3U28C

Crystal structure of a cbf5-nop10-gar1 complex from saccharomyces cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
PPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA ribonucleoprotein complex subunit 4
publication title Reconstitution and structural analysis of the yeast box H/ACA RNA-guided pseudouridine synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase/protein binding
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3u28C00
3U28C 2V3MA 2HVYB 3UAIC 2EY4C 2RFKC 2EQNA 3MQKC
chains in the Genus database with same CATH superfamily
2CXVA 3M5MA 1AO5A 1XUIA 1S81A 1S6LA 2VWLA 1CHGA 2WPMS 2ZHQH 2FS9A 3LJJA 4FVDA 2A5KA 5A0AE 2XCFA 2W7SA 1O3GA 2F9OA 1ZSJA 2RG3A 3TK9A 1SHHB 3SUEA 1OXGA 5DP8A 1L1GA 2FP7B 2R0LA 5C0UA 1WDIA 3UNQA 3UQOA 1P57B 1DSTA 4R8TB 1RIWC 3PMBB 1LHFH 1TABE 2CF9H 4GPGA 4NZQA 4BNRA 1P2OA 4Y0ZE 1JIRA 1GBCA 3QUMP 2XW9A 2BVSH 4GSOA 3UY9A 3VB6A 5K0HA 2CF8H 1Y3UA 1YPJH 1PFXC 2C93B 3E8LA 1BQYA 2ZF0H 4TSFD 5E0HA 1KSNA 1P12E 2ZFPH 1GJ8B 1V2QT 2SGAA 4FUCA 1QY6A 3KF2A 2ZFFH 4FUDA 1ZPBA 1P2JA 3MOCA 5F53A 3F2FA 1YCPM 2KM0A 2FM2A 2W3IA 1AFEH 2V0BA 1GI4A 1SQOA 1TRYA 1O3HA 2SGQE 2BQWB 2HLCA 2BHGA 4FUEA 8GCHG 1OP8A 2UWLA 1DT2A 2OINA 1FDPA 1G32B 2Z9GA 3QGJA 4FETA 4YO9A 4ZH8A 2QF5A 1GCDA 2ZHEH 1VCQA 5DP5A 1CA0B 2GJGA 1E0FD 1C5OH 2ZCLP 4B1TA 4D9RA 3SU5A 1NU9A 1QURH 1BCUH 1VJ9U 3TVJB 1PYTD 1AVXA 3LU9B 3RC4A 4FUGA 1K2I1 1OWIA 3UUZA 3OEED 1UVTH 2XCNA 4D9QA 1HB0B 2FS8A 3BG8A 4FOUC 2A7HA 1GMCF 3U1JB 2P93A 1BMFD 4HI3A 4NIXA 2A7CA 2FYRA 1BMLA 4I7YH 1BIOA 1RD3B 4JMYA 3UWIA 1ESTA 4AB8A 3FP8E 1GMDF 1XUGA 4A1TA 2PSYA 3FAOA 1SQRA 1XXFA 1MKXH 4Y76A 3ZIAD 1BTPA 2Z9LA 2BLWA 4OS4A 1G3BA 3M61U 1MCVA 1UTQA 1ELEE 2GZ7A 4GHQA 5DP3A 2F83A 2FEQH 3GY2A 4KELA 1KIGH 1VITG 3TGKE 1E1RD 2CN0H 1K21H 4ABIA 3MNCA 5FL7D 3S9CA 1C2LA 1MUEB 5T6FA 1ZHPA 1C9TA 2VIDA 2G51A 4Y8XA 2G5NA 4ABGA 1ELAA 3S7KB 3AK5A 3ATLA 2H9HA 4PROA 1AVGH 1CHOF 1T8LA 2XC0A 1NS3A 1P9UA 1TX7A 1UVUH 2ZDAH 1MBQA 1AMHA 1W0KD 2J97A 2FOMB 1JRTA 3HKJB 2OQ5A 1H9LB 1UCYH 2AGGX 2AGIX 1O2TA 3ZZ5A 6ESTA 3FP6E 2HPPH 1CO7E 4WY3A 5C67A 2PKAA 2QXJA 2Y5HA 1FN6A 1B0EA 3CNRA 3ZV8A 4YXWD 1CA0C 4YESB 1WUNH 2Z9IA 3M5NA 4BAMB 3B23B 1ID5H 3S9AA 2STAE 5DKMA 2J95A 4A7IB 1TIOA 2SGPE 1RXPA 2NU2E 2ZFSA 3P6ZB 1O3DA 1S6FA 2PGBB 1CBWB 1THSH 3STIA 1P06A 2TIOA 1P11E 1KY9A 2BX4A 4NCYA 3URCA 4WMFA 2O8UA 2AEIH 2R0KA 