1IRG A;  2ACJ A;  1RI7 A;  3M9A A;  2OUM A;  3G1O A;  5HDN A;  2L9N A;  3K69 A;  3RQI A;  4A6E A;  4HQM A;  2B7E A;  3AL0 B;  4A3J J;  3NQO A;  4U0Y A;  1RC9 A;  2OBP A;  4KIC A;  3F8F A;  3JRA A;  5F04 A;  2FOK A;  3J80 K;  1UMQ A;  2E2I J;  2YSR A;  4ZC3 A;  1T33 A;  5ICC A;  1RES A;  1EH8 A;  1K78 A;  1P92 A;  3B73 A;  1A04 A;  4I02 A;  3OOP A;  3TDZ C;  3QYF A;  4MQ9 F;  4B09 A;  2ZJR F;  3U21 A;  1HF0 A;  6PAX A;  3OR2 C;  2VXD A;  3ABL H;  1K6O A;  3QWL A;  1BI2 A;  3GW2 A;  2A61 A;  3S2D J;  5KK1 A;  1P7J A;  1FBS A;  1MBH A;  2WC2 A;  3T5X A;  1NG7 A;  4II2 A;  5LLQ A;  2NS7 A;  3BG6 A;  2CQQ A;  1JTX A;  1OCT C;  3I4M J;  2BY1 A;  1Z6R A;  1ZGA A;  2DT7 B;  2PJP A;  3OYE A;  3HTU A;  4HAM A;  4KDP A;  5CVJ A;  5D8K B;  2IGK A;  3IP4 B;  4QPO A;  1AOY A;  3QYB A;  2KIU A;  3DEW A;  1Y1V J;  1YHQ I;  1KU9 A;  2JSP A;  5E3O A;  4NC6 A;  5E3L A;  1FNN A;  2CQX A;  2GAU A;  4FAS D;  3GEZ A;  2L7K A;  3T0Y A;  1U5T A;  5DCM B;  3CMY A;  2JN6 A;  5D5X B;  2KDO A;  3DXJ F;  1SFU A;  5D6F A;  1X58 A;  2GXG A;  3K0L A;  3JSO A;  1H89 C;  4DYR A;  2JPC A;  4KIB A;  3IKT A;  4FIS A;  2R7F A;  4A93 J;  2LRE A;  1ONV A;  3SHF A;  3OS0 A;  1IUY A;  1MMD A;  2O5R A;  5GTI C;  1KGS A;  3I55 I;  3IWZ A;  4V2F A;  2XAJ A;  1YG2 A;  3BJO A;  1V3F A;  1XN7 A;  2K40 A;  1W4M A;  5J8C A;  4CO8 A;  2LRD A;  2KMU A;  5H2F C;  1KU3 A;  2LY2 A;  1HDP A;  1L0O C;  1WFX A;  2IGO A;  3RZO J;  2X9D A;  2BV6 A;  2BY2 A;  3JRI A;  2X6Y A;  4RGX A;  2G7U A;  4ON0 A;  3RCO A;  1IRZ A;  2K3F A;  3DBH B;  4FHT A;  4UV8 A;  3TKY A;  4H0E A;  4PGG A;  1IJW C;  2BXZ A;  1S5L C;  4BQO A;  1SC7 A;  3MCZ A;  4KN7 X;  4Y17 A;  4EEF G;  4CDG A;  1B59 A;  1I5Z A;  1FJL A;  3F8M A;  1X1C A;  3RPU A;  1YIT I;  1BM9 A;  1P4A A;  1PP8 F;  3G1L A;  1QZZ A;  4BAY A;  2Q0O A;  1DPR A;  1XCV A;  4RAY A;  1U2W A;  3WTU C;  4IPA A;  3JSP A;  3CCR I;  1QO0 D;  2RNJ A;  4DW6 A;  3GVA A;  3BTI A;  3F8N A;  3OYI A;  3BR1 A;  1Y8R B;  1D0Y A;  3GTG J;  3H35 A;  2NVU B;  3OL4 A;  2JTV A;  3K1N A;  4DZJ A;  1XGO A;  4AIJ A;  4HQE A;  2ISY A;  4X1E A;  3W2W A;  3CCJ I;  3ABT A;  2WV0 A;  3CDI A;  1FOK A;  2FBI A;  2QQB A;  2QEN A;  4U0W A;  5H20 A;  2P5L C;  4FE4 A;  1VQK I;  4X0G A;  2HQN A;  2HEO A;  1JKQ C;  1IO2 A;  2BW3 B;  2STW A;  4RB1 A;  4Z2Y A;  2FNA A;  3WTZ A;  2QVO A;  4C9Y A;  4C3J J;  5F6F A;  1LFP A;  2VKV A;  4MO7 A;  4W1U A;  2CUZ A;  2HVS A;  1KA8 A;  4LIV A;  2M34 A;  1RUO A;  2HXI A;  3KET A;  1U5T C;  1VQ7 I;  2I10 A;  1XSX A;  3QOP A;  3CF5 F;  3CCY A;  4ZTF A;  2P7V B;  1V5E A;  4PCQ A;  3A2K A;  3Q3S A;  3L00 A;  3PNY A;  2DA7 A;  1AHD P;  2EBI A;  2ZC2 A;  1R36 A;  2X51 A;  3A0B C;  2V79 A;  2MH9 A;  4GDF A;  2IS1 A;  2WAF A;  3EYY A;  2W82 A;  2XV4 S;  2BOL A;  3CCV I;  4JQF A;  1BI0 A;  3ZR8 X;  3S2W A;  1G3S A;  