3U23A

Atomic resolution crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide from human rin3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'RQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CD2-associated protein
molecule tags Protein binding
source organism Homo sapiens
publication title Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
pubmed doi rcsb
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3u23A00
2JS0A 1UJYA 2KXCA 5HCKA 4OMMA 2L3QA 4J9BA 1MV3A 3H0FA 1B3QA 3TSZA 2VKNA 2KXDA 1BK2A 4R0KA 2J06A 3TVTA 2H8HA 2ROLA 1CKAA 2W0ZA 3M0TA 4LE9A 5GJWB 1GBRA 1WX6A 2ED0A 1RLPC 1WXBA 2DNUA 4J9FA 2DRMA 2DA9A 1WYXA 4LUDA 1N5ZA 1FMKA 1OPLA 1TUCA 2LJ3A 3REAB 1T3LA 3H41A 1V1CA 2EGEA 4OMLA 3NPFA 2YT6A 1KSWA 3EGUA 1K0XA 3EG1A 4RTWA 1AVZC 4OMQA 1AWXA 2DL3A 1UE9A 2FO0A 3RBBB 3M0SA 2KT8A 2RQRA 3ULRB 1H8KA 2OJ2A 1WDXA 1AZEA 2DL8A 4AFSC 2LQNA 3FJ5A 2RPNA 2A36A 3VS6A 2A37A 1AWOA 4HVUA 2JMAA 5L23A 2CDTA 3M0QA 1NM7A 1JQQA 1OOTA 2K9GA 2YUNA 1YP5A 1X43A 4RTZA 2EW3A 2QDLA 1NG2A 2SRCA 1GFCA 1UHCA 2W10A 1ZUYA 2RQUA 4Z8AA 2DVJA 2O2OA 2PZ1A 2G6FX 2DF6A 4QT7A 1PKSA 1WA7A 1Y0MA 2LX7A 2HCKA 3LH5A 4JPBW 1SSHA 2DLPA 1HJDA 3UA6A 1AWWA 2A28A 1EFNA 1K1ZA 2O88A 2OI3A 3EG3A 1NEBA 3SEMA 3R6NA 1I07A 4AG2C 2GGRA 3NGPA 1HSQA 2JXBA 3M0PA 2HSPA 2JM9A 3EG0A 1KFZA 2DX1A 1MV0B 1JEGA 2EGCA 4RUGA 2KBTA 1RI9A 2EYXA 5IHNA 2HBWA 1GCPA 1XOVA 1M3BA 3C0CA 1JXOA 1OPKA 3EG2A 2O9VA 4AG1C 1X6GA 1SRMA 3A98A 4F16A 2CH4A 2ED1A 2KYMA 1VYVA 4OMPA 2CREA 4AFQC 4F17A 5IXFA 2K79A 3GBQA 2C0IA 2LQWA 5IHIA 4AFUC 1VYUA 1YWOA 1YNZA 2ESWA 1GL5A 5GJVB 1W6XA 3I5SA 1ZUKA 2EBPA 2YUQA 2ECZA 1X69A 1AD5A 3VS4A 2KRMA 3NMZC 1UFFA 1Y57A 1AEYA 2LJ0A 2J7IA 1X27A 2JMCA 2LP5A 2AZVA 2I0NA 4J9IA 3PVLA 1SRLA 3QWYA 1B07A 4IIMA 3PE0A 1ZSGA 2DMOA 2CSQA 2K2MA 2K7AA 1WI7A 4A63B 4DEYA 2SEMA 1RLQC 2KNBB 1X2KA 4Z89A 3QWXX 5FWBA 1K0SA 3UF4A 3I9QA 2DYBA 2V1RA 1T0JA 2BZYA 2CH4W 5FWCA 4CC4B 1UJ0A 2FRYA 2RF0A 3VS2A 4AFZC 2F2XA 2DILA 2M0YA 4K11A 1W70A 1YN8A 4WCIA 2EYYA 2J6FA 1K4US 2KROA 2BTTA 1UECA 1QKXA 2YUPA 2JW4A 2DL7A 2EVRA 3VS0A 4F14A 1MUZA 1SHFA 1GRIA 2FG0A 1PRMC 4J9HA 3IQLA 3EHQA 2CSIA 2CT3A 2GTOA 1OV3A 2CT4A 1UDLA 2MIOA 2LMJA 1M27C 1U06A 1WFWA 1NYGA 2OAWA 3REBB 2C0TA 2JTEA 5ECAA 1GCQC 2K3BA 2O31A 3VS7A 2FPFA 4J9CA 4LUEA 1UTIA 1WIEA 2D0NA 1I0CA 1SHGA 2DL4A 2FEIA 2AZSA 4J9GA 1T3SA 1HD3A 1G83A 1H92A 1T0HA 1WXUA 2DBKA 2NUZA 2X3XD 5EC7A 1RUWA 4HVVA 3TSWA 4GLMA 1PNJA 1NEGA 1AOJA 2RQTA 1PRLC 1BU1A 1KIKA 2VWFA 4CC3A 1WLPB 2L3PA 2K6DA 1JU5C 4E6RA 2DM1A 4J9DA 2VVKA 3UA7A 2JT4A 3VS3A 2RN8A 4Y92A 1YWPA 2KEAA 2LZ6B 1M3AA 1UG1A 2KYBA 4M4ZA 2L0AA 1TUDA 2MOXA 2AK5A 2L3SA 2NWMA 4FSSA 4RTVA 3JV3A 4X1VA 3U23A 2JS2A 2X3WD 4JJCA 2V1QA 2KT1A 1U3OA 3H0HA 2J05A 1I1JA 2RQVA 2DE0X 1QCFA 1YCSB 2CUBA 1QLYA 3KFVA 4CC2A 3H0IA 1SPKA 4JZ4A 2LNHB 3CQTA 1UUEA 4RTXA 3O5ZA 4OMNA 1E6GA 5I22A 2RMOA 3THKA 3VS1A 1ABQA 2EYWA 4HXJA 1M30A 2LCSA 1KJWA 1TG0A 3PVQA 2DRKA 2FPEA 4EIKA 1M8MA 3I35A 1BB9A 2DL5A 2RNAA 4ZNXA 5FW9A 4RTUA 2B86A 2HDAA 2D8JA 1AWJA 3NHNA 2GTJA 4HVWA 2KRNA 1GCQA 2D8HA 4OMOA 4IIOA 4ORZA 1SEMA 4D8KA 2KRSA 4HCKA 2YUOA 5IH2A 1CSKA 2JM8A 1A0NB 1PKTA 1QWEA 4RTTA 1ZLMA 2BZXA 2FRWA 1PWTA 2EGAA 1NLOC 1X2QA 1WXTA 4RTYA 2EYZA 2DBMA 2L2PA 3VS5A 4ESRA 1S1NA 3SHWA 2AKLA 1GBQA 1JO8A 4J9EA 1ZBJA 2DJQA 5IXBA 2BZ8A 2F2WA 1NLPC 1E6HA 2KGTA 2EPDA 1GFDA 1QKWA 3M0RA 1ZX6A 2LJ1A 4LN2A 2GQIA 2M51A 1VYTA 2O9SA 4JJDA 2RQWA 4KRTA 4JZ3A 2J6KA 2ABLA 3UATA 2FPDA 1K76A 1J3TA 2J6OA 2ROTA 4GBQA 1CKBA 2KR3A 1Z9ZA 1W1FA 2KE9A 3I5RA 1UGVA 2GBQA 2PTKA 2IIMA 1G2BA 1JXMA 3RNJA 4Z88A 1ABOA 2C0OA 2D1XA 2YSQA 3EHRA 1ARKA 2A08A 1M3CA 5I11A 1Z9QA 1QWFA 3M0UA 3VRZA 2P4RA 1FYNA 1NYFA 1BBZA 1UHFA 2HEQA 2EKHA 3ZL7C 1OEBA 1E7OA 3VRYA 1LCKA 1K9AA 2AKKA 4DEXA 4LNPA 2GNCA 2ENMA 1X6BA 2PNIA 4CC7A 4D8DA 2YDLA 1VA7A 1ZUUA 4JJBA 1H3HA 5IHKA 1U5SA 2F2VA 2EQIA 2E5KA 2MCNA 1PHTA 2CUDA 2XMFA 1AZGB 1IO6A
chains in the Genus database with same CATH superfamily
2JS0A 1UJYA 3P8BB 2LCLA 5IAYA 2P84A 3OYGA 1K73C 2FZCB 4ME7A 5LJ3e 3I56A 3NTIA 1YITQ 2L3QA 3DB3A 4C92A 3H0FA 3CC7Q 1B3QA 5L8RE 5GAMd 4RMOA 4R0KA 1Q95G 2J06A 3TVTA 3FB9A 3M0TA 1V76A 3RMSA 3A8LB 2F5KA 2ED0A 1M9SA 2EAYA 5CK9A 1RLPC 1Q81R 1WXBA 1YJNQ 3QPHA 2BE7D 3JCMV 3OYCA 1BI3A 1OPLA 2M02A 1T3LA 2IPOB 3G4SA 2QG9B 2E6NA 4OB0B 4OMLA 3QZ9B 4GLKA 2OAUA 4OMQA 1WHHA 2L8DA 2DL3A 3OYBA 5CKFA 2D6FA 3QJYA 4F04B 3JCMW 1ZA1B 2JTMA 4ZGEB 3OYLA 3CC4Q 1MMDA 4AFSC 2LQNA 1VQ9A 2RPNA 2M16A 5CAIA 1QP3A 1MHNA 2A37A 4HCZA 2CDTA 1QVPA 4BI3A 2HQHA 4AT1B 4M7DE 2K9GA 1OX8A 2QDLA 5GAOm 2KMTA 3L2WA 4XK8E 4PJLA 1NG2A 2DPPB 3HPWA 1G5VA 3CCMA 4C92E 5EG2A 2L5QA 1SF9A 2DVJA 1IREB 3X25B 4QT7A 1PKSA 4BB7A 3CCVA 2K57A 3G6ET 4O6JA 5LJ5d 1HJDA 2F5TX 2OI3A 3MJXA 1PC0A 3C95A 2R5AA 4E7IA 2EWNA 2XI9A 2GGRA 2JXBA 4M7AF 4LDVA 3O8VA 3GNGA 5FRNA 2LRQA 5J26A 3QHSA 1MGQA 2EGCA 3RESA 1KQSA 5IHNA 1FMVA 2QYZA 2HBWA 1VQ4Q 4NL3A 5A0DA 1OU9A 2OTJA 1JXOA 3LGLA 1YJNA 3CMET 2O4XA 4OMPA 2CREA 2EIFA 1YHQA 1KC8C 3GBQA 3M59A 4AFUC 1VYUA 2GF7A 3CC7A 1YNZA 8AT1B 1AHJB 1W6XA 3TCJA 4C8QG 2DYIA 1B7TA 3M56A 3ZEHA 5GAMh 4R55A 2ECZA 1KD1C 1MMGA 2DEUA 3NMZC 4FYVB 1UFFA 3CCUT 4Z02A 4FCYA 2OTJT 3PE0A 2DMOA 2CZ1B 3VV0A 1RLQC 2KNBB 1QVFS 3ME9A 2VC8A 3UF4A 3I9QA 5FU7C 2DYBA 4J5YA 3M4YA 2V1RA 1T0JA 5D7UA 1RAHB 3OYMA 4AFZC 2M9UA 2F2XA 1G3YA 1W70A 1YN8A 2DERA 2MPXC 2EQMA 2BTTA 1UECA 5A0LA 3PMTA 2JW4A 2DL7A 2EVRA 1I4K1 4X34A 5KE2A 4F14A 3OYJA 1M4ZA 3MEVA 1GRIA 2FG0A 3CCMQ 4E2FB 5GAN7 1K73R 1VQKT 1WHJA 5CKDA 3LLRA 1OV3A 2ZGWA 2MIOA 1U06A 1HXDA 1WFWA 3JB9G 4A4KA 3CD6T 2JTEA 5ECAA 2Y90A 1LPLA 3OSSC 5HKCA 1C1AA 3HRSA 1WIEA 1I0CA 2FEIA 3CPFA 4J9GA 1HD3A 2QDYB 2NUTB 1VQ9T 4HVVA 4QW2A 2COWA 3JCMf 1PNJA 2ZPIB 3RMQA 4HA8A 4ELZC 4XTWA 4C0GA 1YI2Q 2VWFA 2E10A 3CCJQ 3CCET 2YRCA 1WLPB 2K6DA 4M75C 4E6RA 4KT0E 3JB9D 2AIRB 4J9DA 3UA7A 2RN8A 2HSEB 1YWPA 2P0KA 2DEQA 1UG1A 4FW1A 2MOXA 2AK5A 3N5BB 2L3SA 2XK0A 5GANj 2NLUA 2NWMA 1QVGA 4II1A 1VIEA 3JV3A 4X1VA 1Q86C 5LJ5g 4BD3A 2JS2A 4JJCA 4MDWA 2HAXA 1Q7YC 4M77E 3CCST 1M1KC 3INZA 2J05A 4DQ2A 4C8QC 4GY5A 1NJIC 2RQVA 4PJOA 4D6WA 2NYSA 4RG2A 1YCSB 