1O2RA 1FX0B 2GP9B 1O3MA 1LMWB 2HNTF 5AHGH 6CHAB 1LHGH 2PLXA 5DJ7A 4X1NU 1O3LA 4TWWA 5T3HA 2JH0D 2EI6A 2C8XB 3ZZ4A 4NA9H 5EJZA 5J4QA 3TNTA 1O3PB 3BIVH 2ZKSA 1C2KA 3U28C 4WMEA 1FIZA 2GGVB 3N7OA 1ANEA 3TPIZ 3MO3A 4NSVA 5LPEA 1TPPA 1SG8B 2Y82A 2M2AA 2Z9JA 4INLA 2J9NA 1GI2A 2H6MA 4RN6A 2KX4A 2WINI 1P3CA 3DFLA 1SGNE 1RTKA 2GT7A 1HRTH 3AAVA 4ABHA 1Y5BT 1MAYA 3S0NA 2HPQH 4Q80A 4BAQB 1HDTH 1FPHH 1V2UT 1CQQA 1MZAA 2GCHG 1O5CB 1E79D 5TCCA 5HM9A 3RLWH 4CBNA 2OXSA 1O2LA 1HGTH 3EA8A 1DICA 3SNCA 1UK3A 4DCDA 2FI5E 2ALPA 1Z8IB 2WYGA 1ZHRA 1W7XH 3E90B 3GDVA 4YM9A 1O5FH 1GHZA 1O3KA 1KXEA 1YCPH 1O3CA 1FY8E 1B5GH 2BZ6H 2R2MB 1BOQA 4MPUA 5B6OA 1NBME 2AGEX 2R3YA 2YMSB 3P8FA 4CRGA 2C90B 2OLGA 2I6SA 3V7TA 2FLRH 3FFGA 5E0GA 3SUFA 4AGJA 1SVPA 2F4LA 2PP6A 2JH6D 2WV9A 1CBWC 4OGXA 4B6EA 2ZHDA 3ENSB 1XUKA 1DWCH 5AVDA 1F0SA 1RGQA 2FODA 2PR3A 4LZ1H 5H4IB 4A6LA 1C2HA 1QHRB 4GHTA 2WUCA 2IJOB 3SGBE 5FXLA 1K28D 2A32A 6CHAC 2YNAA 3Q3YA 5LPRA 3F6UH 6GCHG 2ODYB 1WCZA 1C5YB 8ESTE 2ZWLH 4ABEA 4Z1MD 3UNSA 1G9IE 4CR9A 1UHBA 2GCTB 3SJ8A 2R2WU 1T8OA 3M36A 3CS0A 3M3TA 4F48B 2O8LA 3RXJA 5HXFA 2L74A 3WW7A 1ELTA 1AWFH 1KXAA 2QF3A 3P8NA 1SI5H 3K2UA 4K3JA 1FNIA 1AHTH 3K6YA 4IMZA 1AQ7A 1A2CH 1GHAF 3FVFB 1M9UA 1G30B 4K2YA 3SO3A 1NFUA 1XKBC 4VGCB 4UE7H 2NU4E 1WAYB 2GV7A 3TNSA 1BJVA 1ZYOA 1ZMJA 4THNH 3SUGA 1CVWH 2FXRA 1LQDB 5L2ZH 1GI3A 3RMMH 2PUXB 4RSPA 5G4BA 2ZU2A 5A0BA 3S9BA 3F0PA 1GMHG 1O3AA 2Z3CA 3F9EA 1TONA 1QL9A 4B73A 2W3KA 3E1XB 3LC5A 1W13U 3BTDE 2VWMA 4ZKSU 4Y7AA 1GJ5H 2ZO3H 3HGNA 1GDUA 1DLEA 2VVCA 1TMBH 3SW2B 2YMSC 3RU4D 5L6NH 3SJOA 1KDQA 2FOEA 2BY9X 1MBMA 1P2IA 1QJ6B 1A3EH 2GD4B 1BHXF 3IWMA 1HIAB 2K8IA 4YT6H 3MU1A 1NRNH 1TYNA 1ZJDA 2ESTE 4ESTE 3R0FA 1AI8H 1F5LA 1A5HA 2OC1A 5JBCS 1GJ9B 2Y80A 1COWD 2J98A 4JZ1A 4AG2A 2ZZUH 1H9HE 3EAJA 1C1MA 2SFAA 4ZKNU 1YLCA 1C2FA 4D8NA 3U1IB 3RXIA 3UPEA 2KAIB 1AWHB 4KTCA 3DA9B 1DLKB 2W5EA 3BTFE 1P0SH 3SI4H 3GDSA 1GMHF 2GCTC 2WPLS 1W10U 1WTHD 2PHBA 1GI0A 4MPXA 1EB2A 2A45B 1C1VH 2VWNA 3E16B 1D3TB 3U8TH 4X6NA 1OWJA 4VGCC 1BJUA 3F3BA 2GDEH 5EXMA 3DSOA 1GDNA 1TFXA 1KYNA 4K1SA 4KGAA 1W2KH 1QQUA 3T27A 2V3OH 1GBEA 1AKSA 2ZPQA 4YTAA 1D3DB 1SOZA 3HK3B 3ZZDA 1V2NT 2QE7D 3O8CA 1SLWB 1VITH 3DCLA 1C1NA 2FTLE 4SGBE 4WF8A 3W1EA 2ZGBH 3E0PB 1EZUC 5ABWA 2XWAA 1EJMA 1HAZB 3D65E 5IK2D 2WV4A 3W95A 1NO9H 1DY8A 3MO6A 3QGNB 1A0HB 3T2NA 1IHTH 2AYWA 4NSYA 5FCRA 3RXLA 3SNEA 3MNXA 