3U28C

Crystal structure of a cbf5-nop10-gar1 complex from saccharomyces cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
PPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstitution and structural analysis of the yeast box H/ACA RNA-guided pseudouridine synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase/protein binding
molecule keywords H/ACA ribonucleoprotein complex subunit 4
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3u28C00
3MQKC 2EQNA 3U28C 3UAIC 2HVYB 2V3MA 2EY4C 2RFKC
chains in the Genus database with same CATH superfamily
2CF9H 1SMFE 4I8HA 3SJOA 1THRH 3MMGA 3EE0B 3A7YA 4U01A 5T1VA 3DD2H 2GKVE 4RSPA 2W5EA 2WPMS 4UE7H 2FTLE 1WQSA 3VB3A 1O3PB 4X8SH 5C1XA 5DJ7A 4U30A 2Z9LA 3MU4A 4WY3A 1V2LT 1QTFA 2J98B 1P2IA 3PMHB 2KCOA 2AIPA 2NU1E 3AAVA 3EA8A 3C1KA 4E05H 1H8ED 3AW0A 3SGQE 1EFRD 2O8LA 3F9GA 1V2QT 3ITIA 1D6WA 2RDEA 4MQAA 1ARBA 2NU3E 5CDFE 3SNDA 2BX3A 1D3TB 1Z8RA 1Q2WA 1TB6H 3A8CA 1C4U2 3KNXA 4BTIB 2HNTE 4M7GA 1TNIA 5EOKA 3TU7H 4YOGA 1DM4B 4ZHMU 1DY9A 3A7XA 5E8EH 3FN8A 1KSNA 1GMCF 5GIBA 4X6NA 1D4PB 1IQIA 5GJ4B 3M7QA 3V7TA 3LGIA 5TCAA 2PFEA 2YNAA 3M35A 3VB5A 1OSSA 3ZZBA 1UK4A 3CS7A 1ZTLA 4THNH 1C2KA 5JBAS 1BBRH 1O3LA 1O38A 3BG4C 4INHA 1XVOA 4NA8A 4MTBA 3ZVFA 1N6XA 1JXPA 1GJBB 2R3YA 4AFUA 2XC0A 2PR3A 2PTNA 1K1JA 4OS5A 1YPKH 1UVOA 1LHGH 3LGVA 1FPHH 3ZZ5A 1GHXH 5J4QA 1YLDA 1ZOMA 4ZHLU 2PWXA 1GDQA 1P3CA 4GAWA 4J1YA 1LVOA 5CE1A 1CHOG 1SGYE 2BD7A 5A8XA 3S9CA 4K60A 1P9UA 1FY3A 1DSUA 3IG6B 1H8IH 4RKJB 1GBEA 1C1WH 1EQ9A 1AUJA 4IBLH 1G2MA 1DITH 4GHTA 5GNDA 4B71A 2FOCA 1QRXA 1DUEA 4F48B 3KHVA 1P2JA 4AG1A 3N99A 4JZDH 1FMGA 1OP0A 2CGAA 1KIGH 7GCHF 1YBWA 1MD8A 2AS9A 3OEED 4A92A 3GDVA 2SGPE 1AUTC 2WZQA 3FP7E 1ARCA 3N7EA 3QX5H 3VB4A 4XOJA 1MQ6A 2ESTE 2JH0D 3KQCA 6ESTA 1EZXC 1CT2E 5E0JA 4JCNA 4CH2B 3ZZCA 1GI9B 1HXFH 1PPFE 2BYAX 1Y5UT 2QF0A 5TCCA 2I6QA 3UREA 1MCVA 3O8CA 5HXFA 1W0ZU 1PFXC 4CRGA 2ZPSA 2ZO3H 2ZC9H 1F7ZA 1VJAU 3SNEA 1G3DA 1N1LA 2LNCA 3PTNA 2VU8E 2ZGHA 1TNGA 1TRYA 5AFZH 1KYNA 1PPBH 1DDJA 5A09A 1ETTH 1F2SE 1CT4E 2TGDA 4GSOA 1OYTH 4A1XA 1BMNH 3SORA 4Y8XA 4LK4A 2R0KA 1FJSA 3MO3A 2XC5A 1J16A 1O3EA 1YCPK 5FPTA 1O2RA 1H9LB 1WDIA 3Q3XA 1TMTH 2UUJB 1AE8H 1HDTH 1T8OA 3TK6A 1U6QA 1ANBA 3E16B 2JIZD 1O32A 4NIYA 1GJ8B 4ZXXH 1VITG 3RC5A 1LHFH 1SSXA 3OX7U 2H6MA 2RA0A 1PQ7A 1GG6B 5IYTA 5C2ZA 2ZHWH 1XXFA 3SUFA 1ABJH 1OP8A 4D7FA 1XKBC 1G3CA 1BUIA 3ATIA 3W1EA 2AHME 1A4WH 2F9PA 4XFQA 3DUXH 5C5OA 1YWUA 3PRBA 5ESTE 1G2LA 4ASHA 4AGKA 1PQAA 1GMDF 1KXDA 3PMAB 1SR5C 2A4RA 1B0EA 1GJAB 3RMLH 1LHEH 1YPGH 2HOBA 1SGFA 1W2KH 3WW7A 2V6NA 1QA0A 4AB9A 1DWCH 5CHBA 2TBSA 2Q6FA 1BA8B 1PQ8A 2PP6A 1QJ6B 3T28A 2GT8A 3UNSA 1GCTB 2BLOA 2F43B 2WUBA 4UONA 3SU2A 2ZKSA 5EU8A 3GY3A 1O2MA 1C2FA 1GVLA 1EB2A 2FODA 3Q3KA 3NWUA 2VVCA 1P3EA 1A5HA 1MTSA 3P6ZB 4A1TA 3PO1B 1DWEH 1O31A 1UVTH 2OP9A 2R9PA 4O3UA 3SJKA 2Z6BD 3MH6A 1G3BA 1K1PA 2ZPQA 4GVUA 1HNEE 4TT3D 1Z1IA 4Y79A 3V12A 4RT0A 1P2NA 3A80A 1C1TA 4JZFH 1FDPA 3B8JA 4Y6DA 3ZVEA 1PPCE 5FCRA 1QURH 1T8MA 1TGSZ 1K9OE 3VG8A 1O5CB 3TGKE 1BBRK 4HZHA 1QBNA 1TNJA 1G37A 2QE7D 2ZDLA 5H4IB 4CHAC 2BY6X 2VGCB 3TJUA 2WPJS 3UR9A 1TPAE 5AVDA 3SI4H 4A1VA 4I8JA 1DS2E 1DANH 2PSYA 3UIRA 4IMZA 5A0CA 2F9BH 1RTKA 1YPJH 1Y5BT 2CN0H 3E1XB 3SUEA 3QGJA 2BD2A 5JPMH 1EZUC 4YO9A 3H7OA 4B6EA 2SGFE 1VJ9U 2SGEE 5C20A 1J8AA 2ANYA 1BRCE 1GJ9B 1KLIH 4DOQA 1UTMA 1F0SA 4WH8A 3SO3A 1Z8IB 3GY6A 3RXKA 4K1TA 4H6TA 2VIWA 1VCQA 2Q6DA 3FANA 4FVBA 4XBCA 4MDSA 1UTKA 1P2QA 2FS8A 1O30A 4ABJA 1C5QA 2F83A 1M9UA 5C94A 1W11U 3PWCA 1NFWA 4I86A 1NC6A 1COWD 1GHZA 3GDSA 1GBTA 3SUDA 4Y7BA 2FDAA 4KTUA 4AORA 1SI5H 2ZHFH 3F2GA 1O36A 2UWLA 1LQDB 3SQEE 5AHGH 2PV9B 2L74A 2FI4E 2O8UA 5JBTA 1GI8B 1PQ5A 1IQKA 1VR1H 3P8OA 2UWPA 1ELTA 1A5IA 1C5UA 3RMOH 5GWZA 1H4WA 1LMWB 3SGBE 3NK8A 5CMXH 1LTOA 2GCTB 3M61U 2UUKB 1L4DA 2QXGA 3FOAA 1AE5A 2EC9H 1UO6A 2XBYA 3MWIU 1HUTH 2R0LA 4U2WA 4GCHG 3SQHE 3RXIA 3A8DA 2F9VA 2BTCE 2FZZA 4O03A 4O97A 4VGCC 1ZSJA 3ESTA 2XNDD 3RXHA 3DSPA 2TGPZ 4JYVH 4OGXA 2H9TH 2KCAA 4YLUA 4FU8A 1FAXA 1CT0E 1NZQH 3MNSA 1SOZA 4IC6A 4D76A 1TABE 3Q00A 1NO9H 4ACAA 1PPEE 2D2DA 4X6MA 1LVBA 1TMBH 2YOLA 1S6LA 2QC2A 4FETA 2AYWA 1O3NA 3BF6H 1NU9A 3ATLA 1IQMA 1IAUA 3M7TA 6CHAB 4INKA 1TRNA 1UTPA 5BRRE 1SGEE 3K6ZA 3S0NA 3KQ5A 2A31A 1NRNH 3UB0A 2A32A 4WVPE 1KXBA 4ABDA 1BB0B 4HI3A 4BOHA 4ISIH 4ZH8A 1TGNA 5FX6A 3HK6B 1W14U 3ATKA 2ZFPH 1NRPH 2KFWA 3RC6A 4X1RU 1YPLH 2PHBA 2ZGJA 2K8IA 3UWJH 4BTTB 1NRSH 3TJOA 2P8OC 1QL9A 1LO6A 3D65E 4IW4E 3VB6A 4UFEH 1GBJA 2Y7XA 2A5AA 3MU8A 5T6GA 1O5BB 3IWMA 3RDZA 5ABWA 1GHAG 3FKSD 1SGFG 4AC9A 4HG6A 2BLQA 2GP9B 1EOLA 2KAIA 1NY22 1XMNB 1GBCA 2ZGCA 3FVFB 5DG6A 4Z6AH 4K2YA 1C5WB 1SLWB 4GHQA 2HPQH 1SGRE 3A88A 1O0DH 3N7DA 3UNRA 1O2YA 1TX8A 1MCTA 2GCTC 2ZDAH 2FLBH 4ABHA 2J38A 4RI0A 1O3DA 4CRFA 1E38B 1EZSC 4KKDA 1AKSA 1A1RA 1FNIA 1PJPA 2XRCA 3KCGH 3SYJA 3QDZB 1MKXH 2PGBB 3M7UA 4OS6A 1JOUB 1KMHB 1YPMH 3M5NA 1MTNB 3ZIAD 2ALVA 4DIIH 3TVJB 2JH6D 5JDUB 3F6UH 3U8RH 1RIWB 1C5PA 1EAIA 1NBMD 2Y5FA 1NTPA 2C4FH 3K6YA 3OSYA 4P02A 2SGDE 3TIUA 1OWIA 4H42U 1QIXB 2VGCC 2F91A 1HIAA 4LXBH 4UFFH 2CXVA 1HB0B 2NU4E 1KTTB 2TIOA 3ZZ3A 1A5GH 3NRLA 3BTHE 1GBBA 1W0KD 2KM0A 3RXVA 3GCTG 3GCHC 3UOPA 1GHBF 1PPZA 2C90B 3A82A 3D23A 4NSVA 2VIQA 1O3HA 3EQ0H 2V3MA 2HGTH 1GBLA 2C8ZB 3MQKC 1AY6H 1DUAA 1TBZH 1FXYA 3P92A 1FN8A 