3Q0V A;  1U6G A;  3PQJ A;  3HHG A;  1PUF B;  5CQE A;  3L2C A;  2H6C A;  4ABZ A;  3M8E A;  5D8L B;  4CCL A;  4BHP A;  2L54 A;  2AXT C;  3S2H J;  1OYI A;  3EUH C;  1LVK A;  4BY1 J;  2H1L A;  4B1R A;  2VL8 A;  2ZB9 A;  1HDD C;  4CCK A;  2Y75 A;  1YIJ I;  3K1P A;  1DQU A;  4PJM A;  1W36 C;  1T38 A;  2CQK A;  1XPX A;  2Y31 A;  3FWE A;  3DQV C;  3ZN1 A;  3MN2 A;  1CQT A;  2MW8 A;  3BPX A;  3D1N I;  1HST A;  1LE8 B;  1ZR2 A;  2JSC A;  1R5H A;  1Z3X A;  2KFD A;  4M3F A;  2ID6 A;  2IVM A;  5F0F A;  3M8F A;  3HC7 A;  4BY7 J;  5HOO A;  1FTT A;  1LFB A;  2LLK A;  1QQI A;  3V7S A;  3QQA A;  2VJJ A;  4M72 A;  1NH3 A;  2ZXH A;  1R1U A;  1W5C C;  3IRQ A;  1ETK A;  2VBX A;  4C3I J;  1AA7 A;  3KP4 A;  1HW2 A;  5E17 F;  3DEU A;  1WWX A;  3L09 A;  2V9P A;  4Y3O A;  2JK3 A;  1QZE A;  3SZG A;  4EJT A;  1M1E B;  4RB3 C;  2F5V A;  2MC4 A;  2GIZ A;  3ZCO A;  2PLY A;  2UWM A;  2EH3 A;  4OAZ A;  5E3N A;  3MWM A;  4PJJ A;  1VQO I;  3U1K A;  2HDD A;  1MMA A;  2XAF A;  2PFB A;  3PNV A;  3OYD A;  4I0A A;  4XKW A;  1LFU P;  1B1B A;  3HKZ A;  4P9F A;  3F0C A;  2DOF A;  4A3M J;  2QQA A;  5CVV A;  1FMV A;  2KP6 A;  2XF5 A;  2X1C A;  3IL2 A;  5LEK A;  2QQ9 A;  2FJ1 A;  1F1Z A;  1YQA A;  3HG9 A;  3PFY A;  4PGH A;  1SFK A;  2VT2 A;  4B43 A;  2LMD A;  3WTX C;  1X1P A;  2GLO A;  1O4X A;  1ZG5 A;  1JGS A;  2H94 A;  3UKG A;  2EIK H;  2PBI A;  3KLO A;  4NB5 A;  2DPD A;  1HW1 A;  4HX4 A;  5TIS C;  4CCM A;  4XID A;  4CUG A;  4R1H A;  3MKZ A;  1H9T A;  3K4B A;  5H6Q A;  1GT0 C;  1OR7 C;  3E7L A;  3G73 A;  1KYW A;  2DXI A;  2R4G A;  1Q1V A;  2HYJ A;  4C2U A;  2DCE A;  2CH0 A;  4ZDL A;  2V6E A;  2CV1 A;  4G7Z F;  2HTS A;  4CA0 A;  2DTZ A;  4IX7 A;  4L5E A;  2FBK A;  1YTY A;  1HBX G;  3I3L A;  1OYY A;  1QNT A;  1BA5 A;  3HBL A;  2OZ6 A;  3RPQ A;  2I5U A;  1DU0 A;  4BS9 A;  4DQ2 A;  2RAE A;  3M7G A;  2DMU A;  3RIR A;  2R7Z J;  4XLC A;  3LSK A;  4RA2 A;  1LKX A;  2FMY A;  4E6K G;  3H0D A;  1F4K A;  4A3B J;  3CZ6 A;  2HQ5 A;  2GBY A;  3FBN B;  3W6J B;  3HRT A;  3WHB A;  1UHW A;  3C1D A;  1NK2 P;  4EJV A;  1XX5 A;  2V1X A;  3I59 B;  4LB6 B;  3RKW A;  3LNQ A;  3BG3 A;  3K4M A;  1V4R A;  1O7L A;  5ILS A;  2RGV A;  5K7F A;  2MH2 A;  1YE9 A;  1TWF J;  2JA6 J;  2L7M P;  4CIC A;  4GYG A;  1W7P D;  3OMY A;  4BXF A;  1J75 A;  4ZDO A;  3GX4 X;  3MFK A;  2VQG A;  5J1Y A;  2MGQ A;  4ENN A;  2Q2E B;  3LSR A;  1E3O C;  5B1A H;  2HTJ A;  1J59 A;  2LBF B;  2NNN A;  2OCE A;  1WGX A;  3LMM A;  4MQV A;  3BC8 A;  4ENM A;  3GFI A;  2QSG X;  3N97 A;  1TW2 A;  3PM1 A;  1ZAO A;  2ETH A;  2QBY A;  3TO6 A;  4YIF A;  2KL4 A;  2ZXI A;  3J80 Z;  1S3J A;  3ZMZ A;  4QLC U;  5HS7 A;  1GDT A;  2R5Z B;  2JA5 J;  3NEU A;  2GQQ A;  1TT0 A;  1GVD A;  5EDN A;  3OS2 A;  2DAO A;  5FKL A;  5BS6 A;  4BQA A;  3GTO J;  2HOE A;  2JWT A;  1LQ1 A;  4BJ5 C;  1V5G A;  3WTY C;  1KZH