1ZHIA 3CXCA 5LJ5h 3OYDA 3F70A 4FYYB 5GAN4 3M5AA 2PUKB 4XTVA 2LNHB 3A1PA 2JTFA 1ZSZA 3CCLQ 1I81A 2HMAA 1UUEA 4RTXA 4E7JA 3O5ZA 1E6GA 2EKOA 2HKNA 2LX9A 2LCSA 1TS9A 2FPEA 4KH0B 3CC4A 3OYIA 2DTOA 1O9SA 3JRZA 3JCMg 3HP9A 3NTHA 4FIBA 2D8JA 3EAEA 4M78F 5GAN2 2HZYA 2JNGA 5I2SA 2GTJA 4HVWA 3JCMh 3CCJT 2D8HA 4M77F 4E7HA 3JCMd 1VQ6T 2KRSA 1IGUA 1CSKA 1OULA 2JM8A 5M9OA 2I2LA 1M1GA 2XDPA 1VQ8A 4RTTA 4PJJA 4OP0A 3S3MA 2EGAA 1X2QA 2V8IA 5GAN8 2DTHA 2EYZA 3QDRB 4J6XA 2DBMA 4M7AG 1S1NA 3KBGA 1KK7A 1KHIA 3A8GB 4J9EA 1IRXA 2VXFA 1MNEA 1E6HA 3OS1A 1D0ZA 2EPDA 3NTKA 2RB6A 3VUZA 1VQOQ 8ATCB 3ZFJA 3OY9A 3JB9F 4KRTA 1YJ9T 4OMFB 2J6KA 4EMKC 1EZZB 1BI1A 2DFUA 2DXTA 4EMKA 2LC4A 2ABLA 3A8MB 2RD1A 2QQ9A 2FPDA 3MEUA 2A0FB 2XHCA 1M2OA 1Z9ZA 2HKQB 1W1FA 2M0OA 2QA4Q 4M7AC 2E3HA 2KE9A 4KH1B 1UGVA 3I56T 2IIMA 1JXMA 4ATOA 5GMKl 3VYHB 2QEXA 3EHRA 1ARKA 2A08A 5FU7B 4M75G 4KBMB 2ZPGB 5AT1B 1VQ4A 3UT1A 3TU4K 1D0XA 2AKKA 2RA2A 2GNCA 1VQLQ 2K5LA 2PNIA 2YRDA 4D8DA 4XAXB 1ZUUA 1H3HA 2F2VA 2YXYA 2E5KA 1VQPT 1M1FA 1I5OB 2CUDA 3FLGA 4M7DF 2KXCA 2E3IA 3MEAA 4QQDA 2CP7A 2PVGB 1OZ2A 3E2UA 2IG0A 4M78G 4J9BA 1RAFB 4M77D 1Q82C 1MV3A 4A54A 4OB2B 4N4HA 2VKNA 2F1LA 5LJ5e 3CMEQ 2CKKA 1VQLT 4C8QB 3H8ZA 2W0ZA 4LE9A 1GBRA 2KDSA 1RADB 1KQ2A 3A5ZB 3QSUA 4QQ6A 1OYXA 2PVDB 2DRMA 2DA9A 1WYXA 3JCMX 4LUDA 1N5ZA 1FMKA 1TUCA 2BKDN 2LJ3A 3H41A 2YT6A 1K0XA 3EGUA 1X6OA 1XQHA 3FRNA 4RTWA 1NJIR 1K73U 3EFSA 4MMLA 4QVCA 3EG9B 3RBBB 1RI0A 1LNXA 4J8OA 3ULRB 2RJEA 2KI7A 1PM3A 1WHKA 5DLOA 3MEWA 4M75B 2FVUA 3VS6A 4PFOA 1VQNQ 1N8RC 3LWIA 5L23A 3GIBA 1TU0B 2K3XA 2R5MA 4M7AE 1NM7A 2GQVA 3M57A 2FYKA 3G1JA 2HNIA 5KYXB 2X4XA 2XU8A 3MP6A 2OTLT 4OGCA 1QQJA 3ZBDA 1XNIA 4PJNA 3E1SA 1ZUYA 3VKIA 3QZ5B 3CCJA 2O2OA 1OZ3A 2ZPHB 2PZ1A 3CC2Q 1BYMA 2DF6A 3OA6A 1WA7A 1Y0MA 1NPPA 4JPBW 2E1HA 3CMAT 5LJ3g 1YHQQ 1JJ2S 4HT9A 3L2UA 4QVDA 4JRPA 2COZA 3G71A 3PIOA 1HSQA 2JM9A 4PL6A 2LT1A 2CS7A 1D3BB 1RACB 1KFZA 4M7DD 4RKUE 3L2VA 2EYXA 2XIDA 3CD6A 2XICA 3L1AA 4M7AB 3PIPA 4HCBA 3C0CA 1M3BA 2O9VA 3OYYA 1X6GA 1SRMA 3EGDA 2CH4A 3OMGA 2KYMA 1BI2A 1WHGA 3MP1A 2DETA 1TH7A 4N4GA 1VQ6Q 2C0IA 2LQWA 4XU0A 5IHIA 2ESWA 1GL5A 5GJVB 4VUBA 1ZUKA 2EBPA 3OBWA 4JUVA 5GAN3 2YUQA 3TREA 5DLQE 3CXCS 1KD1U 4PLIA 3P8HA 3OYAA 2ZCFB 1Y57A 4OF1A 1X27A 2LP5A 2AZVA 2CP0A 4OVAA 1SRLA 3QWYA 1FX7A 4FSXA 4IIMA 5J3BA 4NL2A 2LT4A 2CSQA 2K7AA 4DEYA 1YIJT 4A4FA 4M75D 4M7AD 1YI2T 4HT8A 3CXCP 5IT9E 5GANf 2FRYA 5CKHA 4B9XA 3EFOA 2DILA 3CMAA 1WPYA 4A53A 2KROA 2GFAA 2HL5C 2BUDA 3G71T 1QCOA 1X75C 4MMKA 1WQ7A 3OS0A 1N9SA 2OTLA 1KQSS 1SSFA 4M77G 1PRMC 1M2VA 2KK4A 2KQWA 3IQLA 4F7UG 2GTOA 5KYWB 2CT4A 1SG5A 4KGZB 2LDMA 1M27C 2H3JA 1NYGA 2C0TA 2XG8D 1Q7YR 1M1KR 2YHTA 3SWNB 2QGFB 4M7DB 3MCAB 5KYYB 3M58A 2FPFA 4J9CA 2DK3A 3PGGA 1YJNT 1SHGA 1TTHB 1T3SA 2E70A 4BDYA 2RHIA 2XD0A 3OSVA 2DBKA 2X3XD 4IUUA 3X24B 5GMKj 1IXDA 4GLMA 4FU6A 1YBYA 2XDBA 1VQKQ 1YI2A 1BU1A 1VQPQ 3JB9I 1Q82R 4CC3A 1K8AR 2L3PA 1RAAB 4DOVA 2EQJA 1JU5C 2QEXQ 4CRIA 3PNWC 4DBFA 2EQUA 2JT4A 5KCHA 3CCRQ 3CPWA 1VQ5Q 4UC4A 4L5GA 3CCRT 3SB2A 4JS5A 1TUDA 1IHWA 2K3YA 4B9WA 3CCLA 1UGSB 2QTVA 3MP8A 4RTVA 3U23A 2A3LA 3DB4A 1QMCA 2X3WD 5CO7A 5GAMj 2C06A 4M75F 3H0HA 2GCXA 1I1JA 4XU1A 1PG5B 1QLYA 4JRQA 5D6XA 2QQBA 2R57A 4J6WA 1Y7XA 4OMNA 1TSFA 1RABB 3VS1A 1ABQA 3CCUQ 1TG0A 4M7DG 2HQXA 4JDSA 2X4WA 4IURA 3R6OA 2DL5A 2RNAA 2QI2A 5FW9A 3G6EA 2LQ8A 1VQMQ 3PFSA 2KRNA 3DLLA 3DLMA 5GAOr 4D8KA 3LH0A 4M77B 2MMPA 1D1AA 2VUBA 3LW5E 1BKBA 1N8RU 1V29B 2JN0A 2DJZA 4PFZA 3EH2A 4E7ZA 1A0NB 1PKTA 1ZLMA 3G71Q 2BZXA 4ZGDB 1I5LA 2FRWA 1YJ9A 3D7SB 4RTYA 4ESRA 4LDWA 5A2QE 9ATCB 4M78E 3RKXA 4C5EA 2VGNA 3VU3C 3C12A 1MNDA 3QJ6A 2JZ2A 5GANg 3M0RA 1Q81U 1ZX6A 4LN2A 1RAEB 3QBYA 2GQIA 5LJ5j 5GAMg 2P0PA 3S3NA 1Y96A 1W4SA 2RHUA 2ATCB 4C92B 2V26A 1K9MR 2RHYA 2K5FA 2J6OA 4GBQA 4MDXA 1CKBA 1VQ9Q 4BUGA 3OYFA 3I56Q 1G3SA 2ZPEB 3I55T 1QW1A 4Z88A 3QXEB 2C0OA 2YSQA 4XQ3A 1PD0A 3T9NA 2NUPB 1QWFA 3VYGA 1FYNA 4XTZA 1NYFA 1BBZA 1UHFA 4EPCA 5CKBA 3VRYA 1K9AA 1C6VX 4DEXA 2DZ9A 1N27A 2JVVA 3CC4T 2E4HA 5IHKA 5GMKh 2EQIA 4C0FA 5GAMe 1PHTA 4NOYA 3CBPA 3BE3A 2OX7A 5HCKA 4MZTA 4OMMA 4Y91A 3V7CA 5DY9A 2L89A 2A7YA 3BDUA 4OGEA 3CCSA 1NJIU 2H8HA 2P4TA 4PJOD 3Q1JA 5GJWB 5KYUA 3WXMB 2BIVA 2X4JA 1W2BP 2DNUA 2YRVA 4M7DC 5KH6A 5J39A 5FLXE 3REAB 3CCEA 4ZTFA 1V1CA 2EGEA 4BI4A 3I55Q 2DD5A 1KSWA 2RM4A 1VQNT 4RG8A 1KG1A 2EJ9A 2XKOC 1UE9A 3TEEA 1Q82U 1VQ5T 2FO0A 3M0SA 1KD1R 1H8KA 2QASA 3JAME 3H9NA 2Y4XA 2VGMA 1WDXA 1NZ9A 2DL8A 1Q7YU 4WF2A 1M1KU 1ZBXA 2A36A 4WTOB 1XTDA 2DVEA 3NFCA 3JSCA 2EFIA 1UEBA 2JMAA 3M53A 2V8JA 3BFMA 4ZN1A 3M0QA 2PUOB 1OOTA 2KVQG 2YUNA 1YP5A 1X43A 4RTZA 1TWBA 2EW3A 2CZ7B 1GFCA 2QK0A 1UHCA 5CKEA 1U8RA 4E7LA 4OB3B 4DA4A 1R0CB 4MZPA 4L6V5 3CEYA 3CBOA 3P8DA 1VQ7Q 3LH5A 5GAMf 3JB9J 2A28A 1EFNA 1LOJA 5FRMA 3EG3A 1B34B 4XTYA 3SEMA 3R6NA 1RAGB 3L42A 3NGPA 2HSPA 3EG0A 3OS5A 2DX1A 3EH1A 1LJOA 1VQ8T 1MV0B 1JEGA 3WVEB 1VQ7T 2KBTA 3CCUA 4C8QA 4PJOC 1XOVA 1OPKA 3EG2A 5CQYA 3X28B 1C0MA 3A98A 4F16A 1VQMA 4M77C 2ZAEA 4RCCA 4AFQC 3M55A 5IXFA 2K79A 4ELYC 2EQKA 1VQ8Q 4ZN3A 3QIIA 2E65A 4M78A 3RKYA 5A0GA 1Y07A 3FDRA 5LJ3j 1X69A 3CBMA 1AD5A 1WJQA 2RJDA 2KRMA 1BCOA 1TUGB 1M90C 3G6EQ 2J7IA 4FYXB 2I0NA 4FT2A 3PVLA 4KGXB 2OTJQ 1TOVA 4O5VA 3SWNC 4Q5WA 1B07A 1NE8A 5GMKe 1Y71A 4L59A 1IZ6A 1I8FA 1X2KA 2RI3A 3QWXX 4Z89A 3EGXB 4C5GA 2CZ6B 3HFNA 1JB0E 2CH4W 4CC4B 1PSFA 1UJ0A 2RF0A 3GP8A 3VS2A 2M0YA 1WHLA 1D0YA 1KC8R 1K4US 3S3OA 1VQNA 3CC7T 2MI6A 1QKXA 5KYNA 4BY6B 3J80E 1VQOT 3VS0A 3LYIA 2FB7A 1YJ9Q 1N9RA 1WHMA 4E47A 1R8OB 3OW2A 4J9HA 3EHQA 3HL8A 1U1SA 1OX9A 2CT3A 5KCOA 4KUDK 4M75E 1VQKA 2LMJA 3LGFA 1VQPA 3HRUA 2M1HA 1S72Q 1VQ7A 3AT1B 3A8HB 3HKSA 2RK2A 4QKUA 1GCQC 2O31A 1YFNA 1N8RR 3OMCA 2DL4A 1X01A 4LDYA 1ZQ1A 1K8AC 4FM4B 1H92A 2E12A 4QQGA 1XJWB 1F1BB 2RHZA 3QKJA 3V8JA 1WXUA 3GNFB 4LD9K 1W2BA 5EC7A 2XDDA 4E7KA 1M90U 3OYEA 2KSSA 4EMHA 4J7IA 3RR6A 2RQTA 1PRLC 1KIKA 2AT1B 2WSEE 2VV5A 4F7UF 1OI1A 2VXEA 2RJCA 3VS3A 2DXBA 3CCRA 3H6ZA 1D1BA 4Y92A 4IKFA 2KEAA 3GF5A 4PJMA 2LZ6B 2KYBA 5DM7R 2L0AA 3OYHA 4FSSA 4C8QD 2FHDA 3FC3A 5FROA 1N6AA 4DBHA 4KULA 4E7SA 2FZKB 3L2RA 1FMWA 2EYQA 1QCFA 4EMGA 3QUIA 