4DT4A 5C0TA 1XVMA 2QF3A 3TLOA 1VITH 4Z0KA 3ZVCA 1UTQA 1D6RA 5TJXA 1THPB 2BZ6H 2OK5A 1C2DA 1VGCC 2GZ9A 4YZUA 4DG4A 1GBDA 3MYWA 1MQ5A 2PKSB 2GX4A 5FBEA 2PSXA 3RU4E 4AB8A 2DE8A 2GV7A 1WBGB 4ZKNU 2XXLA 3L6PA 1NFXA 3SNCA 1C5SA 2XWAA 4CBNA 5K0HA 2Z9KA 9LPRA 4ABEA 2WINI 4K3JA 1HV7A 1O2UA 3ELAH 3TNTA 2VIOA 3ZV9A 5L6NH 2ZI2H 5F6MA 6LPRA 3WY8A 3FAOA 2QXHA 2OBQA 3OY5U 3U8OH 3LPRA 1A0JA 4Z1MD 3ZYDA 5A8YA 1W8BH 3MNBA 1FY5A 2ZFSA 4FUBA 1AMHA 1D9IA 2GJGA 3K2UA 2ZCHP 3PTBA 1JWTA 3U1IB 1NFYA 2BY7X 1O3FA 4ZAEA 2XCNA 3ATMA 1AGJA 2WV9A 1L2EA 1C5LH 2ZFRH 5F03A 1AI8H 4AFQA 4O9VA 1W0YH 1BRBE 1DPOA 1SKYE 2EEKA 4J2YB 3ZVAA 1C5ZB 2LP6A 1ESTA 1KXFA 1BJUA 1MTNC 2A5IA 2Y82A 1LHDH 2A7JA 3QWCH 2XBWA 4E7RG 1RIWC 2ZU2A 1E36B 1KDQB 1ANDA 4NIWA 3FZDA 1TOMH 2THFB 2Y5GA 4ZROA 1SHYA 3A7VA 1GI5A 5A8ZA 4CHAB 3SV2H 3I29A 3ZZ9A 5C0UA 1V2KT 3SU1A 5FPSA 1WTGH 1VZQH 1JBUH 4D8NA 1TGTA 1WTHD 3I78A 3D62A 1GBKA 2PTCE 1NROH 5EGMA 1BTPA 2ZHDA 3U8TH 1OX1A 1TX6A 3E6PH 1G30B 2AMDA 2FYQA 4NA7A 1YY3A 3KGPA 2ZA5A 1EZQA 1SL3A 4NWKA 1O5GH 4FXGH 1BHXB 1BDAA 1SLVB 2BXUH 1Q3XA 1CQQA 1GJ4H 2PLXA 4DT7B 1P09A 1S6FA 4SGAE 1E1QD 3NPSA 1LVYA 1YPHE 5C1YA 4CRCA 4FUJA 2RFKC 1DLKB 2BVRH 5HGGA 4M9FA 3STIA 1DICA 5FXLA 4JZ1A 3SU3A 3T25A 1O3CA 5EJZA 2WYGA 4B2AA 1EJAA 2OQUA 1ZZZA 4CR5A 3LC5A 4OS1A 3MTYA 1C5TA 3A87A 4Q7ZA 1WXRA 4BAHB 3S9AA 1GGDB 5DSFA 4LZ1H 1OYQA 1Z6JH 1DT2A 3BTKE 1S0QA 5DKMA 3UR6A 5EW1H 1INCA 3RU4D 2CJIA 2G8TA 4X1QU 1V3XA 1UTNA 1TE0A 1K0HA 1QR3E 3L33A 2ANMH 3TITA 3SNBA 1HLTH 5GDSH 2ZHEH 1K28D 2A2QH 5EODA 4CRDA 1K1IA 2GT7A 2OC8A 4JZIA 3URDA 1GBIA 5CHAB 3QO6A 1P06A 1HJAC 4OS7A 4D9QA 4IMQA 1EP5A 2QF4A 4YOJA 3LGYA 5E2OA 3QZRA 1UCYK 3VGCB 3VEQB 3F68H 1D3DB 4NGAH 2GDDA 1ELFA 2GDEH 1ANEA 5GXPA 5C17A 1IQNA 3GOVB 2F9OA 1FAKH 4YT7H 1GDNA 2VWMA 1EJMA 2BLVA 4NA9H 5FBIA 5SGAE 3RXRA 2BVXH 1VCPA 8KME2 1GBFA 2H2ZA 1HXEH 4B2CA 1BTXA 2OQ5A 2F3CE 2HNTF 2P94A 2UUFB 5I25A 1AWFH 2OTVA 1C9TA 1GI1A 1SC8U 1O2ZA 2ZG0H 3NUMA 1AD8H 1O2XA 2BD3A 4NZQA 1W10U 1CO7E 2H5DA 1AO5A 2ZDKA 2FOEA 1W13U 2FESH 1O2OA 2ANKH 1HPGA 1YGCH 4GUXA 1E34B 5HYOA 3A81A 2D26C 4ISOA 1VGCB 3M3TA 1SLXB 2J95A 3PROA 2VH0A 1GJ7B 1O37A 2VH6A 4BAKB 1J17T 3SOSA 2CK3D 4I32A 1ACBE 1SGDE 2J9NA 1TWXB 3VXFH 1GI7B 3RXTA 1O2JA 1ZHRA 3MU5A 3RMMH 4B73A 4FUHA 3FO8D 1O2KA 2OCVB 1BMLA 1HAOH 4TWWA 3GY5A 2C8XB 1GJ6A 3LU9B 2OUAA 2ALPA 1CGIE 4WMDA 1P12E 3DFLA 5F8TA 3D49H 1SGTA 1XUJA 3QLPH 4AX9H 4X1NU 2AMQA 4I7YH 1A46H 2JKHA 5BPEA 3E91A 5T6DA 3SJ9A 1UTLM 2Q1JA 2JETC 3VFEA 3PMBB 4I8LA 1O2PA 1Y3WA 1T7CA 1XM1A 4TPIZ 1BRAA 4UFGH 5FHTA 2PW8H 2ZTXA 1GMDG 1QBOA 2LPRA 4B1TA 3ZV8A 3PYHA 1Z8JB 2B9LA 3SU5A 2J2UA 1SGPE 3SI3H 3U69H 2O8MA 2P8OB 1TOCB 3O8BA 1S85A 4H4FA 1K2I1 3I77A 1J14A 3U9AH 3P8NA 2FLRH 4X2XA 1O3IA 2GCHG 2XNIA 2Z3EA 5GCHG 1C2HA 2W7UA 4R8TB 1V6DA 4AZ2B 5B6OA 3AVZA 2PGQB 1C5OH 2UWOA 1NN6A 4WMFA 3ZVGA 1BMMH 2B7DH 4ZKRU 2J98A 2ZU4A 4YLQH 2FXRA 3HKJB 1NT1A 2BZAA 1K22H 2BX4A 4K1EA 1H9HE 1YCPM 1DLEA 1MAYA 1C2JA 2CF8H 3RXSA 3F9HA 4IGDA 2FOFA 2XCFA 4MNWA 2BDYA 2FI3E 3A86A 1C9PA 1Y59T 4LOYH 1DVAH 3EGKH 3LC3A 2BVSH 3UPEA 1O5DH 3W95A 1P2KA 3DT0H 5ESBA 2ODQA 3BSQA 1FV9A 1TFXA 5DP4A 2ZDNA 4NSYA 1XUGA 3PMJA 2ZNKH 3A7TA 2TPIZ 5DP3A 3LKWA 3P8FA 2V0BA 2QGRA 4MLFB 2YMSC 1FY4A 3GYMA 4X2WA 2A7HA 1UCYH 2G4UA 8GCHF 1IQJA 4ABFA 5FL7D 4ASUD 3OY6U 4B75A 1MAXA 4AOQA 1YCPH 2Z9IA 4TY7A 4Y76A 5GPIB 5EXLA 4K69A 1P10A 1EPTB 3BTME 2FP7B 3UWIA 2GZ7A 3F9EA 4RT1A 1AZZA 1TMUH 3ZZDA 1T4VH 1ELEE 1VCWA 1MZAA 3KIDU 1FN6A 4DVAU 3WWFA 2AGIX 5DP6A 1O2SA 4TY6A 3RM0H 1V2MT 1P01A 1ZYOA 3EYDA 1ABIH 1C1PA 3EE7A 1V2OT 1HCGA 4K1SA 1ZPBA 5JB9S 1AHTH 4KGAA 1OWKA 1ESBA 1MABB 2VJ1A 3H7TA 1UK2A 3P95A 2OLGA 2BY9X 5KECA 1F92A 3UFAA 1OKXA 2B5TB 1DWBH 1YF4A 2FX4A 2BQ6B 2ASUB 5E2PA 2WHXA 2WV4A 4Q4LA 1GWAA 1P8VC 4X8VH 2VIPA 2ZQ2A 2NU2E 1MTVA 1SHHB 2SNWA 5I46H 3BN9A 3O8DA 1BMFD 3A7ZA 1O3BA 3DSGA 2P95A 3OTJE 1TQ7B 1EX3A 1PYTD 3BTDE 5EPNA 1N6YA 2J97A 2ZCLP 3V3MA 1BTZA 4XE4A 1GJDB 1O3OA 1TPSA 3UNQA 4IN1A 1TGCA 2VWLA 1O2IA 1CE5A 1FZZA 2G51A 2EA3A 3LT3A 1HBTH 2WUCA 3KQBA 3MU1A 2HLDD 2QA9E 2FO9A 2ZWLH 4XDEA 1GMHG 1GBHA 1NU7B 1LPGB 1CHOF 3MNXA 3GS9A 2SGAA 5DPAA 1HAIH 4ISLA 1OP2A 1C1MA 1GI0A 1MH0A 3SZEA 1RGQA 2GMTB 5EIYA 1NPMA 4X8UH 1HGTH 2W7SA 1Q31A 3UQOA 7GCHG 2J94A 1HYLA 1QQ4A 1L4ZA 3QTOH 4NIXA 2SNVA 1GL1A 5K7RA 1ETSH 2QV1A 2P3TB 2YNBA 3T29A 4UEHH 4FU9A 2HALA 2ZFFH 3F0PA 4ZKSU 2EI7A 3F9FA 1GI3A 1K1LA 1SVPA 2G52A 2ZHQH 3M37A 4WXVA 3VPKA 2Z7FE 1NRQH 4AYVB 3ZZAA 3VXEH 1AFQB 4VGCB 1KXCA 1EAUA 1AIXH 1HJAB 1QA7A 3UUZA 1C5YB 1MD7A 1E37B 4NFFA 1GVZA 1IQHA 4E7NA 1ZTKA 4BAQB 1BTWA 1JIMA 4ABIA 1SPJA 2OD3B 4FOUC 7ESTE 3GCHB 1DSTA 3KQEA 3MH7A 1OWHA 1TBRH 4CRAA 1RJXB 5EW2H 3ZZ4A 2FIRH 4WWYA 4JMYA 1AB9C 1TPOA 5C67A 1N8OB 3SV8A 1A7SA 2ZGXH 1SFQB 2BDCA 2BD9A 2ZDVH 1FIZA 3M3VA 2CMYA 3KEEA 1EXFA 3SW2B 3GY2A 4BAMB 3BEUA 1O2VA 5EPYA 4YTAA 2BQWB 1Z7KA 2BDGA 1GDUA 2BHGA 2ZEBA 3SU0A 1IHTH 2BB4A 3PLBA 2NWNA 4F49A 2F9UA 3DFJA 1O35A 1FUJA 1O2TA 1BITA 1C5RA 1YLNA 2A45B 5HIZA 1Y8TA 4Q7XA 4BTUB 3ZZ7A 4DY7B 3MO9A 3RU4T 1ZLRA 2BDIA 1W12U 4Y71A 5EQQA 3GCTF 2B0FA 1C4V2 3BTQE 3MH5A 4FUEA 2A0QB 1LKAA 1O3MA 2H5CA 1P04A 1XUHA 4IS5A 4PROA 1Y5AT 1QCPA 1KTSB 2AGEX 5E0GA 3R3GB 3BV9B 2WSSD 1A2CH 1C5NH 2A2XH 1THSH 3A89A 2WYJA 1ZSKA 1QRZA 1IQEA 3ZZ8A 5EQRA 2AH4X 5DP5A 9ESTA 1UMAH 3S7HB 3AW1A 4ABGA 3SNAA 1ZPZA 