A;  2O0Y A;  2CV0 A;  5EJC A;  4NC8 A;  1S7E A;  2IGM A;  4NUB A;  3CCQ I;  3F8B A;  3ZQF A;  5DUI A;  3KYC B;  4OAY A;  1FZP B;  1TWC J;  2G0E A;  4UXN A;  4Y4R A;  4WXD A;  4YEJ A;  2VIX A;  1MIJ A;  5FKK A;  5BPD A;  2AO9 A;  1MH4 A;  1BOA A;  2XVC A;  4XKB A;  4CCJ A;  3ZN0 A;  3K70 D;  2FF4 A;  3HEF A;  3VWB A;  2W00 A;  3QAH A;  3SEQ A;  2VPL A;  1LB2 A;  3LFU A;  3E6C C;  5LRR A;  5ILU A;  3BR6 A;  2HPM A;  2Y0S N;  1JUP A;  4CCO A;  2E36 A;  4I7H A;  2EFQ A;  1YJ9 I;  2JRM A;  3BG7 A;  2KDZ A;  4ZYG A;  2XRO A;  5BQT A;  1QGP A;  1HKS A;  2X4H A;  1YJW I;  1OR7 A;  1EH7 A;  1QHH D;  5IP6 A;  1WQ2 A;  2BGC A;  3GLX A;  1OIS A;  3BG5 A;  4XR6 A;  2L9S A;  3DWL E;  3FX3 A;  4ITV A;  1X4P A;  4O3M A;  2COB A;  2ZBK A;  2E7W A;  1SMY F;  3MEX A;  5FKN A;  5L3F A;  1Z7L A;  2LNB A;  3L2V A;  1FOY A;  1ZRF A;  2DPU A;  3ZQH A;  5IP9 J;  2QSF X;  2RQQ A;  2DJI A;  1G8X A;  3KP6 A;  3RSN A;  4G6T B;  3MZH A;  3WTT C;  3IH4 A;  3H36 A;  3X2Q H;  3KP2 A;  2VC0 A;  2P0W A;  4PSW A;  2L9R A;  2DA3 A;  2IW5 A;  2KIM A;  1I27 A;  2ZSH B;  3IH3 A;  3WE2 A;  3GTP J;  1D1A A;  1HQC A;  1N25 A;  2E1O A;  2M4G A;  3KZY A;  5J8F A;  3RKQ A;  3ZRG A;  1I3A A;  4M73 A;  3S3M A;  4DYC A;  3GTK J;  5E1Z B;  5M3F J;  4MTE A;  5HOD A;  3ZMV A;  3CDL A;  1RR7 A;  1APL C;  1MH3 A;  3PUB A;  2GXA A;  4KYW A;  4U87 A;  3AG1 H;  2FX0 A;  2VJI A;  2A5Y B;  1KQ0 A;  2GM4 A;  1LPQ A;  5D4S A;  3C7J A;  3DP7 A;  3SQN A;  4W97 A;  2GWR A;  3OY9 A;  2KZV A;  1O3Q A;  3EET A;  2DYR H;  2K9M A;  2R7S A;  2XIG A;  2DU9 A;  4D7M A;  1NTC A;  1ETY A;  4BJ6 C;  1WH7 A;  2ZFU A;  2VJ4 A;  1X19 A;  3LSH A;  1KYZ A;  1X3Z B;  2ELK A;  1XG1 A;  5F08 A;  3QP5 A;  2VBY A;  3JR9 A;  4R79 A;  1OPC A;  1XDU A;  3QPS A;  2LC2 A;  2QUF A;  3JRD A;  5EZH A;  3GFM A;  3QU3 A;  3DTI A;  4BHC A;  1PDN C;  2QM3 A;  2OTL I;  3BP8 A;  4OIQ F;  1KON A;  3JAM K;  1NK3 P;  2M0M A;  1W0T A;  4G7O F;  3HTS B;  1JKR C;  3IUO A;  1V5F A;  1VQM I;  1D1B A;  2JT1 A;  4Y13 A;  1X3U A;  1IF1 A;  4YFX F;  2OQR A;  3J81 Z;  1XGS A;  1UHM A;  2CMP A;  2QWW A;  4HF2 A;  3JRE A;  2V1U A;  2AXL A;  4F7Z A;  4C3H J;  1QU3 A;  2L01 A;  3CLQ A;  1IN6 A;  4LIT A;  4PFP A;  5CYV A;  1LNW A;  2IT0 A;  4B48 A;  1K4T A;  4FE7 A;  1A5J A;  1X3W B;  1KQ8 A;  1PJR A;  2KT0 A;  4MEY F;  1FSH A;  4C2M J;  2DMQ A;  2DA5 A;  5DYM A;  4AVZ A;  3B02 A;  3GZ6 A;  1SD7 A;  1GXP A;  3OYK A;  1B72 B;  3E0J B;  2R7Q A;  1OCC H;  2VOO A;  5DD8 A;  3BR5 A;  2OV7 A;  2Y48 A;  5IT9 K;  1EF4 A;  4L0Y B;  2A05 A;  4ZYA A;  4N4N B;  1B4A A;  3HXL A;  4DOZ A;  1L3L A;  1VI0 A;  4F93 B;  1LVA A;  3PJR A;  4FET A;  2HZT A;  1PP7 U;  2R7U A;  4EAT A;  2OF7 A;  5IOY A;  3KX2 A;  1USS A;  5FKO A;  4UVC A;  3OL3 A;  4A0Y A;  3REO A;  2ZXW H;  1A36 A;  2NS8 A;  4N9I A;  1MW7 A;  4AID A;  1YS7 