2QQSA 4OB1B 3FEOA 1VQOA 1SPKA 5IN1A 1ZSZC 5GAN5 1H3ZA 4J6YA 4F7UB 3G7ZA 4M78D 2WSCE 2DKGA 3I55A 6AT1B 5I22A 2RMOA 3THKA 4PLLA 3V8KA 4HXJA 1WZOA 1KJWA 5GMKi 4N4IA 1M8MA 1BB9A 3MPUB 4RTUA 1AWJA 3NHNA 1JRIA 5LJ3h 4IIOA 1SEMA 4PJOE 4C8QE 4HCKA 2YUOA 2MWPA 1M8VA 2YWWA 1KQSP 4Y28E 4ZTJA 1QWEA 5LJ3f 2V8KA 4FW2A 3PTAA 3JCMe 3ASKA 4AMCA 1YIJA 1NLOC 1WXTA 4PJOB 3J81E 3VS5A 1WQWA 3VUBA 2AKLA 2CP2A 4JRIA 1QP2A 3BDLA 1K9MC 2DJQA 5IXBA 2F2WA 1NLPC 2DXUA 3OQ5A 1NBEB 1GFDA 2LJ1A 4KGVB 2O9SA 3CCMT 3M9QA 2RQWA 2ZZDA 5CVIA 2FL7A 3UATA 3CPWP 4XTXA 2ZPBB 3HTRA 2HQEA 1JJ2A 1G3TA 5GMKm 2KR3A 2RHXA 2GBQA 4BE0A 1G2BA 2KY9A 3RNJA 1ABOA 3BY7A 2D1XA 1M3CA 5I11A 1Z9QA 1IHVA 2GFUA 3VRZA 1U1TA 2P4RA 4PKCC 3X20B 2HEQA 2D0QB 3ZL7C 2H3EB 3CCQQ 4JLIA 4LDXA 2CP6A 2ZPFB 3EG9A 2ENMA 4IUVA 1X6BA 4JLGA 3RKWA 4CC7A 4JJBA 2QQRA 2CZ0B 1U5SA 3JCMP 2XMFA 1MMNA 4J7FA 2JOYA 4MZMA 5GANd 1IB8A 1VUBA 2KAFA 3HFOA 1D3BA 3TSZA 3VJPA 3M54A 3CCQT 2KXDA 1YJWA 1BK2A 1G3WA 2WSFE 1RL2A 2ROLA 2CP3A 1CKAA 1WX6A 4C5HA 2QAZA 2O4XB 4J9FA 1M90R 3E19A 1ZA2B 4F7UE 1WGSA 3DKMA 3UWNA 4JS4A 4PFPA 4A4EA 3L2ZA 1VQMT 2RK1A 3MKDA 3NPFA 3JCMb 3V8LA 3EG1A 1B34A 1AVZC 4P5NA 5GAOn 5HK3A 2X51A 1AWXA 4PJOG 2QQAA 2KT8A 2RQRA 2E64A 4PK4A 4V2SA 2OJ2A 4EMKB 3X26B 4XU2A 3A8OB 4C0DB 1AZEA 4FYWB 3FJ5A 2QA4A 1VQLA 1HYOA 2PVOB 1UGPB 4M7AA 5GAOp 1ACMB 1AWOA 4HVUA 3MHXA 1QCNA 1JQQA 2DIQA 5D6YA 5FU6B 3KUFA 5I21A 3JCMQ 3S6WA 1FWZA 1PSEA 1JJ2P 2SRCA 2AHJB 2W10A 1PCXA 1D09B 2RQUA 2COYA 4Z8AA 2DXCA 5LJ3d 2CP5A 2G6FX 3EFRA 3OW2P 1M5Q1 4RCBA 2E5QA 1D1CA 2LX7A 2HCKA 1JBMA 1SSHA 2DLPA 4DBQA 3UA6A 1AWWA 1K1ZA 3SD4A 2O88A 1NEBA 2HD0A 1I07A 1KHCA 3GLXA 4AG2C 3QYGB 3M0PA 1BI0A 4EDUA 3KXTA 2LCCA 4LDUA 3EGXA 1EX4A 4RUGA 2LNVA 4LXCA 3OS2A 5CIUA 3CCVQ 1RI9A 4XU3A 3PT9A 1GCPA 4IUPA 5KYUB 4HCCA 3SFMA 4FT4A 3E9GA 4AG1C 4M7DA 2ED1A 3QG1A 3RUXA 1VYVA 2DTIA 2EJFA 7AT1B 4F17A 1H641 4M78C 3LX7A 5KYXA 1YWOA 5GANh 2YLBA 2FZGB 1Q86R 3I5SA 2LTOA 3CPWS 4FL6A 1YITA 2PU9B 4KUIA 3VS4A 3CMAQ 1OQKA 3SDZA 4ANJA 2MWOA 1AEYA 2X4YA 2LJ0A 2QGGA 2JMCA 2JUFA 3M4GA 4M75A 4J9IA 1K9MU 3HRTA 1P92A 4BI8B 1LVKA 4LD6A 5LL6S 3LWHA 1ZSGA 3JB9H 5CQXA 5KYYA 2RI2A 2K2MA 1WI7A 4A63B 2SEMA 4QVZA 5FWBA 1K0SA 3OBYA 4JJNK 2MK5A 2LQKA 2BZYA 1NPRA 5FWCA 4TVRA 2DD4A 5LJ5f 4C92F 1YIJQ 2E6ZA 3META 4K11A 4WCIA 3OYNA 3JCMJ 2EYYA 2J6FA 2PQWA 2F69A 4BE2A 1S72T 2YUPA 1VQ5A 1OU8A 1EIFA 1MUZA 2E41A 4X9CA 1SHFA 1QVGS 3RIRA 2WACA 2CSIA 4IUTA 3JCMc 1UDLA 3CMEA 4NS5A 5HY6A 5GAOl 2OAWA 3REBB 1YHQT 4C5IA 5HK0A 2K3BA 3L2QA 3EGDB 3VS7A 2G3RA 3AHUA 4LUEA 2VASA 1UTIA 4M77A 2D0NA 2AZSA 5FU6C 1G83A 3V7RA 1UGRB 4M78B 2LVMA 1SKUB 1MMAA 1T0HA 2MAMA 2NUZA 2OTLQ 1RUWA 2QA4T 3TSWA 1QVFP 3EFOB 1NEGA 1AOJA 1WNLA 1FXXA 1YITT 4BDZA 5I2MA 1VIFA 2O01E 2VYTA 5KE3A 2DM1A 1QVFA 5C6SA 2VVKA 4BY6C 2HL3A 2Z0WA 4A4GA 4C0ZA 1M2VB 1M3AA 1Y96B 2DO3A 4M4ZA 4ZGJB 1Q81C 4C92C 3J7AF 1G8XA 5KYWA 3CC2T 2CYZB 2DIGA 3WVDB 4C0DC 5CCAA 3OW2S 2V1QA 2BE9B 1Q86U 2KT1A 1U3OA 3C4SA 2DE0X 2CUBA 4A4HA 3KFVA 4C92D 3URGA 3GOXA 3TQ7P 4CC2A 4J83A 3H0IA 4JZ4A 3CQTA 1KC8U 2JJ9A 1UB4A 4XTUA 2NUPA 1VQ4T 1UGQB 1YJWQ 2NUTA 2R58A 3RDVA 5C0MA 5CR2A 1O75A 2RJFA 2EYWA 4N0AA 1M30A 2K5IA 3PVQA 4N0AC 1DJ7B 2DRKA 4EIKA 3I35A 1W2BS 5AYFA 3UDCA 4ZNXA 2HBPA 2DAQA 4HKEA 2B86A 2K2VA 4CI0C 2HDAA 1TXQA 2MYSA 3G4ST 1BIAA 3MO8A 4PNOA 1GCQA 4OMOA 4ORZA 4B6MA 3SWNA 3QO3A 2IVWA 4JRKA 5IH2A 2RO0A 4C92G 3CCLT 3PMIA 1VQ6A 3FIFA 1AT1B 1PWTA 3CCSQ 2D9TA 2L2PA 5GANe 3UPUA 3SHWA 3RERA 2X9HA 1GBQA 1JO8A 1ZBJA 3OB9A 2P0QA 1S72A 3C94A 1ZSZB 2BZ8A 2CGHA 2KGTA 1BCMA 4X9DA 1WJRA 1QKWA 3G4SQ 1RAIB 5GAOq 2M51A 1BIBA 3FJPA 1VYTA 3QDFA 4DBRA 4JJDA 4DOWA 4JZ3A 2L3RA 1GXIE 2QXFA 4R56A 4IUQA 1R0BG 2K4YA 3CC2A 2DZCA 4BE1A 1K76A 3CCQA 1YJWT 1J3TA 3GPLA 2ROTA 4YTLA 3CCEQ 2MF2A 1KQ1A 3ER0A 3I5RA 1YCYA 2YLCA 2PTKA 1HK9A 2RH2A 2X35A 1WJSA 5GAN6 4F7UA 2QTXA 4BACA 1QVGP 5D6WA 1K8AU 2VB6A 3V7SA 3HHTB 3M0UA 3E9FA 2EKHA 1OEBA 1E7OA 1R77A 1LCKA 2RI5A 3CD6Q 4LNPA 3CCVT 3BW1A 3OYKA 3QYHB 2YDLA 3HSBA 1VA7A 2EJGA 1VOMA 4C8QF 1IGQA 2Y4YA 4PJOF 2MCNA 1PD1A 2QEXT 2B8AA 1AZGB 1IO6A
chains in the Genus database with same CATH topology
2JS0A 1UJYA 2KXCA 5HCKA 4OMMA 2L3QA 4J9BA 1MV3A 3H0FA 1B3QA 3TSZA 2VKNA 2KXDA 1BK2A 4R0KA 2J06A 3TVTA 2H8HA 2ROLA 1CKAA 2W0ZA 3M0TA 4LE9A 5GJWB 1GBRA 1WX6A 2ED0A 1RLPC 1WXBA 2DNUA 4J9FA 2DRMA 2DA9A 1WYXA 4LUDA 1N5ZA 1FMKA 1OPLA 1TUCA 2LJ3A 3REAB 1T3LA 3H41A 1V1CA 2EGEA 4OMLA 3NPFA 2YT6A 1KSWA 3EGUA 1K0XA 3EG1A 4RTWA 1AVZC 4OMQA 1AWXA 2DL3A 1UE9A 2FO0A 3RBBB 3M0SA 2KT8A 2RQRA 3ULRB 1H8KA 2OJ2A 1WDXA 1AZEA 2DL8A 4AFSC 2LQNA 3FJ5A 2RPNA 2A36A 3VS6A 2A37A 1AWOA 4HVUA 2JMAA 5L23A 2CDTA 3M0QA 1NM7A 1JQQA 1OOTA 2K9GA 2YUNA 1YP5A 1X43A 4RTZA 2EW3A 2QDLA 1NG2A 2SRCA 1GFCA 1UHCA 2W10A 1ZUYA 2RQUA 4Z8AA 2DVJA 2O2OA 2PZ1A 2G6FX 2DF6A 4QT7A 1PKSA 1WA7A 1Y0MA 2LX7A 2HCKA 3LH5A 4JPBW 1SSHA 2DLPA 1HJDA 3UA6A 1AWWA 2A28A 1EFNA 1K1ZA 2O88A 2OI3A 3EG3A 1NEBA 3SEMA 3R6NA 1I07A 4AG2C 2GGRA 3NGPA 1HSQA 2JXBA 3M0PA 2HSPA 2JM9A 3EG0A 1KFZA 2DX1A 1MV0B 1JEGA 2EGCA 4RUGA 2KBTA 1RI9A 2EYXA 5IHNA 2HBWA 1GCPA 1XOVA 1M3BA 3C0CA 1JXOA 1OPKA 3EG2A 2O9VA 4AG1C 1X6GA 1SRMA 3A98A 4F16A 2CH4A 2ED1A 2KYMA 1VYVA 4OMPA 2CREA 4AFQC 4F17A 5IXFA 2K79A 3GBQA 2C0IA 2LQWA 5IHIA 4AFUC 1VYUA 1YWOA 1YNZA 2ESWA 1GL5A 5GJVB 1W6XA 3I5SA 1ZUKA 2EBPA 2YUQA 2ECZA 1X69A 1AD5A 3VS4A 2KRMA 3NMZC 1UFFA 1Y57A 1AEYA 2LJ0A 2J7IA 1X27A 2JMCA 2LP5A 2AZVA 2I0NA 4J9IA 3PVLA 1SRLA 3QWYA 1B07A 4IIMA 3PE0A 1ZSGA 2DMOA 2CSQA 2K2MA 2K7AA 1WI7A 4A63B 4DEYA 2SEMA 1RLQC 2KNBB 1X2KA 4Z89A 3QWXX 5FWBA 1K0SA 3UF4A 3I9QA 2DYBA 2V1RA 1T0JA 2BZYA 2CH4W 5FWCA 4CC4B 1UJ0A 2FRYA 2RF0A 3VS2A 4AFZC 2F2XA 2DILA 2M0YA 4K11A 1W70A 1YN8A 4WCIA 2EYYA 2J6FA 1K4US 2KROA 2BTTA 1UECA 1QKXA 2YUPA 2JW4A 2DL7A 2EVRA 3VS0A 4F14A 1MUZA 1SHFA 1GRIA 2FG0A 1PRMC 4J9HA 3IQLA 3EHQA 2CSIA 2CT3A 2GTOA 1OV3A 2CT4A 1UDLA 2MIOA 2LMJA 1M27C 1U06A 1WFWA 1NYGA 2OAWA 3REBB 2C0TA 2JTEA 5ECAA 1GCQC 2K3BA 2O31A 3VS7A 2FPFA 4J9CA 4LUEA 1UTIA 1WIEA 2D0NA 1I0CA 1SHGA 2DL4A 2FEIA 2AZSA 4J9GA 1T3SA 1HD3A 1G83A 1H92A 1T0HA 1WXUA 2DBKA 2NUZA 2X3XD 5EC7A 1RUWA 4HVVA 