3U23A

Atomic resolution crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide from human rin3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
RQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CD2-associated protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3u23A00
5HCKA 1JQQA 5ECAA 1S1NA 3PE0A 2FPEA 1YNZA 2O88A 5I22A 2C0TA 2DX1A 1E6HA 2CSQA 2EYZA 2DL8A 1Y0MA 2M0YA 2RQTA 4J9CA 2D1XA 1X2KA 2V1RA 4HXJA 2DM1A 2O31A 4LE9A 1ARKA 2SRCA 2AZVA 2EBPA 2EGAA 1HSQA 4LNPA 4AG2C 2LJ1A 1E6GA 2EYYA 1SPKA 2AK5A 5IHNA 3A98A 3M0SA 1UHCA 3VS4A 1AD5A 2M51A 4CC2A 2LQWA 2RF0A 3QWXX 4DEYA 1HJDA 3JV3A 3PVQA 2K6DA 1BK2A 1VYUA 2AKLA 4K11A 1GL5A 2RNAA 2X3XD 4LN2A 2KRSA 4F14A 1G83A 2ED1A 2DL4A 2J6FA 1OPLA 2RN8A 3UA6A 1JO8A 2HDAA 2LZ6B 2D8HA 2D0NA 3M0QA 4J9GA 1AOJA 3M0RA 1B07A 4RTTA 2DMOA 2K7AA 2BTTA 2VKNA 1RLQC 1J3TA 2JM8A 1U5SA 2X3WD 1E7OA 3EG3A 3EG0A 1GCPA 2IIMA 2KXCA 3VS2A 2CDTA 3GBQA 1EFNA 1JXMA 4J9HA 3EG1A 4GBQA 3RNJA 4J9DA 4ORZA 4ESRA 1LCKA 5IHIA 1PRMC 1U3OA 1SHFA 1PWTA 1AWJA 4OMMA 2LMJA 3FJ5A 1BB9A 2CUDA 2CSIA 2YUQA 5IHKA 1RUWA 1K4US 4AG1C 1T0JA 4E6RA 1K0XA 2DBKA 1W70A 1QWFA 2JXBA 2JTEA 2RPNA 3EG2A 4J9FA 2L2PA 1NG2A 2C0IA 2RMOA 2FPDA 1BBZA 2DVJA 2DL5A 3UA7A 2GNCA 4M4ZA 2J6KA 2ESWA 3REBB 2A28A 1NYGA 2GQIA 2E5KA 4RTUA 1KJWA 2KRMA 1NM7A 2PNIA 4HVVA 5GJVB 2DRMA 2MOXA 2K2MA 1WXTA 2NWMA 2ROTA 2C0OA 1ZUKA 1K0SA 2HBWA 1TUCA 1WDXA 4X1VA 3M0PA 5IXBA 1H92A 1SEMA 4D8DA 1UFFA 1X6BA 2K79A 3VS1A 1M3AA 2PZ1A 1AVZC 3VS3A 3O5ZA 3SEMA 2KROA 1CKAA 1WLPB 2CUBA 3ZL7C 4KRTA 1V1CA 2FPFA 2EQIA 2QDLA 2LQNA 2KYBA 1TG0A 2BZYA 4RTWA 2DNUA 2KR3A 3TVTA 4J9IA 1X6GA 3KFVA 1OOTA 4OMLA 2CH4W 4JJDA 1U06A 3IQLA 2DL7A 2OI3A 1ABQA 1GFDA 1PKTA 1NEGA 2EVRA 2J6OA 2VVKA 4LUEA 2NUZA 1WXUA 3CQTA 2YDLA 2JS2A 2DJQA 2A36A 1T0HA 2YT6A 1JXOA 1N5ZA 1AZEA 2J7IA 1Y57A 2RQRA 1UECA 4JZ3A 1GCQC 2GTJA 2KBTA 2LCSA 2SEMA 3UATA 2EYWA 2K3BA 2FRYA 4Z89A 1WI7A 1ZX6A 3NHNA 5FWCA 2K9GA 2O9VA 1M3CA 4F16A 3EGUA 2KT8A 2CT3A 1ZLMA 1X43A 3QWYA 3NMZC 1H8KA 2GBQA 1AWWA 1K9AA 3UF4A 3I35A 3RBBB 2HEQA 5IH2A 2MCNA 2EKHA 2LJ3A 1I07A 5EC7A 4DEXA 1M8MA 2DBMA 2FRWA 1MUZA 1KIKA 1YP5A 2CREA 2W0ZA 4OMOA 4J9BA 1ABOA 2O9SA 2FG0A 2B86A 1RI9A 2ECZA 3NGPA 1MV3A 1FYNA 1AWOA 2AKKA 2VWFA 1M30A 1WA7A 1M3BA 1XOVA 2JW4A 1ZUYA 4AFSC 2BZXA 2EGEA 4AFUC 2L3SA 5L23A 2A08A 4QT7A 2J05A 1Z9QA 3VRYA 4LUDA 2F2XA 2DLPA 4JZ4A 1HD3A 1VYVA 1UHFA 1UGVA 4IIOA 2HCKA 4A63B 1NEBA 2DL3A 2PTKA 3R6NA 2OJ2A 2ABLA 3I9QA 1NYFA 4CC7A 2DA9A 5FWBA 2LNHB 1X27A 2EPDA 2KYMA 2EGCA 1OPKA 2P4RA 1Z9ZA 1SRLA 2XMFA 1VA7A 3M0UA 1QWEA 1WFWA 1X2QA 2CH4A 1QCFA 4J9EA 1OV3A 1QKWA 4Z88A 3EHQA 2YUPA 3TSZA 1WXBA 2DRKA 2KEAA 2I0NA 2DYBA 2JT4A 4OMNA 1M27C 2KGTA 3SHWA 2H8HA 1UTIA 4RTYA 2AZSA 2JM9A 2L0AA 2MIOA 2RQWA 4R0KA 2DF6A 1ZBJA 1GBQA 4Z8AA 3VRZA 2G6FX 4RUGA 1VYTA 2EW3A 1W6XA 4HVUA 2ED0A 4ZNXA 1X69A 2ENMA 1ZUUA 4D8KA 1H3HA 2JMCA 1ZSGA 1AEYA 3LH5A 4HVWA 1GCQA 1IO6A 2CT4A 4F17A 1PNJA 3U23A 1T3SA 3REAB 4RTVA 2JMAA 1WYXA 2W10A 3I5SA 4WCIA 5I11A 4AFQC 2JS0A 1I1JA 1NLOC 2KNBB 1UUEA 4Y92A 1OEBA 2O2OA 2L3QA 4JPBW 1KSWA 2DE0X 1UJYA 1UG1A 2EYXA 4EIKA 2F2WA 3C0CA 1CKBA 1YWPA 3VS5A 1K76A 2KXDA 4CC3A 2RQUA 3NPFA 1PKSA 1FMKA 1JEGA 1KFZA 1G2BA 4AFZC 3H0HA 1NLPC 1T3LA 3H41A 1TUDA 1SHGA 3ULRB 1K1ZA 2ROLA 3TSWA 1JU5C 2LP5A 3M0TA 1B3QA 4GLMA 1UE9A 1SSHA 4OMQA 5GJWB 1CSKA 1MV0B 1A0NB 5FW9A 1YWOA 3VS7A 3H0FA 4CC4B 4HCKA 1YN8A 1W1FA 2V1QA 1BU1A 2L3PA 1PRLC 1UDLA 2F2VA 2YUOA 4FSSA 1GFCA 2FEIA 5IXFA 2YSQA 3PVLA 1QLYA 2LJ0A 2RQVA 1AZGB 3H0IA 1QKXA 3VS6A 1WX6A 2BZ8A 1SRMA 4RTZA 1PHTA 2KE9A 4JJCA 2KRNA 2FO0A 4OMPA 2D8JA 1WIEA 4IIMA 2HSPA 2YUNA 2DILA 3THKA 2A37A 2LX7A 1I0CA 3EHRA 1UJ0A 2J06A 2OAWA 4JJBA 1GRIA 2GGRA 2GTOA 1YCSB 3I5RA 2KT1A 1GBRA 1AWXA 3VS0A 4RTXA 1RLPC
chains in the Genus database with same CATH superfamily
2JN0A 1RABB 1YNZA 2C0TA 4M78A 3G6EA 2RQTA 4J9CA 1Y71A 2D1XA 3SD4A 4LE9A 2A7YA 3CEYA 4BUGA 2HQEA 4C92B 1K8AR 3HRSA 5IHNA 3VS4A 1AD5A 3LWHA 5KCOA 4KGZB 3QWXX 2D6FA 1OZ2A 1KQSA 4XTXA 2XU8A 1GL5A 2RNAA 3PTAA 4DBFA 3EH2A 3J81E 1S72A 5AYFA 4PKCC 3CMAT 3JCMh 2WSEE 5FU7C 3EH1A 3M0RA 1Y7XA 3M57A 1W2BS 5LJ5d 2QEXA 3CCVA 2NUTB 2VKNA 1RLQC 2YRCA 3OBWA 1Q81R 1VQKQ 3JCMg 3EG3A 2NLUA 3EAEA 1GCPA 2CDTA 4R55A 1R8OB 3E1SA 4ZGJB 3EG1A 3F70A 3J80E 2RJCA 5KYYB 3CCSQ 4ZN3A 5LJ3e 1G3YA 2Y90A 2FZKB 5IHIA 3JB9I 1U3OA 1VQPQ 4XTUA 3GNFB 1Q86R 3PMTA 1SHFA 3WXMB 1Q95G 2NUPA 2HL3A 5LJ3f 5DLQE 1G8XA 3PIOA 3T9NA 4C8QF 3GLXA 4E7LA 2LT1A 3EFRA 2QAZA 2CSIA 2YUQA 1K4US 2CZ6B 3CCST 2DBKA 1D0ZA 4Z02A 1QWFA 2GFUA 3OQ5A 2JXBA 2JTEA 3EG2A 1VQLQ 1S72Q 3QZ9B 1QMCA 3QO3A 4C5HA 1X75C 1Y96B 2DIQA 5GANg 3CMAQ 3UA7A 1N8RC 4XTWA 2RI5A 2J6KA 4M7DD 2ESWA 2A28A 3OB9A 4BY6C 1RL2A 1NYGA 2GQIA 4RTUA 5CKBA 2NUTA 2KRMA 1K9MC 2CZ1B 2DRMA 3FLGA 2K2MA 1VQOA 1IGQA 3SWNA 4KULA 5CVIA 2QXFA 4QVDA 1TUCA 1WDXA 2EQKA 5GAMd 2CP3A 2HBPA 4RKUE 5GAMe 3ER0A 1YJ9T 2EYQA 1V29B 2DIGA 2JOYA 5KYXB 4AT1B 2KROA 2D0QB 4KRTA 3QUIA 4NS5A 4JS5A 2CP7A 2KK4A 2EKOA 1IRXA 1BI0A 2FPFA 3PNWC 1MMGA 1B34B 1TXQA 2E10A 3QG1A 2KR3A 1X6GA 1VOMA 3O8VA 4OMLA 4MDXA 2CH4W 4M77E 3IQLA 3JAME 3C4SA 1ABQA 4M7AD 1G3TA 1ZSZC 3OW2A 3CXCP 2J6OA 4IUQA 3JCMf 2E41A 4LUEA 2NUZA 4M77F 1WXUA 2Y4YA 3G71Q 4YTLA 1N8RR 1M1KU 2XK0A 1D1AA 1N5ZA 1RAIB 4PFOA 3MP1A 1UECA 2F5TX 5DY9A 2LCLA 4PJOC 2QEXQ 2HZYA 2HQHA 2EYWA 3OW2S 1KC8C 1UEBA 4JLIA 5CAIA 1Q81U 3EGUA 3CCLA 2CP6A 1UGRB 2RA2A 3KBGA 2PVGB 3I35A 4E2FB 4QW2A 1VQMT 3V8LA 1I07A 1KIKA 2RHZA 2CREA 3I55A 1QP3A 3WVDB 3OS5A 3CMET 3HTRA 2BKDN 4BE2A 3LLRA 2FG0A 1RADB 1Q7YR 3GP8A 3RERA 2DPPB 3KXTA 1IHVA 2JW4A 1M3BA 2IVWA 3G71A 1B7TA 4JRKA 2EGEA 4E7SA 2L3SA 2J05A 4RMOA 1OULA 4LUDA 4OGCA 4ZTFA 4ANJA 3X24B 1F1BB 4C92F 2XKOC 4QQGA 4M7DC 2Y4XA 2MI6A 2MAMA 1YJNA 3PT9A 2HQXA 1QQJA 5LJ3d 1X27A 5GANh 2KYMA 1Z9ZA 1SRLA 1X2QA 1RAHB 1QCFA 3V8JA 1K8AU 2E5QA 4X9CA 2DYBA 2JT4A 2KGTA 3SHWA 2G3RA 2H8HA 3CC2T 3X25B 2JM9A 2L0AA 2HNIA 3LGLA 2FZGB 1QVGS 1ZBJA 1GXIE 1GBQA 4RUGA 1VQKT 2LT4A 5D6YA 4ZNXA 4M77G 4J5YA 2L5QA 4PJOG 3A8GB 3URGA 1I5LA 2L3RA 1ZSZA 3CCUA 4Y28E 4D8KA 3OA6A 1AEYA 2DERA 1GCQA 1IO6A 4M7AG 5A2QE 3JB9H 