A;  2KRF A;  2Y2Z A;  2FD5 A;  2A6H F;  2QLZ A;  2O9L A;  1U9N A;  5ICF A;  1WJ5 A;  4D7N A;  4OIN F;  2NVY J;  4EGZ A;  2IGN A;  4OMZ A;  4ANJ A;  3GUD A;  2L3D A;  1W5T A;  4G6Q A;  5KAF C;  1HKT A;  2P6S A;  2QKM B;  1LDJ A;  1WCM J;  1UB9 A;  4A3L J;  2RDP A;  2HS5 A;  1FY7 A;  2E2H J;  2NVX J;  4UNO A;  5FRM A;  3BZK A;  3MKY B;  3K4C A;  3FXL A;  2IRF G;  4A3D J;  1FOW A;  1B8I A;  4XN0 A;  2JVG A;  3ONQ A;  3QPL A;  1T8I A;  1E17 A;  1MMN A;  1GV2 A;  2HVQ A;  4M9X A;  1UZC A;  3MZY A;  4XOP A;  2O03 A;  3JRG A;  3BR0 A;  2DLL A;  1R00 A;  4BE1 A;  2VPR A;  2Z2S B;  1DGW Y;  2ZJP F;  2XB0 X;  5BOX A;  1MJA A;  4ZTJ A;  2A6T A;  3OS1 A;  2L4A A;  5AIP A;  2EV0 A;  3G1M A;  1JUS A;  4IOC F;  2QGU A;  3RTR A;  3AG2 H;  3S32 A;  1T98 A;  4EMS A;  2F5F A;  1R23 A;  4BL0 B;  1ON2 A;  5K5Q A;  2MLG A;  4XLH A;  1IC8 A;  5LEJ A;  5J47 A;  4J01 A;  1AU7 A;  4UHT A;  1K83 J;  3K4N A;  1BN5 A;  1IN8 A;  2RV8 A;  1ZQ3 P;  1JHH A;  2VOD A;  3HPG A;  4NBQ A;  3DPL C;  2EZK A;  1Y56 A;  1R4M B;  4IKF A;  1HCR A;  4ZYE A;  1HW5 A;  3K10 A;  5GAD J;  3GZN B;  3EQL F;  4ZYD A;  5GTH C;  2BYV E;  2GZW A;  5E8I A;  4EM0 B;  4Z6Y A;  3K2Z A;  1XMK A;  2JQ7 A;  3E5Q A;  2V6C A;  4L5J A;  1CF7 A;  4GXO A;  2NVT J;  1QZY A;  4HF0 A;  3TGN A;  2XF6 A;  2CUJ A;  2CG4 A;  3GBG A;  4M6Y A;  3ABM H;  4ZDP A;  4CYD A;  4F92 B;  3V8K A;  3HOY J;  2RKH A;  3VEP A;  2VUM J;  5M5Y J;  2HI3 A;  1SD6 A;  4HNV A;  4XRS A;  1XS9 A;  1A6Q A;  1FBQ A;  2ECB A;  1MDM A;  1LEB A;  5IYB J;  1S72 I;  4KA4 A;  3DKY A;  2ECC A;  2H8W A;  4G8X A;  4M6V A;  2VKE A;  4XRF A;  2ZJ2 A;  4AIK A;  2VAS A;  1R49 A;  3BJA A;  2O61 A;  5IPA A;  4HX8 A;  5EEG A;  3PQK A;  4CZC A;  2EWN A;  1ON1 A;  1GVJ A;  3E5X A;  2BEO A;  4ESB A;  4JOM A;  4CHU A;  2XAS A;  1MNM C;  1B8I B;  1VND A;  4RDU A;  3W2V A;  2HKO A;  4ASN A;  4HLX A;  1OKR A;  5L3E A;  1T08 B;  5K5O A;  3FXQ A;  1ZLJ A;  5L3B A;  4BE2 A;  1STZ A;  1TTY A;  3LSM A;  2K02 A;  1FMW A;  2XAG A;  1GLN A;  1RET A;  1VQ4 I;  1O7F A;  1G4D A;  1MBK A;  2K7L A;  1T6S A;  2PMH A;  5JHU A;  3OYG A;  3J7Z I;  3H5N A;  3VB2 A;  4IJA A;  1H0M A;  2E1M B;  2QQ8 A;  3P9K A;  5FKM A;  2XSJ C;  1E3P A;  5E1W A;  5LBQ A;  2R3S A;  4JX4 A;  3CCS I;  3GO5 A;  3TDU C;  3AG3 H;  1GXQ A;  2DDB A;  2YX4 A;  4CCN A;  5HLG A;  3IC7 A;  2Z9O A;  2HOT A;  3PUF A;  1XSV A;  2HWV A;  1UG2 A;  4BHB A;  2R92 J;  4XLF A;  3FXO A;  2E2J J;  2LBF A;  3VYS B;  2ADU A;  4KIG A;  5A2Q K;  2QEX I;  4RB0 A;  3Q5F A;  1Z9C A;  1OMI A;  3WGI A;  2GOX B;  2M8G X;  2PN6 A;  2E1M C;  2JVH A;  3EUH A;  5DS9 A;  3TP3 A;  5L3D A;  2EFW A;  1T95 A;  5CVU A;  3F3X A;  1OLT A;  4KJZ A;  4C30 A;  4CZZ A;  2O6G E;  2V1D A;  4Q47 A;  2LR8 A;  1TWH J;  3WE3 A;  4II3 A;  3FZV A;  2L9V A;  4LG0 B;  1XDS A;  3H3U A;  3OIP A;  