3TSWA 4GLMA 1PNJA 1NEGA 1AOJA 2RQTA 1PRLC 1BU1A 1KIKA 2VWFA 4CC3A 1WLPB 2L3PA 2K6DA 1JU5C 4E6RA 2DM1A 4J9DA 2VVKA 3UA7A 2JT4A 3VS3A 2RN8A 4Y92A 1YWPA 2KEAA 2LZ6B 1M3AA 1UG1A 2KYBA 4M4ZA 2L0AA 1TUDA 2MOXA 2AK5A 2L3SA 2NWMA 4FSSA 4RTVA 3JV3A 4X1VA 3U23A 2JS2A 2X3WD 4JJCA 2V1QA 2KT1A 1U3OA 3H0HA 2J05A 1I1JA 2RQVA 2DE0X 1QCFA 1YCSB 2CUBA 1QLYA 3KFVA 4CC2A 3H0IA 1SPKA 4JZ4A 2LNHB 3CQTA 1UUEA 4RTXA 3O5ZA 4OMNA 1E6GA 5I22A 2RMOA 3THKA 3VS1A 1ABQA 2EYWA 4HXJA 1M30A 2LCSA 1KJWA 1TG0A 3PVQA 2DRKA 2FPEA 4EIKA 1M8MA 3I35A 1BB9A 2DL5A 2RNAA 4ZNXA 5FW9A 4RTUA 2B86A 2HDAA 2D8JA 1AWJA 3NHNA 2GTJA 4HVWA 2KRNA 1GCQA 2D8HA 4OMOA 4IIOA 4ORZA 1SEMA 4D8KA 2KRSA 4HCKA 2YUOA 5IH2A 1CSKA 2JM8A 1A0NB 1PKTA 1QWEA 4RTTA 1ZLMA 2BZXA 2FRWA 1PWTA 2EGAA 1NLOC 1X2QA 1WXTA 4RTYA 2EYZA 2DBMA 2L2PA 3VS5A 4ESRA 1S1NA 3SHWA 2AKLA 1GBQA 1JO8A 4J9EA 1ZBJA 2DJQA 5IXBA 2BZ8A 2F2WA 1NLPC 1E6HA 2KGTA 2EPDA 1GFDA 1QKWA 3M0RA 1ZX6A 2LJ1A 4LN2A 2GQIA 2M51A 1VYTA 2O9SA 4JJDA 2RQWA 4KRTA 4JZ3A 2J6KA 2ABLA 3UATA 2FPDA 1K76A 1J3TA 2J6OA 2ROTA 4GBQA 1CKBA 2KR3A 1Z9ZA 1W1FA 2KE9A 3I5RA 1UGVA 2GBQA 2PTKA 2IIMA 1G2BA 1JXMA 3RNJA 4Z88A 1ABOA 2C0OA 2D1XA 2YSQA 3EHRA 1ARKA 2A08A 1M3CA 5I11A 1Z9QA 1QWFA 3M0UA 3VRZA 2P4RA 1FYNA 1NYFA 1BBZA 1UHFA 2HEQA 2EKHA 3ZL7C 1OEBA 1E7OA 3VRYA 1LCKA 1K9AA 2AKKA 4DEXA 4LNPA 2GNCA 2ENMA 1X6BA 2PNIA 4CC7A 4D8DA 2YDLA 1VA7A 1ZUUA 4JJBA 1H3HA 5IHKA 1U5SA 2F2VA 2EQIA 2E5KA 2MCNA 1PHTA 2CUDA 2XMFA 1AZGB 1IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS0 A;  1UJY A;  2KXC A;  5HCK A;  4OMM A;  2L3Q A;  4J9B A;  1MV3 A;  3H0F A;  1B3Q A;  3TSZ A;  2VKN A;  2KXD A;  1BK2 A;  4R0K A;  2J06 A;  3TVT A;  2H8H A;  2ROL A;  1CKA A;  2W0Z A;  3M0T A;  4LE9 A;  5GJW B;  1GBR A;  1WX6 A;  2ED0 A;  1RLP C;  1WXB A;  2DNU A;  4J9F A;  2DRM A;  2DA9 A;  1WYX A;  4LUD A;  1N5Z A;  1FMK A;  1OPL A;  1TUC A;  2LJ3 A;  3REA B;  1T3L A;  3H41 A;  1V1C A;  2EGE A;  4OML A;  3NPF A;  2YT6 A;  1KSW A;  3EGU A;  1K0X A;  3EG1 A;  4RTW A;  1AVZ C;  4OMQ A;  1AWX A;  2DL3 A;  1UE9 A;  2FO0 A;  3RBB B;  3M0S A;  2KT8 A;  2RQR A;  3ULR B;  1H8K A;  2OJ2 A;  1WDX A;  1AZE A;  2DL8 A;  4AFS C;  2LQN A;  3FJ5 A;  2RPN A;  2A36 A;  3VS6 A;  2A37 A;  1AWO A;  4HVU A;  2JMA A;  5L23 A;  2CDT A;  3M0Q A;  1NM7 A;  1JQQ A;  1OOT A;  2K9G A;  2YUN A;  1YP5 A;  1X43 A;  4RTZ A;  2EW3 A;  2QDL A;  1NG2 A;  2SRC A;  1GFC A;  1UHC A;  2W10 A;  1ZUY A;  2RQU A;  4Z8A A;  2DVJ A;  2O2O A;  2PZ1 A;  2G6F X;  2DF6 A;  4QT7 A;  1PKS A;  1WA7 A;  1Y0M A;  2LX7 A;  2HCK A;  3LH5 A;  4JPB W;  1SSH A;  2DLP A;  1HJD A;  3UA6 A;  1AWW A;  2A28 A;  1EFN A;  1K1Z A;  2O88 A;  2OI3 A;  3EG3 A;  1NEB A;  3SEM A;  3R6N A;  1I07 A;  4AG2 C;  2GGR A;  3NGP A;  1HSQ A;  2JXB A;  3M0P A;  2HSP A;  2JM9 A;  3EG0 A;  1KFZ A;  2DX1 A;  1MV0 B;  1JEG A;  2EGC A;  4RUG A;  2KBT A;  1RI9 A;  2EYX A;  5IHN A;  2HBW A;  1GCP A;  1XOV A;  1M3B A;  3C0C A;  1JXO A;  1OPK A;  3EG2 A;  2O9V A;  4AG1 C;  1X6G A;  1SRM A;  3A98 A;  4F16 A;  2CH4 A;  2ED1 A;  2KYM A;  1VYV A;  4OMP A;  2CRE A;  4AFQ C;  4F17 A;  5IXF A;  2K79 A;  3GBQ A;  2C0I A;  2LQW A;  5IHI A;  4AFU C;  1VYU A;  1YWO A;  1YNZ A;  2ESW A;  1GL5 A;  5GJV B;  1W6X A;  3I5S A;  1ZUK A;  2EBP A;  2YUQ A;  2ECZ A;  1X69 A;  1AD5 A;  3VS4 A;  2KRM A;  3NMZ C;  1UFF A;  1Y57 A;  1AEY A;  2LJ0 A;  2J7I A;  1X27 A;  2JMC A;  2LP5 A;  2AZV A;  2I0N A;  4J9I A;  3PVL A;  1SRL A;  3QWY A;  1B07 A;  4IIM A;  3PE0 A;  1ZSG A;  2DMO A;  2CSQ A;  2K2M A;  2K7A A;  1WI7 A;  4A63 B;  4DEY A;  2SEM A;  1RLQ C;  2KNB B;  1X2K A;  4Z89 A;  3QWX X;  5FWB A;  1K0S A;  3UF4 A;  3I9Q A;  2DYB A;  2V1R A;  1T0J A;  2BZY A;  2CH4 W;  5FWC A;  4CC4 B;  1UJ0 A;  2FRY A;  2RF0 A;  3VS2 A;  4AFZ C;  2F2X A;  2DIL A;  2M0Y A;  4K11 A;  1W70 A;  1YN8 A;  4WCI A;  2EYY A;  2J6F A;  1K4U S;  2KRO A;  2BTT A;  1UEC A;  1QKX A;  2YUP A;  2JW4 A;  2DL7 A;  2EVR A;  3VS0 A;  4F14 A;  1MUZ A;  1SHF A;  1GRI A;  2FG0 A;  1PRM C;  4J9H A;  3IQL A;  3EHQ A;  2CSI A;  2CT3 A;  2GTO A;  1OV3 A;  2CT4 A;  1UDL A;  2MIO A;  2LMJ A;  1M27 C;  1U06 A;  1WFW A;  1NYG A;  2OAW A;  3REB B;  2C0T A;  2JTE A;  5ECA A;  1GCQ C;  2K3B A;  2O31 A;  3VS7 A;  2FPF A;  4J9C A;  4LUE A;  1UTI A;  1WIE A;  2D0N A;  1I0C A;  1SHG A;  2DL4 A;  2FEI A;  2AZS A;  4J9G A;  1T3S A;  1HD3 A;  1G83 A;  1H92 A;  1T0H A;  1WXU A;  2DBK A;  2NUZ A;  2X3X D;  5EC7 A;  1RUW A;  4HVV A;  3TSW A;  4GLM A;  1PNJ A;  1NEG A;  1AOJ A;  2RQT A;  1PRL C;  1BU1 A;  1KIK A;  2VWF A;  4CC3 A;  1WLP B;  2L3P A;  2K6D A;  1JU5 C;  4E6R A;  2DM1 A;  4J9D A;  2VVK A;  3UA7 A;  2JT4 A;  3VS3 A;  2RN8 A;  4Y92 A;  1YWP A;  2KEA A;  2LZ6 B;  1M3A A;  1UG1 A;  2KYB A;  4M4Z A;  2L0A A;  1TUD A;  2MOX A;  2AK5 A;  2L3S A;  2NWM A;  4FSS A;  4RTV A;  3JV3 A;  4X1V A;  3U23 A;  2JS2 A;  2X3W D;  4JJC A;  2V1Q A;  2KT1 A;  1U3O A;  3H0H A;  2J05 A;  1I1J A;  2RQV A;  2DE0 X;  1QCF A;  1YCS B;  2CUB A;  1QLY A;  3KFV A;  4CC2 A;  3H0I A;  1SPK A;  4JZ4 A;  2LNH B;  3CQT A;  1UUE A;  4RTX A;  3O5Z A;  4OMN A;  1E6G A;  5I22 A;  2RMO A;  3THK A;  3VS1 A;  1ABQ A;  2EYW A;  4HXJ A;  1M30 A;  2LCS A;  1KJW A;  1TG0 A;  3PVQ A;  2DRK A;  2FPE A;  4EIK A;  1M8M A;  3I35 A;  1BB9 A;  2DL5 A;  2RNA A;  4ZNX A;  5FW9 A;  4RTU A;  2B86 A;  2HDA A;  2D8J A;  1AWJ A;  3NHN A;  2GTJ A;  4HVW A;  2KRN A;  1GCQ A;  2D8H A;  4OMO A;  4IIO A;  4ORZ A;  1SEM A;  4D8K A;  2KRS A;  4HCK A;  2YUO A;  5IH2 A;  1CSK A;  2JM8 A;  1A0N B;  1PKT A;  1QWE A;  4RTT A;  1ZLM A;  2BZX A;  2FRW A;  1PWT A;  2EGA A;  1NLO C;  1X2Q A;  1WXT A;  4RTY A;  2EYZ A;  2DBM A;  2L2P A;  3VS5 A;  4ESR A;  1S1N A;  3SHW A;  2AKL A;  1GBQ A;  1JO8 A;  4J9E A;  1ZBJ A;  2DJQ A;  5IXB A;  2BZ8 A;  2F2W A;  1NLP C;  1E6H A;  2KGT A;  2EPD A;  1GFD A;  1QKW A;  3M0R A;  1ZX6 A;  2LJ1 A;  4LN2 A;  2GQI A;  2M51 A;  1VYT A;  2O9S A;  4JJD A;  2RQW A;  4KRT A;  4JZ3 A;  2J6K A;  2ABL A;  3UAT A;  2FPD A;  1K76 A;  1J3T A;  2J6O A;  2ROT A;  4GBQ A;  1CKB A;  2KR3 A;  1Z9Z A;  1W1F A;  2KE9 A;  3I5R A;  1UGV A;  2GBQ A;  2PTK A;  2IIM A;  1G2B A;  1JXM A;  3RNJ A;  4Z88 A;  1ABO A;  2C0O A;  2D1X A;  2YSQ A;  3EHR A;  1ARK A;  2A08 A;  1M3C A;  5I11 A;  1Z9Q A;  1QWF A;  3M0U A;  3VRZ A;  2P4R A;  1FYN A;  1NYF A;  1BBZ A;  1UHF A;  2HEQ A;  2EKH A;  3ZL7 C;  1OEB A;  1E7O A;  3VRY A;  1LCK A;  1K9A A;  2AKK A;  4DEX A;  4LNP A;  2GNC A;  2ENM A;  1X6B A;  2PNI A;  4CC7 A;  4D8D A;  2YDL A;  1VA7 A;  1ZUU A;  4JJB A;  1H3H A;  5IHK A;  1U5S A;  2F2V A;  2EQI A;  2E5K A;  2MCN A;  1PHT A;  2CUD A;  2XMF A;  1AZG B;  1IO6 A; 