4GY5A 4B9WA 1T3SA 2RI2A 2OTLA 1WYXA 2LVMA 2CP2A 4RG8A 2NYSA 3CCJQ 4M75B 1NLOC 1YHQQ 2KNBB 1OEBA 2O2OA 3D7SB 1KSWA 3QYGB 2DE0X 1SG5A 1UJYA 2VGNA 1TOVA 3M54A 2EYXA 3JRZA 1D3BA 1VQPT 1YWPA 1QVFP 1LOJA 2XI9A 4OB0B 1KQ2A 4M7DE 2JTMA 3OYCA 2CZ7B 3QXEB 1KC8U 1NLPC 1T3LA 2MMPA 2BE7D 1K1ZA 2ROLA 3TSWA 2LP5A 5GANd 1G5VA 4OMQA 5GJWB 1M1KC 3MEWA 3OBYA 4FW2A 3H0FA 3CCVT 1BU1A 2L3PA 1PRLC 4N4HA 4WTOB 5LJ5h 3OYGA 3GOXA 3CCMT 4O5VA 4KBMB 1D0YA 2RQVA 5CQXA 3A8MB 3JCMb 4EPCA 2L89A 4RTZA 5GAOq 5GAOp 5I2MA 1PHTA 1TH7A 2HKNA 2HSEB 4JJCA 4HT9A 2FO0A 1KHIA 2D8JA 4OMPA 1WIEA 2HSPA 4M7AF 2DILA 3MKDA 2E64A 1K73R 3VKIA 5D7UA 4KGVB 1I0CA 2LX7A 1UJ0A 3A8OB 2OAWA 2QTVA 3OYLA 3QIIA 1GRIA 2GTOA 2QI2A 3I5RA 1Q86C 4HKEA 2KT1A 4QKUA 3CCRQ 2QA4Q 1GBRA 5KH6A 5HCKA 1IGUA 2COWA 5ECAA 3AHUA 1S1NA 1D3BB 3L42A 3PE0A 1JJ2A 3SFMA 2PUOB 1VQ5Q 1E6HA 4XK8E 4KT0E 4KH1B 2QK0A 2M1HA 4FYWB 1ZHIA 1WNLA 1C6VX 4FL6A 4NL2A 2X35A 4PJLA 4PJOA 3BFMA 4OB1B 4M75E 3EGDB 1AT1B 1HSQA 4LNPA 4AG2C 5GAN3 2ZPEB 3ZFJA 1E6GA 1M1GA 4FIBA 2AK5A 4C8QA 1UHCA 3MEAA 5GAMj 3J7AF 4E7JA 3S6WA 3QDFA 1VQ8T 2M51A 3CMEA 3G4SA 3PGGA 3LWIA 3CC4A 4F7UE 4DEYA 2RJFA 5KYXA 1Q82R 3PVQA 2P0QA 2K6DA 1BK2A 4A4HA 2X3XD 4LN2A 2KRSA 3X26B 2DTIA 2ED1A 3CC7T 1OPLA 1X6OA 2HDAA 1YFNA 3CCJA 4IUTA 8ATCB 3I55Q 2VC8A 1YITT 2VYTA 3I56T 4RTTA 4B6MA 2RM4A 4R56A 1J3TA 3L2UA 1M90U 2ZPIB 1I81A 1KK7A 1ACMB 3EG0A 4LD6A 1R0BG 2KXCA 2YHTA 1VQ8A 3GBQA 1EFNA 3CPWP 2XDPA 3RNJA 5GMKm 1YI2Q 2P0KA 4J9DA 4ORZA 3JB9J 4JJNK 1KQSS 3V7RA 4PJOB 1AWJA 4IURA 2DTOA 1JB0E 4UC4A 2CUDA 1AHJB 3JSCA 1RUWA 2K2VA 1WHGA 1T0JA 3JCMX 1FMVA 4N4GA 1K73C 4FYVB 4C0FA 3JCMd 2GQVA 1UGQB 3JCMe 2RPNA 4J9FA 4M7AA 2CS7A 2L8DA 5LJ3h 3OYIA 4E7HA 1NG2A 3ASKA 4A53A 1MMNA 4QVZA 2RMOA 3RMQA 2BIVA 3CCLQ 1Q81C 1BBZA 4PLLA 1PSEA 4J7IA 3RKXA 4FCYA 1VQ6Q 2DL5A 4M4ZA 3REBB 2KMTA 3OYBA 4RCCA 2GF7A 4HVVA 1ZSZB 3G7ZA 2NWMA 2LDMA 4BE0A 2C0OA 1K0SA 2HBWA 4X1VA 3M0PA 3TEEA 5IXBA 3ZEHA 1H92A 4D8DA 2A3LA 1QVPA 1H3ZA 5A0LA 1PCXA 3G4ST 2X9HA 2K79A 5CK9A 1WQWA 1M3AA 3VS3A 1PC0A 2CUBA 1WLPB 1WJSA 4HA8A 4ELZC 2X4WA 5KYNA 2M16A 4C8QC 5HY6A 1VQ7A 3EFOB 2M9UA 2DXUA 1TG0A 2BZYA 3M4YA 4RTWA 4M77B 5GMKh 3TREA 1W4SA 3TVTA 2LRQA 2HKQB 5D6XA 5J26A 1U8RA 2VUBA 3JCMc 1PKTA 2F1LA 3QYHB 2FYKA 1K9MR 4M78B 3RIRA 1YITQ 4PL6A 1M2VA 1T0HA 2PVOB 1N27A 2RQRA 1GCQC 4DBQA 2SEMA 2BUDA 2K9GA 3L1AA 1M3CA 4F16A 1C1AA 2CT3A 3M5AA 3JB9D 1QVGA 2OTJT 3QDRB 5KYUA 2GBQA 3SWNB 5CKHA 5LJ5g 1AWWA 3UF4A 4HCBA 3OS2A 5IH2A 1VQKA 2EKHA 4EDUA 3M58A 4MZPA 4DEXA 5GAN8 1M8MA 2DBMA 1MUZA 2A0FB 2EQMA 4X34A 5GAN7 5GAOm 2W0ZA 4J9BA 2RO0A 3A5ZB 3QHSA 4XTZA 2ZZDA 3QPHA 2B86A 3EGDA 2ZCFB 1QCOA 5KYWA 2VWFA 3NTIA 1XOVA 3I56Q 1ZUYA 4AFSC 5HK3A 4EMKB 4M7AC 4N4IA 5KYYA 1Q86U 5L23A 2A08A 3VRYA 2HAXA 1I5OB 4JZ4A 1HD3A 1WGSA 1YJ9Q 2E65A 2E3HA 2HCKA 2DL3A 2PTKA 3R6NA 4BI3A 1VQNT 1PM3A 1NYFA 4CC7A 1V76A 2DJZA 2DA9A 1D1BA 5FWBA 2P4RA 1NJIR 1VA7A 3DB4A 1QWEA 5KE2A 2DXTA 3EFOA 4XU2A 1QCNA 2COYA 1QKWA 1U1TA 4M78E 4Z88A 2YUPA 2X4YA 2DRKA 2KEAA 2DZ9A 2I0NA 1TTHB 4OMNA 4XU3A 5CKDA 2MIOA 1S72T 4R0KA 2EQUA 3CD6A 3VRZA 1VIEA 5A0GA 3FEOA 1MMDA 3BE3A 4M78G 1VYTA 1BYMA 1W6XA 5FROA 2ED0A 2Z0WA 3LYIA 4JRPA 2YLBA 2KY9A 2RD1A 1FXXA 3HRUA 5CKEA 3CCRT 1X69A 3RESA 3L2QA 1H3HA 2JNGA 2PQWA 3RKYA 3LH5A 2B8AA 2CT4A 2RJEA 2K3XA 1G3WA 2VB6A 1VQ5A 2W10A 3I5SA 2JS0A 1I1JA 3BW1A 3CCMQ 1UUEA 4NOYA 5GAMg 2ZPGB 3CCQT 3LGFA 3FIFA 2LC4A 5LJ5f 1ZA1B 1CKBA 1ZQ1A 4PJNA 2KXDA 2RI3A 1EX4A 4EMHA 5DM7R 1D1CA 3MEVA 1M2OA 1PKSA 3BY7A 4Q5WA 1Y96A 2EWNA 3ULRB 2X4XA 2JVVA 4GLMA 1UE9A 1TUGB 1CSKA 1MV0B 5FU6B 3RR6A 4A4EA 4CC4B 1UB4A 2F2VA 3M59A 1BCOA 2YUOA 1YHQT 1GFCA 2FEIA 1WX6A 2BZ8A 1SRMA 3L2WA 2EIFA 2KE9A 1D0XA 1KQ1A 3HKSA 2FL7A 3DLLA 2I2LA 4OVAA 2QGFB 3EHRA 2K5LA 3CPFA 4BDYA 2XG8D 3MJXA 5LJ5e 3FC3A 4C5GA 1PSFA 2EJFA 1TU0B 2FPEA 2JUFA 5CR2A 2F5KA 3LW5E 1VQ9T 2O88A 2OTLQ 4BB7A 4D6WA 1LNXA 2DL8A 2M0YA 4M78F 1VQ4A 1O9SA 3CC2Q 2QG9B 4HXJA 1M1FA 2VXEA 1XNIA 2EBPA 1HYOA 5C6SA 3EGXA 2KSSA 2LJ1A 2KQWA 1N8RU 1VQMQ 3P8HA 1M1KR 2DO3A 2EYYA 1SPKA 5GMKj 2V8JA 4M77A 4OB2B 4KUDK 1KD1U 1M2VB 1BI3A 3HPWA 2DEUA 4F7UB 2RHYA 5CQYA 4CC2A 4C92A 2RF0A 4NL3A 3JV3A 2AKLA 1JJ2S 3M4GA 4K11A 2QEXT 1G83A 5I21A 3M53A 1XQHA 2DEQA 2RN8A 2E70A 5FU7B 3UA6A 4DOWA 2QQAA 2LZ6B 4A4GA 2D0NA 3M0QA 2XDDA 1U1SA 2IPOB 2WSCE 1B07A 5A0DA 1PD0A 1Y07A 2LQKA 2K7AA 4QQ6A 2KI7A 3S3MA 1U5SA 2X3WD 3QBYA 2LCCA 1RAEB 2E3IA 3MHXA 1YJWT 3CMEQ 1I4K1 1JXMA 4J9HA 2FB7A 1DJ7B 4GBQA 1NPRA 4J7FA 1LCKA 3H8ZA 4PJOE 4MZMA 2H3EB 4E7ZA 3ME9A 4MMKA 3OYKA 4C8QG 4DOVA 4OMMA 1WHMA 3GF5A 1BB9A 5CO7A 4E7KA 1TSFA 1Q7YU 5IHKA 4AG1C 1K0XA 1N9RA 1W70A 2ZPBB 2QDYB 1YJWQ 4O6JA 3MPUB 1VQ8Q 4PJOF 2L2PA 3OY9A 1KC8R 2C0IA 3HHTB 2QYZA 4N0AC 3TU4K 1VQ7T 3OYMA 3L2RA 3G71T 5IAYA 1K8AC 3OSSC 4J6YA 5LL6S 2GNCA 4XAXB 3CXCA 3CD6Q 2E5KA 1IZ6A 3CC4Q 1KJWA 3PIPA 1NM7A 2PNIA 5GJVB 2MOXA 2DXCA 1BI2A 3EGXB 2ROTA 1WJRA 1ZUKA 4FM4B 1Q82C 1X01A 2R57A 1RAGB 1SEMA 1SSFA 2K57A 1X6BA 4TVRA 3S3NA 3HFOA 2O4XB 3VS1A 4F7UG 2R5MA 3NTHA 3O5ZA 3SEMA 3ZL7C 4BI4A 4QQDA 3OMGA 1MMAA 4M7DA 4DA4A 3QKJA 2O4XA 4OMFB 2QDLA 2FZCB 3CCET 4A4KA 3C95A 2DFUA 2RK2A 3KFVA 1OOTA 4DBRA 1VQ4T 3G6ET 1HK9A 2DL7A 1YCYA 4PLIA 4HCZA 1NEGA 2EVRA 2VGMA 4BACA 2ZPFB 2YDLA 2JS2A 2DJQA 2A36A 2MWPA 4XQ3A 1JXOA 1RI0A 1AZEA 1SF9A 2J7IA 3V7SA 1VQOQ 2KBTA 3OS1A 3G6EQ 2DD5A 4Y91A 3UATA 3OYNA 1OU9A 5AT1B 3OYYA 2FRYA 2MF2A 2O01E 1KG1A 1FWZA 1WI7A 2O9VA 1OYXA 2KT8A 2V8IA 2E12A 1ZLMA 1X43A 3NMZC 1H8KA 3RUXA 5KYWB 1K9AA 3A8LB 1VQ6A 3RBBB 1NBEB 2HEQA 1MHNA 5GMKe 3CC7A 5EC7A 3SDZA 2CZ0B 3META 2GFAA 2FRWA 1JRIA 3X20B 1Q7YC 3CCJT 4M78C 4OMOA 2JZ2A 4J83A 5LJ5j 2YLCA 4C8QD 1ABOA 2YWWA 4L59A 3C94A 3N5BB 4J6XA 1RI9A 2ECZA 4FT2A 3NGPA 3H6ZA 2AIRB 5J39A 3CC4T 1AWOA 1M30A 5J3BA 4B9XA 4DBHA 1YI2A 3DLMA 4QT7A 4M78D 3Q1JA 3OS0A 5IT9E 2F2XA 2DLPA 5FLXE 2LQ8A 4JUVA 5I2SA 1KQSP 1VYVA 3A8HB 3EG9B 1VQ4Q 4IIOA 4C5EA 4FU6A 2ABLA 3I9QA 4BI8B 5KCHA 1NZ9A 3CCEQ 3VYHB 2YRVA 4PJOD 2YXYA 4JRIA 4M75G 4CRIA 4LD9K 2QASA 1OPKA 4M75F 2VASA 2XMFA 2MK5A 5KE3A 1WHLA 3JB9F 1OX9A 1WFWA 3CBOA 2CH4A 4KH0B 3JB9G 3EHQA 5CCAA 4ATOA 4FSXA 5DLOA 