3RLYH 3V0XA 2JJ2D 1FLEE 1EB1H 1YPEH 4MG3A 4FUFA 1IOEA 3FFGA 4GPGA 4X1SU 5JB8S 1C2LA 1QJ1B 2ZCKP 2STBE 2IOTA 4JK5A 1SFIA 3T62A 1FI8A 4WJG2 4LZ4B 2FOBA 3M5MA 2Q6GA 3SV9A 1T8NA 2C8YB 1HAVB 3STJA 1QBVH 3TJVA 4Y8YA 3F2HA 1XXDA 2A4GA 2V7QD 4Y7AA 3KYGA 4DW2U 1B5GH 3GDUA 3OEHD 2JH5D 3A7WA 4YOIA 1P57B 2KZ4A 3RXUA 3SBKA 2RA3A 3TK9A 4ZHAA 4CRBA 1T31A 3SGAE 1MU8B 1ZHMA 1BCUH 1CU1A 1MKXK 1CBWC 3PV4A 3F0OA 3SN8A 2A4QA 1P0SH 5EXMA 3TGJE 1C1UH 4I8KA 2J92A 3T2NA 6GCHF 2JETB 2C8WB 3SHAH 5FPYA 1AN1E 1TA6A 1SGCA 1L1JA 1O3JA 1E1RD 3M5OA 3KL6A 4B2BA 3A8BA 4ZKOU 4Q80A 1V2WT 1WUNH 3FZZA 4HTCH 3PLPA 4X6PA 2W6JD 2WPDD 4KELA 3RXFA 1A0LA 2L6OA 3RXMA 1A3BH 1EPTC 2XW9A 1C2GA 3HGNA 2GMTC 3JZ2B 1QL8A 3OYPA 1UW7A 1JRTA 3BEFB 3DA9B 1ZGVA 1TX7A 3HK3B 1HFDA 1BRUP 3A84A 3SUGA 1ANCA 1SQAA 3RXPA 4A6LA 1UTOA 1LCYA 1AKSB 1O3GA 1ELBA 1AQ7A 1GL0E 1QHRB 1D3QB 3SV7A 3E3TA 1QRWA 1YKTA 1E0FD 2J5UA 4MNYA 5AFYH 4HFPB 4JZEH 2OXSA 1TBQH 4H6SB 4XBDA 2GZ8A 4AFSA 1UVSH 1VKYA 3BG8A 2VIVA 1UTJA 4HGCA 1AU8A 3TGIE 4UD9H 1O33A 1K1MA 2ZU1A 4DURA 1F0TA 3OE7D 4TPYA 1HAPH 3H09A 4YM9A 1EUFA 2BDBA 1O2LA 1ID5H 2VB0A 1TLDA 5G4BA 4Y8ZA 3MFJA 1IQLA 1AVWA 3T26A 2ZTYA 4BANB 5HMAA 1YPHC 1O2NA 1SQRA 4UDWH 4ZUHA 5C3NA 2ILNA 1L0ZA 1F0RA 4DJZB 2EY4C 1NFUA 5LPEA 3S69A 1K21H 5A2MH 1V2TT 2BXTH 1CBWB 3JZ1B 2FI5E 1HJ8A 3URCA 1GBMA 1PYTC 1TNLA 3GISB 1H8HD 1N8OC 3QUMP 1C1QA 2EQNA 1G3EA 1FX0B 2XBXA 1MU6B 3MO6A 1BTUA 1K1NA 5DP7A 5DP8A 3RXOA 1C5MD 3TNSA 1A3EH 3LIWA 3LGUA 2SGQE 1W7GH 1EAWA 2OC0A 2CHAB 4FUDA 5L2YH 1DX5M 2Y5HA 1C5VA 3E0NB 3KF2A 1H1BA 2ZDMA 4JK6A 1RRKA 2H1UA 3OFND 4OS4A 3TH3H 2FM2A 5J4SA 2G5VA 3TH4H 2XOKD 5AF9H 1OWJA 2QXJA 1DY8A 4MPUA 1V2JT 1UHBA 1UVPA 1JIRA 1ZMJA 1HAVA 1NBME 1GHAF 1AVXA 3F2FA 3HGPA 1WV7H 1GPZA 2K0QA 1O3AA 3RM2H 1CA8B 1K1OA 3U1JB 1S84A 1CA0B 4X2YA 5A0BA 4XD7D 4FUIA 2STAE 2BOKA 3PO1C 2ZPRA 3EA7A 1LVMA 1ELCA 4NWLA 1AFEH 1O2GH 4Y10E 3UOUA 1GI4A 3GCOA 1FIWA 1L1NA 4ABAA 1ZR0A 1SLUB 1ZJDA 3TJNA 3QGNB 3LGWA 3T27A 5JBCS 3SU6A 5HM9A 2FS9A 3DSOA 1AFQC 5LH8A 5CHAC 1JMOH 3PWBA 2BQ7B 5EG4A 1BZXE 1GHWH 1QNJA 3ZZ6A 3SZNA 3HKIB 2A1DB 2XC4A 1MKWK 2YMSD 3NCLA 4ZCNA 3DHKH 4WXIA 2QF5A 1KLJH 1GMCG 1FPCH 3ATWA 5HM2A 2J4IA 3E0PB 2GVFA 3ZVDA 2SFAA 1B7XB 1P03A 2I6SA 1C4Y2 3SJ8A 3EA9A 2O8TA 2H9HA 1C1RA 1X7AC 3BTWE 4K8YA 1Y3VA 1ELVA 1DWDH 1C1OA 1QJ7B 4A7IB 1F5RA 2FPZA 3RXAA 2GGVB 4OS2A 3M36A 1CHGA 1HJ9A 1UJ1A 3BEIB 3KQDA 3ODFA 1ESAA 4X8TH 3RXEA 4Y0ZE 1OXGA 1MMJN 5DGJA 1SGNE 1YP9A 1NM6A 2ANWA 4KTCA 4BXWA 5B6LA 1UVUH 3DCLA 1YC0A 3C27B 1QB1A 1O34A 1ZHPA 1MUEB 1BOQA 2GCHF 4ESTE 1E35B 4RKOB 4B74A 5PTPA 1EP6A 5F8XA 4ZXYH 2JJ1D 5EXNA 1V2ST 2EI6A 4IC5A 3MH4A 3CENA 5IK2D 2G55A 5T3HA 1GBAA 2AMPA 1GJ5H 1QQUA 2FOAA 2VINA 3PV5A 3RXJA 3U28C 3VB7A 3G01A 4P00A 4E06H 4OGYA 3TK5A 2FWWA 1EJNA 1C2MA 2M2AA 2VVVA 1FY8E 1P2OA 3WWBA 1G9IE 4FU7A 2G4TA 2LELA 3NXPA 3F3BA 1T32A 1AB9B 1QZ8A 1XUFA 2IN2A 3BTGE 4F55A 1BMAA 1RTLA 5DK1A 2W26A 3FP8E 1LQEA 2IJD1 2G00A 5FAHA 1IQGA 4D9RA 3LH3A 2Y80A 3SHCH 4MPVA 1LHCH 4DCDA 1HAHH 4TSFD 1AWHB 2BDAA 1HAYB 2D8WA 4K8BA 1GCTC 1S5SA 2FMJA 3KYFA 1RS0A 1WYKA 3TH2H 2Y6TA 4FUGA 2A4OA 1BTHH 4MVNA 3AASA 2C3SA 2ZP0H 1GGDC 1HIAB 1Y3UA 2BMGB 1SGIB 2CV3A 1O2HA 1SBWA 4WH6A 2XBVA 3BTEE 3FP6E 4NZLA 1OHHD 1VITF 1ZJKA 2JDID 2PUXB 1MBQA 5HIYA 2BD4A 1NRRH 3QZQA 3SJIA 2ZZUH 4ABBA 5DO4H 2HWLB 3RXDA 1EATA 2XYAA 1EAXA 1XKAC 2Z94A 3LJJA 4MPWA 1WOFA 2WPLS 3IITA 1EPTA 5L30H 1OOKB 2D1JA 4DGJA 2YMSB 2VWOA 3Q76A 1RD3B 1PPGE 3VGCC 3K9XB 2HNTC 2VBCA 2ZU3A 4TWYA 4U32A 3B23B 1ZMNA 2DUCA 2KX4A 1O5EH 1FONA 4SGBE 1GHYH 1HAXB 2AGGX 3M5LA 5T6FA 5E0HA 2KCYA 5ETXA 1WSSH 4AN7A 3MNCA 2AFQB 2P3UB 1RXPA 3M3SA 3HPTB 1LKBA 3BIVH 3ENSB 3GY4A 3RMNH 1J15A 1IHSH 3UTUH 3O8RA 2EI8A 1LDTT 5C5NA 1GMHF 1Z71A 3LDXH 1RTFB 1GG6C 1V2UT 4KP0A 1ZSLA 2PUQH 2Z3DA 1P05A 4I31A 1DXPA 1YM0A 1P2MA 3MOCA 4NCYA 5F8ZA 1ETRH 1OPHB 3MU0A 3EAJA 3CS0A 2VVUA 1KLTA 1EKBB 1MTWA 1QB9A 4X6OA 3K65B 1G36A 1GI2A 4Q2KA 2XTTB 1C1VH 1XUKA 1BBRE 1DOJA 2P3FH 4I33A 2Y81A 2TRMA 4QT8C 1HAGE 1QY6A 3BG4B 1SGQE 1XUIA 4OM9A 1B0FA 4AG2A 2ZU5A 2KAIB 3P70B 1BIOA 1MBMA 3BTFE 1E79D 1ELAA 5JBBS 4FUCA 4MPXA 3AK5A 5LGOA 2PKAA 2B8OH 1DE7H 2IPQX 3LH1A 2ZIQH 3BIUH 3Q77A 2V3OH 2AIQA 3LONA 4NFEA 2KCPA 4NIVA 4KTSA 2BD5A 1T8LA 2ODPA 2H9EH 1TAWA 2R3UA 1GJCB 3F1SB 1ZRKA 1CGJE 4UFDH 3PRDA 1C2IA 4AFZA 3GY8A 1TQ0B 5HKKD 1G32B 2HVXA 2IJOB 1LPZB 3T5FH 5KEDA 4DIHH 3GY7A 1FY1A 2V3HH 2GV6A 1Y3YA 2R2MB 1S6HA 3OAAD 4A5TS 2KR7A 2BLWA 4ACBA 4B6FA 1GHVH 1S82A 1F0UA 2QYIA 3PM3A 2QCYA 1WU1A 3PLKA 5DN6D 3W94A 5F53A 3N7OA 2RG3A 3RUOA 1H9IE 1CGHA 6CHAC 4CR9A 3GICB 2VWNA 4XBBA 2VNTA 2BY5X 4Y11E 3RC4A 1QGFA 1FQ3A 3LJOA 2VIDA 1S0RA 3B9FH 1NS3A 1ZPCA 1UHBB 5L2ZH 4IN2A 2J34A 2GD4B 3RXCA 4D7GA 1UK3A 3HATH 1TGBA 1W3CA 1SQOA 2RDLA 2A7CA 1BHXF 3A85A 3TPIZ 2QN5T 4GCHF 1MZDA 4RN6A 3L3TA 3QN7A 2ULLA 2Z9GA 3MHWU 2ZFTA 3E90B 1KY9A 3CNRA 1Z8GA 4ISNA 4XSKU 4CH8B 3P17H 3RXLA 3RP2A 3UQVA 4BXSA 2ODYB 1C2EA 2AERH 2BD8A 3SU4A 4MNVA 1O2WA 1TNKA 3QK1A 4YESB 1MKWH 2HRVA 2BY8X 2ZQ1A 4X2VA 2ZGBH 2G5NA 5GCHF 1A0HB 4ZMAH 1QFKH 2DE9A 4INLA 4TYDA 3RXQA 1D3PB 1WQVH 2FX6A 2ZFQH 4O3TA 5C1UA 8ESTE 4BAOB 3RXGA 3P8GA 1KXEA 3ZYEA 5EJLA 1JRSA 2HLCA 1V2NT 1Z6EA 3NZIA 4MNXA 5KGOA 1C5XB 1TPPA 1TYNA 3U98H 1V2RT 1C1NA 1PPHE 1OWEA 1Z1JA 1W7XH 1CSOE 3SV6A 2IPHA 1ELDE 4Q7YA 3LOXA 2UUYA 8LPRA 3PB1E 3V13A 4R0IA 