#chains in the Genus database with same CATH topology
 2JS0 A;  1UJY A;  3P8B B;  2LCL A;  5IAY A;  2P84 A;  3OYG A;  1K73 C;  2FZC B;  4ME7 A;  5LJ3 e;  3I56 A;  3NTI A;  1YIT Q;  2L3Q A;  3DB3 A;  4C92 A;  3H0F A;  3CC7 Q;  1B3Q A;  5L8R E;  5GAM d;  4RMO A;  4R0K A;  1Q95 G;  2J06 A;  3TVT A;  3FB9 A;  3M0T A;  1V76 A;  3RMS A;  3A8L B;  2F5K A;  2ED0 A;  1M9S A;  2EAY A;  5CK9 A;  1RLP C;  1Q81 R;  1WXB A;  1YJN Q;  3QPH A;  2BE7 D;  3JCM V;  3OYC A;  1BI3 A;  1OPL A;  2M02 A;  1T3L A;  2IPO B;  3G4S A;  2QG9 B;  2E6N A;  4OB0 B;  4OML A;  3QZ9 B;  4GLK A;  2OAU A;  4OMQ A;  1WHH A;  2L8D A;  2DL3 A;  3OYB A;  5CKF A;  2D6F A;  3QJY A;  4F04 B;  3JCM W;  1ZA1 B;  2JTM A;  4ZGE B;  3OYL A;  3CC4 Q;  1MMD A;  4AFS C;  2LQN A;  1VQ9 A;  2RPN A;  2M16 A;  5CAI A;  1QP3 A;  1MHN A;  2A37 A;  4HCZ A;  2CDT A;  1QVP A;  4BI3 A;  2HQH A;  4AT1 B;  4M7D E;  2K9G A;  1OX8 A;  2QDL A;  5GAO m;  2KMT A;  3L2W A;  4XK8 E;  4PJL A;  1NG2 A;  2DPP B;  3HPW A;  1G5V A;  3CCM A;  4C92 E;  5EG2 A;  2L5Q A;  1SF9 A;  2DVJ A;  1IRE B;  3X25 B;  4QT7 A;  1PKS A;  4BB7 A;  3CCV A;  2K57 A;  3G6E T;  4O6J A;  5LJ5 d;  1HJD A;  2F5T X;  2OI3 A;  3MJX A;  1PC0 A;  3C95 A;  2R5A A;  4E7I A;  2EWN A;  2XI9 A;  2GGR A;  2JXB A;  4M7A F;  4LDV A;  3O8V A;  3GNG A;  5FRN A;  2LRQ A;  5J26 A;  3QHS A;  1MGQ A;  2EGC A;  3RES A;  1KQS A;  5IHN A;  1FMV A;  2QYZ A;  2HBW A;  1VQ4 Q;  4NL3 A;  5A0D A;  1OU9 A;  2OTJ A;  1JXO A;  3LGL A;  1YJN A;  3CME T;  2O4X A;  4OMP A;  2CRE A;  2EIF A;  1YHQ A;  1KC8 C;  3GBQ A;  3M59 A;  4AFU C;  1VYU A;  2GF7 A;  3CC7 A;  1YNZ A;  8AT1 B;  1AHJ B;  1W6X A;  3TCJ A;  4C8Q G;  2DYI A;  1B7T A;  3M56 A;  3ZEH A;  5GAM h;  4R55 A;  2ECZ A;  1KD1 C;  1MMG A;  2DEU A;  3NMZ C;  4FYV B;  1UFF A;  3CCU T;  4Z02 A;  4FCY A;  2OTJ T;  3PE0 A;  2DMO A;  2CZ1 B;  3VV0 A;  1RLQ C;  2KNB B;  1QVF S;  3ME9 A;  2VC8 A;  3UF4 A;  3I9Q A;  5FU7 C;  2DYB A;  4J5Y A;  3M4Y A;  2V1R A;  1T0J A;  5D7U A;  1RAH B;  3OYM A;  4AFZ C;  2M9U A;  2F2X A;  1G3Y A;  1W70 A;  1YN8 A;  2DER A;  2MPX C;  2EQM A;  2BTT A;  1UEC A;  5A0L A;  3PMT A;  2JW4 A;  2DL7 A;  2EVR A;  1I4K 1;  4X34 A;  5KE2 A;  4F14 A;  3OYJ A;  1M4Z A;  3MEV A;  1GRI A;  2FG0 A;  3CCM Q;  4E2F B;  5GAN 7;  1K73 R;  1VQK T;  1WHJ A;  5CKD A;  3LLR A;  1OV3 A;  2ZGW A;  2MIO A;  1U06 A;  1HXD A;  1WFW A;  3JB9 G;  4A4K A;  3CD6 T;  2JTE A;  5ECA A;  2Y90 A;  1LPL A;  3OSS C;  5HKC A;  1C1A A;  3HRS A;  1WIE A;  1I0C A;  2FEI A;  3CPF A;  4J9G A;  1HD3 A;  2QDY B;  2NUT B;  1VQ9 T;  4HVV A;  4QW2 A;  2COW A;  3JCM f;  1PNJ A;  2ZPI B;  3RMQ A;  4HA8 A;  4ELZ C;  4XTW A;  4C0G A;  1YI2 Q;  2VWF A;  2E10 A;  3CCJ Q;  3CCE T;  2YRC A;  1WLP B;  2K6D A;  4M75 C;  4E6R A;  4KT0 E;  3JB9 D;  2AIR B;  4J9D A;  3UA7 A;  2RN8 A;  2HSE B;  1YWP A;  2P0K A;  2DEQ A;  1UG1 A;  4FW1 A;  2MOX A;  2AK5 A;  3N5B B;  2L3S A;  2XK0 A;  5GAN j;  2NLU A;  2NWM A;  1QVG A;  4II1 A;  1VIE A;  3JV3 A;  4X1V A;  1Q86 C;  5LJ5 g;  4BD3 A;  2JS2 A;  4JJC A;  4MDW A;  2HAX A;  1Q7Y C;  4M77 E;  3CCS T;  1M1K C;  3INZ A;  2J05 A;  4DQ2 A;  4C8Q C;  4GY5 A;  1NJI C;  2RQV A;  4PJO A;  4D6W A;  2NYS A;  4RG2 A;  1YCS B;  1ZHI A;  3CXC A;  5LJ5 h;  3OYD A;  3F70 A;  4FYY B;  5GAN 4;  3M5A A;  2PUK B;  4XTV A;  2LNH B;  3A1P A;  2JTF A;  1ZSZ A;  3CCL Q;  1I81 A;  2HMA A;  1UUE A;  4RTX A;  4E7J A;  3O5Z A;  1E6G A;  2EKO A;  2HKN A;  2LX9 A;  2LCS A;  1TS9 A;  2FPE A;  4KH0 B;  3CC4 A;  3OYI A;  2DTO A;  1O9S A;  3JRZ A;  3JCM g;  3HP9 A;  3NTH A;  4FIB A;  2D8J A;  3EAE A;  4M78 F;  5GAN 2;  2HZY A;  2JNG A;  5I2S A;  2GTJ A;  4HVW A;  3JCM h;  3CCJ T;  2D8H A;  4M77 F;  4E7H A;  3JCM d;  1VQ6 T;  2KRS A;  1IGU A;  1CSK A;  1OUL A;  2JM8 A;  5M9O A;  2I2L A;  1M1G A;  2XDP A;  1VQ8 A;  4RTT A;  4PJJ A;  4OP0 A;  3S3M A;  2EGA A;  1X2Q A;  2V8I A;  5GAN 8;  2DTH A;  2EYZ A;  3QDR B;  4J6X A;  2DBM A;  4M7A G;  1S1N A;  3KBG A;  1KK7 A;  1KHI A;  3A8G B;  4J9E A;  1IRX A;  2VXF A;  1MNE A;  1E6H A;  3OS1 A;  1D0Z A;  2EPD A;  3NTK A;  2RB6 A;  3VUZ A;  1VQO Q;  8ATC B;  3ZFJ A;  3OY9 A;  3JB9 F;  4KRT A;  1YJ9 T;  4OMF B;  2J6K A;  4EMK C;  1EZZ B;  1BI1 A;  2DFU A;  2DXT A;  4EMK A;  2LC4 A;  2ABL A;  3A8M B;  2RD1 A;  2QQ9 A;  2FPD A;  3MEU A;  2A0F B;  2XHC A;  1M2O A;  1Z9Z A;  2HKQ B;  1W1F A;  2M0O A;  2QA4 Q;  4M7A C;  2E3H A;  2KE9 A;  4KH1 B;  1UGV A;  3I56 T;  2IIM A;  1JXM A;  4ATO A;  5GMK l;  3VYH B;  2QEX A;  3EHR A;  1ARK A;  2A08 A;  5FU7 B;  4M75 G;  4KBM B;  2ZPG B;  5AT1 B;  1VQ4 A;  3UT1 A;  3TU4 K;  1D0X A;  2AKK A;  2RA2 A;  2GNC A;  1VQL Q;  2K5L A;  2PNI A;  2YRD A;  4D8D A;  4XAX B;  1ZUU A;  1H3H A;  2F2V A;  2YXY A;  2E5K A;  1VQP T;  1M1F A;  1I5O B;  2CUD A;  3FLG A;  4M7D F;  2KXC A;  2E3I A;  3MEA A;  4QQD A;  2CP7 A;  2PVG B;  1OZ2 A;  3E2U A;  2IG0 A;  4M78 G;  4J9B A;  1RAF B;  4M77 D;  1Q82 C;  1MV3 A;  4A54 A;  4OB2 B;  4N4H A;  2VKN A;  2F1L A;  5LJ5 e;  3CME Q;  2CKK A;  1VQL T;  4C8Q B;  3H8Z A;  2W0Z A;  4LE9 A;  1GBR A;  2KDS A;  1RAD B;  1KQ2 A;  3A5Z B;  3QSU A;  4QQ6 A;  1OYX A;  2PVD B;  2DRM A;  2DA9 A;  1WYX A;  3JCM X;  4LUD A;  1N5Z A;  1FMK A;  1TUC A;  2BKD N;  2LJ3 A;  3H41 A;  2YT6 A;  1K0X A;  3EGU A;  1X6O A;  1XQH A;  3FRN A;  4RTW A;  1NJI R;  1K73 U;  3EFS A;  4MML A;  4QVC A;  3EG9 B;  3RBB B;  1RI0 A;  1LNX A;  4J8O A;  3ULR B;  2RJE A;  2KI7 A;  1PM3 A;  1WHK