2JTFA 4IUVA 2AHJB 2AZSA 2RQWA 3CXCS 1UGPB 2DF6A 1MNEA 4Z8AA 1QW1A 3P8DA 3CCMA 3CD6T 4WF2A 1WQ7A 2CP5A 3CMAA 3OYHA 3SWNC 2K5FA 5D6WA 3NFCA 1VQ7Q 3HSBA 3RKWA 1ZSGA 4IUUA 2DD4A 4HVWA 1N6AA 5EG2A 1NJIC 2P4TA 1IHWA 2PVDB 2JMAA 2DK3A 2CP0A 1D09B 4WCIA 2RB6A 4AFQC 6AT1B 2K4YA 2FVUA 4X9DA 4Y92A 2M02A 2CGHA 3VV0A 4JPBW 3CCSA 5GANf 2C06A 1BKBA 2DAQA 4M75C 1UG1A 4IUPA 5GAOl 3FDRA 4L5GA 1K76A 2RQUA 4OB3B 4FW1A 1YJNT 1K9MU 3BDLA 3NPFA 2XIDA 1KFZA 1G2BA 1BIAA 5LJ3j 5FRMA 1TUDA 1SHGA 4HT8A 4E47A 2X51A 2OTLT 1JU5C 4ZGEB 3M0TA 1OU8A 3CCUQ 5FW9A 3VS7A 3CPWS 4HCKA 1YN8A 2V1QA 3JCMJ 4E7IA 2OTJQ 5IXFA 1RACB 3PVLA 2LJ0A 1QKXA 4LDUA 3AT1B 4XU1A 1WHHA 4EMGA 2R5AA 3HFNA 2KRNA 1FX7A 1QP2A 4BDZA 3GNGA 4L6V5 4RCBA 3VUBA 1R0CB 4C92C 3THKA 2K3YA 1VQMA 3M56A 2F69A 1BI1A 4A54A 1YCSB 4J6WA 2RK1A 1QVGP 2V26A 2PU9B 1AWXA 3VS0A 4RTXA 4P5NA 1RLPC 2RJDA 3QJ6A 1NJIU 1LVKA 1JQQA 3MP8A 5GANj 5I22A 2DX1A 2EJGA 1M5Q1 2CSQA 2DKGA 3V7CA 2EYZA 1VQ9Q 1Y0MA 2NUPB 1X2KA 2V1RA 4LDVA 2DM1A 2O31A 5HKCA 3VU3C 1ARKA 2SRCA 2AZVA 3JCMW 2WSFE 3OYAA 2EGAA 3LX7A 1RAFB 2D9TA 2LTOA 3A98A 2MWOA 3M0SA 2V8KA 3CBPA 3LH0A 4ZGDB 3HL8A 1VQLT 1IREB 1QVFA 2K5IA 2LQWA 3PFSA 2XICA 1HJDA 3OYJA 1W2BP 1VYUA 2KVQG 4F14A 2DL4A 2J6FA 3FB9A 3OYDA 1JO8A 2D8HA 4M75A 5M9OA 3CC2A 4J9GA 1OX8A 1I8FA 1AOJA 3NTKA 2R58A 4PJJA 4ELYC 2DMOA 1WHJA 1XTDA 2BTTA 1P92A 5GAMf 2JM8A 1E7OA 3TCJA 1EIFA 4MMLA 3CC7Q 3M55A 2IIMA 3RMSA 3VS2A 1VQLA 1YIJT 2IG0A 3VYGA 2OAUA 3P8BB 4ESRA 1PRMC 4LXCA 5GAN5 1PWTA 3CCQQ 2LMJA 3FJ5A 1NPPA 4N0AA 3FJPA 5L8RE 3UWNA 4C92G 4E6RA 4II1A 2ZPHB 3JCMQ 2COZA 4C8QB 2QGGA 4C0ZA 9ATCB 2YRDA 1WHKA 2GCXA 2KDSA 1VQNQ 4OF1A 1MGQA 3CCEA 1C0MA 1YIJA 2FPDA 5LJ3g 2E4HA 2P84A 4C92D 2DVJA 1YJ9A 4PNOA 1FMWA 2M0OA 3RDVA 1YITA 4KUIA 3CPWA 3CCRA 5C0MA 1IB8A 3QSUA 3A1PA 1KHCA 3FRNA 1WXTA 3VUZA 2DXBA 1LJOA 4A4FA 1OZ3A 1UGSB 4ZN1A 1W2BA 1UFFA 4JRQA 1H641 2AT1B 3S3OA 2OTJA 8AT1B 2PZ1A 1BCMA 1AVZC 1CKAA 5GAN2 4PJMA 5FU6C 1V1CA 2EQIA 2KYBA 2LQNA 4BD3A 1TS9A 2DNUA 3EFSA 3DB3A 4J9IA 1YIJQ 1SKUB 4JJDA 1U06A 2OI3A 2DETA 5KYUB 1WJQA 2EJ9A 1GFDA 1EZZB 2VVKA 4PK4A 3MO8A 5IN1A 1WZOA 4F04B 2DYIA 3BDUA 3UDCA 3CQTA 2QTXA 4OGEA 4LDWA 2YT6A 1G3SA 1Y57A 3HRTA 4JZ3A 1PG5B 2GTJA 2LCSA 1VQ9A 1VIFA 3VJPA 4XTVA 1YBYA 2CYZB 2K3BA 4Z89A 1QVFS 1ZX6A 3NHNA 1OQKA 3QZ5B 5FWCA 4C8QE 4DQ2A 1M90C 2HD0A 4M75D 4M7AE 4V2SA 3E19A 1VQOT 3QWYA 3E9GA 4BE1A 3GIBA 5GMKi 3CCVQ 4LDYA 4MZTA 2LNVA 2X4JA 3SB2A 2MCNA 1JJ2P 2LJ3A 3OYFA 3INZA 3OW2P 1BIBA 5HK0A 1ZA2B 3G4SQ 3EG9A 1YP5A 4KGXB 2FHDA 2P0PA 3PMIA 1Q82U 2EFIA 2O9SA 1OI1A 2E6NA 4EMKA 2QA4A 4QVCA 1MV3A 1FYNA 5GANe 2AKKA 1WA7A 3L2VA 3OMCA 7AT1B 2BZXA 3MCAB 4AFUC 2DZCA 4M7DF 1Z9QA 1VQPA 2LX9A 3MP6A 4EMKC 1K73U 3M9QA 1UHFA 1UGVA 2XD0A 4A63B 4IKFA 1NEBA 3V8KA 2OJ2A 5GAN4 5CKFA 1PD1A 4C0GA 2RHXA 3OSVA 5FRNA 4JLGA 2LNHB 1LPLA 2EPDA 5CIUA 2QQBA 2EGCA 2VXFA 3CCQA 1YJWA 4XTYA 3M0UA 1IXDA 1NE8A 4RG2A 4J9EA 1OV3A 3L2ZA 4GLKA 4C0DB 3TSZA 1WXBA 2VV5A 3CCUT 2ZAEA 1N9SA 3G1JA 1M27C 1UTIA 4RTYA 1HXDA 2ZGWA 4F7UA 1KD1C 4FYXB 4VUBA 2E6ZA 3CBMA 2G6FX 1VUBA 3E9FA 1YHQA 1MNDA 3I56A 3H9NA 3JCMV 5GAOr 2EW3A 1KD1R 4HVUA 1YJNQ 4M7AB 3X28B 4JDSA 1VQ6T 1JBMA 1M8VA 2QQSA 2ENMA 1ZUUA 2WACA 1M9SA 3CCLT 2XHCA 2JMCA 4F7UF 4F17A 1PNJA 3U23A 2E1HA 2XDBA 3REAB 4RTVA 4BY6B 1R77A 1WPYA 2OX7A 5I11A 3KUFA 4MDWA 2MYSA 4AMCA 5GAN6 2BE9B 3QJYA 4C0DC 2DTHA 2L3QA 4J8OA 2QQRA 4C92E 3R6OA 2RH2A 4EIKA 2F2WA 3C0CA 1O75A 2CKKA 3VS5A 4FYYB 1M4ZA 2HL5C 4CC3A 4PFZA 4JS4A 4CI0C 1TWBA 1YI2T 3MEUA 3ZBDA 1VQNA 1FMKA 1JEGA 4AFZC 4M7DB 4M77D 2KAFA 3H0HA 1M90R 3H41A 2PUKB 1VQ5T 3E2UA 1RAAB 4XU0A 1B3QA 1SSHA 1A0NB 3WVEB 3I55T 1YWOA 4M7DG 3TQ7P 2QQ9A 3C12A 3HP9A 2QA4T 1W1FA 2ATCB 5GAMh 5GAOn 1UDLA 4C5IA 4LDXA 4OP0A 2JJ9A 2MPXC 1XJWB 4FSSA 4ME7A 1B34A 4M77C 2YSQA 1QLYA 3H0IA 1AZGB 2RHIA 3VS6A 2EQJA 1ZBXA 3UT1A 4HCCA 3UPUA 3GPLA 2H3JA 4IIMA 2YUNA 4ZTJA 2A37A 2EAYA 4PFPA 2HMAA 5GMKl 3DKMA 2J06A 4JJBA 4FT4A 2GGRA 3OYEA 2RHUA 3JCMP 2DVEA
chains in the Genus database with same CATH topology
5HCKA 1JQQA 5ECAA 1S1NA 3PE0A 2FPEA 1YNZA 2O88A 5I22A 2C0TA 2DX1A 1E6HA 2CSQA 2EYZA 2DL8A 1Y0MA 2M0YA 2RQTA 4J9CA 2D1XA 1X2KA 2V1RA 4HXJA 2DM1A 2O31A 4LE9A 1ARKA 2SRCA 2AZVA 2EBPA 2EGAA 1HSQA 4LNPA 4AG2C 2LJ1A 1E6GA 2EYYA 1SPKA 2AK5A 5IHNA 3A98A 3M0SA 1UHCA 3VS4A 1AD5A 2M51A 4CC2A 2LQWA 2RF0A 3QWXX 4DEYA 1HJDA 3JV3A 3PVQA 2K6DA 1BK2A 1VYUA 2AKLA 4K11A 1GL5A 2RNAA 2X3XD 4LN2A 2KRSA 4F14A 1G83A 2ED1A 2DL4A 2J6FA 1OPLA 2RN8A 3UA6A 1JO8A 2HDAA 2LZ6B 2D8HA 2D0NA 3M0QA 4J9GA 1AOJA 3M0RA 1B07A 4RTTA 2DMOA 2K7AA 2BTTA 2VKNA 1RLQC 1J3TA 2JM8A 1U5SA 2X3WD 1E7OA 3EG3A 3EG0A 1GCPA 2IIMA 2KXCA 3VS2A 2CDTA 3GBQA 1EFNA 1JXMA 4J9HA 3EG1A 4GBQA 3RNJA 4J9DA 4ORZA 4ESRA 1LCKA 5IHIA 1PRMC 1U3OA 1SHFA 1PWTA 1AWJA 4OMMA 2LMJA 3FJ5A 1BB9A 2CUDA 2CSIA 2YUQA 5IHKA 1RUWA 1K4US 4AG1C 1T0JA 4E6RA 1K0XA 2DBKA 1W70A 1QWFA 2JXBA 2JTEA 2RPNA 3EG2A 4J9FA 2L2PA 1NG2A 2C0IA 2RMOA 2FPDA 1BBZA 2DVJA 2DL5A 3UA7A 2GNCA 4M4ZA 2J6KA 2ESWA 3REBB 2A28A 1NYGA 2GQIA 2E5KA 4RTUA 1KJWA 2KRMA 1NM7A 2PNIA 4HVVA 5GJVB 2DRMA 2MOXA 2K2MA 1WXTA 2NWMA 2ROTA 2C0OA 1ZUKA 1K0SA 2HBWA 1TUCA 1WDXA 4X1VA 3M0PA 5IXBA 1H92A 1SEMA 4D8DA 1UFFA 1X6BA 2K79A 3VS1A 1M3AA 2PZ1A 1AVZC 3VS3A 3O5ZA 3SEMA 2KROA 1CKAA 1WLPB 2CUBA 3ZL7C 4KRTA 1V1CA 2FPFA 2EQIA 2QDLA 2LQNA 2KYBA 1TG0A 2BZYA 4RTWA 2DNUA 2KR3A 3TVTA 4J9IA 1X6GA 3KFVA 1OOTA 4OMLA 2CH4W 4JJDA 1U06A 3IQLA 2DL7A 2OI3A 1ABQA 1GFDA 1PKTA 1NEGA 2EVRA 2J6OA 2VVKA 4LUEA 2NUZA 1WXUA 3CQTA 2YDLA 2JS2A 2DJQA 2A36A 1T0HA 2YT6A 1JXOA 1N5ZA 1AZEA 2J7IA 1Y57A 2RQRA 1UECA 4JZ3A 1GCQC 2GTJA 2KBTA 2LCSA 2SEMA 3UATA 2EYWA 2K3BA 2FRYA 4Z89A 1WI7A 1ZX6A 3NHNA 5FWCA 2K9GA 2O9VA 1M3CA 4F16A 3EGUA 2KT8A 2CT3A 1ZLMA 1X43A 3QWYA 3NMZC 1H8KA 2GBQA 1AWWA 1K9AA 3UF4A 3I35A 3RBBB 2HEQA 5IH2A 2MCNA 2EKHA 2LJ3A 1I07A 5EC7A 4DEXA 1M8MA 2DBMA 2FRWA 1MUZA 1KIKA 1YP5A 2CREA 2W0ZA 4OMOA 4J9BA 1ABOA 2O9SA 2FG0A 2B86A 1RI9A 2ECZA 3NGPA 1MV3A 1FYNA 1AWOA 2AKKA 2VWFA 1M30A 1WA7A 1M3BA 1XOVA 2JW4A 1ZUYA 4AFSC 2BZXA 2EGEA 4AFUC 2L3SA 5L23A 2A08A 4QT7A 2J05A 1Z9QA 3VRYA 4LUDA 2F2XA 2DLPA 