2W3IA 4F4OC 1GI6A 4AYYB 1J9CH 1TIOA 3OTPA 2R2WU 1IQFA 4GLYA 1WCZA 1F5LA 1OS8A 3MI4A 4X0WU 1P02A 4X1PU 1ZRBA 1SQTA 2G81E 1WAYB 1YLCA 2Z3CA 2WPHS 2O9QA 2OINA 1NESE 2FYRA 4K5ZA 4AGJA 1EOJA 2FOHA 2QAAA 1AVGH 4I8GA 3S7KB 3A8AA 1SG8B 2TGAA 3QTVH 1SB1H 3ODDA 1O5AB 6GCHG 3CP7A 1BTYA 1BQYA 1HAZB 2OC7A 2QXIA 1S83A 4Q63A 1RFNA 1DFPA 5IDKA 3UY9A 1T4UH 5EJ1A 2PKSC 1O3KA 3A83A 3KN2A 2FOMB 4BNRA 5DP9A 2WV5A 2F9NA 1KXAA 2O8WA 2ZECA 7LPRA 3E8LA 4YXWD 2M5TA 2OBOA 3R0FA 1O5FH 1P11E 5LPRA 1TA2A 2QY0B 1HRTH 1GVKB 2V35A 4JYUH 1O39A 4WMEA 1C1SA 4WF8A 2FOGA 1V2VT 1CVWH 1TONA 2QIQA 1BT7A 1TNHA 2HVYB 5A0AE 3RXBA 2WPIS 3EDXB 1V2PT 1ZGIA 3BTTE 2Z9JA 1QB6A 1GHBG 4JYTA 5JYIA 2C93B 1AZ8A 2W3KA 2WPKS 2W6ID 1XX9A 4XRNA 2P93A 1TALA 1DXWA 1L1GA 3OU0A 2ZF0H 5LPFA 1F5KU 3GCNA 3NKKA 1MTUA 2BOHB 4ISHH 5FX5A 4CBOA 2CHAC 1Y3XA 2RCEA 4B76A 1YYY1 4NG9H 2K1QA 5EQSA 2F4LA 4YT6H 3UAIC 1P9SA 1LPKB 2FEQH 2P16A 3PV2A 1TRMA 3AAUA 2A5KA 3ZVBA 2HPPH 1SOTA 1A61H 1CA0C 1H8DH 1KDQA 1BJVA 2BDHA 7KMEH 3S9BA 1ZTJA 1ORFA 3LGTA 2P59A 2TGTA 1OWDA 3GYLB 1QL7A 2OC1A 2ZTZA 2BM2A 5FCKA 1W0JD 1O2QA 2FTMA 1S81A 1UCYE 2NU0E 3H5CB 4Y0YE 2PKAB 4CREA 2Y7ZA 2GTBA 2XWBI 4FVDA 1EASA 3Q3YA 1ZMLA 3RLWH 1GCDA 8GCHG 2AEIH 1ELGA
chains in the Genus database with same CATH topology
3MQKC 2EQNA 3U28C 3UAIC 2HVYB 2V3MA 2EY4C 2RFKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQK C;  2EQN A;  3U28 C;  3UAI C;  2HVY B;  2V3M A;  2EY4 C;  2RFK C; 
#chains in the Genus database with same CATH topology
 2CF9 H;  1SMF E;  4I8H A;  3SJO A;  1THR H;  3MMG A;  3EE0 B;  3A7Y A;  4U01 A;  5T1V A;  3DD2 H;  2GKV E;  4RSP A;  2W5E A;  2WPM S;  4UE7 H;  2FTL E;  1WQS A;  3VB3 A;  1O3P B;  4X8S H;  5C1X A;  5DJ7 A;  4U30 A;  2Z9L A;  3MU4 A;  4WY3 A;  1V2L T;  1QTF A;  2J98 B;  1P2I A;  3PMH B;  2KCO A;  2AIP A;  2NU1 E;  3AAV A;  3EA8 A;  3C1K A;  4E05 H;  1H8E D;  3AW0 A;  3SGQ E;  1EFR D;  2O8L A;  3F9G A;  1V2Q T;  3ITI A;  1D6W A;  2RDE A;  4MQA A;  1ARB A;  2NU3 E;  5CDF E;  3SND A;  2BX3 A;  1D3T B;  1Z8R A;  1Q2W A;  1TB6 H;  3A8C A;  1C4U 2;  3KNX A;  4BTI B;  2HNT E;  4M7G A;  1TNI A;  5EOK A;  3TU7 H;  4YOG A;  1DM4 B;  4ZHM U;  1DY9 A;  3A7X A;  5E8E H;  3FN8 A;  1KSN A;  1GMC F;  5GIB A;  4X6N A;  1D4P B;  1IQI A;  5GJ4 B;  3M7Q A;  3V7T A;  3LGI A;  5TCA A;  2PFE A;  2YNA A;  3M35 A;  3VB5 A;  1OSS A;  3ZZB A;  1UK4 A;  3CS7 A;  1ZTL A;  4THN H;  1C2K A;  5JBA S;  1BBR H;  1O3L A;  1O38 A;  3BG4 C;  4INH A;  1XVO A;  4NA8 A;  4MTB A;  3ZVF A;  1N6X A;  1JXP A;  1GJB B;  2R3Y A;  4AFU A;  2XC0 A;  2PR3 A;  2PTN A;  1K1J A;  4OS5 A;  1YPK H;  1UVO A;  1LHG H;  3LGV A;  1FPH H;  3ZZ5 A;  1GHX H;  5J4Q A;  1YLD A;  1ZOM A;  4ZHL U;  2PWX A;  1GDQ A;  1P3C A;  4GAW A;  4J1Y A;  1LVO A;  5CE1 A;  1CHO G;  1SGY E;  2BD7 A;  5A8X A;  3S9C A;  4K60 A;  1P9U A;  1FY3 A;  1DSU A;  3IG6 B;  1H8I H;  4RKJ B;  1GBE A;  1C1W H;  1EQ9 A;  1AUJ A;  4IBL H;  1G2M A;  1DIT H;  4GHT A;  5GND A;  4B71 A;  2FOC A;  1QRX A;  1DUE A;  4F48 B;  3KHV A;  1P2J A;  4AG1 A;  3N99 A;  4JZD H;  1FMG A;  1OP0 A;  2CGA A;  1KIG H;  7GCH F;  1YBW A;  1MD8 A;  2AS9 A;  3OEE D;  4A92 A;  3GDV A;  2SGP E;  1AUT C;  2WZQ A;  3FP7 E;  1ARC A;  3N7E A;  3QX5 H;  3VB4 A;  4XOJ A;  1MQ6 A;  2EST E;  2JH0 D;  3KQC A;  6EST A;  1EZX C;  1CT2 E;  5E0J A;  4JCN A;  4CH2 B;  3ZZC A;  1GI9 B;  1HXF H;  1PPF E;  2BYA X;  1Y5U T;  2QF0 A;  5TCC A;  2I6Q A;  3URE A;  1MCV A;  3O8C A;  5HXF A;  1W0Z U;  1PFX C;  4CRG A;  2ZPS A;  2ZO3 H;  2ZC9 H;  1F7Z A;  1VJA U;  3SNE A;  1G3D A;  1N1L A;  2LNC A;  3PTN A;  2VU8 E;  2ZGH A;  1TNG A;  1TRY A;  5AFZ H;  1KYN A;  1PPB H;  1DDJ A;  5A09 A;  1ETT H;  1F2S E;  1CT4 E;  2TGD A;  4GSO A;  1OYT H;  4A1X A;  1BMN H;  3SOR A;  4Y8X A;  4LK4 A;  2R0K A;  1FJS A;  3MO3 A;  2XC5 A;  1J16 A;  1O3E A;  1YCP K;  5FPT A;  1O2R A;  1H9L B;  1WDI A;  3Q3X A;  1TMT H;  2UUJ B;  1AE8 H;  1HDT H;  1T8O A;  3TK6 A;  1U6Q A;  1ANB A;  3E16 B;  2JIZ D;  1O32 A;  4NIY A;  1GJ8 B;  4ZXX H;  1VIT G;  3RC5 A;  1LHF H;  1SSX A;  3OX7 U;  2H6M A;  2RA0 A;  1PQ7 A;  1GG6 B;  5IYT A;  5C2Z A;  2ZHW H;  1XXF A;  3SUF A;  1ABJ H;  1OP8 A;  4D7F A;  1XKB C;  1G3C A;  1BUI A;  3ATI A;  3W1E A;  2AHM E;  1A4W H;  2F9P A;  4XFQ A;  3DUX H;  5C5O A;  1YWU A;  3PRB A;  5EST E;  1G2L A;  4ASH A;  4AGK A;  1PQA A;  1GMD F;  1KXD A;  3PMA B;  1SR5 C;  2A4R A;  1B0E A;  1GJA B;  3RML H;  1LHE H;  1YPG H;  2HOB A;  1SGF A;  1W2K H;  3WW7 A;  2V6N A;  1QA0 A;  4AB9 A;  1DWC H;  5CHB A;  2TBS A;  2Q6F A;  1BA8 B;  1PQ8 A;  2PP6 A;  1QJ6 B;  3T28 A;  2GT8 A;  3UNS A;  1GCT B;  2BLO A;  2F43 B;  2WUB A;  4UON A;  3SU2 A;  2ZKS A;  5EU8 A;  3GY3 A;  1O2M A;  1C2F A;  1GVL A;  1EB2 A;  2FOD A;  3Q3K A;  3NWU A;  2VVC A;  1P3E A;  1A5H A;  1MTS A;  3P6Z B;  4A1T A;  3PO1 B;  1DWE H;  1O31 A;  1UVT H;  2OP9 A;  2R9P A;  4O3U A;  3SJK A;  2Z6B D;  3MH6 A;  1G3B A;  1K1P A;  2ZPQ A;  4GVU A;  1HNE E;  4TT3 D;  1Z1I A;  4Y79 A;  3V12 A;  4RT0 A;  1P2N A;  3A80 A;  1C1T A;  4JZF H;  1FDP A;  3B8J A;  4Y6D A;  3ZVE A;  1PPC E;  5FCR A;  1QUR H;  1T8M A;  1TGS Z;  1K9O E;  3VG8 A;  1O5C B;  3TGK E;  1BBR K;  4HZH A;  1QBN A;  1TNJ A;  1G37 A;  2QE7 D;  2ZDL A;  5H4I B;  4CHA C;  2BY6 X;  2VGC B;  