3GYH X;  2PG4 A;  3H92 A;  2GOM A;  5IT9 Z;  2ZCW A;  1IRF A;  3CJN A;  1Z21 A;  2EV6 A;  3OIQ A;  4HZF A;  5ERI A;  4QPQ A;  2E7X A;  2W84 A;  3ROU A;  3V4G A;  2M8E A;  3JRF A;  3TO7 A;  1W0U A;  5DTD A;  2EA4 A;  1JHF A;  2OZU A;  3ZQC A;  2CWE A;  4IRG A;  3N05 A;  5J6X A;  3BR3 A;  1IAW A;  2DOA A;  4ENK A;  1BR2 A;  4O5V A;  2WB1 A;  2WAD A;  3T8T A;  3I4P A;  4GGG A;  4J19 A;  3HL2 A;  3J81 K;  5FD5 A;  3S17 J;  2QKL B;  2FNP A;  4BNC A;  3L9F A;  2R5Z A;  1JUM A;  5FO5 A;  4HPQ A;  2XGC A;  3MMY B;  3DLL F;  1Z05 A;  4YRV A;  1CF7 B;  3BCA A;  3KYD B;  1XCB A;  2ZJQ F;  1I3Q J;  2JA7 J;  4MLO A;  3LA7 A;  3QU6 A;  3J7Y J;  2EA2 A;  3FF5 A;  2XRL A;  2WBM A;  2R0Q C;  2L0K A;  2M7B A;  2X6W A;  3GF2 A;  3CJQ B;  3GWZ A;  3FKI J;  3FK7 A;  4YFK F;  1XGN A;  4A6D A;  3NWT A;  1E2X A;  1WI3 A;  1MKM A;  2DFH A;  3DPU A;  5TGT A;  3C2G A;  3CTA A;  5DD4 A;  2X1E A;  1IW7 F;  1J5Y A;  4ENJ A;  2PMZ N;  1Z91 A;  3JRB A;  3S1Q J;  4EM1 A;  2LYC A;  1W5S A;  2DA4 A;  5F64 A;  2KIQ A;  1D8J A;  3GLL A;  4JX5 A;  5EYR A;  1FPQ A;  3FDY A;  2Q8K A;  3V7C A;  1H88 C;  2Q2E A;  3DU5 A;  4KNY A;  2V7F A;  4S05 A;  1XB4 A;  3Q0U A;  4RM3 A;  1ZN2 A;  3KCC A;  1ZAR A;  1T56 A;  4G6D A;  3COA C;  3ZQ7 A;  3CCM I;  2OTJ I;  1NG6 A;  4FQG A;  1YFH A;  1FP1 D;  3HM5 A;  4Y15 A;  5GAE J;  4IVN A;  4CXF A;  5FLV A;  3LA2 A;  2BVM A;  2DQR A;  3DTK A;  1XD7 A;  1RZ4 A;  1TQP A;  3M1C A;  3NWS A;  2MG4 A;  4LIU A;  2BHY A;  3W6V A;  5AIQ A;  3ELK A;  2DMT A;  1T0F A;  1VFC A;  1U8B A;  5C4X J;  3D5R C;  2F4I A;  1PYV A;  4WXH A;  2HZD A;  5F0H A;  2E35 A;  4OU0 A;  3JRC A;  3OYJ A;  4JP0 A;  2CW7 A;  3CC7 I;  3S93 A;  1FYL A;  3WG9 A;  3BG9 A;  5JVT A;  5IYC J;  2G7H A;  3RYR A;  3HKZ N;  5K1Y A;  2F2E A;  3PL8 A;  3ZXS A;  4D5C A;  5E79 C;  3CUQ C;  3CP2 A;  3GFJ A;  3HUG B;  5HDG A;  2D1H A;  4U0V A;  2E19 A;  3Q9S A;  1XMX A;  2N8G A;  2X6X A;  3BQY A;  2NS0 A;  3H9Q A;  2LF8 A;  3BTC A;  3EPZ A;  2VKH A;  5A2Q Z;  2LG4 A;  4LB5 A;  1RNL A;  1TNT A;  2LSO A;  4AD9 A;  4BU2 A;  3F21 A;  2K3P A;  2RN7 A;  3TO9 A;  3J7A Y;  5D4R A;  1J7K A;  5EF6 A;  3I56 I;  5E20 A;  3KEO A;  1YX3 A;  4ZYH A;  3HOV J;  4XLN F;  3I4N J;  2ESN A;  3HSF A;  4DBQ A;  1IGN A;  3FM3 A;  1ORK A;  4UB6 C;  1Y0U A;  3SZP A;  2XRN A;  1V55 H;  2VQL A;  2DFI A;  4BYY A;  2L4M A;  1SFO J;  2XAU A;  1S8N A;  4XRM A;  2Y9Y A;  2WY7 Q;  3R60 A;  2DJN A;  2DA1 A;  4XK4 A;  1QA6 A;  4XSX F;  2EZL A;  3S3N A;  3TL4 X;  5ICG A;  3SDG A;  4LG3 A;  4MFD A;  3JRH A;  2HOS A;  3HGG A;  1IV8 A;  3O8H A;  5K7H A;  2VQC A;  1BC8 C;  1BR4 A;  3CDH A;  2MD0 A;  2IXS A;  2A68 F;  5C4J J;  3HOT A;  1POG A;  1LE8 A;  3CF2 A;  2XSD C;  3ECH A;  2L2O A;  4Y7N J;  2O8K A;  3KEY A;  5GAG J;  3ZP5 A;  1FBU A;  1ZGJ A;  3O6B B;  2M45 A;  3HSE A;  4BAC A;  