4JZ4A 1HD3A 1VYVA 1UHFA 1UGVA 4IIOA 2HCKA 4A63B 1NEBA 2DL3A 2PTKA 3R6NA 2OJ2A 2ABLA 3I9QA 1NYFA 4CC7A 2DA9A 5FWBA 2LNHB 1X27A 2EPDA 2KYMA 2EGCA 1OPKA 2P4RA 1Z9ZA 1SRLA 2XMFA 1VA7A 3M0UA 1QWEA 1WFWA 1X2QA 2CH4A 1QCFA 4J9EA 1OV3A 1QKWA 4Z88A 3EHQA 2YUPA 3TSZA 1WXBA 2DRKA 2KEAA 2I0NA 2DYBA 2JT4A 4OMNA 1M27C 2KGTA 3SHWA 2H8HA 1UTIA 4RTYA 2AZSA 2JM9A 2L0AA 2MIOA 2RQWA 4R0KA 2DF6A 1ZBJA 1GBQA 4Z8AA 3VRZA 2G6FX 4RUGA 1VYTA 2EW3A 1W6XA 4HVUA 2ED0A 4ZNXA 1X69A 2ENMA 1ZUUA 4D8KA 1H3HA 2JMCA 1ZSGA 1AEYA 3LH5A 4HVWA 1GCQA 1IO6A 2CT4A 4F17A 1PNJA 3U23A 1T3SA 3REAB 4RTVA 2JMAA 1WYXA 2W10A 3I5SA 4WCIA 5I11A 4AFQC 2JS0A 1I1JA 1NLOC 2KNBB 1UUEA 4Y92A 1OEBA 2O2OA 2L3QA 4JPBW 1KSWA 2DE0X 1UJYA 1UG1A 2EYXA 4EIKA 2F2WA 3C0CA 1CKBA 1YWPA 3VS5A 1K76A 2KXDA 4CC3A 2RQUA 3NPFA 1PKSA 1FMKA 1JEGA 1KFZA 1G2BA 4AFZC 3H0HA 1NLPC 1T3LA 3H41A 1TUDA 1SHGA 3ULRB 1K1ZA 2ROLA 3TSWA 1JU5C 2LP5A 3M0TA 1B3QA 4GLMA 1UE9A 1SSHA 4OMQA 5GJWB 1CSKA 1MV0B 1A0NB 5FW9A 1YWOA 3VS7A 3H0FA 4CC4B 4HCKA 1YN8A 1W1FA 2V1QA 1BU1A 2L3PA 1PRLC 1UDLA 2F2VA 2YUOA 4FSSA 1GFCA 2FEIA 5IXFA 2YSQA 3PVLA 1QLYA 2LJ0A 2RQVA 1AZGB 3H0IA 1QKXA 3VS6A 1WX6A 2BZ8A 1SRMA 4RTZA 1PHTA 2KE9A 4JJCA 2KRNA 2FO0A 4OMPA 2D8JA 1WIEA 4IIMA 2HSPA 2YUNA 2DILA 3THKA 2A37A 2LX7A 1I0CA 3EHRA 1UJ0A 2J06A 2OAWA 4JJBA 1GRIA 2GGRA 2GTOA 1YCSB 3I5RA 2KT1A 1GBRA 1AWXA 3VS0A 4RTXA 1RLPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCK A;  1JQQ A;  5ECA A;  1S1N A;  3PE0 A;  2FPE A;  1YNZ A;  2O88 A;  5I22 A;  2C0T A;  2DX1 A;  1E6H A;  2CSQ A;  2EYZ A;  2DL8 A;  1Y0M A;  2M0Y A;  2RQT A;  4J9C A;  2D1X A;  1X2K A;  2V1R A;  4HXJ A;  2DM1 A;  2O31 A;  4LE9 A;  1ARK A;  2SRC A;  2AZV A;  2EBP A;  2EGA A;  1HSQ A;  4LNP A;  4AG2 C;  2LJ1 A;  1E6G A;  2EYY A;  1SPK A;  2AK5 A;  5IHN A;  3A98 A;  3M0S A;  1UHC A;  3VS4 A;  1AD5 A;  2M51 A;  4CC2 A;  2LQW A;  2RF0 A;  3QWX X;  4DEY A;  1HJD A;  3JV3 A;  3PVQ A;  2K6D A;  1BK2 A;  1VYU A;  2AKL A;  4K11 A;  1GL5 A;  2RNA A;  2X3X D;  4LN2 A;  2KRS A;  4F14 A;  1G83 A;  2ED1 A;  2DL4 A;  2J6F A;  1OPL A;  2RN8 A;  3UA6 A;  1JO8 A;  2HDA A;  2LZ6 B;  2D8H A;  2D0N A;  3M0Q A;  4J9G A;  1AOJ A;  3M0R A;  1B07 A;  4RTT A;  2DMO A;  2K7A A;  2BTT A;  2VKN A;  1RLQ C;  1J3T A;  2JM8 A;  1U5S A;  2X3W D;  1E7O A;  3EG3 A;  3EG0 A;  1GCP A;  2IIM A;  2KXC A;  3VS2 A;  2CDT A;  3GBQ A;  1EFN A;  1JXM A;  4J9H A;  3EG1 A;  4GBQ A;  3RNJ A;  4J9D A;  4ORZ A;  4ESR A;  1LCK A;  5IHI A;  1PRM C;  1U3O A;  1SHF A;  1PWT A;  1AWJ A;  4OMM A;  2LMJ A;  3FJ5 A;  1BB9 A;  2CUD A;  2CSI A;  2YUQ A;  5IHK A;  1RUW A;  1K4U S;  4AG1 C;  1T0J A;  4E6R A;  1K0X A;  2DBK A;  1W70 A;  1QWF A;  2JXB A;  2JTE A;  2RPN A;  3EG2 A;  4J9F A;  2L2P A;  1NG2 A;  2C0I A;  2RMO A;  2FPD A;  1BBZ A;  2DVJ A;  2DL5 A;  3UA7 A;  2GNC A;  4M4Z A;  2J6K A;  2ESW A;  3REB B;  2A28 A;  1NYG A;  2GQI A;  2E5K A;  4RTU A;  1KJW A;  2KRM A;  1NM7 A;  2PNI A;  4HVV A;  5GJV B;  2DRM A;  2MOX A;  2K2M A;  1WXT A;  2NWM A;  2ROT A;  2C0O A;  1ZUK A;  1K0S A;  2HBW A;  1TUC A;  1WDX A;  4X1V A;  3M0P A;  5IXB A;  1H92 A;  1SEM A;  4D8D A;  1UFF A;  1X6B A;  2K79 A;  3VS1 A;  1M3A A;  2PZ1 A;  1AVZ C;  3VS3 A;  3O5Z A;  3SEM A;  2KRO A;  1CKA A;  1WLP B;  2CUB A;  3ZL7 C;  4KRT A;  1V1C A;  2FPF A;  2EQI A;  2QDL A;  2LQN A;  2KYB A;  1TG0 A;  2BZY A;  4RTW A;  2DNU A;  2KR3 A;  3TVT A;  4J9I A;  1X6G A;  3KFV A;  1OOT A;  4OML A;  2CH4 W;  4JJD A;  1U06 A;  3IQL A;  2DL7 A;  2OI3 A;  1ABQ A;  1GFD A;  1PKT A;  1NEG A;  2EVR A;  2J6O A;  2VVK A;  4LUE A;  2NUZ A;  1WXU A;  3CQT A;  2YDL A;  2JS2 A;  2DJQ A;  2A36 A;  1T0H A;  2YT6 A;  1JXO A;  1N5Z A;  1AZE A;  2J7I A;  1Y57 A;  2RQR A;  1UEC A;  4JZ3 A;  1GCQ C;  2GTJ A;  2KBT A;  2LCS A;  2SEM A;  3UAT A;  2EYW A;  2K3B A;  2FRY A;  4Z89 A;  1WI7 A;  1ZX6 A;  3NHN A;  5FWC A;  2K9G A;  2O9V A;  1M3C A;  4F16 A;  3EGU A;  2KT8 A;  2CT3 A;  1ZLM A;  1X43 A;  3QWY A;  3NMZ C;  1H8K A;  2GBQ A;  1AWW A;  1K9A A;  3UF4 A;  3I35 A;  3RBB B;  2HEQ A;  5IH2 A;  2MCN A;  2EKH A;  2LJ3 A;  1I07 A;  5EC7 A;  4DEX A;  1M8M A;  2DBM A;  2FRW A;  1MUZ A;  1KIK A;  1YP5 A;  2CRE A;  2W0Z A;  4OMO A;  4J9B A;  1ABO A;  2O9S A;  2FG0 A;  2B86 A;  1RI9 A;  2ECZ A;  3NGP A;  1MV3 A;  1FYN A;  1AWO A;  2AKK A;  2VWF A;  1M30 A;  1WA7 A;  1M3B A;  1XOV A;  2JW4 A;  1ZUY A;  4AFS C;  2BZX A;  2EGE A;  4AFU C;  2L3S A;  5L23 A;  2A08 A;  4QT7 A;  2J05 A;  1Z9Q A;  3VRY A;  4LUD A;  2F2X A;  2DLP A;  4JZ4 A;  1HD3 A;  1VYV A;  1UHF A;  1UGV A;  4IIO A;  2HCK A;  4A63 B;  1NEB A;  2DL3 A;  2PTK A;  3R6N A;  2OJ2 A;  2ABL A;  3I9Q A;  1NYF A;  4CC7 A;  2DA9 A;  5FWB A;  2LNH B;  1X27 A;  2EPD A;  2KYM A;  2EGC A;  1OPK A;  2P4R A;  1Z9Z A;  1SRL A;  2XMF A;  1VA7 A;  3M0U A;  1QWE A;  1WFW A;  1X2Q A;  2CH4 A;  1QCF A;  4J9E A;  1OV3 A;  1QKW A;  4Z88 A;  3EHQ A;  2YUP A;  3TSZ A;  1WXB A;  2DRK A;  2KEA A;  2I0N A;  2DYB A;  2JT4 A;  4OMN A;  1M27 C;  2KGT A;  3SHW A;  2H8H A;  1UTI A;  4RTY A;  2AZS A;  2JM9 A;  2L0A A;  2MIO A;  2RQW A;  4R0K A;  2DF6 A;  1ZBJ A;  1GBQ A;  4Z8A A;  3VRZ A;  2G6F X;  4RUG A;  1VYT A;  2EW3 A;  1W6X A;  4HVU A;  2ED0 A;  4ZNX A;  1X69 A;  2ENM A;  1ZUU A;  4D8K A;  1H3H A;  2JMC A;  1ZSG A;  1AEY A;  3LH5 A;  4HVW A;  1GCQ A;  1IO6 A;  2CT4 A;  4F17 A;  1PNJ A;  3U23 A;  1T3S A;  3REA B;  4RTV A;  2JMA A;  1WYX A;  2W10 A;  3I5S A;  4WCI A;  5I11 A;  4AFQ C;  2JS0 A;  1I1J A;  1NLO C;  2KNB B;  1UUE A;  4Y92 A;  1OEB A;  2O2O A;  2L3Q A;  4JPB W;  1KSW A;  2DE0 X;  1UJY A;  1UG1 A;  2EYX A;  4EIK A;  2F2W A;  3C0C A;  1CKB A;  1YWP A;  3VS5 A;  1K76 A;  2KXD A;  4CC3 A;  2RQU A;  3NPF A;  1PKS A;  1FMK A;  1JEG A;  1KFZ A;  1G2B A;  4AFZ C;  3H0H A;  1NLP C;  1T3L A;  3H41 A;  1TUD A;  1SHG A;  3ULR B;  1K1Z A;  2ROL A;  3TSW A;  1JU5 C;  2LP5 A;  3M0T A;  1B3Q A;  4GLM A;  1UE9 A;  1SSH A;  4OMQ A;  5GJW B;  1CSK A;  1MV0 B;  1A0N B;  5FW9 A;  1YWO A;  3VS7 A;  3H0F A;  4CC4 B;  4HCK A;  1YN8 A;  1W1F A;  2V1Q A;  1BU1 A;  2L3P A;  1PRL C;  1UDL A;  2F2V A;  2YUO A;  4FSS A;  1GFC A;  2FEI A;  5IXF A;  2YSQ A;  3PVL A;  1QLY A;  2LJ0 A;  2RQV A;  1AZG B;  3H0I A;  1QKX A;  3VS6 A;  1WX6 A;  2BZ8 A;  1SRM A;  4RTZ A;  1PHT A;  2KE9 A;  4JJC A;  2KRN A;  2FO0 A;  4OMP A;  2D8J A;  1WIE A;  4IIM A;  2HSP A;  2YUN A;  2DIL A;  3THK A;  2A37 A;  2LX7 A;  1I0C A;  3EHR A;  1UJ0 A;  2J06 A;  2OAW A;  4JJB A;  1GRI A;  2GGR A;  2GTO A;  1YCS B;  3I5R A;  2KT1 A;  1GBR A;  1AWX A;  3VS0 A;  4RTX A;  1RLP C; 