3TJU A;  2WPJ S;  3UR9 A;  1TPA E;  5AVD A;  3SI4 H;  4A1V A;  4I8J A;  1DS2 E;  1DAN H;  2PSY A;  3UIR A;  4IMZ A;  5A0C A;  2F9B H;  1RTK A;  1YPJ H;  1Y5B T;  2CN0 H;  3E1X B;  3SUE A;  3QGJ A;  2BD2 A;  5JPM H;  1EZU C;  4YO9 A;  3H7O A;  4B6E A;  2SGF E;  1VJ9 U;  2SGE E;  5C20 A;  1J8A A;  2ANY A;  1BRC E;  1GJ9 B;  1KLI H;  4DOQ A;  1UTM A;  1F0S A;  4WH8 A;  3SO3 A;  1Z8I B;  3GY6 A;  3RXK A;  4K1T A;  4H6T A;  2VIW A;  1VCQ A;  2Q6D A;  3FAN A;  4FVB A;  4XBC A;  4MDS A;  1UTK A;  1P2Q A;  2FS8 A;  1O30 A;  4ABJ A;  1C5Q A;  2F83 A;  1M9U A;  5C94 A;  1W11 U;  3PWC A;  1NFW A;  4I86 A;  1NC6 A;  1COW D;  1GHZ A;  3GDS A;  1GBT A;  3SUD A;  4Y7B A;  2FDA A;  4KTU A;  4AOR A;  1SI5 H;  2ZHF H;  3F2G A;  1O36 A;  2UWL A;  1LQD B;  3SQE E;  5AHG H;  2PV9 B;  2L74 A;  2FI4 E;  2O8U A;  5JBT A;  1GI8 B;  1PQ5 A;  1IQK A;  1VR1 H;  3P8O A;  2UWP A;  1ELT A;  1A5I A;  1C5U A;  3RMO H;  5GWZ A;  1H4W A;  1LMW B;  3SGB E;  3NK8 A;  5CMX H;  1LTO A;  2GCT B;  3M61 U;  2UUK B;  1L4D A;  2QXG A;  3FOA A;  1AE5 A;  2EC9 H;  1UO6 A;  2XBY A;  3MWI U;  1HUT H;  2R0L A;  4U2W A;  4GCH G;  3SQH E;  3RXI A;  3A8D A;  2F9V A;  2BTC E;  2FZZ A;  4O03 A;  4O97 A;  4VGC C;  1ZSJ A;  3EST A;  2XND D;  3RXH A;  3DSP A;  2TGP Z;  4JYV H;  4OGX A;  2H9T H;  2KCA A;  4YLU A;  4FU8 A;  1FAX A;  1CT0 E;  1NZQ H;  3MNS A;  1SOZ A;  4IC6 A;  4D76 A;  1TAB E;  3Q00 A;  1NO9 H;  4ACA A;  1PPE E;  2D2D A;  4X6M A;  1LVB A;  1TMB H;  2YOL A;  1S6L A;  2QC2 A;  4FET A;  2AYW A;  1O3N A;  3BF6 H;  1NU9 A;  3ATL A;  1IQM A;  1IAU A;  3M7T A;  6CHA B;  4INK A;  1TRN A;  1UTP A;  5BRR E;  1SGE E;  3K6Z A;  3S0N A;  3KQ5 A;  2A31 A;  1NRN H;  3UB0 A;  2A32 A;  4WVP E;  1KXB A;  4ABD A;  1BB0 B;  4HI3 A;  4BOH A;  4ISI H;  4ZH8 A;  1TGN A;  5FX6 A;  3HK6 B;  1W14 U;  3ATK A;  2ZFP H;  1NRP H;  2KFW A;  3RC6 A;  4X1R U;  1YPL H;  2PHB A;  2ZGJ A;  2K8I A;  3UWJ H;  4BTT B;  1NRS H;  3TJO A;  2P8O C;  1QL9 A;  1LO6 A;  3D65 E;  4IW4 E;  3VB6 A;  4UFE H;  1GBJ A;  2Y7X A;  2A5A A;  3MU8 A;  5T6G A;  1O5B B;  3IWM A;  3RDZ A;  5ABW A;  1GHA G;  3FKS D;  1SGF G;  4AC9 A;  4HG6 A;  2BLQ A;  2GP9 B;  1EOL A;  2KAI A;  1NY2 2;  1XMN B;  1GBC A;  2ZGC A;  3FVF B;  5DG6 A;  4Z6A H;  4K2Y A;  1C5W B;  1SLW B;  4GHQ A;  2HPQ H;  1SGR E;  3A88 A;  1O0D H;  3N7D A;  3UNR A;  1O2Y A;  1TX8 A;  1MCT A;  2GCT C;  2ZDA H;  2FLB H;  4ABH A;  2J38 A;  4RI0 A;  1O3D A;  4CRF A;  1E38 B;  1EZS C;  4KKD A;  1AKS A;  1A1R A;  1FNI A;  1PJP A;  2XRC A;  3KCG H;  3SYJ A;  3QDZ B;  1MKX H;  2PGB B;  3M7U A;  4OS6 A;  1JOU B;  1KMH B;  1YPM H;  3M5N A;  1MTN B;  3ZIA D;  2ALV A;  4DII H;  3TVJ B;  2JH6 D;  5JDU B;  3F6U H;  3U8R H;  1RIW B;  1C5P A;  1EAI A;  1NBM D;  2Y5F A;  1NTP A;  2C4F H;  3K6Y A;  3OSY A;  4P02 A;  2SGD E;  3TIU A;  1OWI A;  4H42 U;  1QIX B;  2VGC C;  2F91 A;  1HIA A;  4LXB H;  4UFF H;  2CXV A;  1HB0 B;  2NU4 E;  1KTT B;  2TIO A;  3ZZ3 A;  1A5G H;  3NRL A;  3BTH E;  1GBB A;  1W0K D;  2KM0 A;  3RXV A;  3GCT G;  3GCH C;  3UOP A;  1GHB F;  1PPZ A;  2C90 B;  3A82 A;  3D23 A;  4NSV A;  2VIQ A;  1O3H A;  3EQ0 H;  2V3M A;  2HGT H;  1GBL A;  2C8Z B;  3MQK C;  1AY6 H;  1DUA A;  1TBZ H;  1FXY A;  3P92 A;  1FN8 A;  4DT4 A;  5C0T A;  1XVM A;  2QF3 A;  3TLO A;  1VIT H;  4Z0K A;  3ZVC A;  1UTQ A;  1D6R A;  5TJX A;  1THP B;  2BZ6 H;  2OK5 A;  1C2D A;  1VGC C;  2GZ9 A;  4YZU A;  4DG4 A;  1GBD A;  3MYW A;  1MQ5 A;  2PKS B;  2GX4 A;  5FBE A;  2PSX A;  3RU4 E;  4AB8 A;  2DE8 A;  2GV7 A;  1WBG B;  4ZKN U;  2XXL A;  3L6P A;  1NFX A;  3SNC A;  1C5S A;  2XWA A;  4CBN A;  5K0H A;  2Z9K A;  9LPR A;  4ABE A;  2WIN I;  4K3J A;  1HV7 A;  1O2U A;  3ELA H;  3TNT A;  2VIO A;  3ZV9 A;  5L6N H;  2ZI2 H;  5F6M A;  6LPR A;  3WY8 A;  3FAO A;  2QXH A;  2OBQ A;  3OY5 U;  3U8O H;  3LPR A;  1A0J A;  4Z1M D;  3ZYD A;  5A8Y A;  1W8B H;  3MNB A;  1FY5 A;  2ZFS A;  4FUB A;  1AMH A;  1D9I A;  2GJG A;  3K2U A;  2ZCH P;  3PTB A;  1JWT A;  3U1I B;  1NFY A;  2BY7 X;  1O3F A;  4ZAE A;  2XCN A;  3ATM A;  1AGJ A;  2WV9 A;  1L2E A;  1C5L H;  2ZFR H;  5F03 A;  1AI8 H;  4AFQ A;  4O9V A;  1W0Y H;  1BRB E;  1DPO A;  1SKY E;  2EEK A;  4J2Y B;  3ZVA A;  1C5Z B;  2LP6 A;  1EST A;  1KXF A;  1BJU A;  1MTN C;  2A5I A;  2Y82 A;  1LHD H;  2A7J A;  3QWC H;  2XBW A;  4E7R G;  1RIW C;  2ZU2 A;  1E36 B;  1KDQ B;  1AND A;  4NIW A;  3FZD A;  1TOM H;  2THF B;  2Y5G A;  4ZRO A;  1SHY A;  3A7V A;  1GI5 A;  5A8Z A;  4CHA B;  3SV2 H;  3I29 A;  3ZZ9 A;  5C0U A;  1V2K T;  3SU1 A;  5FPS A;  1WTG H;  1VZQ H;  1JBU H;  4D8N A;  1TGT A;  1WTH D;  3I78 A;  3D62 A;  1GBK A;  2PTC E;  1NRO H;  5EGM A;  1BTP A;  2ZHD A;  3U8T H;  1OX1 A;  1TX6 A;  3E6P H;  1G30 B;  2AMD A;  2FYQ A;  4NA7 A;  1YY3 A;  3KGP A;  2ZA5 A;  1EZQ A;  1SL3 A;  4NWK A;  1O5G H;  4FXG H;  1BHX B;  1BDA A;  1SLV B;  2BXU H;  1Q3X A;  1CQQ A;  1GJ4 H;  2PLX A;  4DT7 B;  1P09 A;  1S6F A;  4SGA E;  1E1Q D;  3NPS A;  1LVY A;  1YPH E;  5C1Y A;  4CRC A;  4FUJ A;  2RFK C;  1DLK B;  2BVR H;  5HGG A;  4M9F A;  3STI A;  1DIC A;  5FXL A;  4JZ1 A;  3SU3 A;  3T25 A;  1O3C A;  5EJZ A;  2WYG A;  4B2A A;  1EJA A;  2OQU A;  1ZZZ A;  4CR5 A;  3LC5 A;  4OS1 A;  3MTY A;  1C5T A;  3A87 A;  4Q7Z A;  1WXR A;  4BAH B;  3S9A A;  1GGD B;  