A;  5DLO A;  3MEW A;  4M75 B;  2FVU A;  3VS6 A;  4PFO A;  1VQN Q;  1N8R C;  3LWI A;  5L23 A;  3GIB A;  1TU0 B;  2K3X A;  2R5M A;  4M7A E;  1NM7 A;  2GQV A;  3M57 A;  2FYK A;  3G1J A;  2HNI A;  5KYX B;  2X4X A;  2XU8 A;  3MP6 A;  2OTL T;  4OGC A;  1QQJ A;  3ZBD A;  1XNI A;  4PJN A;  3E1S A;  1ZUY A;  3VKI A;  3QZ5 B;  3CCJ A;  2O2O A;  1OZ3 A;  2ZPH B;  2PZ1 A;  3CC2 Q;  1BYM A;  2DF6 A;  3OA6 A;  1WA7 A;  1Y0M A;  1NPP A;  4JPB W;  2E1H A;  3CMA T;  5LJ3 g;  1YHQ Q;  1JJ2 S;  4HT9 A;  3L2U A;  4QVD A;  4JRP A;  2COZ A;  3G71 A;  3PIO A;  1HSQ A;  2JM9 A;  4PL6 A;  2LT1 A;  2CS7 A;  1D3B B;  1RAC B;  1KFZ A;  4M7D D;  4RKU E;  3L2V A;  2EYX A;  2XID A;  3CD6 A;  2XIC A;  3L1A A;  4M7A B;  3PIP A;  4HCB A;  3C0C A;  1M3B A;  2O9V A;  3OYY A;  1X6G A;  1SRM A;  3EGD A;  2CH4 A;  3OMG A;  2KYM A;  1BI2 A;  1WHG A;  3MP1 A;  2DET A;  1TH7 A;  4N4G A;  1VQ6 Q;  2C0I A;  2LQW A;  4XU0 A;  5IHI A;  2ESW A;  1GL5 A;  5GJV B;  4VUB A;  1ZUK A;  2EBP A;  3OBW A;  4JUV A;  5GAN 3;  2YUQ A;  3TRE A;  5DLQ E;  3CXC S;  1KD1 U;  4PLI A;  3P8H A;  3OYA A;  2ZCF B;  1Y57 A;  4OF1 A;  1X27 A;  2LP5 A;  2AZV A;  2CP0 A;  4OVA A;  1SRL A;  3QWY A;  1FX7 A;  4FSX A;  4IIM A;  5J3B A;  4NL2 A;  2LT4 A;  2CSQ A;  2K7A A;  4DEY A;  1YIJ T;  4A4F A;  4M75 D;  4M7A D;  1YI2 T;  4HT8 A;  3CXC P;  5IT9 E;  5GAN f;  2FRY A;  5CKH A;  4B9X A;  3EFO A;  2DIL A;  3CMA A;  1WPY A;  4A53 A;  2KRO A;  2GFA A;  2HL5 C;  2BUD A;  3G71 T;  1QCO A;  1X75 C;  4MMK A;  1WQ7 A;  3OS0 A;  1N9S A;  2OTL A;  1KQS S;  1SSF A;  4M77 G;  1PRM C;  1M2V A;  2KK4 A;  2KQW A;  3IQL A;  4F7U G;  2GTO A;  5KYW B;  2CT4 A;  1SG5 A;  4KGZ B;  2LDM A;  1M27 C;  2H3J A;  1NYG A;  2C0T A;  2XG8 D;  1Q7Y R;  1M1K R;  2YHT A;  3SWN B;  2QGF B;  4M7D B;  3MCA B;  5KYY B;  3M58 A;  2FPF A;  4J9C A;  2DK3 A;  3PGG A;  1YJN T;  1SHG A;  1TTH B;  1T3S A;  2E70 A;  4BDY A;  2RHI A;  2XD0 A;  3OSV A;  2DBK A;  2X3X D;  4IUU A;  3X24 B;  5GMK j;  1IXD A;  4GLM A;  4FU6 A;  1YBY A;  2XDB A;  1VQK Q;  1YI2 A;  1BU1 A;  1VQP Q;  3JB9 I;  1Q82 R;  4CC3 A;  1K8A R;  2L3P A;  1RAA B;  4DOV A;  2EQJ A;  1JU5 C;  2QEX Q;  4CRI A;  3PNW C;  4DBF A;  2EQU A;  2JT4 A;  5KCH A;  3CCR Q;  3CPW A;  1VQ5 Q;  4UC4 A;  4L5G A;  3CCR T;  3SB2 A;  4JS5 A;  1TUD A;  1IHW A;  2K3Y A;  4B9W A;  3CCL A;  1UGS B;  2QTV A;  3MP8 A;  4RTV A;  3U23 A;  2A3L A;  3DB4 A;  1QMC A;  2X3W D;  5CO7 A;  5GAM j;  2C06 A;  4M75 F;  3H0H A;  2GCX A;  1I1J A;  4XU1 A;  1PG5 B;  1QLY A;  4JRQ A;  5D6X A;  2QQB A;  2R57 A;  4J6W A;  1Y7X A;  4OMN A;  1TSF A;  1RAB B;  3VS1 A;  1ABQ A;  3CCU Q;  1TG0 A;  4M7D G;  2HQX A;  4JDS A;  2X4W A;  4IUR A;  3R6O A;  2DL5 A;  2RNA A;  2QI2 A;  5FW9 A;  3G6E A;  2LQ8 A;  1VQM Q;  3PFS A;  2KRN A;  3DLL A;  3DLM A;  5GAO r;  4D8K A;  3LH0 A;  4M77 B;  2MMP A;  1D1A A;  2VUB A;  3LW5 E;  1BKB A;  1N8R U;  1V29 B;  2JN0 A;  2DJZ A;  4PFZ A;  3EH2 A;  4E7Z A;  1A0N B;  1PKT A;  1ZLM A;  3G71 Q;  2BZX A;  4ZGD B;  1I5L A;  2FRW A;  1YJ9 A;  3D7S B;  4RTY A;  4ESR A;  4LDW A;  5A2Q E;  9ATC B;  4M78 E;  3RKX A;  4C5E A;  2VGN A;  3VU3 C;  3C12 A;  1MND A;  3QJ6 A;  2JZ2 A;  5GAN g;  3M0R A;  1Q81 U;  1ZX6 A;  4LN2 A;  1RAE B;  3QBY A;  2GQI A;  5LJ5 j;  5GAM g;  2P0P A;  3S3N A;  1Y96 A;  1W4S A;  2RHU A;  2ATC B;  4C92 B;  2V26 A;  1K9M R;  2RHY A;  2K5F A;  2J6O A;  4GBQ A;  4MDX A;  1CKB A;  1VQ9 Q;  4BUG A;  3OYF A;  3I56 Q;  1G3S A;  2ZPE B;  3I55 T;  1QW1 A;  4Z88 A;  3QXE B;  2C0O A;  2YSQ A;  4XQ3 A;  1PD0 A;  3T9N A;  2NUP B;  1QWF A;  3VYG A;  1FYN A;  4XTZ A;  1NYF A;  1BBZ A;  1UHF A;  4EPC A;  5CKB A;  3VRY A;  1K9A A;  1C6V X;  4DEX A;  2DZ9 A;  1N27 A;  2JVV A;  3CC4 T;  2E4H A;  5IHK A;  5GMK h;  2EQI A;  4C0F A;  5GAM e;  1PHT A;  4NOY A;  3CBP A;  3BE3 A;  2OX7 A;  5HCK A;  4MZT A;  4OMM A;  4Y91 A;  3V7C A;  5DY9 A;  2L89 A;  2A7Y A;  3BDU A;  4OGE A;  3CCS A;  1NJI U;  2H8H A;  2P4T A;  4PJO D;  3Q1J A;  5GJW B;  5KYU A;  3WXM B;  2BIV A;  2X4J A;  1W2B P;  2DNU A;  2YRV A;  4M7D C;  5KH6 A;  5J39 A;  5FLX E;  3REA B;  3CCE A;  4ZTF A;  1V1C A;  2EGE A;  4BI4 A;  3I55 Q;  2DD5 A;  1KSW A;  2RM4 A;  1VQN T;  4RG8 A;  1KG1 A;  2EJ9 A;  2XKO C;  1UE9 A;  3TEE A;  1Q82 U;  1VQ5 T;  2FO0 A;  3M0S A;  1KD1 R;  1H8K A;  2QAS A;  3JAM E;  3H9N A;  2Y4X A;  2VGM A;  1WDX A;  1NZ9 A;  2DL8 A;  1Q7Y U;  4WF2 A;  1M1K U;  1ZBX A;  2A36 A;  4WTO B;  1XTD A;  2DVE A;  3NFC A;  3JSC A;  2EFI A;  1UEB A;  2JMA A;  3M53 A;  2V8J A;  3BFM A;  4ZN1 A;  3M0Q A;  2PUO B;  1OOT A;  2KVQ G;  2YUN A;  1YP5 A;  1X43 A;  4RTZ A;  1TWB A;  2EW3 A;  2CZ7 B;  1GFC A;  2QK0 A;  1UHC A;  5CKE A;  1U8R A;  4E7L A;  4OB3 B;  4DA4 A;  1R0C B;  4MZP A;  4L6V 5;  3CEY A;  3CBO A;  3P8D A;  1VQ7 Q;  3LH5 A;  5GAM f;  3JB9 J;  2A28 A;  1EFN A;  1LOJ A;  5FRM A;  3EG3 A;  1B34 B;  4XTY A;  3SEM A;  3R6N A;  1RAG B;  3L42 A;  3NGP A;  2HSP A;  3EG0 A;  3OS5 A;  2DX1 A;  3EH1 A;  1LJO A;  1VQ8 T;  1MV0 B;  1JEG A;  3WVE B;  1VQ7 T;  2KBT A;  3CCU A;  4C8Q A;  4PJO C;  1XOV A;  1OPK A;  3EG2 A;  5CQY A;  3X28 B;  1C0M A;  3A98 A;  4F16 A;  1VQM A;  4M77 C;  2ZAE A;  4RCC A;  4AFQ C;  3M55 A;  5IXF A;  2K79 A;  4ELY C;  2EQK A;  1VQ8 Q;  4ZN3 A;  3QII A;  2E65 A;  4M78 A;  3RKY A;  5A0G A;  1Y07 A;  3FDR A;  5LJ3 j;  1X69 A;  3CBM A;  1AD5 A;  1WJQ A;  2RJD A;  2KRM A;  1BCO A;  1TUG B;  1M90 C;  3G6E Q;  2J7I A;  4FYX B;  2I0N A;  4FT2 A;  3PVL A;  4KGX B;  2OTJ Q;  1TOV A;  4O5V A;  3SWN C;  4Q5W A;  1B07 A;  1NE8 A;  5GMK e;  1Y71 A;  4L59 A;  1IZ6 A;  1I8F A;  1X2K A;  2RI3 A;  3QWX X;  4Z89 A;  3EGX B;  4C5G A;  2CZ6 B;  3HFN A;  1JB0 E;  2CH4 W;  4CC4 B;  1PSF A;  1UJ0 A;  2RF0 A;  3GP8 A;  3VS2 A;  2M0Y A;  1WHL A;  1D0Y A;  1KC8 R;  1K4U S;  3S3O A;  1VQN A;  3CC7 T;  2MI6 A;  1QKX A;  5KYN A;  4BY6 B;  3J80 E;  1VQO T;  3VS0 A;  3LYI A;  2FB7 A;  1YJ9 Q;  1N9R A;  1WHM A;  4E47 A;  1R8O B;  3OW2 A;  4J9H A;  3EHQ A;  3HL8 A;  1U1S A;  1OX9 A;  2CT3 A;  5KCO A;  4KUD K;  4M75 E;  1VQK