4OS5A 1FXYA 5CDFE 1WSSH 2SGDE 4ZAEA 3A84A 4Z0KA 2TGPZ 4MDSA 1WU1A 1QJ1B 2GZ8A 1O2ZA 5HIZA 2GV6A 1LVMA 1FY4A 3Q76A 3BN9A 2QXIA 1FPCH 5CHAB 1TNIA 3WWFA 5A09A 1C1RA 1V2PT 3SQEE 1GL1A 1UTKA 1MAXA 5GIBA 4LOYH 1P09A 2ILNA 1HJ9A 1WYKA 3NK8A 2OD3B 1OOKB 1S82A 4U2WA 1T8MA 4JK5A 1SFQB 3PTBA 1S85A 1GDQA 3M7TA 4MNVA 1Y3YA 1XX9A 1ETSH 5DGJA 5DP9A 1QRXA 3U8OH 1KXCA 3MI4A 1O2HA 3BTME 1P2KA 4MPVA 4DOQA 3A87A 3G01A 3KQ5A 4IC5A 1SMFE 1C4U2 1L1JA 4D7FA 1PQ7A 4I86A 1QB9A 4M7GA 4NA8A 1O32A 1Z6JH 3EGKH 4TY6A 2WSSD 1GJDB 3D49H 5CE1A 5FAHA 4DGJA 1FV9A 2ZPRA 1J8AA 3NPSA 1ZMLA 1QFKH 4MNXA 2J94A 3SU0A 1O2NA 4O9VA 3MTYA 1KTTB 1ZGIA 3LGUA 1O38A 2CV3A 2FDAA 3GY4A 1EJNA 4KTSA 1LTOA 4LK4A 1Z8JB 3LC3A 4YOIA 3P92A 3ZVEA 4H42U 1GBMA 1HXFH 4IN2A 1SC8U 4ZXXH 5EQRA 1P02A 1GPZA 3H7TA 3ZVBA 1C5TA 1ESBA 4FUFA 2PSXA 1V2JT 2RDEA 4X2XA 2KCAA 3SNDA 1DVAH 1SGIB 5CHAC 3PV4A 1HAIH 2OP9A 1ESAA 3GY6A 2Y5GA 2O8TA 4MLFB 4WVPE 3B9FH 1C5PA 2RFKC 1MTSA 3Q3XA 4HGCA 5GJ4B 4JZEH 2QC2A 1WBGB 3KN2A 2UWPA 3DUXH 2STBE 1C1UH 1JIMA 1OS8A 1C4Y2 1ETRH 1V2RT 1DOJA 3RXGA 1ZMNA 2ZGJA 4Y79A 3DD2H 3ZV9A 3DHKH 3PB1E 5SGAE 1GI5A 3KQEA 1PPFE 2A31A 3A8BA 3PO1B 1QA7A 1O2MA 1TOMH 1AZ8A 1ZSKA 4P02A 1ELGA 3TJNA 2TGDA 1MD7A 2VIVA 1WQVH 2ZU5A 4CHAB 1GHBF 1C1TA 4ZHAA 4Y6DA 1D6WA 2ZQ2A 1SGPE 1F5KU 3BEUA 1H8ED 1K1MA 4MG3A 1W0JD 1ZJKA 1L4ZA 3SU3A 4TWYA 3VB7A 3HGPA 3KNXA 3SV7A 3ATKA 4INHA 1V2MT 1DUEA 1H8IH 2THFB 1GBHA 4ABAA 1AU8A 1EPTA 1T32A 2XXLA 1GVKB 1MD8A 4ISHH 1XUJA 1D9IA 2JETB 1P2MA 1WXRA 3T62A 1NFXA 1MMJN 2FZZA 2Q6DA 3F2GA 1C5VA 2EEKA 1O35A 2K0QA 3F9FA 1QA0A 3MH4A 3SV6A 2D2DA 3LDXH 1IOEA 2P3FH 3GCNA 4ZUHA 3RXEA 1SGTA 3RXKA 1F0UA 1XXDA 1GMCG 1GJCB 1UK4A 1XVMA 1C5SA 5F8TA 2JH5D 3ZVDA 2FMJA 2LNCA 4X6OA 1DDJA 3I78A 2ZTZA 1TRMA 4AG1A 2ZGHA 2LELA 2QIQA 3OE7D 3ODFA 3ZVAA 1TGBA 2VIPA 3FZZA 1QRWA 3VEQB 4IBLH 1NRPH 1LDTT 1UCYE 3BTGE 3CS7A 1K1LA 1GMDG 1WQSA 5T6GA 1MQ6A 1DWBH 2BD2A 1GHVH 1PPHE 2IJD1 2J92A 2OC8A 2SNWA 1A61H 1ELBA 1Y3VA 2FIRH 4IW4E 1NY22 4X8SH 3RXVA 2BYAX 2NU0E 1V2KT 1NPMA 1SGRE 2XC5A 4X1QU 3PO1C 3I29A 3KYFA 1Z1JA 1GBKA 3QX5H 4CHAC 1P10A 2RA0A 1XUHA 1IQIA 1QNJA 2EI7A 2EQNA 1GVZA 4Y11E 3N7EA 2V35A 3ZVFA 1THRH 2BD8A 4Q2KA 1GHWH 3T5FH 3NUMA 1BMMH 2OC0A 2ZFTA 1CHOG 5EJLA 1FZZA 4HFPB 3SV8A 1J17T 2BVXH 3RXCA 1OYQA 2XBVA 3NZIA 2J2UA 3OAAD 1PPZA 1C1PA 1T4UH 2Y81A 4O3TA 3QWCH 1GJ4H 3HATH 5DG6A 3RXSA 2W26A 1GG6B 3O8RA 3SZNA 