5DSF A;  4LZ1 H;  1OYQ A;  1Z6J H;  1DT2 A;  3BTK E;  1S0Q A;  5DKM A;  3UR6 A;  5EW1 H;  1INC A;  3RU4 D;  2CJI A;  2G8T A;  4X1Q U;  1V3X A;  1UTN A;  1TE0 A;  1K0H A;  1QR3 E;  3L33 A;  2ANM H;  3TIT A;  3SNB A;  1HLT H;  5GDS H;  2ZHE H;  1K28 D;  2A2Q H;  5EOD A;  4CRD A;  1K1I A;  2GT7 A;  2OC8 A;  4JZI A;  3URD A;  1GBI A;  5CHA B;  3QO6 A;  1P06 A;  1HJA C;  4OS7 A;  4D9Q A;  4IMQ A;  1EP5 A;  2QF4 A;  4YOJ A;  3LGY A;  5E2O A;  3QZR A;  1UCY K;  3VGC B;  3VEQ B;  3F68 H;  1D3D B;  4NGA H;  2GDD A;  1ELF A;  2GDE H;  1ANE A;  5GXP A;  5C17 A;  1IQN A;  3GOV B;  2F9O A;  1FAK H;  4YT7 H;  1GDN A;  2VWM A;  1EJM A;  2BLV A;  4NA9 H;  5FBI A;  5SGA E;  3RXR A;  2BVX H;  1VCP A;  8KME 2;  1GBF A;  2H2Z A;  1HXE H;  4B2C A;  1BTX A;  2OQ5 A;  2F3C E;  2HNT F;  2P94 A;  2UUF B;  5I25 A;  1AWF H;  2OTV A;  1C9T A;  1GI1 A;  1SC8 U;  1O2Z A;  2ZG0 H;  3NUM A;  1AD8 H;  1O2X A;  2BD3 A;  4NZQ A;  1W10 U;  1CO7 E;  2H5D A;  1AO5 A;  2ZDK A;  2FOE A;  1W13 U;  2FES H;  1O2O A;  2ANK H;  1HPG A;  1YGC H;  4GUX A;  1E34 B;  5HYO A;  3A81 A;  2D26 C;  4ISO A;  1VGC B;  3M3T A;  1SLX B;  2J95 A;  3PRO A;  2VH0 A;  1GJ7 B;  1O37 A;  2VH6 A;  4BAK B;  1J17 T;  3SOS A;  2CK3 D;  4I32 A;  1ACB E;  1SGD E;  2J9N A;  1TWX B;  3VXF H;  1GI7 B;  3RXT A;  1O2J A;  1ZHR A;  3MU5 A;  3RMM H;  4B73 A;  4FUH A;  3FO8 D;  1O2K A;  2OCV B;  1BML A;  1HAO H;  4TWW A;  3GY5 A;  2C8X B;  1GJ6 A;  3LU9 B;  2OUA A;  2ALP A;  1CGI E;  4WMD A;  1P12 E;  3DFL A;  5F8T A;  3D49 H;  1SGT A;  1XUJ A;  3QLP H;  4AX9 H;  4X1N U;  2AMQ A;  4I7Y H;  1A46 H;  2JKH A;  5BPE A;  3E91 A;  5T6D A;  3SJ9 A;  1UTL M;  2Q1J A;  2JET C;  3VFE A;  3PMB B;  4I8L A;  1O2P A;  1Y3W A;  1T7C A;  1XM1 A;  4TPI Z;  1BRA A;  4UFG H;  5FHT A;  2PW8 H;  2ZTX A;  1GMD G;  1QBO A;  2LPR A;  4B1T A;  3ZV8 A;  3PYH A;  1Z8J B;  2B9L A;  3SU5 A;  2J2U A;  1SGP E;  3SI3 H;  3U69 H;  2O8M A;  2P8O B;  1TOC B;  3O8B A;  1S85 A;  4H4F A;  1K2I 1;  3I77 A;  1J14 A;  3U9A H;  3P8N A;  2FLR H;  4X2X A;  1O3I A;  2GCH G;  2XNI A;  2Z3E A;  5GCH G;  1C2H A;  2W7U A;  4R8T B;  1V6D A;  4AZ2 B;  5B6O A;  3AVZ A;  2PGQ B;  1C5O H;  2UWO A;  1NN6 A;  4WMF A;  3ZVG A;  1BMM H;  2B7D H;  4ZKR U;  2J98 A;  2ZU4 A;  4YLQ H;  2FXR A;  3HKJ B;  1NT1 A;  2BZA A;  1K22 H;  2BX4 A;  4K1E A;  1H9H E;  1YCP M;  1DLE A;  1MAY A;  1C2J A;  2CF8 H;  3RXS A;  3F9H A;  4IGD A;  2FOF A;  2XCF A;  4MNW A;  2BDY A;  2FI3 E;  3A86 A;  1C9P A;  1Y59 T;  4LOY H;  1DVA H;  3EGK H;  3LC3 A;  2BVS H;  3UPE A;  1O5D H;  3W95 A;  1P2K A;  3DT0 H;  5ESB A;  2ODQ A;  3BSQ A;  1FV9 A;  1TFX A;  5DP4 A;  2ZDN A;  4NSY A;  1XUG A;  3PMJ A;  2ZNK H;  3A7T A;  2TPI Z;  5DP3 A;  3LKW A;  3P8F A;  2V0B A;  2QGR A;  4MLF B;  2YMS C;  1FY4 A;  3GYM A;  4X2W A;  2A7H A;  1UCY H;  2G4U A;  8GCH F;  1IQJ A;  4ABF A;  5FL7 D;  4ASU D;  3OY6 U;  4B75 A;  1MAX A;  4AOQ A;  1YCP H;  2Z9I A;  4TY7 A;  4Y76 A;  5GPI B;  5EXL A;  4K69 A;  1P10 A;  1EPT B;  3BTM E;  2FP7 B;  3UWI A;  2GZ7 A;  3F9E A;  4RT1 A;  1AZZ A;  1TMU H;  3ZZD A;  1T4V H;  1ELE E;  1VCW A;  1MZA A;  3KID U;  1FN6 A;  4DVA U;  3WWF A;  2AGI X;  5DP6 A;  1O2S A;  4TY6 A;  3RM0 H;  1V2M T;  1P01 A;  1ZYO A;  3EYD A;  1ABI H;  1C1P A;  3EE7 A;  1V2O T;  1HCG A;  4K1S A;  1ZPB A;  5JB9 S;  1AHT H;  4KGA A;  1OWK A;  1ESB A;  1MAB B;  2VJ1 A;  3H7T A;  1UK2 A;  3P95 A;  2OLG A;  2BY9 X;  5KEC A;  1F92 A;  3UFA A;  1OKX A;  2B5T B;  1DWB H;  1YF4 A;  2FX4 A;  2BQ6 B;  2ASU B;  5E2P A;  2WHX A;  2WV4 A;  4Q4L A;  1GWA A;  1P8V C;  4X8V H;  2VIP A;  2ZQ2 A;  2NU2 E;  1MTV A;  1SHH B;  2SNW A;  5I46 H;  3BN9 A;  3O8D A;  1BMF D;  3A7Z A;  1O3B A;  3DSG A;  2P95 A;  3OTJ E;  1TQ7 B;  1EX3 A;  1PYT D;  3BTD E;  5EPN A;  1N6Y A;  2J97 A;  2ZCL P;  3V3M A;  1BTZ A;  4XE4 A;  1GJD B;  1O3O A;  1TPS A;  3UNQ A;  4IN1 A;  1TGC A;  2VWL A;  1O2I A;  1CE5 A;  1FZZ A;  2G51 A;  2EA3 A;  3LT3 A;  1HBT H;  2WUC A;  3KQB A;  3MU1 A;  2HLD D;  2QA9 E;  2FO9 A;  2ZWL H;  4XDE A;  1GMH G;  1GBH A;  1NU7 B;  1LPG B;  1CHO F;  3MNX A;  3GS9 A;  2SGA A;  5DPA A;  1HAI H;  4ISL A;  1OP2 A;  1C1M A;  1GI0 A;  1MH0 A;  3SZE A;  1RGQ A;  2GMT B;  5EIY A;  1NPM A;  4X8U H;  1HGT H;  2W7S A;  1Q31 A;  3UQO A;  7GCH G;  2J94 A;  1HYL A;  1QQ4 A;  1L4Z A;  3QTO H;  4NIX A;  2SNV A;  1GL1 A;  5K7R A;  1ETS H;  2QV1 A;  2P3T B;  2YNB A;  3T29 A;  4UEH H;  4FU9 A;  2HAL A;  2ZFF H;  3F0P A;  4ZKS U;  2EI7 A;  3F9F A;  1GI3 A;  1K1L A;  1SVP A;  2G52 A;  2ZHQ H;  3M37 A;  4WXV A;  3VPK A;  2Z7F E;  1NRQ H;  4AYV B;  3ZZA A;  3VXE H;  1AFQ B;  4VGC B;  1KXC A;  1EAU A;  1AIX H;  1HJA B;  1QA7 A;  3UUZ A;  1C5Y B;  1MD7 A;  1E37 B;  4NFF A;  1GVZ A;  1IQH A;  4E7N A;  1ZTK A;  4BAQ B;  1BTW A;  1JIM A;  4ABI A;  1SPJ A;  2OD3 B;  4FOU C;  7EST E;  3GCH B;  1DST A;  3KQE A;  3MH7 A;  1OWH A;  1TBR H;  4CRA A;  1RJX B;  5EW2 H;  3ZZ4 A;  2FIR H;  4WWY A;  4JMY A;  1AB9 C;  1TPO A;  5C67 A;  1N8O B;  3SV8 A;  1A7S A;  2ZGX H;  1SFQ B;  2BDC A;  2BD9 A;  2ZDV H;  1FIZ A;  3M3V A;  2CMY A;  3KEE A;  1EXF A;  3SW2 B;  3GY2 A;  4BAM B;  3BEU A;  1O2V A;  5EPY A;  4YTA A;  2BQW B;  1Z7K A;  2BDG A;  1GDU A;  2BHG A;  2ZEB A;  3SU0 A;  1IHT H;  2BB4 A;  3PLB A;  