3PO2 J;  3OYC A;  3PSI A;  3LST A;  3ZQL A;  3V8J A;  1J2X A;  2E71 A;  4KT5 C;  2QCO A;  2WAQ N;  4GYI A;  3TQN A;  2R7X A;  5HNF A;  4I99 C;  4BBR J;  3ZMS A;  1VZ0 A;  1K61 A;  2LVS A;  3LSP A;  1MBG A;  3WG7 H;  1MDM B;  4AC0 A;  1H9G A;  3Q9V A;  1SVO A;  3KIO A;  4RAZ A;  3CMM A;  5ICE A;  4IHS A;  1YW7 A;  5IY5 H;  1ETW A;  2P5K A;  9ANT A;  3IRR A;  2WA0 A;  4U7B A;  1N77 A;  4IHX A;  2PQ8 A;  5BMZ A;  3FK6 A;  3M07 A;  2M9H A;  2Y69 H;  1ZEL A;  4E7H A;  2PJR A;  1R9T J;  4BDZ A;  3OYM A;  1EH6 A;  5J4Y A;  2HR3 A;  2MBF A;  1YYV A;  3QOD A;  4X6A J;  2DDA A;  2QA4 I;  5LHH A;  3FMQ A;  4WX9 A;  5JVG F;  4XLP F;  3KYL A;  2NOG A;  3K4J A;  4XOT A;  1HKQ A;  3NAU A;  1SFE A;  1OFC X;  3IV5 A;  4XNF A;  1ETV A;  2EFO A;  2GIV A;  4OIO F;  2VKD A;  1GHC A;  1DPU A;  1KQ9 A;  1BIB A;  1FC3 A;  3F6O A;  3A03 A;  5LHG A;  4FTH A;  1UAA A;  3GFL A;  4CYC B;  1I1S A;  5BNG A;  2EIM H;  1MMS A;  1OYW A;  3CME I;  2XAH A;  2VXZ A;  4UVA A;  5J1R A;  3PFI A;  4HSR A;  3HOX J;  4IHW A;  2MSY A;  4MFE A;  3I5U A;  4EVI A;  4B47 A;  4AIH A;  3CC4 I;  2P4W A;  4KUM A;  4G94 A;  4PDK A;  5LD2 C;  2DOE A;  3ECO A;  2B63 J;  1P2F A;  2HKX A;  3E6B A;  1Q1H A;  2LF7 A;  4KMF A;  5LGU A;  1MZB A;  2ELJ A;  1Z0X A;  2LDU A;  3BWG A;  4A2U A;  1QVT A;  3S1R J;  3GTM J;  3PIO F;  3M3Y J;  4MTD A;  4A3C J;  3VOD A;  3G4S I;  1VQ6 I;  3PSF A;  1VQN I;  4GRI A;  3F72 A;  2UXX A;  4N0B A;  1OCP A;  1ETO A;  2PMZ A;  3BT9 A;  3F6V A;  1R71 A;  1U3E M;  2C6Y A;  2TCT A;  5FFZ A;  1SFX A;  1XTA A;  3M4O J;  1UST A;  4XOR A;  2LY1 A;  5DUK A;  3DPT A;  2EFN A;  1FTZ A;  2M87 A;  3I53 A;  3WU0 A;  1YO5 C;  2DW4 A;  2Q1Z B;  3FXM A;  3FHZ A;  3ZPL A;  3B6A A;  2M4K A;  3BRO A;  2BVL A;  4M71 A;  4D5F A;  1S7O A;  1WJB A;  3S8P A;  1TC3 C;  3CLO A;  4L0Z B;  2W4S A;  4R8H A;  1FIA A;  2X0L A;  1FYM A;  1G59 A;  1D0Z A;  2LFB A;  2OD5 A;  2A6E F;  1F9N A;  4S0H B;  3R6S A;  1O3R A;  2NOJ B;  4YFN F;  4WWC A;  1YS6 A;  3RZD J;  3MZ8 A;  3WOD F;  4Y52 J;  2PEX A;  3CO7 C; 
#chains in the Genus database with same CATH homology
 3H35 A;  3OL4 A;  4PJL A;  3QOE A;  4BL0 B;  2AQF A;  3W2W A;  4XLH A;  4J01 A;  3K4N A;  4X0G A;  3W3C A;  4NQW B;  3OYL A;  2BW3 B;  1Y6I A;  1MMG A;  3L2Q A;  4C9Y A;  1LFP A;  3HPG A;  3OYB A;  4BEH A;  2CUZ A;  2HVS A;  3DPL C;  4LIV A;  2V9K A;  1Y56 A;  2A5W A;  5CQG A;  4IKF A;  2CV2 A;  1S9H A;  1WJC A;  3K10 A;  3VYR B;  4ZTF A;  4DBR A;  1V5E A;  2MYS A;  4D1Q A;  4XQF A;  3A2K A;  2W1O A;  4YEL A;  2E5Z A;  4RLQ A;  2E5N A;  3D5L A;  3PNY A;  3OWT A;  3A4C A;  3AKZ A;  2XF6 A;  1X4O A;  2CUJ A;  2X51 A;  1D1C A;  3GBG A;  4ZDP A;  4F92 B;  2IS1 A;  2WAF A;  2W82 A;  4XN3 A;  4E7L A;  2V1N A;  2BOL A;  4JQF A;  1WJD A;  3ZR8 X;  2XC7 A;  3H9G A;  1WJF A;  2VLA A;  5CQE A;  3IAS 2;  