#chains in the Genus database with same CATH topology
 2JN0 A;  1RAB B;  1YNZ A;  2C0T A;  4M78 A;  3G6E A;  2RQT A;  4J9C A;  1Y71 A;  2D1X A;  3SD4 A;  4LE9 A;  2A7Y A;  3CEY A;  4BUG A;  2HQE A;  4C92 B;  1K8A R;  3HRS A;  5IHN A;  3VS4 A;  1AD5 A;  3LWH A;  5KCO A;  4KGZ B;  3QWX X;  2D6F A;  1OZ2 A;  1KQS A;  4XTX A;  2XU8 A;  1GL5 A;  2RNA A;  3PTA A;  4DBF A;  3EH2 A;  3J81 E;  1S72 A;  5AYF A;  4PKC C;  3CMA T;  3JCM h;  2WSE E;  5FU7 C;  3EH1 A;  3M0R A;  1Y7X A;  3M57 A;  1W2B S;  5LJ5 d;  2QEX A;  3CCV A;  2NUT B;  2VKN A;  1RLQ C;  2YRC A;  3OBW A;  1Q81 R;  1VQK Q;  3JCM g;  3EG3 A;  2NLU A;  3EAE A;  1GCP A;  2CDT A;  4R55 A;  1R8O B;  3E1S A;  4ZGJ B;  3EG1 A;  3F70 A;  3J80 E;  2RJC A;  5KYY B;  3CCS Q;  4ZN3 A;  5LJ3 e;  1G3Y A;  2Y90 A;  2FZK B;  5IHI A;  3JB9 I;  1U3O A;  1VQP Q;  4XTU A;  3GNF B;  1Q86 R;  3PMT A;  1SHF A;  3WXM B;  1Q95 G;  2NUP A;  2HL3 A;  5LJ3 f;  5DLQ E;  1G8X A;  3PIO A;  3T9N A;  4C8Q F;  3GLX A;  4E7L A;  2LT1 A;  3EFR A;  2QAZ A;  2CSI A;  2YUQ A;  1K4U S;  2CZ6 B;  3CCS T;  2DBK A;  1D0Z A;  4Z02 A;  1QWF A;  2GFU A;  3OQ5 A;  2JXB A;  2JTE A;  3EG2 A;  1VQL Q;  1S72 Q;  3QZ9 B;  1QMC A;  3QO3 A;  4C5H A;  1X75 C;  1Y96 B;  2DIQ A;  5GAN g;  3CMA Q;  3UA7 A;  1N8R C;  4XTW A;  2RI5 A;  2J6K A;  4M7D D;  2ESW A;  2A28 A;  3OB9 A;  4BY6 C;  1RL2 A;  1NYG A;  2GQI A;  4RTU A;  5CKB A;  2NUT A;  2KRM A;  1K9M C;  2CZ1 B;  2DRM A;  3FLG A;  2K2M A;  1VQO A;  1IGQ A;  3SWN A;  4KUL A;  5CVI A;  2QXF A;  4QVD A;  1TUC A;  1WDX A;  2EQK A;  5GAM d;  2CP3 A;  2HBP A;  4RKU E;  5GAM e;  3ER0 A;  1YJ9 T;  2EYQ A;  1V29 B;  2DIG A;  2JOY A;  5KYX B;  4AT1 B;  2KRO A;  2D0Q B;  4KRT A;  3QUI A;  4NS5 A;  4JS5 A;  2CP7 A;  2KK4 A;  2EKO A;  1IRX A;  1BI0 A;  2FPF A;  3PNW C;  1MMG A;  1B34 B;  1TXQ A;  2E10 A;  3QG1 A;  2KR3 A;  1X6G A;  1VOM A;  3O8V A;  4OML A;  4MDX A;  2CH4 W;  4M77 E;  3IQL A;  3JAM E;  3C4S A;  1ABQ A;  4M7A D;  1G3T A;  1ZSZ C;  3OW2 A;  3CXC P;  2J6O A;  4IUQ A;  3JCM f;  2E41 A;  4LUE A;  2NUZ A;  4M77 F;  1WXU A;  2Y4Y A;  3G71 Q;  4YTL A;  1N8R R;  1M1K U;  2XK0 A;  1D1A A;  1N5Z A;  1RAI B;  4PFO A;  3MP1 A;  1UEC A;  2F5T X;  5DY9 A;  2LCL A;  4PJO C;  2QEX Q;  2HZY A;  2HQH A;  2EYW A;  3OW2 S;  1KC8 C;  1UEB A;  4JLI A;  5CAI A;  1Q81 U;  3EGU A;  3CCL A;  2CP6 A;  1UGR B;  2RA2 A;  3KBG A;  2PVG B;  3I35 A;  4E2F B;  4QW2 A;  1VQM T;  3V8L A;  1I07 A;  1KIK A;  2RHZ A;  2CRE A;  3I55 A;  1QP3 A;  3WVD B;  3OS5 A;  3CME T;  3HTR A;  2BKD N;  4BE2 A;  3LLR A;  2FG0 A;  1RAD B;  1Q7Y R;  3GP8 A;  3RER A;  2DPP B;  3KXT A;  1IHV A;  2JW4 A;  1M3B A;  2IVW A;  3G71 A;  1B7T A;  4JRK A;  2EGE A;  4E7S A;  2L3S A;  2J05 A;  4RMO A;  1OUL A;  4LUD A;  4OGC A;  4ZTF A;  4ANJ A;  3X24 B;  1F1B B;  4C92 F;  2XKO C;  4QQG A;  4M7D C;  2Y4X A;  2MI6 A;  2MAM A;  1YJN A;  3PT9 A;  2HQX A;  1QQJ A;  5LJ3 d;  1X27 A;  5GAN h;  2KYM A;  1Z9Z A;  1SRL A;  1X2Q A;  1RAH B;  1QCF A;  3V8J A;  1K8A U;  2E5Q A;  4X9C A;  2DYB A;  2JT4 A;  2KGT A;  3SHW A;  2G3R A;  2H8H A;  3CC2 T;  3X25 B;  2JM9 A;  2L0A A;  2HNI A;  3LGL A;  2FZG B;  1QVG S;  1ZBJ A;  1GXI E;  1GBQ A;  4RUG A;  1VQK T;  2LT4 A;  5D6Y A;  4ZNX A;  4M77 G;  4J5Y A;  2L5Q A;  4PJO G;  3A8G B;  3URG A;  1I5L A;  2L3R A;  1ZSZ A;  3CCU A;  4Y28 E;  4D8K A;  3OA6 A;  1AEY A;  2DER A;  1GCQ A;  1IO6 A;  4M7A G;  5A2Q E;  3JB9 H;  4GY5 A;  4B9W A;  1T3S A;  2RI2 A;  2OTL A;  1WYX A;  2LVM A;  2CP2 A;  4RG8 A;  2NYS A;  3CCJ Q;  4M75 B;  1NLO C;  1YHQ Q;  2KNB B;  1OEB A;  2O2O A;  3D7S B;  1KSW A;  3QYG B;  2DE0 X;  1SG5 A;  1UJY A;  2VGN A;  1TOV A;  3M54 A;  2EYX A;  3JRZ A;  1D3B A;  1VQP T;  1YWP A;  1QVF P;  1LOJ A;  2XI9 A;  4OB0 B;  1KQ2 A;  4M7D E;  2JTM A;  3OYC A;  2CZ7 B;  3QXE B;  1KC8 U;  1NLP C;  1T3L A;  2MMP A;  2BE7 D;  1K1Z A;  2ROL A;  3TSW A;  2LP5 A;  5GAN d;  1G5V A;  4OMQ A;  5GJW B;  1M1K C;  3MEW A;  3OBY A;  4FW2 A;  3H0F A;  3CCV T;  1BU1 A;  2L3P A;  1PRL C;  4N4H A;  4WTO B;  5LJ5 h;  3OYG A;  3GOX A;  3CCM T;  4O5V A;  4KBM B;  1D0Y A;  2RQV A;  5CQX A;  3A8M B;  3JCM b;  4EPC A;  2L89 A;  4RTZ A;  5GAO q;  5GAO p;  5I2M A;  1PHT A;  1TH7 A;  2HKN A;  2HSE B;  4JJC A;  4HT9 A;  2FO0 A;  1KHI A;  2D8J A;  4OMP A;  1WIE A;  2HSP A;  4M7A F;  2DIL A;  3MKD A;  2E64 A;  1K73 R;  3VKI A;  5D7U A;  4KGV B;  1I0C A;  2LX7 A;  1UJ0 A;  3A8O B;  2OAW A;  2QTV A;  3OYL A;  3QII A;  1GRI A;  2GTO A;  2QI2 A;  3I5R A;  1Q86 C;  4HKE A;  2KT1 A;  4QKU A;  3CCR Q;  2QA4 Q;  1GBR A;  5KH6 A;  5HCK A;  1IGU A;  2COW A;  5ECA A;  3AHU A;  1S1N A;  1D3B B;  3L42 A;  3PE0 A;  1JJ2 A;  3SFM A;  2PUO B;  1VQ5 Q;  1E6H A;  4XK8 E;  4KT0 E;  4KH1 B;  2QK0 A;  2M1H A;  4FYW B;  1ZHI A;  1WNL A;  1C6V X;  4FL6 A;  4NL2 A;  2X35 A;  4PJL A;  4PJO A;  3BFM A;  4OB1 B;  4M75 E;  3EGD B;  1AT1 B;  1HSQ A;  4LNP A;  4AG2 C;  5GAN 3;  2ZPE B;  3ZFJ A;  1E6G A;  1M1G A;  4FIB A;  2AK5 A;  4C8Q A;  1UHC A;  3MEA A;  5GAM j;  3J7A F;  4E7J A;  3S6W A;  3QDF A;  1VQ8 T;  2M51 A;  3CME A;  3G4S A;  3PGG A;  3LWI A;  3CC4 A;  4F7U E;  4DEY A;  2RJF A;  5KYX A;  1Q82 R;  3PVQ A;  2P0Q A;  2K6D A;  1BK2 A;  4A4H A;  2X3X D;  4LN2 A;  2KRS A;  3X26 B;  2DTI A;  2ED1 A;  3CC7 T;  1OPL A;  1X6O A;  2HDA A;  1YFN A;  3CCJ A;  4IUT A;  8ATC B;  3I55 Q;  2VC8 A;  1YIT T;  2VYT A;  3I56 T;  4RTT A;  4B6M A;  2RM4 A;  4R56 A;  1J3T A;  3L2U A;  1M90 U;  2ZPI B;  1I81 A;  1KK7 A;  1ACM B;  3EG0 A;  4LD6 