2NWN A;  4F49 A;  2F9U A;  3DFJ A;  1O35 A;  1FUJ A;  1O2T A;  1BIT A;  1C5R A;  1YLN A;  2A45 B;  5HIZ A;  1Y8T A;  4Q7X A;  4BTU B;  3ZZ7 A;  4DY7 B;  3MO9 A;  3RU4 T;  1ZLR A;  2BDI A;  1W12 U;  4Y71 A;  5EQQ A;  3GCT F;  2B0F A;  1C4V 2;  3BTQ E;  3MH5 A;  4FUE A;  2A0Q B;  1LKA A;  1O3M A;  2H5C A;  1P04 A;  1XUH A;  4IS5 A;  4PRO A;  1Y5A T;  1QCP A;  1KTS B;  2AGE X;  5E0G A;  3R3G B;  3BV9 B;  2WSS D;  1A2C H;  1C5N H;  2A2X H;  1THS H;  3A89 A;  2WYJ A;  1ZSK A;  1QRZ A;  1IQE A;  3ZZ8 A;  5EQR A;  2AH4 X;  5DP5 A;  9EST A;  1UMA H;  3S7H B;  3AW1 A;  4ABG A;  3SNA A;  1ZPZ A;  3RLY H;  3V0X A;  2JJ2 D;  1FLE E;  1EB1 H;  1YPE H;  4MG3 A;  4FUF A;  1IOE A;  3FFG A;  4GPG A;  4X1S U;  5JB8 S;  1C2L A;  1QJ1 B;  2ZCK P;  2STB E;  2IOT A;  4JK5 A;  1SFI A;  3T62 A;  1FI8 A;  4WJG 2;  4LZ4 B;  2FOB A;  3M5M A;  2Q6G A;  3SV9 A;  1T8N A;  2C8Y B;  1HAV B;  3STJ A;  1QBV H;  3TJV A;  4Y8Y A;  3F2H A;  1XXD A;  2A4G A;  2V7Q D;  4Y7A A;  3KYG A;  4DW2 U;  1B5G H;  3GDU A;  3OEH D;  2JH5 D;  3A7W A;  4YOI A;  1P57 B;  2KZ4 A;  3RXU A;  3SBK A;  2RA3 A;  3TK9 A;  4ZHA A;  4CRB A;  1T31 A;  3SGA E;  1MU8 B;  1ZHM A;  1BCU H;  1CU1 A;  1MKX K;  1CBW C;  3PV4 A;  3F0O A;  3SN8 A;  2A4Q A;  1P0S H;  5EXM A;  3TGJ E;  1C1U H;  4I8K A;  2J92 A;  3T2N A;  6GCH F;  2JET B;  2C8W B;  3SHA H;  5FPY A;  1AN1 E;  1TA6 A;  1SGC A;  1L1J A;  1O3J A;  1E1R D;  3M5O A;  3KL6 A;  4B2B A;  3A8B A;  4ZKO U;  4Q80 A;  1V2W T;  1WUN H;  3FZZ A;  4HTC H;  3PLP A;  4X6P A;  2W6J D;  2WPD D;  4KEL A;  3RXF A;  1A0L A;  2L6O A;  3RXM A;  1A3B H;  1EPT C;  2XW9 A;  1C2G A;  3HGN A;  2GMT C;  3JZ2 B;  1QL8 A;  3OYP A;  1UW7 A;  1JRT A;  3BEF B;  3DA9 B;  1ZGV A;  1TX7 A;  3HK3 B;  1HFD A;  1BRU P;  3A84 A;  3SUG A;  1ANC A;  1SQA A;  3RXP A;  4A6L A;  1UTO A;  1LCY A;  1AKS B;  1O3G A;  1ELB A;  1AQ7 A;  1GL0 E;  1QHR B;  1D3Q B;  3SV7 A;  3E3T A;  1QRW A;  1YKT A;  1E0F D;  2J5U A;  4MNY A;  5AFY H;  4HFP B;  4JZE H;  2OXS A;  1TBQ H;  4H6S B;  4XBD A;  2GZ8 A;  4AFS A;  1UVS H;  1VKY A;  3BG8 A;  2VIV A;  1UTJ A;  4HGC A;  1AU8 A;  3TGI E;  4UD9 H;  1O33 A;  1K1M A;  2ZU1 A;  4DUR A;  1F0T A;  3OE7 D;  4TPY A;  1HAP H;  3H09 A;  4YM9 A;  1EUF A;  2BDB A;  1O2L A;  1ID5 H;  2VB0 A;  1TLD A;  5G4B A;  4Y8Z A;  3MFJ A;  1IQL A;  1AVW A;  3T26 A;  2ZTY A;  4BAN B;  5HMA A;  1YPH C;  1O2N A;  1SQR A;  4UDW H;  4ZUH A;  5C3N A;  2ILN A;  1L0Z A;  1F0R A;  4DJZ B;  2EY4 C;  1NFU A;  5LPE A;  3S69 A;  1K21 H;  5A2M H;  1V2T T;  2BXT H;  1CBW B;  3JZ1 B;  2FI5 E;  1HJ8 A;  3URC A;  1GBM A;  1PYT C;  1TNL A;  3GIS B;  1H8H D;  1N8O C;  3QUM P;  1C1Q A;  2EQN A;  1G3E A;  1FX0 B;  2XBX A;  1MU6 B;  3MO6 A;  1BTU A;  1K1N A;  5DP7 A;  5DP8 A;  3RXO A;  1C5M D;  3TNS A;  1A3E H;  3LIW A;  3LGU A;  2SGQ E;  1W7G H;  1EAW A;  2OC0 A;  2CHA B;  4FUD A;  5L2Y H;  1DX5 M;  2Y5H A;  1C5V A;  3E0N B;  3KF2 A;  1H1B A;  2ZDM A;  4JK6 A;  1RRK A;  2H1U A;  3OFN D;  4OS4 A;  3TH3 H;  2FM2 A;  5J4S A;  2G5V A;  3TH4 H;  2XOK D;  5AF9 H;  1OWJ A;  2QXJ A;  1DY8 A;  4MPU A;  1V2J T;  1UHB A;  1UVP A;  1JIR A;  1ZMJ A;  1HAV A;  1NBM E;  1GHA F;  1AVX A;  3F2F A;  3HGP A;  1WV7 H;  1GPZ A;  2K0Q A;  1O3A A;  3RM2 H;  1CA8 B;  1K1O A;  3U1J B;  1S84 A;  1CA0 B;  4X2Y A;  5A0B A;  4XD7 D;  4FUI A;  2STA E;  2BOK A;  3PO1 C;  2ZPR A;  3EA7 A;  1LVM A;  1ELC A;  4NWL A;  1AFE H;  1O2G H;  4Y10 E;  3UOU A;  1GI4 A;  3GCO A;  1FIW A;  1L1N A;  4ABA A;  1ZR0 A;  1SLU B;  1ZJD A;  3TJN A;  3QGN B;  3LGW A;  3T27 A;  5JBC S;  3SU6 A;  5HM9 A;  2FS9 A;  3DSO A;  1AFQ C;  5LH8 A;  5CHA C;  1JMO H;  3PWB A;  2BQ7 B;  5EG4 A;  1BZX E;  1GHW H;  1QNJ A;  3ZZ6 A;  3SZN A;  3HKI B;  2A1D B;  2XC4 A;  1MKW K;  2YMS D;  3NCL A;  4ZCN A;  3DHK H;  4WXI A;  2QF5 A;  1KLJ H;  1GMC G;  1FPC H;  3ATW A;  5HM2 A;  2J4I A;  3E0P B;  2GVF A;  3ZVD A;  2SFA A;  1B7X B;  1P03 A;  2I6S A;  1C4Y 2;  3SJ8 A;  3EA9 A;  2O8T A;  2H9H A;  1C1R A;  1X7A C;  3BTW E;  4K8Y A;  1Y3V A;  1ELV A;  1DWD H;  1C1O A;  1QJ7 B;  4A7I B;  1F5R A;  2FPZ A;  3RXA A;  2GGV B;  4OS2 A;  3M36 A;  1CHG A;  1HJ9 A;  1UJ1 A;  3BEI B;  3KQD A;  3ODF A;  1ESA A;  4X8T H;  3RXE A;  4Y0Z E;  1OXG A;  1MMJ N;  5DGJ A;  1SGN E;  1YP9 A;  1NM6 A;  2ANW A;  4KTC A;  4BXW A;  5B6L A;  1UVU H;  3DCL A;  1YC0 A;  3C27 B;  1QB1 A;  1O34 A;  1ZHP A;  1MUE B;  1BOQ A;  2GCH F;  4EST E;  1E35 B;  4RKO B;  4B74 A;  5PTP A;  1EP6 A;  5F8X A;  4ZXY H;  2JJ1 D;  5EXN A;  1V2S T;  2EI6 A;  4IC5 A;  3MH4 A;  3CEN A;  5IK2 D;  2G55 A;  5T3H A;  1GBA A;  2AMP A;  1GJ5 H;  1QQU A;  2FOA A;  2VIN A;  3PV5 A;  3RXJ A;  3U28 C;  3VB7 A;  3G01 A;  4P00 A;  4E06 H;  4OGY A;  3TK5 A;  2FWW A;  1EJN A;  1C2M A;  2M2A A;  2VVV A;  1FY8 E;  1P2O A;  3WWB A;  1G9I E;  4FU7 A;  2G4T A;  2LEL A;  3NXP A;  3F3B A;  1T32 A;  1AB9 B;  1QZ8 A;  1XUF A;  2IN2 A;  3BTG E;  4F55 A;  1BMA A;  1RTL A;  5DK1 A;  2W26 A;  3FP8 E;  1LQE A;  2IJD 1;  2G00 A;  5FAH A;  1IQG A;  4D9R A;  3LH3 A;  2Y80 A;  3SHC H;  4MPV A;  1LHC H;  4DCD A;  1HAH H;  4TSF D;  1AWH B;  2BDA A;  1HAY B;  2D8W A;  4K8B A;  1GCT C;  1S5S A;  2FMJ A;  3KYF A;  1RS0 A;  1WYK A;  3TH2 H;  2Y6T A;  4FUG A;  2A4O A;  1BTH H;  4MVN A;  3AAS A;  