2Z1D A;  4CCL A;  3C2H A;  3DKY A;  2KPM A;  5KCM A;  4DJA A;  3EUH C;  1LVK A;  3DLA A;  2VL8 A;  2K5C A;  1EA3 A;  2VAS A;  2Z16 A;  4CCK A;  1DQU A;  4PJM A;  1W36 C;  2HVR A;  4CZC A;  3DQV C;  4JOM A;  3AFH A;  3W2V A;  3L2W A;  1Z3X A;  1Z3Y A;  3HC7 A;  5HOO A;  4BE2 A;  5CPR B;  3LSM A;  1FMW A;  2VJJ A;  1GLN A;  2ZXH A;  1TZL A;  2VQH A;  4KT6 A;  4RLF A;  3OYF A;  3OYG A;  4XKV A;  3H5N A;  1AA7 A;  3RPU D;  2E1M B;  4E7K A;  1SAU A;  2R7V A;  2XSJ C;  4Y3O A;  3BLY A;  1P9Q C;  4OWR B;  4BQN A;  3SZG A;  3EUA A;  3ZGK A;  2F5V A;  2LH9 A;  2R7T A;  2AQE A;  2MC4 A;  3ZCO A;  4CCN A;  2UWM A;  4OAZ A;  4RM2 A;  3CJR B;  4PJJ A;  1E0E A;  3L2R A;  1MMA A;  3PNV A;  4XLF A;  3OYD A;  2LBF A;  3VYS B;  4XKW A;  2HPI A;  3HKZ A;  3SEZ A;  3OYN A;  2GOX B;  4E7S A;  2F6C A;  3I9V 2;  1FMV A;  2KP6 A;  2XF5 A;  2X1C A;  2Y0S A;  2E1M C;  2JVH A;  3MKW B;  3HG9 A;  3PFY A;  2KQR A;  1T95 A;  1SFK A;  4B43 A;  4C30 A;  1OLT A;  3H9J A;  4KJZ A;  5HVQ C;  2HU9 A;  3L2U A;  4II3 A;  4E7I A;  3DKX A;  3ZQQ A;  3OOU A;  3OIP A;  2K9L A;  4CCM A;  4CUG A;  2M7A A;  2GOM A;  3MKZ A;  5KNL A;  3K4B A;  4BQQ A;  3OIQ A;  1Z21 A;  3IAM 2;  1OR7 C;  4QPQ A;  2DXI A;  2R4G A;  2V4J C;  2X1D A;  4C2U A;  3VSK A;  2DCE A;  2CH0 A;  4ZDL A;  5KHD A;  1U0J A;  2CFO A;  2CV1 A;  2V6E A;  3N05 A;  4CA0 A;  4IX7 A;  4C2T A;  2DOA A;  2IS6 A;  4HG2 A;  1BR2 A;  3DTE A;  4HRI A;  3I3L A;  2WB1 A;  2WAD A;  3HL2 A;  3BCB A;  2KHM A;  3UNG C;  2UUZ A;  4PSX A;  2QKL B;  4BS9 A;  1BOB A;  4P5O A;  4HPQ A;  4XLC A;  3MMY B;  3LSK A;  3V42 A;  1LKX A;  4E6K G;  4YRV A;  3H0D A;  3BCA A;  3CZ6 A;  3CP8 A;  3FBN B;  1QHG A;  3LSG A;  3M8J A;  4F91 B;  2PJR B;  4MLO A;  1DP3 A;  1X1B A;  2KLO A;  2R7W A;  1K6Y A;  1T0F C;  4HEA 2;  2WBM A;  2WAQ A;  2MAB A;  4F55 A;  2M7B A;  2X6W A;  4XLE A;  4BEH B;  3CJQ B;  4PUS A;  3AL0 C;  3K4M A;  3OYH A;  3NWT A;  2BW3 A;  3D5S C;  3VDX A;  2RRE A;  1YE9 A;  3DPU A;  5TGT A;  3C2G A;  2X1E A;  3LSI A;  4B44 A;  4BUP A;  3OMY A;  3A1Y A;  4BXF A;  4ZDO A;  3HPH A;  2WY8 Q;  2KRH A;  2WAE A;  2LYC A;  2VQG A;  4NNJ A;  4HST A;  3K70 C;  2Q2E B;  3QYE A;  2LBF B;  3TMO A;  2JA2 A;  3PNT A;  3LMM A;  4H4K C;  2XF7 A;  3BC8 A;  3FDY A;  1UG0 A;  2KRC A;  2MFZ A;  3DU5 A;  2V7F A;  4RM3 A;  2KL4 A;  2ZXI A;  4D9J A;  4HNT A;  1NG6 A;  5FRO A;  4N4O B;  4B3X A;  1TT0 A;  4BGD A;  4HNU A;  3OS2 A;  1HA8 A;  1MNE A;  2BVM A;  3DTK A;  3M1C A;  3NWS A;  4LIU A;  1N75 A;  3VSL A;  4BJ5 C;  1V5G A;  3H5R A;  2CV0 A;  4PK4 A;  1MND A;  1ERD A;  4NC8 A;  2IGM A;  4NUB A;  5CKT A;  2IS2 A;  3D5R C;  2F4I A;  1LDK B;  4OAY A;  1PYV A;  2HZD A;  3TBI A;  3SYT A;  4Y4R A;  4F52 A;  4YEJ A;  2VIX A;  3OYJ A;  2W7N A;  4AU7 A;  2CW7 A;  4KIS A;  3S93 A;  4DIQ A;  3DU6 A;  3EUK L;  4XKB