A;  1R0B G;  2KXC A;  2YHT A;  1VQ8 A;  3GBQ A;  1EFN A;  3CPW P;  2XDP A;  3RNJ A;  5GMK m;  1YI2 Q;  2P0K A;  4J9D A;  4ORZ A;  3JB9 J;  4JJN K;  1KQS S;  3V7R A;  4PJO B;  1AWJ A;  4IUR A;  2DTO A;  1JB0 E;  4UC4 A;  2CUD A;  1AHJ B;  3JSC A;  1RUW A;  2K2V A;  1WHG A;  1T0J A;  3JCM X;  1FMV A;  4N4G A;  1K73 C;  4FYV B;  4C0F A;  3JCM d;  2GQV A;  1UGQ B;  3JCM e;  2RPN A;  4J9F A;  4M7A A;  2CS7 A;  2L8D A;  5LJ3 h;  3OYI A;  4E7H A;  1NG2 A;  3ASK A;  4A53 A;  1MMN A;  4QVZ A;  2RMO A;  3RMQ A;  2BIV A;  3CCL Q;  1Q81 C;  1BBZ A;  4PLL A;  1PSE A;  4J7I A;  3RKX A;  4FCY A;  1VQ6 Q;  2DL5 A;  4M4Z A;  3REB B;  2KMT A;  3OYB A;  4RCC A;  2GF7 A;  4HVV A;  1ZSZ B;  3G7Z A;  2NWM A;  2LDM A;  4BE0 A;  2C0O A;  1K0S A;  2HBW A;  4X1V A;  3M0P A;  3TEE A;  5IXB A;  3ZEH A;  1H92 A;  4D8D A;  2A3L A;  1QVP A;  1H3Z A;  5A0L A;  1PCX A;  3G4S T;  2X9H A;  2K79 A;  5CK9 A;  1WQW A;  1M3A A;  3VS3 A;  1PC0 A;  2CUB A;  1WLP B;  1WJS A;  4HA8 A;  4ELZ C;  2X4W A;  5KYN A;  2M16 A;  4C8Q C;  5HY6 A;  1VQ7 A;  3EFO B;  2M9U A;  2DXU A;  1TG0 A;  2BZY A;  3M4Y A;  4RTW A;  4M77 B;  5GMK h;  3TRE A;  1W4S A;  3TVT A;  2LRQ A;  2HKQ B;  5D6X A;  5J26 A;  1U8R A;  2VUB A;  3JCM c;  1PKT A;  2F1L A;  3QYH B;  2FYK A;  1K9M R;  4M78 B;  3RIR A;  1YIT Q;  4PL6 A;  1M2V A;  1T0H A;  2PVO B;  1N27 A;  2RQR A;  1GCQ C;  4DBQ A;  2SEM A;  2BUD A;  2K9G A;  3L1A A;  1M3C A;  4F16 A;  1C1A A;  2CT3 A;  3M5A A;  3JB9 D;  1QVG A;  2OTJ T;  3QDR B;  5KYU A;  2GBQ A;  3SWN B;  5CKH A;  5LJ5 g;  1AWW A;  3UF4 A;  4HCB A;  3OS2 A;  5IH2 A;  1VQK A;  2EKH A;  4EDU A;  3M58 A;  4MZP A;  4DEX A;  5GAN 8;  1M8M A;  2DBM A;  1MUZ A;  2A0F B;  2EQM A;  4X34 A;  5GAN 7;  5GAO m;  2W0Z A;  4J9B A;  2RO0 A;  3A5Z B;  3QHS A;  4XTZ A;  2ZZD A;  3QPH A;  2B86 A;  3EGD A;  2ZCF B;  1QCO A;  5KYW A;  2VWF A;  3NTI A;  1XOV A;  3I56 Q;  1ZUY A;  4AFS C;  5HK3 A;  4EMK B;  4M7A C;  4N4I A;  5KYY A;  1Q86 U;  5L23 A;  2A08 A;  3VRY A;  2HAX A;  1I5O B;  4JZ4 A;  1HD3 A;  1WGS A;  1YJ9 Q;  2E65 A;  2E3H A;  2HCK A;  2DL3 A;  2PTK A;  3R6N A;  4BI3 A;  1VQN T;  1PM3 A;  1NYF A;  4CC7 A;  1V76 A;  2DJZ A;  2DA9 A;  1D1B A;  5FWB A;  2P4R A;  1NJI R;  1VA7 A;  3DB4 A;  1QWE A;  5KE2 A;  2DXT A;  3EFO A;  4XU2 A;  1QCN A;  2COY A;  1QKW A;  1U1T A;  4M78 E;  4Z88 A;  2YUP A;  2X4Y A;  2DRK A;  2KEA A;  2DZ9 A;  2I0N A;  1TTH B;  4OMN A;  4XU3 A;  5CKD A;  2MIO A;  1S72 T;  4R0K A;  2EQU A;  3CD6 A;  3VRZ A;  1VIE A;  5A0G A;  3FEO A;  1MMD A;  3BE3 A;  4M78 G;  1VYT A;  1BYM A;  1W6X A;  5FRO A;  2ED0 A;  2Z0W A;  3LYI A;  4JRP A;  2YLB A;  2KY9 A;  2RD1 A;  1FXX A;  3HRU A;  5CKE A;  3CCR T;  1X69 A;  3RES A;  3L2Q A;  1H3H A;  2JNG A;  2PQW A;  3RKY A;  3LH5 A;  2B8A A;  2CT4 A;  2RJE A;  2K3X A;  1G3W A;  2VB6 A;  1VQ5 A;  2W10 A;  3I5S A;  2JS0 A;  1I1J A;  3BW1 A;  3CCM Q;  1UUE A;  4NOY A;  5GAM g;  2ZPG B;  3CCQ T;  3LGF A;  3FIF A;  2LC4 A;  5LJ5 f;  1ZA1 B;  1CKB A;  1ZQ1 A;  4PJN A;  2KXD A;  2RI3 A;  1EX4 A;  4EMH A;  5DM7 R;  1D1C A;  3MEV A;  1M2O A;  1PKS A;  3BY7 A;  4Q5W A;  1Y96 A;  2EWN A;  3ULR B;  2X4X A;  2JVV A;  4GLM A;  1UE9 A;  1TUG B;  1CSK A;  1MV0 B;  5FU6 B;  3RR6 A;  4A4E A;  4CC4 B;  1UB4 A;  2F2V A;  3M59 A;  1BCO A;  2YUO A;  1YHQ T;  1GFC A;  2FEI A;  1WX6 A;  2BZ8 A;  1SRM A;  3L2W A;  2EIF A;  2KE9 A;  1D0X A;  1KQ1 A;  3HKS A;  2FL7 A;  3DLL A;  2I2L A;  4OVA A;  2QGF B;  3EHR A;  2K5L A;  3CPF A;  4BDY A;  2XG8 D;  3MJX A;  5LJ5 e;  3FC3 A;  4C5G A;  1PSF A;  2EJF A;  1TU0 B;  2FPE A;  2JUF A;  5CR2 A;  2F5K A;  3LW5 E;  1VQ9 T;  2O88 A;  2OTL Q;  4BB7 A;  4D6W A;  1LNX A;  2DL8 A;  2M0Y A;  4M78 F;  1VQ4 A;  1O9S A;  3CC2 Q;  2QG9 B;  4HXJ A;  1M1F A;  2VXE A;  1XNI A;  2EBP A;  1HYO A;  5C6S A;  3EGX A;  2KSS A;  2LJ1 A;  2KQW A;  1N8R U;  1VQM Q;  3P8H A;  1M1K R;  2DO3 A;  2EYY A;  1SPK A;  5GMK j;  2V8J A;  4M77 A;  4OB2 B;  4KUD K;  1KD1 U;  1M2V B;  1BI3 A;  3HPW A;  2DEU A;  4F7U B;  2RHY A;  5CQY A;  4CC2 A;  4C92 A;  2RF0 A;  4NL3 A;  3JV3 A;  2AKL A;  1JJ2 S;  3M4G A;  4K11 A;  2QEX T;  1G83 A;  5I21 A;  3M53 A;  1XQH A;  2DEQ A;  2RN8 A;  2E70 A;  5FU7 B;  3UA6 A;  4DOW A;  2QQA A;  2LZ6 B;  4A4G A;  2D0N A;  3M0Q A;  2XDD A;  1U1S A;  2IPO B;  2WSC E;  1B07 A;  5A0D A;  1PD0 A;  1Y07 A;  2LQK A;  2K7A A;  4QQ6 A;  2KI7 A;  3S3M A;  1U5S A;  2X3W D;  3QBY A;  2LCC A;  1RAE B;  2E3I A;  3MHX A;  1YJW T;  3CME Q;  1I4K 1;  1JXM A;  4J9H A;  2FB7 A;  1DJ7 B;  4GBQ A;  1NPR A;  4J7F A;  1LCK A;  3H8Z A;  4PJO E;  4MZM A;  2H3E B;  4E7Z A;  3ME9 A;  4MMK A;  3OYK A;  4C8Q G;  4DOV A;  4OMM A;  1WHM A;  3GF5 A;  1BB9 A;  5CO7 A;  4E7K A;  1TSF A;  1Q7Y U;  5IHK A;  4AG1 C;  1K0X A;  1N9R A;  1W70 A;  2ZPB B;  2QDY B;  1YJW Q;  4O6J A;  3MPU B;  1VQ8 Q;  4PJO F;  2L2P A;  3OY9 A;  1KC8 R;  2C0I A;  3HHT B;  2QYZ A;  4N0A C;  3TU4 K;  1VQ7 T;  3OYM A;  3L2R A;  3G71 T;  5IAY A;  1K8A C;  3OSS C;  4J6Y A;  5LL6 S;  2GNC A;  4XAX B;  3CXC A;  3CD6 Q;  2E5K A;  1IZ6 A;  3CC4 Q;  1KJW A;  3PIP A;  1NM7 A;  2PNI A;  5GJV B;  2MOX A;  2DXC A;  1BI2 A;  3EGX B;  2ROT A;  1WJR A;  1ZUK A;  4FM4 B;  1Q82 C;  1X01 A;  2R57 A;  1RAG B;  1SEM A;  1SSF A;  2K57 A;  1X6B A;  4TVR A;  3S3N A;  3HFO A;  2O4X B;  3VS1 A;  4F7U G;  2R5M A;  3NTH A;  3O5Z A;  3SEM A;  3ZL7 C;  4BI4 A;  4QQD A;  3OMG A;  1MMA A;  4M7D A;  4DA4 A;  3QKJ A;  2O4X A;  4OMF B;  2QDL A;  2FZC B;  3CCE T;  4A4K A;  3C95 A;  2DFU A;  2RK2 A;  3KFV A;  1OOT A;  4DBR A;  1VQ4 T;  3G6E T;  1HK9 A;  2DL7 A;  1YCY A;  4PLI A;  4HCZ A;  1NEG A;  2EVR A;  2VGM A;  4BAC A;  2ZPF B;  2YDL A;  2JS2 A;  2DJQ A;  2A36 A;  2MWP A;  4XQ3 A;  1JXO A;  1RI0 A;  1AZE A;  1SF9 A;  2J7I A;  3V7S A;  1VQO Q;  2KBT A;  3OS1 A;  3G6E Q;  2DD5 A;  4Y91 A;  3UAT A;  3OYN A;  1OU9 A;  5AT1 B;  3OYY A;  2FRY A;  2MF2 A;  2O01 E;  1KG1 A;  1FWZ A;  1WI7 A;  2O9V A;  1OYX A;  2KT8 A;  2V8I A;  2E12 A;  1ZLM A;  1X43 A;  3NMZ C;  1H8K A;  3RUX A;  5KYW