2C3S A;  2ZP0 H;  1GGD C;  1HIA B;  1Y3U A;  2BMG B;  1SGI B;  2CV3 A;  1O2H A;  1SBW A;  4WH6 A;  2XBV A;  3BTE E;  3FP6 E;  4NZL A;  1OHH D;  1VIT F;  1ZJK A;  2JDI D;  2PUX B;  1MBQ A;  5HIY A;  2BD4 A;  1NRR H;  3QZQ A;  3SJI A;  2ZZU H;  4ABB A;  5DO4 H;  2HWL B;  3RXD A;  1EAT A;  2XYA A;  1EAX A;  1XKA C;  2Z94 A;  3LJJ A;  4MPW A;  1WOF A;  2WPL S;  3IIT A;  1EPT A;  5L30 H;  1OOK B;  2D1J A;  4DGJ A;  2YMS B;  2VWO A;  3Q76 A;  1RD3 B;  1PPG E;  3VGC C;  3K9X B;  2HNT C;  2VBC A;  2ZU3 A;  4TWY A;  4U32 A;  3B23 B;  1ZMN A;  2DUC A;  2KX4 A;  1O5E H;  1FON A;  4SGB E;  1GHY H;  1HAX B;  2AGG X;  3M5L A;  5T6F A;  5E0H A;  2KCY A;  5ETX A;  1WSS H;  4AN7 A;  3MNC A;  2AFQ B;  2P3U B;  1RXP A;  3M3S A;  3HPT B;  1LKB A;  3BIV H;  3ENS B;  3GY4 A;  3RMN H;  1J15 A;  1IHS H;  3UTU H;  3O8R A;  2EI8 A;  1LDT T;  5C5N A;  1GMH F;  1Z71 A;  3LDX H;  1RTF B;  1GG6 C;  1V2U T;  4KP0 A;  1ZSL A;  2PUQ H;  2Z3D A;  1P05 A;  4I31 A;  1DXP A;  1YM0 A;  1P2M A;  3MOC A;  4NCY A;  5F8Z A;  1ETR H;  1OPH B;  3MU0 A;  3EAJ A;  3CS0 A;  2VVU A;  1KLT A;  1EKB B;  1MTW A;  1QB9 A;  4X6O A;  3K65 B;  1G36 A;  1GI2 A;  4Q2K A;  2XTT B;  1C1V H;  1XUK A;  1BBR E;  1DOJ A;  2P3F H;  4I33 A;  2Y81 A;  2TRM A;  4QT8 C;  1HAG E;  1QY6 A;  3BG4 B;  1SGQ E;  1XUI A;  4OM9 A;  1B0F A;  4AG2 A;  2ZU5 A;  2KAI B;  3P70 B;  1BIO A;  1MBM A;  3BTF E;  1E79 D;  1ELA A;  5JBB S;  4FUC A;  4MPX A;  3AK5 A;  5LGO A;  2PKA A;  2B8O H;  1DE7 H;  2IPQ X;  3LH1 A;  2ZIQ H;  3BIU H;  3Q77 A;  2V3O H;  2AIQ A;  3LON A;  4NFE A;  2KCP A;  4NIV A;  4KTS A;  2BD5 A;  1T8L A;  2ODP A;  2H9E H;  1TAW A;  2R3U A;  1GJC B;  3F1S B;  1ZRK A;  1CGJ E;  4UFD H;  3PRD A;  1C2I A;  4AFZ A;  3GY8 A;  1TQ0 B;  5HKK D;  1G32 B;  2HVX A;  2IJO B;  1LPZ B;  3T5F H;  5KED A;  4DIH H;  3GY7 A;  1FY1 A;  2V3H H;  2GV6 A;  1Y3Y A;  2R2M B;  1S6H A;  3OAA D;  4A5T S;  2KR7 A;  2BLW A;  4ACB A;  4B6F A;  1GHV H;  1S82 A;  1F0U A;  2QYI A;  3PM3 A;  2QCY A;  1WU1 A;  3PLK A;  5DN6 D;  3W94 A;  5F53 A;  3N7O A;  2RG3 A;  3RUO A;  1H9I E;  1CGH A;  6CHA C;  4CR9 A;  3GIC B;  2VWN A;  4XBB A;  2VNT A;  2BY5 X;  4Y11 E;  3RC4 A;  1QGF A;  1FQ3 A;  3LJO A;  2VID A;  1S0R A;  3B9F H;  1NS3 A;  1ZPC A;  1UHB B;  5L2Z H;  4IN2 A;  2J34 A;  2GD4 B;  3RXC A;  4D7G A;  1UK3 A;  3HAT H;  1TGB A;  1W3C A;  1SQO A;  2RDL A;  2A7C A;  1BHX F;  3A85 A;  3TPI Z;  2QN5 T;  4GCH F;  1MZD A;  4RN6 A;  3L3T A;  3QN7 A;  2ULL A;  2Z9G A;  3MHW U;  2ZFT A;  3E90 B;  1KY9 A;  3CNR A;  1Z8G A;  4ISN A;  4XSK U;  4CH8 B;  3P17 H;  3RXL A;  3RP2 A;  3UQV A;  4BXS A;  2ODY B;  1C2E A;  2AER H;  2BD8 A;  3SU4 A;  4MNV A;  1O2W A;  1TNK A;  3QK1 A;  4YES B;  1MKW H;  2HRV A;  2BY8 X;  2ZQ1 A;  4X2V A;  2ZGB H;  2G5N A;  5GCH F;  1A0H B;  4ZMA H;  1QFK H;  2DE9 A;  4INL A;  4TYD A;  3RXQ A;  1D3P B;  1WQV H;  2FX6 A;  2ZFQ H;  4O3T A;  5C1U A;  8EST E;  4BAO B;  3RXG A;  3P8G A;  1KXE A;  3ZYE A;  5EJL A;  1JRS A;  2HLC A;  1V2N T;  1Z6E A;  3NZI A;  4MNX A;  5KGO A;  1C5X B;  1TPP A;  1TYN A;  3U98 H;  1V2R T;  1C1N A;  1PPH E;  1OWE A;  1Z1J A;  1W7X H;  1CSO E;  3SV6 A;  2IPH A;  1ELD E;  4Q7Y A;  3LOX A;  2UUY A;  8LPR A;  3PB1 E;  3V13 A;  4R0I A;  2W3I A;  4F4O C;  1GI6 A;  4AYY B;  1J9C H;  1TIO A;  3OTP A;  2R2W U;  1IQF A;  4GLY A;  1WCZ A;  1F5L A;  1OS8 A;  3MI4 A;  4X0W U;  1P02 A;  4X1P U;  1ZRB A;  1SQT A;  2G81 E;  1WAY B;  1YLC A;  2Z3C A;  2WPH S;  2O9Q A;  2OIN A;  1NES E;  2FYR A;  4K5Z A;  4AGJ A;  1EOJ A;  2FOH A;  2QAA A;  1AVG H;  4I8G A;  3S7K B;  3A8A A;  1SG8 B;  2TGA A;  3QTV H;  1SB1 H;  3ODD A;  1O5A B;  6GCH G;  3CP7 A;  1BTY A;  1BQY A;  1HAZ B;  2OC7 A;  2QXI A;  1S83 A;  4Q63 A;  1RFN A;  1DFP A;  5IDK A;  3UY9 A;  1T4U H;  5EJ1 A;  2PKS C;  1O3K A;  3A83 A;  3KN2 A;  2FOM B;  4BNR A;  5DP9 A;  2WV5 A;  2F9N A;  1KXA A;  2O8W A;  2ZEC A;  7LPR A;  3E8L A;  4YXW D;  2M5T A;  2OBO A;  3R0F A;  1O5F H;  1P11 E;  5LPR A;  1TA2 A;  2QY0 B;  1HRT H;  1GVK B;  2V35 A;  4JYU H;  1O39 A;  4WME A;  1C1S A;  4WF8 A;  2FOG A;  1V2V T;  1CVW H;  1TON A;  2QIQ A;  1BT7 A;  1TNH A;  2HVY B;  5A0A E;  3RXB A;  2WPI S;  3EDX B;  1V2P T;  1ZGI A;  3BTT E;  2Z9J A;  1QB6 A;  1GHB G;  4JYT A;  5JYI A;  2C93 B;  1AZ8 A;  2W3K A;  2WPK S;  2W6I D;  1XX9 A;  4XRN A;  2P93 A;  1TAL A;  1DXW A;  1L1G A;  3OU0 A;  2ZF0 H;  5LPF A;  1F5K U;  3GCN A;  3NKK A;  1MTU A;  2BOH B;  4ISH H;  5FX5 A;  4CBO A;  2CHA C;  1Y3X A;  2RCE A;  4B76 A;  1YYY 1;  4NG9 H;  2K1Q A;  5EQS A;  2F4L A;  4YT6 H;  3UAI C;  1P9S A;  1LPK B;  2FEQ H;  2P16 A;  3PV2 A;  1TRM A;  3AAU A;  2A5K A;  3ZVB A;  2HPP H;  1SOT A;  1A61 H;  1CA0 C;  1H8D H;  1KDQ A;  1BJV A;  2BDH A;  7KME H;  3S9B A;  1ZTJ A;  1ORF A;  3LGT A;  2P59 A;  2TGT A;  1OWD A;  3GYL B;  1QL7 A;  2OC1 A;  2ZTZ A;  2BM2 A;  5FCK A;  1W0J D;  1O2Q A;  2FTM A;  1S81 A;  1UCY E;  2NU0 E;  3H5C B;  4Y0Y E;  2PKA B;  4CRE A;  2Y7Z A;  2GTB A;  2XWB I;  4FVD A;  1EAS A;  3Q3Y A;  1ZML A;  3RLW H;  1GCD A;  8GCH G;  2AEI H;  1ELG A; 
#chains in the Genus database with same CATH homology
 3MQK C;  2EQN A;  3U28 C;  3UAI C;  2HVY B;  2V3M A;  2EY4 C;  2RFK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...