2JETC 1UTPA 2BD5A 2J38A 2WPJS 2WZQA 5JB9S 3GY8A 1UHBB 4F4OC 5EIYA 4NFFA 2QGRA 5KGOA 4XD7D 5A2MH 4ISIH 1H8HD 1QBVH 2O9QA 3BSQA 3SN8A 1Z7KA 3MH5A 4ZCNA 1LO6A 2VH6A 1C1SA 5AFYH 3A85A 1IQJA 4JZDH 3UAIC 1TGSZ 1NBMD 2ALVA 4HZHA 5EJ1A 1EASA 1SLXB 1DPOA 1GBJA 1YLDA 1N1LA 1YWUA 3PRDA 2ZGCA 5A0CA 3KQBA 3P95A 1W0YH 1KXFA 3KQCA 1IQNA 1SQTA 1EQ9A 1C5NH 3M7UA 3UNRA 1V2WT 1YPKH 4BANB 5ESBA 2BXUH 2ZCKP 4I8KA 2B9LA 3O8BA 3HK6B 4UFGH 4B6FA 1BZXE 1O3JA 2P95A 1AE5A 3SV9A 4UFDH 1MABB 4WH6A 3MU0A 4HG6A 5ESTE 4YZUA 2Q6GA 1AVWA 1O37A 1VGCB 1GWAA 2KFWA 1PQ5A 1ZLRA 5DP6A 4IMQA 4OS1A 4CRCA 2A4QA 2RCEA 1SBWA 3M5LA 4KTUA 2O8MA 2W6ID 2KZ4A 5TJXA 2NU3E 2PTNA 1JBUH 1LCYA 2M5TA 1P05A 2A7JA 3M5OA 1W12U 4WXIA 2J98B 1K22H 4BAKB 1Z71A 4DIIH 1SGCA 3OEHD 4X2YA 2ZU1A 1YPHE 1SKYE 1TNGA 2ZPSA 1PQAA 3SOSA 1H8DH 3ZZ3A 2P8OB 2XRCA 1G37A 2V6NA 1O33A 4O03A 3RUOA 1LPKB 1GG6C 5HKKD 3ZZCA 1JXPA 1FUJA 2BD9A 2F9VA 1ANDA 3UOUA 4OS7A 4U30A 4BXWA 3QK1A 3DT0H 1F5RA 4XE4A 5C5OA 1O3NA 2IN2A 1HJ8A 4AFZA 3H09A 1GI1A 2A4RA 4XDEA 1AE8H 1O30A 1EXFA 1Z8GA 2QYIA 2AS9A 3RM2H 1NESE 3KCGH 5DP7A 1FIWA 1A5GH 1EZXC 1AKSB 1GBAA 5E2OA 1ZTJA 3UOPA 3O8DA 1W0ZU 2KR7A 1FLEE 4O3UA 3VFEA 2XBYA 2Z3DA 4FUHA 1P8VC 4CH8B 2TGAA 1O2YA 2NWNA 2FLBH 3SU1A 4NFEA 2ZHFH 1ACBE 4ZXYH 5FBEA 3VGCB 3RC5A 4IC6A 1OX1A 2P59A 4H4FA 1JRSA 1QTFA 2EY4C 2VH0A 1TAWA 5FPSA 1GHAG 5J4SA 2FOGA 1VGCC 1AUTC 4WH8A 2BD4A 1LKAA 3T28A 1AIXH 1O31A 1BBRK 1ZRKA 3BTTE 4NG9H 3OTPA 1D3PB 2AH4X 1HAVB 3Q3KA 1NC6A 1C5XB 1CGIE 1QB1A 2GX4A 4DT7B 4LXBH 1TLDA 1F92A 3LH1A 4MQAA 4X1RU 3BEFB 3Q77A 3PLBA 2FX4A 1CT4E 5FBIA 1GGDB 2F9NA 1P03A 1CT0E 3L3TA 7GCHF 2AERH 2B0FA 1TBQH 4RKOB 4LZ4B 3BG4B 1CU1A 3BF6H 1K0HA 1EJAA 3BTHE 4U01A 2VVUA 1O2PA 1DITH 1FY3A 2P8OC 5FX5A 3TH3H 2QF0A 3ZZ9A 1C5QA 1BTHH 2QA9E 2L6OA 1A4WH 1MKWK 1K9OE 1B0FA 3AASA 2ZTYA 2GZ9A 1UO6A 4MPWA 2BB4A 2GMTB 1P2NA 1TNHA 4BTIB 5B6LA 1ZPCA 1G3CA 1BDAA 1CA8B 1NT1A 2FYQA 3F2HA 2P94A 3KGPA 5I46H 1BTUA 2XOKD 1O2GH 1OYTH 1UTMA 1RRKA 3ATWA 3KYGA 1TBZH 3SU2A 1ANBA 2VB0A 2UUKB 4Y0YE 3Q00A 4ACBA 3V12A 1TQ7B 3JZ2B 3RXHA 3QZQA 4Y71A 4JYTA 1GBFA 3EA7A 1Y5AT 5GCHF 5DP4A 1TWXB 5BRRE 1O5EH 1BRUP 1F7ZA 1O2QA 3SBKA 4JCNA 3VGCC 4MTBA 2Y5FA 1SL3A 4J2YB 1EAUA 1HBTH 2ZI2H 3GCOA 5C1XA 1TPOA 3M3VA 1ZR0A 4A92A 2FOFA 3FOAA 2BOKA 1MU6B 3UTUH 1MH0A 1BITA 1N8OB 5C94A 1NU7B 5JBBS 3BTQE 3SU6A 3S69A 1XVOA 4NIWA 4XBCA 1GGDC 3E0NB 3MNSA 