A;  4CCJ A;  2R7O A;  4RMN A;  3K70 D;  1N78 A;  2VB6 A;  3FHN A;  3VWB A;  2W00 A;  3PL8 A;  3SEQ A;  3ZXS A;  4AYB A;  2VPL A;  3LFU A;  3CP2 A;  3HUG B;  2HPM A;  4P1W A;  2HQA A;  1D0X A;  4E7Z A;  2X85 A;  4CCO A;  1WJE A;  2X6X A;  3H9Q A;  3BG7 A;  4CH7 A;  1YX5 A;  3EPZ A;  3K4K A;  2VKH A;  4NC7 A;  2FUG 2;  4IQ4 A;  2LG4 A;  2R7R A;  2I8D A;  2HNH A;  4XON A;  4BU2 A;  1BR1 A;  1QHH D;  2K3P A;  4IQJ A;  3J7A Y;  4XLA A;  4XR6 A;  4CSW A;  3RQ4 A;  2L9S A;  4J00 A;  3DWL E;  4ITV A;  1X4P A;  3SDB A;  3K4L A;  2DT6 A;  1Z7L A;  1YX3 A;  4Y33 A;  3L2V A;  2JUG A;  3E1S A;  2RQQ A;  2DJI A;  1G8X A;  4DBQ A;  3HOS A;  3RSN A;  4G6T B;  2VQL A;  1IRX A;  2P0W A;  2XDV A;  4PSW A;  1X1A A;  2XAU A;  4XKC A;  4PFO A;  2E60 A;  2ZSH B;  4IZZ A;  4XM3 A;  2WY7 Q;  1D1A A;  2V26 A;  3DEE A;  2M4G A;  3S3N A;  3TL4 X;  3ZRG A;  4E7J A;  3S3M A;  1JI8 A;  4LG3 A;  2M3A A;  3S3O A;  3FBI B;  1UEL B;  2VQC A;  3PUB A;  1BR4 A;  2MD0 A;  2IXS A;  4U87 A;  4F3Q A;  4KIT B;  2HDW A;  2VJI A;  5JHF A;  3OYA A;  3HOT A;  3CF2 A;  2L2O A;  3VYU B;  3KEY A;  3OY9 A;  3G2B A;  2KZV A;  3S32 A;  2K9M A;  4BAC A;  2R7S A;  3OYC A;  3PSI A;  4BJ6 C;  2OUM A;  2ZFU A;  2L9N A;  2VJ4 A;  3AL0 B;  1X19 A;  3LSH A;  2R7X A;  5HNF A;  1VZ0 A;  3W2A A;  4R79 A;  3CMM A;  3K6G A;  2LC2 A;  1DGR M;  4ZC3 A;  2WA0 A;  2VJ5 A;  3DTI A;  4ZJZ A;  4U7B A;  1N77 A;  1KON A;  2M0M A;  4BE0 A;  3QYF A;  3IUO A;  1V5F A;  1D1B A;  4E4H A;  3U21 A;  2UV1 A;  4PJN A;  3OR2 C;  1ZEL A;  4E7H A;  2PJR A;  2CS3 A;  4BDZ A;  3OYM A;  2VXD A;  3QOD A;  2CMP A;  3VYT B;  1QU3 A;  1NG7 A;  4II2 A;  4XL9 A;  3BG6 A;  3LL7 A;  4LIT A;  4PFP A;  3KYL A;  3K4J A;  4XOT A;  1R6R A;  2DT7 B;  4B48 A;  5FRN A;  3OYE A;  2RNG A;  4XNF A;  1PJR A;  2VKD A;  1J09 A;  2IGK A;  3IP4 B;  3MD2 A;  4AVZ A;  4QPO A;  3QYB A;  2ZSI B;  3OYK A;  2OC6 A;  4DGW B;  1UAA A;  3E0J B;  2JSP A;  2R7Q A;  2OV7 A;  3F9K A;  4FAS D;  2VXZ A;  4HSR A;  2L7K A;  4XMY A;  4ZYA A;  4N4N B;  4BDY A;  2KDO A;  4B47 A;  3HXL A;  1WJA A;  4DOZ A;  4F93 B;  3PJR A;  4FET A;  2R7U A;  4EAT A;  3KX2 A;  3UR3 C;  5LD2 C;  3OL3 A;  2LRE A;  2CW8 A;  3OS0 A;  1MW7 A;  3FKJ A;  1MMD A;  2O5R A;  5HNH A;  5LFA A;  2ELJ A;  3OR1 C;  1WJ5 A;  2IGN A;  4ANJ A;  1W36 D;  3PSF A;  2IS4 A;  2QKM B;  4GRI A;  2PMZ A;  2LRD A;  2KMU A;  2LY2 A;  4BJT A;  5FRM A;  3MKY B;  1WFX A;  2IGO A;  3K4C A;  4XN0 A;  2JVG A;  2X6Y A;  3ONQ A;  3RCO A;  1MMN A;  4XOR A;  2LY1 A;  3DPT A;  2HVQ A;  4BQO A;  3CES A;  4XOP A;  1X1D A;  2Q1Z B;  1X1C A;  2M4K A;  2BVL A;  1WJB A;  3S8P A;  4BE1 A;  2W4S A;  2Z2S B;  1DGW Y;  3H5A A;  1G59 A;  1D0Z A;  2LOO A;  2L5Q A;  4ZTJ A;  2A6T A;  5HLT A;  3OS1 A;  2NOJ B;  3RTR A;  3OYI A;  1D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...