B;  1K9A A;  3A8L B;  1VQ6 A;  3RBB B;  1NBE B;  2HEQ A;  1MHN A;  5GMK e;  3CC7 A;  5EC7 A;  3SDZ A;  2CZ0 B;  3MET A;  2GFA A;  2FRW A;  1JRI A;  3X20 B;  1Q7Y C;  3CCJ T;  4M78 C;  4OMO A;  2JZ2 A;  4J83 A;  5LJ5 j;  2YLC A;  4C8Q D;  1ABO A;  2YWW A;  4L59 A;  3C94 A;  3N5B B;  4J6X A;  1RI9 A;  2ECZ A;  4FT2 A;  3NGP A;  3H6Z A;  2AIR B;  5J39 A;  3CC4 T;  1AWO A;  1M30 A;  5J3B A;  4B9X A;  4DBH A;  1YI2 A;  3DLM A;  4QT7 A;  4M78 D;  3Q1J A;  3OS0 A;  5IT9 E;  2F2X A;  2DLP A;  5FLX E;  2LQ8 A;  4JUV A;  5I2S A;  1KQS P;  1VYV A;  3A8H B;  3EG9 B;  1VQ4 Q;  4IIO A;  4C5E A;  4FU6 A;  2ABL A;  3I9Q A;  4BI8 B;  5KCH A;  1NZ9 A;  3CCE Q;  3VYH B;  2YRV A;  4PJO D;  2YXY A;  4JRI A;  4M75 G;  4CRI A;  4LD9 K;  2QAS A;  1OPK A;  4M75 F;  2VAS A;  2XMF A;  2MK5 A;  5KE3 A;  1WHL A;  3JB9 F;  1OX9 A;  1WFW A;  3CBO A;  2CH4 A;  4KH0 B;  3JB9 G;  3EHQ A;  5CCA A;  4ATO A;  4FSX A;  5DLO A;  2JTF A;  4IUV A;  2AHJ B;  2AZS A;  2RQW A;  3CXC S;  1UGP B;  2DF6 A;  1MNE A;  4Z8A A;  1QW1 A;  3P8D A;  3CCM A;  3CD6 T;  4WF2 A;  1WQ7 A;  2CP5 A;  3CMA A;  3OYH A;  3SWN C;  2K5F A;  5D6W A;  3NFC A;  1VQ7 Q;  3HSB A;  3RKW A;  1ZSG A;  4IUU A;  2DD4 A;  4HVW A;  1N6A A;  5EG2 A;  1NJI C;  2P4T A;  1IHW A;  2PVD B;  2JMA A;  2DK3 A;  2CP0 A;  1D09 B;  4WCI A;  2RB6 A;  4AFQ C;  6AT1 B;  2K4Y A;  2FVU A;  4X9D A;  4Y92 A;  2M02 A;  2CGH A;  3VV0 A;  4JPB W;  3CCS A;  5GAN f;  2C06 A;  1BKB A;  2DAQ A;  4M75 C;  1UG1 A;  4IUP A;  5GAO l;  3FDR A;  4L5G A;  1K76 A;  2RQU A;  4OB3 B;  4FW1 A;  1YJN T;  1K9M U;  3BDL A;  3NPF A;  2XID A;  1KFZ A;  1G2B A;  1BIA A;  5LJ3 j;  5FRM A;  1TUD A;  1SHG A;  4HT8 A;  4E47 A;  2X51 A;  2OTL T;  1JU5 C;  4ZGE B;  3M0T A;  1OU8 A;  3CCU Q;  5FW9 A;  3VS7 A;  3CPW S;  4HCK A;  1YN8 A;  2V1Q A;  3JCM J;  4E7I A;  2OTJ Q;  5IXF A;  1RAC B;  3PVL A;  2LJ0 A;  1QKX A;  4LDU A;  3AT1 B;  4XU1 A;  1WHH A;  4EMG A;  2R5A A;  3HFN A;  2KRN A;  1FX7 A;  1QP2 A;  4BDZ A;  3GNG A;  4L6V 5;  4RCB A;  3VUB A;  1R0C B;  4C92 C;  3THK A;  2K3Y A;  1VQM A;  3M56 A;  2F69 A;  1BI1 A;  4A54 A;  1YCS B;  4J6W A;  2RK1 A;  1QVG P;  2V26 A;  2PU9 B;  1AWX A;  3VS0 A;  4RTX A;  4P5N A;  1RLP C;  2RJD A;  3QJ6 A;  1NJI U;  1LVK A;  1JQQ A;  3MP8 A;  5GAN j;  5I22 A;  2DX1 A;  2EJG A;  1M5Q 1;  2CSQ A;  2DKG A;  3V7C A;  2EYZ A;  1VQ9 Q;  1Y0M A;  2NUP B;  1X2K A;  2V1R A;  4LDV A;  2DM1 A;  2O31 A;  5HKC A;  3VU3 C;  1ARK A;  2SRC A;  2AZV A;  3JCM W;  2WSF E;  3OYA A;  2EGA A;  3LX7 A;  1RAF B;  2D9T A;  2LTO A;  3A98 A;  2MWO A;  3M0S A;  2V8K A;  3CBP A;  3LH0 A;  4ZGD B;  3HL8 A;  1VQL T;  1IRE B;  1QVF A;  2K5I A;  2LQW A;  3PFS A;  2XIC A;  1HJD A;  3OYJ A;  1W2B P;  1VYU A;  2KVQ G;  4F14 A;  2DL4 A;  2J6F A;  3FB9 A;  3OYD A;  1JO8 A;  2D8H A;  4M75 A;  5M9O A;  3CC2 A;  4J9G A;  1OX8 A;  1I8F A;  1AOJ A;  3NTK A;  2R58 A;  4PJJ A;  4ELY C;  2DMO A;  1WHJ A;  1XTD A;  2BTT A;  1P92 A;  5GAM f;  2JM8 A;  1E7O A;  3TCJ A;  1EIF A;  4MML A;  3CC7 Q;  3M55 A;  2IIM A;  3RMS A;  3VS2 A;  1VQL A;  1YIJ T;  2IG0 A;  3VYG A;  2OAU A;  3P8B B;  4ESR A;  1PRM C;  4LXC A;  5GAN 5;  1PWT A;  3CCQ Q;  2LMJ A;  3FJ5 A;  1NPP A;  4N0A A;  3FJP A;  5L8R E;  3UWN A;  4C92 G;  4E6R A;  4II1 A;  2ZPH B;  3JCM Q;  2COZ A;  4C8Q B;  2QGG A;  4C0Z A;  9ATC B;  2YRD A;  1WHK A;  2GCX A;  2KDS A;  1VQN Q;  4OF1 A;  1MGQ A;  3CCE A;  1C0M A;  1YIJ A;  2FPD A;  5LJ3 g;  2E4H A;  2P84 A;  4C92 D;  2DVJ A;  1YJ9 A;  4PNO A;  1FMW A;  2M0O A;  3RDV A;  1YIT A;  4KUI A;  3CPW A;  3CCR A;  5C0M A;  1IB8 A;  3QSU A;  3A1P A;  1KHC A;  3FRN A;  1WXT A;  3VUZ A;  2DXB A;  1LJO A;  4A4F A;  1OZ3 A;  1UGS B;  4ZN1 A;  1W2B A;  1UFF A;  4JRQ A;  1H64 1;  2AT1 B;  3S3O A;  2OTJ A;  8AT1 B;  2PZ1 A;  1BCM A;  1AVZ C;  1CKA A;  5GAN 2;  4PJM A;  5FU6 C;  1V1C A;  2EQI A;  2KYB A;  2LQN A;  4BD3 A;  1TS9 A;  2DNU A;  3EFS A;  3DB3 A;  4J9I A;  1YIJ Q;  1SKU B;  4JJD A;  1U06 A;  2OI3 A;  2DET A;  5KYU B;  1WJQ A;  2EJ9 A;  1GFD A;  1EZZ B;  2VVK A;  4PK4 A;  3MO8 A;  5IN1 A;  1WZO A;  4F04 B;  2DYI A;  3BDU A;  3UDC A;  3CQT A;  2QTX A;  4OGE A;  4LDW A;  2YT6 A;  1G3S A;  1Y57 A;  3HRT A;  4JZ3 A;  1PG5 B;  2GTJ A;  2LCS A;  1VQ9 A;  1VIF A;  3VJP A;  4XTV A;  1YBY A;  2CYZ B;  2K3B A;  4Z89 A;  1QVF S;  1ZX6 A;  3NHN A;  1OQK A;  3QZ5 B;  5FWC A;  4C8Q E;  4DQ2 A;  1M90 C;  2HD0 A;  4M75 D;  4M7A E;  4V2S A;  3E19 A;  1VQO T;  3QWY A;  3E9G A;  4BE1 A;  3GIB A;  5GMK i;  3CCV Q;  4LDY A;  4MZT A;  2LNV A;  2X4J A;  3SB2 A;  2MCN A;  1JJ2 P;  2LJ3 A;  3OYF A;  3INZ A;  3OW2 P;  1BIB A;  5HK0 A;  1ZA2 B;  3G4S Q;  3EG9 A;  1YP5 A;  4KGX B;  2FHD A;  2P0P A;  3PMI A;  1Q82 U;  2EFI A;  2O9S A;  1OI1 A;  2E6N A;  4EMK A;  2QA4 A;  4QVC A;  1MV3 A;  1FYN A;  5GAN e;  2AKK A;  1WA7 A;  3L2V A;  3OMC A;  7AT1 B;  2BZX A;  3MCA B;  4AFU C;  2DZC A;  4M7D F;  1Z9Q A;  1VQP A;  2LX9 A;  3MP6 A;  4EMK C;  1K73 U;  3M9Q A;  1UHF A;  1UGV A;  2XD0 A;  4A63 B;  4IKF A;  1NEB A;  3V8K A;  2OJ2 A;  5GAN 4;  5CKF A;  1PD1 A;  4C0G A;  2RHX A;  3OSV A;  5FRN A;  4JLG A;  2LNH B;  1LPL A;  2EPD A;  5CIU A;  2QQB A;  2EGC A;  2VXF A;  3CCQ A;  1YJW A;  4XTY A;  3M0U A;  1IXD A;  1NE8 A;  4RG2 A;  4J9E A;  1OV3 A;  3L2Z A;  4GLK A;  4C0D B;  3TSZ A;  1WXB A;  2VV5 A;  3CCU T;  2ZAE A;  1N9S A;  3G1J A;  1M27 C;  1UTI A;  4RTY A;  1HXD A;  2ZGW A;  4F7U A;  1KD1 C;  4FYX B;  4VUB A;  2E6Z A;  3CBM A;  2G6F X;  1VUB A;  3E9F A;  1YHQ A;  1MND A;  3I56 A;  3H9N A;  3JCM V;  5GAO r;  2EW3 A;  1KD1 R;  4HVU A;  1YJN Q;  4M7A B;  3X28 B;  4JDS A;  1VQ6 T;  1JBM A;  1M8V A;  2QQS A;  2ENM A;  1ZUU A;  2WAC A;  1M9S A;  3CCL T;  2XHC A;  2JMC A;  4F7U F;  4F17 A;  1PNJ A;  3U23 A;  2E1H A;  2XDB A;  3REA B;  4RTV A;  4BY6 B;  1R77 A;  1WPY A;  2OX7 A;  5I11 A;  3KUF A;  4MDW A;  2MYS A;  4AMC A;  5GAN 6;  2BE9 B;  3QJY A;  4C0D C;  2DTH A;  2L3Q A;  4J8O A;  2QQR A;  4C92 E;  3R6O A;  2RH2 A;  4EIK A;  2F2W A;  3C0C A;  1O75 A;  2CKK A;  3VS5 A;  4FYY B;  1M4Z A;  2HL5 C;  4CC3 A;  4PFZ A;  4JS4 A;  4CI0 C;  1TWB A;  1YI2 T;  3MEU A;  3ZBD A;  1VQN A;  1FMK A;  1JEG A;  4AFZ C;  4M7D B;  4M77 D;  2KAF A;  3H0H A;  1M90 R;  3H41 A;  2PUK B;  1VQ5 T;  3E2U A;  1RAA B;  4XU0 A;  1B3Q A;  1SSH A;  1A0N B;  3WVE B;  3I55 T;  1YWO A;  4M7D G;  3TQ7 P;  2QQ9 A;  3C12 A;  3HP9 A;  2QA4 T;  1W1F A;  2ATC B;  5GAM h;  5GAO n;  1UDL A;  4C5I A;  4LDX A;  4OP0 A;  2JJ9 A;  2MPX C;  1XJW B;  4FSS A;  4ME7 A;  1B34 A;  4M77 C;  2YSQ A;  1QLY A;  3H0I A;  1AZG B;  2RHI A;  3VS6 A;  2EQJ A;  1ZBX A;  3UT1 A;  4HCC A;  3UPU A;  3GPL A;  2H3J A;  4IIM A;  2YUN A;  4ZTJ A;  2A37 A;  2EAY A;  4PFP A;  2HMA A;  5GMK l;  3DKM A;  2J06 A;  4JJB A;  4FT4 A;  2GGR A;  3OYE A;  2RHU A;  3JCM P;  2DVE A; 