3A89A 1FJSA 1IQHA 1QL8A 3BG4C 5C1YA 4NIVA 1TPSA 2EC9H 1XKAC 1QL7A 2G81E 7LPRA 1N6YA 2G52A 5EQQA 5HGGA 1UTLM 3N7DA 2ZNKH 3VPKA 1EP5A 1DWEH 1SR5C 1O36A 3A7XA 1JOUB 1C2JA 1PPBH 5EG4A 4ABJA 1BUIA 1LVOA 3SNAA 2Z9KA 3A8CA 2RA3A 2ZP0H 5C1UA 2BMGB 1GCTB 1QQ4A 4AZ2B 3A86A 4JZIA 2H9TH 1TPAE 1HYLA 5E8EH 1VJAU 1O2WA 1BTXA 2LPRA 7KMEH 4D7GA 2GMTC 1F0TA 3DFJA 1V3XA 1HNEE 2C8ZB 4GAWA 1DE7H 3A82A 4CRBA 4GUXA 4NWLA 3OU0A 4FU7A 2ODQA 5KEDA 1W11U 3AW1A 1UVSH 3TITA 1W3CA 2JKHA 2G00A 3A81A 3SU4A 3LGYA 1C5UA 2HWLB 2B8OH 1ZPZA 2IPQX 3ITIA 3RP2A 3WY8A 2KCPA 3TU7H 1J16A 2BX3A 2F9UA 4X8VH 2XTTB 1C2DA 3SNBA 2BY5X 4YLUA 1GI7B 1C2MA 3PLKA 2QAAA 1L2EA 1YPHC 3U98H 3AW0A 2A2XH 5FX6A 3F9GA 1O3EA 3CENA 5T6DA 3M7QA 1HUTH 3GY7A 4A5TS 1YPMH 1EUFA 1TNJA 1G3EA 5C17A 4YLQH 1BRBE 2BDBA 4NZLA 4CBOA 4X1PU 4X8TH 1N8OC 2ZDLA 2FI4E 3RXTA 3QTOH 4YT7H 2ZFRH 3H7OA 3SJKA 1C1WH 4X6MA 1J14A 5F8ZA 3LGWA 1O2OA 2BY8X 3LT3A 1EOLA 3MQKC 2WPKS 4TPIZ 1K1JA 3GISB 3TK6A 3BV9B 4FUJA 1IQFA 5A8YA 1FAXA 4AFSA 2BOHB 2SNVA 2H5CA 4AOQA 8KME2 1A7SA 1GCTC 1BB0B 3FP7E 4ASHA 3UQVA 2WPIS 5EXNA 3NXPA 2AMPA 1PYTC 2C8WB 5IDKA 2G55A 1CT2E 1C5LH 4AX9H 1W8BH 6LPRA 1UW7A 2VVVA 4BOHA 1AB9B 1RFNA 4DJZB 3QTVH 3VB4A 1O34A 1S0RA 1ELVA 4CH2B 2G4TA 1B7XB 1H4WA 3PRBA 3PV5A 4BAHB 1PJPA 4I31A 3PWBA 1S5SA 5DN6D 2C8YB 1SOTA 2ZDVH 4Y8ZA 1V2OT 1O5AB 5EGMA 1VCWA 1OHHD 2ZGXH 1GHYH 2Q6FA 4ZHMU 4AORA 4DURA 1P2QA 4E06H 3UWJH 1BTZA 1GBIA 1XUFA 2G5VA 2CHAB 4ISNA 4YOGA 2PGQB 4ABDA 4E7RG 2PKSB 1BMNH 1GHBG 3ZYEA 2AMQA 2HVYB 3LPRA 1C9PA 1LHCH 2OC7A 2F43B 1EFRD 1CGHA 1ELDE 1HAYB 3L6PA 4JZFH 3GYMA 4H6TA 2BLQA 3GS9A 5E0JA 1YPEH 3PWCA 3FANA 2ZDMA 1OKXA 1ZSLA 3OFND 1YPGH 4K5ZA 4XBBA 1AGJA 1MTVA 1BBRH 4FVBA 3SGAE 3RLYH 1BRAA 1GJ7B 1GVLA 3ELAH 3OTJE 4DG4A 1IQKA 1FONA 2HNTC 3RXMA 3UB0A 3KIDU 2QN5T 2R9PA 3A7YA 2FOAA 4Y8YA 2ZCHP 2TPIZ 1EATA 2D1JA 1HIAA 1NRQH 1HV7A 1E34B 3A7TA 1E1QD 4GVUA 1ZTLA 1RS0A 1GBTA 1ZRBA 1LPZB 5AFZH 2YMSD 5JB8S 3M35A 2PKAB 3MFJA 2XC4A 3STJA 1MKWH 1QR3E 2ZA5A 3ZVGA 2H1UA 1Z8RA 1SGYE 5DO4H 1TGCA 2BDHA 1TE0A 4I8JA 1MTNB 2I6QA 3U69H 2B7DH 1AB9C 2G4UA 2KAIA 3QN7A 2ZECA 2CGAA 3T26A 1T4VH 1UJ1A 1GBBA 1GJBB 4P00A 1V2LT 2HLDD 3TJUA 1ETTH 4GCHF 3UREA 3SZEA 3PMJA 1O2SA 1L4DA 3WWBA 4Z6AH 4J1YA 4AFUA 1GI6A 1JMOH 2J5UA 3AVZA 3LIWA 3MU5A 3P70B 1TNKA 3RXOA 1OP2A 2FPZA 3VB5A 2CHAC 2PKSC 4Q7YA 2BD3A 3A7WA 1BHXB 2AFQB 1EKBB 1YM0A 2ZFQH 4NWKA 3E6PH 