A;  2LMJ A;  3LGF A;  1VQP A;  3HRU A;  2M1H A;  1S72 Q;  1VQ7 A;  3AT1 B;  3A8H B;  3HKS A;  2RK2 A;  4QKU A;  1GCQ C;  2O31 A;  1YFN A;  1N8R R;  3OMC A;  2DL4 A;  1X01 A;  4LDY A;  1ZQ1 A;  1K8A C;  4FM4 B;  1H92 A;  2E12 A;  4QQG A;  1XJW B;  1F1B B;  2RHZ A;  3QKJ A;  3V8J A;  1WXU A;  3GNF B;  4LD9 K;  1W2B A;  5EC7 A;  2XDD A;  4E7K A;  1M90 U;  3OYE A;  2KSS A;  4EMH A;  4J7I A;  3RR6 A;  2RQT A;  1PRL C;  1KIK A;  2AT1 B;  2WSE E;  2VV5 A;  4F7U F;  1OI1 A;  2VXE A;  2RJC A;  3VS3 A;  2DXB A;  3CCR A;  3H6Z A;  1D1B A;  4Y92 A;  4IKF A;  2KEA A;  3GF5 A;  4PJM A;  2LZ6 B;  2KYB A;  5DM7 R;  2L0A A;  3OYH A;  4FSS A;  4C8Q D;  2FHD A;  3FC3 A;  5FRO A;  1N6A A;  4DBH A;  4KUL A;  4E7S A;  2FZK B;  3L2R A;  1FMW A;  2EYQ A;  1QCF A;  4EMG A;  3QUI A;  2QQS A;  4OB1 B;  3FEO A;  1VQO A;  1SPK A;  5IN1 A;  1ZSZ C;  5GAN 5;  1H3Z A;  4J6Y A;  4F7U B;  3G7Z A;  4M78 D;  2WSC E;  2DKG A;  3I55 A;  6AT1 B;  5I22 A;  2RMO A;  3THK A;  4PLL A;  3V8K A;  4HXJ A;  1WZO A;  1KJW A;  5GMK i;  4N4I A;  1M8M A;  1BB9 A;  3MPU B;  4RTU A;  1AWJ A;  3NHN A;  1JRI A;  5LJ3 h;  4IIO A;  1SEM A;  4PJO E;  4C8Q E;  4HCK A;  2YUO A;  2MWP A;  1M8V A;  2YWW A;  1KQS P;  4Y28 E;  4ZTJ A;  1QWE A;  5LJ3 f;  2V8K A;  4FW2 A;  3PTA A;  3JCM e;  3ASK A;  4AMC A;  1YIJ A;  1NLO C;  1WXT A;  4PJO B;  3J81 E;  3VS5 A;  1WQW A;  3VUB A;  2AKL A;  2CP2 A;  4JRI A;  1QP2 A;  3BDL A;  1K9M C;  2DJQ A;  5IXB A;  2F2W A;  1NLP C;  2DXU A;  3OQ5 A;  1NBE B;  1GFD A;  2LJ1 A;  4KGV B;  2O9S A;  3CCM T;  3M9Q A;  2RQW A;  2ZZD A;  5CVI A;  2FL7 A;  3UAT A;  3CPW P;  4XTX A;  2ZPB B;  3HTR A;  2HQE A;  1JJ2 A;  1G3T A;  5GMK m;  2KR3 A;  2RHX A;  2GBQ A;  4BE0 A;  1G2B A;  2KY9 A;  3RNJ A;  1ABO A;  3BY7 A;  2D1X A;  1M3C A;  5I11 A;  1Z9Q A;  1IHV A;  2GFU A;  3VRZ A;  1U1T A;  2P4R A;  4PKC C;  3X20 B;  2HEQ A;  2D0Q B;  3ZL7 C;  2H3E B;  3CCQ Q;  4JLI A;  4LDX A;  2CP6 A;  2ZPF B;  3EG9 A;  2ENM A;  4IUV A;  1X6B A;  4JLG A;  3RKW A;  4CC7 A;  4JJB A;  2QQR A;  2CZ0 B;  1U5S A;  3JCM P;  2XMF A;  1MMN A;  4J7F A;  2JOY A;  4MZM A;  5GAN d;  1IB8 A;  1VUB A;  2KAF A;  3HFO A;  1D3B A;  3TSZ A;  3VJP A;  3M54 A;  3CCQ T;  2KXD A;  1YJW A;  1BK2 A;  1G3W A;  2WSF E;  1RL2 A;  2ROL A;  2CP3 A;  1CKA A;  1WX6 A;  4C5H A;  2QAZ A;  2O4X B;  4J9F A;  1M90 R;  3E19 A;  1ZA2 B;  4F7U E;  1WGS A;  3DKM A;  3UWN A;  4JS4 A;  4PFP A;  4A4E A;  3L2Z A;  1VQM T;  2RK1 A;  3MKD A;  3NPF A;  3JCM b;  3V8L A;  3EG1 A;  1B34 A;  1AVZ C;  4P5N A;  5GAO n;  5HK3 A;  2X51 A;  1AWX A;  4PJO G;  2QQA A;  2KT8 A;  2RQR A;  2E64 A;  4PK4 A;  4V2S A;  2OJ2 A;  4EMK B;  3X26 B;  4XU2 A;  3A8O B;  4C0D B;  1AZE A;  4FYW B;  3FJ5 A;  2QA4 A;  1VQL A;  1HYO A;  2PVO B;  1UGP B;  4M7A A;  5GAO p;  1ACM B;  1AWO A;  4HVU A;  3MHX A;  1QCN A;  1JQQ A;  2DIQ A;  5D6Y A;  5FU6 B;  3KUF A;  5I21 A;  3JCM Q;  3S6W A;  1FWZ A;  1PSE A;  1JJ2 P;  2SRC A;  2AHJ B;  2W10 A;  1PCX A;  1D09 B;  2RQU A;  2COY A;  4Z8A A;  2DXC A;  5LJ3 d;  2CP5 A;  2G6F X;  3EFR A;  3OW2 P;  1M5Q 1;  4RCB A;  2E5Q A;  1D1C A;  2LX7 A;  2HCK A;  1JBM A;  1SSH A;  2DLP A;  4DBQ A;  3UA6 A;  1AWW A;  1K1Z A;  3SD4 A;  2O88 A;  1NEB A;  2HD0 A;  1I07 A;  1KHC A;  3GLX A;  4AG2 C;  3QYG B;  3M0P A;  1BI0 A;  4EDU A;  3KXT A;  2LCC A;  4LDU A;  3EGX A;  1EX4 A;  4RUG A;  2LNV A;  4LXC A;  3OS2 A;  5CIU A;  3CCV Q;  1RI9 A;  4XU3 A;  3PT9 A;  1GCP A;  4IUP A;  5KYU B;  4HCC A;  3SFM A;  4FT4 A;  3E9G A;  4AG1 C;  4M7D A;  2ED1 A;  3QG1 A;  3RUX A;  1VYV A;  2DTI A;  2EJF A;  7AT1 B;  4F17 A;  1H64 1;  4M78 C;  3LX7 A;  5KYX A;  1YWO A;  5GAN h;  2YLB A;  2FZG B;  1Q86 R;  3I5S A;  2LTO A;  3CPW S;  4FL6 A;  1YIT A;  2PU9 B;  4KUI A;  3VS4 A;  3CMA Q;  1OQK A;  3SDZ A;  4ANJ A;  2MWO A;  1AEY A;  2X4Y A;  2LJ0 A;  2QGG A;  2JMC A;  2JUF A;  3M4G A;  4M75 A;  4J9I A;  1K9M U;  3HRT A;  1P92 A;  4BI8 B;  1LVK A;  4LD6 A;  5LL6 S;  3LWH A;  1ZSG A;  3JB9 H;  5CQX A;  5KYY A;  2RI2 A;  2K2M A;  1WI7 A;  4A63 B;  2SEM A;  4QVZ A;  5FWB A;  1K0S A;  3OBY A;  4JJN K;  2MK5 A;  2LQK A;  2BZY A;  1NPR A;  5FWC A;  4TVR A;  2DD4 A;  5LJ5 f;  4C92 F;  1YIJ Q;  2E6Z A;  3MET A;  4K11 A;  4WCI A;  3OYN A;  3JCM J;  2EYY A;  2J6F A;  2PQW A;  2F69 A;  4BE2 A;  1S72 T;  2YUP A;  1VQ5 A;  1OU8 A;  1EIF A;  1MUZ A;  2E41 A;  4X9C A;  1SHF A;  1QVG S;  3RIR A;  2WAC A;  2CSI A;  4IUT A;  3JCM c;  1UDL A;  3CME A;  4NS5 A;  5HY6 A;  5GAO l;  2OAW A;  3REB B;  1YHQ T;  4C5I A;  5HK0 A;  2K3B A;  3L2Q A;  3EGD B;  3VS7 A;  2G3R A;  3AHU A;  4LUE A;  2VAS A;  1UTI A;  4M77 A;  2D0N A;  2AZS A;  5FU6 C;  1G83 A;  3V7R A;  1UGR B;  4M78 B;  2LVM A;  1SKU B;  1MMA A;  1T0H A;  2MAM A;  2NUZ A;  2OTL Q;  1RUW A;  2QA4 T;  3TSW A;  1QVF P;  3EFO B;  1NEG A;  1AOJ A;  1WNL A;  1FXX A;  1YIT T;  4BDZ A;  5I2M A;  1VIF A;  2O01 E;  2VYT A;  5KE3 A;  2DM1 A;  1QVF A;  5C6S A;  2VVK A;  4BY6 C;  2HL3 A;  2Z0W A;  4A4G A;  4C0Z A;  1M2V B;  1M3A A;  1Y96 B;  2DO3 A;  4M4Z A;  4ZGJ B;  1Q81 C;  4C92 C;  3J7A F;  1G8X A;  5KYW A;  3CC2 T;  2CYZ B;  2DIG A;  3WVD B;  4C0D C;  5CCA A;  3OW2 S;  2V1Q A;  2BE9 B;  1Q86 U;  2KT1 A;  1U3O A;  3C4S A;  2DE0 X;  2CUB A;  4A4H A;  3KFV A;  4C92 D;  3URG A;  3GOX A;  3TQ7 P;  4CC2 A;  4J83 A;  3H0I A;  4JZ4 A;  3CQT A;  1KC8 U;  2JJ9 A;  1UB4 A;  4XTU A;  2NUP A;  1VQ4 T;  1UGQ B;  1YJW Q;  2NUT A;  2R58 A;  3RDV A;  5C0M A;  5CR2 A;  1O75 A;  2RJF A;  2EYW A;  4N0A A;  1M30 A;  2K5I A;  3PVQ A;  4N0A C;  1DJ7 B;  2DRK A;  4EIK A;  3I35 A;  1W2B S;  5AYF A;  3UDC A;  4ZNX A;  2HBP A;  2DAQ A;  4HKE A;  2B86 A;  2K2V A;  4CI0 C;  2HDA A;  1TXQ A;  2MYS A;  3G4S T;  1BIA A;  3MO8 A;  4PNO A;  1GCQ A;  4OMO A;  4ORZ A;  4B6M A;  3SWN A;  3QO3 A;  2IVW A;  4JRK A;  5IH2 A;  2RO0 A;  4C92 G;  3CCL T;  3PMI A;  1VQ6 A;  3FIF A;  1AT1 B;  1PWT A;  3CCS Q;  2D9T A;  2L2P A;  5GAN e;  3UPU A;  3SHW A;  3RER A;  2X9H A;  1GBQ A;  1JO8 A;  1ZBJ A;  3OB9 A;  2P0Q A;  1S72 A;  3C94 A;  1ZSZ B;  2BZ8 A;  2CGH A;  2KGT A;  1BCM A;  4X9D A;  1WJR A;  1QKW A;  3G4S Q;  1RAI B;  5GAO q;  2M51 A;  1BIB A;  3FJP A;  1VYT A;  3QDF A;  4DBR A;  4JJD A;  4DOW A;  4JZ3 A;  2L3R A;  1GXI E;  2QXF A;  4R56 A;  4IUQ A;  1R0B G;  2K4Y A;  3CC2 A;  2DZC A;  4BE1 A;  1K76 A;  3CCQ A;  1YJW T;  1J3T A;  3GPL A;  2ROT A;  4YTL A;  3CCE Q;  2MF2 A;  1KQ1 A;  3ER0 A;  3I5R A;  1YCY A;  2YLC A;  2PTK A;  1HK9 A;  2RH2 A;  2X35 A;  1WJS A;  5GAN 6;  4F7U A;  2QTX A;  4BAC A;  1QVG P;  5D6W A;  1K8A U;  2VB6 A;  3V7S A;  3HHT B;  3M0U A;  3E9F A;  2EKH A;  1OEB A;  1E7O A;  1R77 A;  1LCK A;  2RI5 A;  3CD6 Q;  4LNP A;  3CCV T;  3BW1 A;  3OYK A;  3QYH B;  2YDL A;  3HSB A;  1VA7 A;  2EJG A;  1VOM A;  4C8Q F;  1IGQ A;  2Y4Y A;  4PJO F;  2MCN A;  1PD1 A;  2QEX T;  2B8A A;  1AZG B;  1IO6 A; 