#chains in the Genus database with same CATH homology
 5HCK A;  1JQQ A;  5ECA A;  1S1N A;  3PE0 A;  2FPE A;  1YNZ A;  2O88 A;  5I22 A;  2C0T A;  2DX1 A;  1E6H A;  2CSQ A;  2EYZ A;  2DL8 A;  1Y0M A;  2M0Y A;  2RQT A;  4J9C A;  2D1X A;  1X2K A;  2V1R A;  4HXJ A;  2DM1 A;  2O31 A;  4LE9 A;  1ARK A;  2SRC A;  2AZV A;  2EBP A;  2EGA A;  1HSQ A;  4LNP A;  4AG2 C;  2LJ1 A;  1E6G A;  2EYY A;  1SPK A;  2AK5 A;  5IHN A;  3A98 A;  3M0S A;  1UHC A;  3VS4 A;  1AD5 A;  2M51 A;  4CC2 A;  2LQW A;  2RF0 A;  3QWX X;  4DEY A;  1HJD A;  3JV3 A;  3PVQ A;  2K6D A;  1BK2 A;  1VYU A;  2AKL A;  4K11 A;  1GL5 A;  2RNA A;  2X3X D;  4LN2 A;  2KRS A;  4F14 A;  1G83 A;  2ED1 A;  2DL4 A;  2J6F A;  1OPL A;  2RN8 A;  3UA6 A;  1JO8 A;  2HDA A;  2LZ6 B;  2D8H A;  2D0N A;  3M0Q A;  4J9G A;  1AOJ A;  3M0R A;  1B07 A;  4RTT A;  2DMO A;  2K7A A;  2BTT A;  2VKN A;  1RLQ C;  1J3T A;  2JM8 A;  1U5S A;  2X3W D;  1E7O A;  3EG3 A;  3EG0 A;  1GCP A;  2IIM A;  2KXC A;  3VS2 A;  2CDT A;  3GBQ A;  1EFN A;  1JXM A;  4J9H A;  3EG1 A;  4GBQ A;  3RNJ A;  4J9D A;  4ORZ A;  4ESR A;  1LCK A;  5IHI A;  1PRM C;  1U3O A;  1SHF A;  1PWT A;  1AWJ A;  4OMM A;  2LMJ A;  3FJ5 A;  1BB9 A;  2CUD A;  2CSI A;  2YUQ A;  5IHK A;  1RUW A;  1K4U S;  4AG1 C;  1T0J A;  4E6R A;  1K0X A;  2DBK A;  1W70 A;  1QWF A;  2JXB A;  2JTE A;  2RPN A;  3EG2 A;  4J9F A;  2L2P A;  1NG2 A;  2C0I A;  2RMO A;  2FPD A;  1BBZ A;  2DVJ A;  2DL5 A;  3UA7 A;  2GNC A;  4M4Z A;  2J6K A;  2ESW A;  3REB B;  2A28 A;  1NYG A;  2GQI A;  2E5K A;  4RTU A;  1KJW A;  2KRM A;  1NM7 A;  2PNI A;  4HVV A;  5GJV B;  2DRM A;  2MOX A;  2K2M A;  1WXT A;  2NWM A;  2ROT A;  2C0O A;  1ZUK A;  1K0S A;  2HBW A;  1TUC A;  1WDX A;  4X1V A;  3M0P A;  5IXB A;  1H92 A;  1SEM A;  4D8D A;  1UFF A;  1X6B A;  2K79 A;  3VS1 A;  1M3A A;  2PZ1 A;  1AVZ C;  3VS3 A;  3O5Z A;  3SEM A;  2KRO A;  1CKA A;  1WLP B;  2CUB A;  3ZL7 C;  4KRT A;  1V1C A;  2FPF A;  2EQI A;  2QDL A;  2LQN A;  2KYB A;  1TG0 A;  2BZY A;  4RTW A;  2DNU A;  2KR3 A;  3TVT A;  4J9I A;  1X6G A;  3KFV A;  1OOT A;  4OML A;  2CH4 W;  4JJD A;  1U06 A;  3IQL A;  2DL7 A;  2OI3 A;  1ABQ A;  1GFD A;  1PKT A;  1NEG A;  2EVR A;  2J6O A;  2VVK A;  4LUE A;  2NUZ A;  1WXU A;  3CQT A;  2YDL A;  2JS2 A;  2DJQ A;  2A36 A;  1T0H A;  2YT6 A;  1JXO A;  1N5Z A;  1AZE A;  2J7I A;  1Y57 A;  2RQR A;  1UEC A;  4JZ3 A;  1GCQ C;  2GTJ A;  2KBT A;  2LCS A;  2SEM A;  3UAT A;  2EYW A;  2K3B A;  2FRY A;  4Z89 A;  1WI7 A;  1ZX6 A;  3NHN A;  5FWC A;  2K9G A;  2O9V A;  1M3C A;  4F16 A;  3EGU A;  2KT8 A;  2CT3 A;  1ZLM A;  1X43 A;  3QWY A;  3NMZ C;  1H8K A;  2GBQ A;  1AWW A;  1K9A A;  3UF4 A;  3I35 A;  3RBB B;  2HEQ A;  5IH2 A;  2MCN A;  2EKH A;  2LJ3 A;  1I07 A;  5EC7 A;  4DEX A;  1M8M A;  2DBM A;  2FRW A;  1MUZ A;  1KIK A;  1YP5 A;  2CRE A;  2W0Z A;  4OMO A;  4J9B A;  1ABO A;  2O9S A;  2FG0 A;  2B86 A;  1RI9 A;  2ECZ A;  3NGP A;  1MV3 A;  1FYN A;  1AWO A;  2AKK A;  2VWF A;  1M30 A;  1WA7 A;  1M3B A;  1XOV A;  2JW4 A;  1ZUY A;  4AFS C;  2BZX A;  2EGE A;  4AFU C;  2L3S A;  5L23 A;  2A08 A;  4QT7 A;  2J05 A;  1Z9Q A;  3VRY A;  4LUD A;  2F2X A;  2DLP A;  4JZ4 A;  1HD3 A;  1VYV A;  1UHF A;  1UGV A;  4IIO A;  2HCK A;  4A63 B;  1NEB A;  2DL3 A;  2PTK A;  3R6N A;  2OJ2 A;  2ABL A;  3I9Q A;  1NYF A;  4CC7 A;  2DA9 A;  5FWB A;  2LNH B;  1X27 A;  2EPD A;  2KYM A;  2EGC A;  1OPK A;  2P4R A;  1Z9Z A;  1SRL A;  2XMF A;  1VA7 A;  3M0U A;  1QWE A;  1WFW A;  1X2Q A;  2CH4 A;  1QCF A;  4J9E A;  1OV3 A;  1QKW A;  4Z88 A;  3EHQ A;  2YUP A;  3TSZ A;  1WXB A;  2DRK A;  2KEA A;  2I0N A;  2DYB A;  2JT4 A;  4OMN A;  1M27 C;  2KGT A;  3SHW A;  2H8H A;  1UTI A;  4RTY A;  2AZS A;  2JM9 A;  2L0A A;  2MIO A;  2RQW A;  4R0K A;  2DF6 A;  1ZBJ A;  1GBQ A;  4Z8A A;  3VRZ A;  2G6F X;  4RUG A;  1VYT A;  2EW3 A;  1W6X A;  4HVU A;  2ED0 A;  4ZNX A;  1X69 A;  2ENM A;  1ZUU A;  4D8K A;  1H3H A;  2JMC A;  1ZSG A;  1AEY A;  3LH5 A;  4HVW A;  1GCQ A;  1IO6 A;  2CT4 A;  4F17 A;  1PNJ A;  3U23 A;  1T3S A;  3REA B;  4RTV A;  2JMA A;  1WYX A;  2W10 A;  3I5S A;  4WCI A;  5I11 A;  4AFQ C;  2JS0 A;  1I1J A;  1NLO C;  2KNB B;  1UUE A;  4Y92 A;  1OEB A;  2O2O A;  2L3Q A;  4JPB W;  1KSW A;  2DE0 X;  1UJY A;  1UG1 A;  2EYX A;  4EIK A;  2F2W A;  3C0C A;  1CKB A;  1YWP A;  3VS5 A;  1K76 A;  2KXD A;  4CC3 A;  2RQU A;  3NPF A;  1PKS A;  1FMK A;  1JEG A;  1KFZ A;  1G2B A;  4AFZ C;  3H0H A;  1NLP C;  1T3L A;  3H41 A;  1TUD A;  1SHG A;  3ULR B;  1K1Z A;  2ROL A;  3TSW A;  1JU5 C;  2LP5 A;  3M0T A;  1B3Q A;  4GLM A;  1UE9 A;  1SSH A;  4OMQ A;  5GJW B;  1CSK A;  1MV0 B;  1A0N B;  5FW9 A;  1YWO A;  3VS7 A;  3H0F A;  4CC4 B;  4HCK A;  1YN8 A;  1W1F A;  2V1Q A;  1BU1 A;  2L3P A;  1PRL C;  1UDL A;  2F2V A;  2YUO A;  4FSS A;  1GFC A;  2FEI A;  5IXF A;  2YSQ A;  3PVL A;  1QLY A;  2LJ0 A;  2RQV A;  1AZG B;  3H0I A;  1QKX A;  3VS6 A;  1WX6 A;  2BZ8 A;  1SRM A;  4RTZ A;  1PHT A;  2KE9 A;  4JJC A;  2KRN A;  2FO0 A;  4OMP A;  2D8J A;  1WIE A;  4IIM A;  2HSP A;  2YUN A;  2DIL A;  3THK A;  2A37 A;  2LX7 A;  1I0C A;  3EHR A;  1UJ0 A;  2J06 A;  2OAW A;  4JJB A;  1GRI A;  2GGR A;  2GTO A;  1YCS B;  3I5R A;  2KT1 A;  1GBR A;  1AWX A;  3VS0 A;  4RTX A;  1RLP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...