1PPCE 2YNBA 3MU8A 2JIZD 2ZQ1A 1GI9B 5K7RA 1O2JA 3LOXA 5FPTA 1DSUA 4X2VA 2K1QA 4F49A 4NIYA 1L1NA 3GCTG 4CR5A 1NN6A 1O5GH 3LONA 3F68H 5BPEA 1TA6A 2NU1E 1N6XA 1OWKA 2QCYA 2Z6BD 3TJOA 4ASUD 3E91A 4UD9H 1EAWA 1UK2A 1O5DH 5HMAA 5GDSH 2BLOA 1BT7A 4FUBA 4AN7A 1O5BB 3JZ1B 3SJ9A 2GTBA 1BMAA 1YBWA 1MTUA 5E2PA 4Q7ZA 1Y3XA 2FOBA 2WHXA 4B74A 1HAOH 1AY6H 1NRRH 3GOVB 4Y7BA 1MTNC 4ABBA 3LGVA 4OS2A 3VXFH 8LPRA 1MZDA 4AYVB 3M37A 3C1KA 2ANKH 2Z3EA 2OK5A 1HAXB 3GY3A 1K1NA 4ISOA 4JYVH 2VINA 1T31A 3M3SA 1A0LA 3LJOA 3GCTF 3RDZA 1AFQB 1P01A 1EOJA 3UFAA 4I8HA 4SGAE 3ZVCA 1F0RA 1GHXH 5L30H 4RT1A 1YLNA 1TB6H 2HGTH 2FO9A 4K60A 4NGAH 2VNTA 2JJ1D 3RMNH 4B2BA 1ORFA 4AGKA 3SQHE 5C3NA 1C2IA 1Q2WA 2CJIA 2D26C 2P16A 2BM2A 1EZSC 2DUCA 3EA9A 1A46H 1MCTA 2AIPA 5KECA 3BTWE 3SHCH 3QZRA 1TX8A 4BTUB 5LPFA 3FZDA 4WXVA 1O2XA 2KCYA 3NKKA 3QLPH 2VJ1A 3GCHB 1FN8A 4X1SU 1KXBA 1OP0A 4A1VA 3TK5A 2WPDD 1O39A 3A80A 2KCOA 4K1EA 3GY5A 2V3MA 1KLIH 5JBAS 1RJXB 5F8XA 1ARBA 2FI3E 2ZU4A 1V2ST 1YY3A 1K1IA 3MH7A 3D23A 4IS5A 8GCHF 4MNWA 1SGQE 1IAUA 2R3UA 2UUJB 4I8GA 2ZC9H 1ABJH 1HCGA 1VR1H 1C1OA 3R3GB 4ZKRU 1S83A 5JBTA 5LGOA 3UR6A 3OY5U 3NRLA 3U8RH 4RKJB 4R0IA 1K1PA 4I33A 1GJAB 1YKTA 1KDQB 2VIOA 2ZHWH 2P3TB 2XBXA 1TMTH 3PTNA 3SORA 1SGDE 2XNDD 2F9PA 1O3OA 2Y7ZA 4DVAU 3TH4H 5DK1A 3BIUH 1NRSH 3A8AA 1HXEH 2BD7A 5FPYA 4UEHH 1LKBA 2XWBI 5EPNA 2VIWA 1TBRH 2Y6TA 5TCAA 2WV5A 1KLTA 1AFQC 3RC6A 4AYYB 1Y59T 3LGIA 2V3HH 4AFQA 4OS6A 5EPYA 3CP7A 3F0OA 4BAOB 1O2VA 1DXWA 2A4GA 1C5WB 4M9FA 2BQ7B 4KP0A 5F03A 3RXAA 5GWZA 2TGTA 2HALA 3TGJE 1VCPA 1VITF 4HTCH 1QBNA 3OX7U 1H9IE 2XNIA 1E36B 2EI8A 4O97A 1ELFA 1TGTA 7GCHG 1ELCA 3GCHC 3I77A 1DWDH 2O8WA 2A1DB 3LGTA 1S84A 4BXSA 2OCVB 1UMAH 5GXPA 1D3QB 1YC0A 1FY5A 1NM6A 1NTPA 2FESH 1O2UA 5HM2A 2H5DA 2RDLA 3EE7A 3RXDA 1ZTKA 2OTVA 2HOBA 1A3BH 4A1XA 2YOLA 4X6PA 1Z1IA 4DT4A 3GDUA 1C4V2 5A8XA 5FHTA 1S6HA 3FKSD 3OSYA 5DSFA 2TRMA 3ZYDA 3DSPA 1C5RA 4E7NA 1VKYA 1ZGVA 1TX6A 4X0WU 3MMGA 4IN1A 3SI3H 1DXPA 5T1VA 2BVRH 2ASUB 4AC9A 1SGEE 3B8JA 3PROA 1GI8B 5GPIB 4WJG2 3UR9A 3PYHA 2H9EH 2ULLA 5GCHG 1OWHA 1W7GH 2FTMA 2ZG0H 4TPYA 4Q63A 1PPEE 3T29A 4ZMAH 3RM0H 1OSSA 4XBDA 3NWUA 5EQSA 5IYTA 3IG6B 1HPGA 1L0ZA 1BA8B 2QV1A 2Z7FE 2PTCE 4FUIA 3TH2H 2HRVA 4XOJA 4ZHLU 3GYLB 2GDDA 1IQGA 2EA3A 4CRFA 1GBLA 1T7CA 1WOFA 3F9HA 3KHVA 3K65B 1TMUH 3PM3A 3RXRA 3EE0B 2BDYA 2F9BH 2LP6A 5C2ZA 1IQEA 1T8NA 2XYAA 1Y8TA 1OPHB 