#chains in the Genus database with same CATH homology
 2JS0 A;  1UJY A;  2KXC A;  5HCK A;  4OMM A;  2L3Q A;  4J9B A;  1MV3 A;  3H0F A;  1B3Q A;  3TSZ A;  2VKN A;  2KXD A;  1BK2 A;  4R0K A;  2J06 A;  3TVT A;  2H8H A;  2ROL A;  1CKA A;  2W0Z A;  3M0T A;  4LE9 A;  5GJW B;  1GBR A;  1WX6 A;  2ED0 A;  1RLP C;  1WXB A;  2DNU A;  4J9F A;  2DRM A;  2DA9 A;  1WYX A;  4LUD A;  1N5Z A;  1FMK A;  1OPL A;  1TUC A;  2LJ3 A;  3REA B;  1T3L A;  3H41 A;  1V1C A;  2EGE A;  4OML A;  3NPF A;  2YT6 A;  1KSW A;  3EGU A;  1K0X A;  3EG1 A;  4RTW A;  1AVZ C;  4OMQ A;  1AWX A;  2DL3 A;  1UE9 A;  2FO0 A;  3RBB B;  3M0S A;  2KT8 A;  2RQR A;  3ULR B;  1H8K A;  2OJ2 A;  1WDX A;  1AZE A;  2DL8 A;  4AFS C;  2LQN A;  3FJ5 A;  2RPN A;  2A36 A;  3VS6 A;  2A37 A;  1AWO A;  4HVU A;  2JMA A;  5L23 A;  2CDT A;  3M0Q A;  1NM7 A;  1JQQ A;  1OOT A;  2K9G A;  2YUN A;  1YP5 A;  1X43 A;  4RTZ A;  2EW3 A;  2QDL A;  1NG2 A;  2SRC A;  1GFC A;  1UHC A;  2W10 A;  1ZUY A;  2RQU A;  4Z8A A;  2DVJ A;  2O2O A;  2PZ1 A;  2G6F X;  2DF6 A;  4QT7 A;  1PKS A;  1WA7 A;  1Y0M A;  2LX7 A;  2HCK A;  3LH5 A;  4JPB W;  1SSH A;  2DLP A;  1HJD A;  3UA6 A;  1AWW A;  2A28 A;  1EFN A;  1K1Z A;  2O88 A;  2OI3 A;  3EG3 A;  1NEB A;  3SEM A;  3R6N A;  1I07 A;  4AG2 C;  2GGR A;  3NGP A;  1HSQ A;  2JXB A;  3M0P A;  2HSP A;  2JM9 A;  3EG0 A;  1KFZ A;  2DX1 A;  1MV0 B;  1JEG A;  2EGC A;  4RUG A;  2KBT A;  1RI9 A;  2EYX A;  5IHN A;  2HBW A;  1GCP A;  1XOV A;  1M3B A;  3C0C A;  1JXO A;  1OPK A;  3EG2 A;  2O9V A;  4AG1 C;  1X6G A;  1SRM A;  3A98 A;  4F16 A;  2CH4 A;  2ED1 A;  2KYM A;  1VYV A;  4OMP A;  2CRE A;  4AFQ C;  4F17 A;  5IXF A;  2K79 A;  3GBQ A;  2C0I A;  2LQW A;  5IHI A;  4AFU C;  1VYU A;  1YWO A;  1YNZ A;  2ESW A;  1GL5 A;  5GJV B;  1W6X A;  3I5S A;  1ZUK A;  2EBP A;  2YUQ A;  2ECZ A;  1X69 A;  1AD5 A;  3VS4 A;  2KRM A;  3NMZ C;  1UFF A;  1Y57 A;  1AEY A;  2LJ0 A;  2J7I A;  1X27 A;  2JMC A;  2LP5 A;  2AZV A;  2I0N A;  4J9I A;  3PVL A;  1SRL A;  3QWY A;  1B07 A;  4IIM A;  3PE0 A;  1ZSG A;  2DMO A;  2CSQ A;  2K2M A;  2K7A A;  1WI7 A;  4A63 B;  4DEY A;  2SEM A;  1RLQ C;  2KNB B;  1X2K A;  4Z89 A;  3QWX X;  5FWB A;  1K0S A;  3UF4 A;  3I9Q A;  2DYB A;  2V1R A;  1T0J A;  2BZY A;  2CH4 W;  5FWC A;  4CC4 B;  1UJ0 A;  2FRY A;  2RF0 A;  3VS2 A;  4AFZ C;  2F2X A;  2DIL A;  2M0Y A;  4K11 A;  1W70 A;  1YN8 A;  4WCI A;  2EYY A;  2J6F A;  1K4U S;  2KRO A;  2BTT A;  1UEC A;  1QKX A;  2YUP A;  2JW4 A;  2DL7 A;  2EVR A;  3VS0 A;  4F14 A;  1MUZ A;  1SHF A;  1GRI A;  2FG0 A;  1PRM C;  4J9H A;  3IQL A;  3EHQ A;  2CSI A;  2CT3 A;  2GTO A;  1OV3 A;  2CT4 A;  1UDL A;  2MIO A;  2LMJ A;  1M27 C;  1U06 A;  1WFW A;  1NYG A;  2OAW A;  3REB B;  2C0T A;  2JTE A;  5ECA A;  1GCQ C;  2K3B A;  2O31 A;  3VS7 A;  2FPF A;  4J9C A;  4LUE A;  1UTI A;  1WIE A;  2D0N A;  1I0C A;  1SHG A;  2DL4 A;  2FEI A;  2AZS A;  4J9G A;  1T3S A;  1HD3 A;  1G83 A;  1H92 A;  1T0H A;  1WXU A;  2DBK A;  2NUZ A;  2X3X D;  5EC7 A;  1RUW A;  4HVV A;  3TSW A;  4GLM A;  1PNJ A;  1NEG A;  1AOJ A;  2RQT A;  1PRL C;  1BU1 A;  1KIK A;  2VWF A;  4CC3 A;  1WLP B;  2L3P A;  2K6D A;  1JU5 C;  4E6R A;  2DM1 A;  4J9D A;  2VVK A;  3UA7 A;  2JT4 A;  3VS3 A;  2RN8 A;  4Y92 A;  1YWP A;  2KEA A;  2LZ6 B;  1M3A A;  1UG1 A;  2KYB A;  4M4Z A;  2L0A A;  1TUD A;  2MOX A;  2AK5 A;  2L3S A;  2NWM A;  4FSS A;  4RTV A;  3JV3 A;  4X1V A;  3U23 A;  2JS2 A;  2X3W D;  4JJC A;  2V1Q A;  2KT1 A;  1U3O A;  3H0H A;  2J05 A;  1I1J A;  2RQV A;  2DE0 X;  1QCF A;  1YCS B;  2CUB A;  1QLY A;  3KFV A;  4CC2 A;  3H0I A;  1SPK A;  4JZ4 A;  2LNH B;  3CQT A;  1UUE A;  4RTX A;  3O5Z A;  4OMN A;  1E6G A;  5I22 A;  2RMO A;  3THK A;  3VS1 A;  1ABQ A;  2EYW A;  4HXJ A;  1M30 A;  2LCS A;  1KJW A;  1TG0 A;  3PVQ A;  2DRK A;  2FPE A;  4EIK A;  1M8M A;  3I35 A;  1BB9 A;  2DL5 A;  2RNA A;  4ZNX A;  5FW9 A;  4RTU A;  2B86 A;  2HDA A;  2D8J A;  1AWJ A;  3NHN A;  2GTJ A;  4HVW A;  2KRN A;  1GCQ A;  2D8H A;  4OMO A;  4IIO A;  4ORZ A;  1SEM A;  4D8K A;  2KRS A;  4HCK A;  2YUO A;  5IH2 A;  1CSK A;  2JM8 A;  1A0N B;  1PKT A;  1QWE A;  4RTT A;  1ZLM A;  2BZX A;  2FRW A;  1PWT A;  2EGA A;  1NLO C;  1X2Q A;  1WXT A;  4RTY A;  2EYZ A;  2DBM A;  2L2P A;  3VS5 A;  4ESR A;  1S1N A;  3SHW A;  2AKL A;  1GBQ A;  1JO8 A;  4J9E A;  1ZBJ A;  2DJQ A;  5IXB A;  2BZ8 A;  2F2W A;  1NLP C;  1E6H A;  2KGT A;  2EPD A;  1GFD A;  1QKW A;  3M0R A;  1ZX6 A;  2LJ1 A;  4LN2 A;  2GQI A;  2M51 A;  1VYT A;  2O9S A;  4JJD A;  2RQW A;  4KRT A;  4JZ3 A;  2J6K A;  2ABL A;  3UAT A;  2FPD A;  1K76 A;  1J3T A;  2J6O A;  2ROT A;  4GBQ A;  1CKB A;  2KR3 A;  1Z9Z A;  1W1F A;  2KE9 A;  3I5R A;  1UGV A;  2GBQ A;  2PTK A;  2IIM A;  1G2B A;  1JXM A;  3RNJ A;  4Z88 A;  1ABO A;  2C0O A;  2D1X A;  2YSQ A;  3EHR A;  1ARK A;  2A08 A;  1M3C A;  5I11 A;  1Z9Q A;  1QWF A;  3M0U A;  3VRZ A;  2P4R A;  1FYN A;  1NYF A;  1BBZ A;  1UHF A;  2HEQ A;  2EKH A;  3ZL7 C;  1OEB A;  1E7O A;  3VRY A;  1LCK A;  1K9A A;  2AKK A;  4DEX A;  4LNP A;  2GNC A;  2ENM A;  1X6B A;  2PNI A;  4CC7 A;  4D8D A;  2YDL A;  1VA7 A;  1ZUU A;  4JJB A;  1H3H A;  5IHK A;  1U5S A;  2F2V A;  2EQI A;  2E5K A;  2MCN A;  1PHT A;  2CUD A;  2XMF A;  1AZG B;  1IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...