1UTNA 2W6JD 3AAUA 2GT8A 1FY1A 1D4PB 1V6DA 2CK3D 1RTLA 3ATMA 5FCKA 4Q4LA 1C2EA 2HNTE 2ZTXA 2DE9A 1OWEA 2FOHA 3NCLA 1TALA 2GCHF 3MO9A 5LH8A 1Y3WA 2QF4A 1TQ0B 3QDZB 3U9AH 4K8YA 3A8DA 4OM9A 2D8WA 5EU8A 4JK6A 2OUAA 2Q1JA 3RMLH 5JPMH 1DM4B 3TLOA 3VB3A 2B5TB 1V2TT 2PUQH 3RU4T 3W94A 2ANMH 2J34A 5I25A 1SQAA 2FOCA 1KLJH 4TT3D 1SSXA 1AN1E 1LQEA 9ESTA 1SLUB 1IQMA 4DIHH 1BRCE 1EAIA 2ZU3A 3SHAH 1LVBA 4UFFH 3A83A 3BTEE 2SGEE 1F2SE 5DPAA 4XFQA 2BQ6B 3H5CB 3SYJA 1EZQA 2Y7XA 1JWTA 3A88A 1EAXA 1ABIH 1O3FA 3PV2A 1W14U 1NFYA 4WMDA 4WWYA 1YP9A 3TIUA 4H6SB 1ARCA 3C27B 1G3DA 3V0XA 5HIYA 4YOJA 6GCHF 1P3EA 2BY6X 2FWWA 3FO8D 2A5IA 1HLTH 4I8LA 3ATIA 5HYOA 2Z94A 1DUAA 1C2GA 4Q7XA 3TJVA 2BZAA 3FN8A 2PW8H 1GBDA 2JDID 1ZHMA 3PMHB 4E05H 2ZDKA 4CRDA 1O2IA 1HAHH 3MYWA 5JYIA 1LHDH 1G36A 1DFPA 1UTOA 4TYDA 1DS2E 1O2KA 1Q3XA 3BEIB 2SGFE 3V13A 3F1SB 3MNBA 5L2YH 1XM1A 3RMOH 2BXTH 2OBQA 3L33A 2AMDA 1BTYA 1E37B 1P04A 2XBWA 3DSGA 3KQDA 4ISLA 4QT8C 4K1TA 1EPTB 1TOCB 2JJ2D 3HKIB 3MWIU 4I32A 1K1OA 3RXBA 1NZQH 1KMHB 1SLVB 1P9SA 1INCA 2FX6A 1CGJE 4B75A 1E35B 1Y5UT 2AHME 4D76A 2VGCB 4CREA 5PTPA 1AD8H 1H1BA 2DE8A 1QRZA 1EB1H 2A4OA 2P3UB 3ZZBA 1BBRE 2BDCA 5C20A 1YYY1 1YF4A 5CMXH 2V7QD 4K69A 3UIRA 1LHEH 2ZDNA 3A7ZA 2PFEA 3PLPA 4UDWH 3PMAB 7ESTE 1QBOA 4U32A 1MKXK 2AIQA 4Y10E 3KEEA 1WTGH 1O0DH 2VBCA 3K9XB 3SGQE 1X7AC 3HPTB 4RT0A 5AF9H 1QGFA 1YGCH 4IGDA 3ZZ8A 1Z6EA 1TA2A 3VG8A 2WUBA 3V3MA 1DY9A 3KL6A 1PPGE 2QY0B 1SPJA 1BTWA 3S7HB 1UVOA 1HAVA 1VZQH 1D6RA 2C4FH 4B76A 1RTFB 1ZOMA 4JYUH 1HJAB 1CE5A 4DW2U 3N99A 1UTJA 2C3SA 3K6ZA 2BDIA 4NA7A 1WV7H 2ODPA 2BDAA 3GICB 5C0TA 5F6MA 1IHSH 3IITA 4FXGH 4RI0A 1C1QA 2PWXA 2UWOA 5EW1H 1UCYK 2GKVE 4ACAA 2VU8E 2GVFA 4B2CA 4UFEH 9LPRA 5ETXA 4B2AA 1MU8B 1OWDA 3URDA 1C5MD 1SGFA 2F3CE 4DY7B 1A1RA 1J9CH 1QZ8A 3RU4E 2BTCE 1MQ5A 1HAPH 2WPHS 2ANWA 1A5IA 3RXFA 1NFWA 1FMGA 1V2VT 1TRNA 1KXDA 1TNLA 1S0QA 4KKDA 1EPTC 3SV2H 4FU8A 3SUDA 4TY7A 1HAGE 2VWOA 3RXQA 1U6QA 2QXHA 5CHBA 1GJ6A 5EW2H 2J4IA 3QO6A 2VGCC 1SB1H 4AB9A 1O3IA 5C5NA 4OGYA 1ZZZA 1QB6A 2OBOA 1YPLH 4GLYA 1QCPA 1AZZA 1C5ZB 2A5AA 4CRAA 2F91A 2UUYA 1THPB 2IPHA 4GCHG 1UVPA 3P8GA 1PQ8A 1FQ3A 1AUJA 1NROH 2ANYA 3P8OA 4FU9A 4ZROA 1QJ7B 2BLVA 3SJIA 3MHWU 1LVYA 3D62A 1O3BA 3ZZ6A 1RIWB 3ZZ7A 2VIQA 3EQ0H 1J15A 2TBSA 2OQUA 3ZZAA 4BTTB 2QXGA 3P17H 3BTKE 1EX3A 2H2ZA 3VXEH 4B71A 5GNDA 4F55A 2BY7X 1KTSB 1G2MA 2UUFB 1HJAC 3TGIE 2IOTA 2A2QH 1MTWA 3E3TA 4X8UH 2HVXA 4XRNA 2W7UA 1SHYA 5EOKA 5EODA 5A8ZA 1IQLA 1G2LA 3ESTA 1SFIA 1E38B 1TGNA 2WYJA 1FI8A 4XSKU 5EXLA 1GL0E 2ZIQH 3OY6U 1EP6A 1LPGB 3OYPA 1YCPK 1DX5M 5JDUB 1SGFG 2PV9B 4MNYA 4ABFA 2CMYA 1A0JA 3EDXB 4K8BA 1DANH 1Q31A 3MU4A 3RXPA 1CSOE 1XMNB 3T25A 4MVNA 4UONA 4ZKOU 2BDGA 4INKA 3LKWA 3RXUA 2ZEBA 1HFDA 1FAKH 4X2WA 2G8TA 3MH6A 3ODDA 3A7VA 3EYDA 1ANCA 1QIXB 3LH3A 2A0QB
chains in the Genus database with same CATH topology
3U28C 2V3MA 2HVYB 3UAIC 2EY4C 2RFKC 2EQNA 3MQKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U28 C;  2V3M A;  2HVY B;  3UAI C;  2EY4 C;  2RFK C;  2EQN A;  3MQK C; 
#chains in the Genus database with same CATH topology
 2CXV A;  3M5M A;  1AO5 A;  1XUI A;  1S81 A;  1S6L A;  2VWL A;  1CHG A;  2WPM S;  2ZHQ H;  2FS9 A;  3LJJ A;  4FVD A;  2A5K A;  5A0A E;  2XCF A;  2W7S A;  1O3G A;  2F9O A;  1ZSJ A;  2RG3 A;  3TK9 A;  1SHH B;  3SUE A;  1OXG A;  5DP8 A;  1L1G A;  2FP7 B;  2R0L A;  5C0U A;  1WDI A;  3UNQ A;  3UQO A;  1P57 B;  1DST A;  4R8T B;  1RIW C;  3PMB B;  1LHF H;  1TAB E;  2CF9 H;  4GPG A;  4NZQ A;  4BNR A;  1P2O A;  4Y0Z E;  1JIR A;  1GBC A;  3QUM P;  2XW9 A;  2BVS H;  4GSO A;  3UY9 A;  3VB6 A;  5K0H A;  2CF8 H;  1Y3U A;  1YPJ H;  1PFX C;  2C93 B;  3E8L A;  1BQY A;  2ZF0 H;  4TSF D;  5E0H A;  1KSN A;  1P12 E;  2ZFP H;  1GJ8 B;  1V2Q T;  2SGA A;  4FUC A;  1QY6 A;  3KF2 A;  2ZFF H;  4FUD A;  1ZPB A;  1P2J A;  3MOC A;  5F53 A;  3F2F A;  1YCP M;  2KM0 A;  2FM2 A;  2W3I A;  1AFE H;  2V0B A;  1GI4 A;  1SQO A;  1TRY A;  1O3H A;  2SGQ E;  2BQW B;  2HLC A;  2BHG A;  4FUE A;  8GCH G;  1OP8 A;  2UWL A;  1DT2 A;  2OIN A;  1FDP A;  1G32 B;  2Z9G A;  3QGJ A;  4FET A;  4YO9 A;  4ZH8 A;  2QF5 A;  1GCD A;  2ZHE H;  1VCQ A;  5DP5 A;  1CA0 B;  2GJG A;  1E0F D;  1C5O H;  2ZCL P;  4B1T A;  4D9R A;  3SU5 A;  1NU9 A;  1QUR H;  1BCU H;  1VJ9 U;  3TVJ B;  1PYT D;  1AVX A;  3LU9 B;  3RC4 A;  4FUG A;  1K2I 1;  1OWI A;  3UUZ A;  3OEE D;  1UVT H;  2XCN A;  4D9Q A;  1HB0 B;  2FS8 A;  3BG8 A;  4FOU C;  2A7H A;  1GMC F;  3U1J B;  2P93 A;  1BMF D;  4HI3 A;  4NIX A;  2A7C A;  2FYR A;  1BML A;  4I7Y H;  1BIO A;  1RD3 B;  4JMY A;  3UWI A;  1EST A;  4AB8 A;  3FP8 E;  1GMD F;  1XUG A;  4A1T A;  2PSY A;  3FAO A;  1SQR A;  1XXF A;  1MKX H;  4Y76 A;  3ZIA D;  1BTP A;  2Z9L A;  2BLW A;  4OS4 A;  1G3B A;  3M61 U;  1MCV A;  1UTQ A;  1ELE E;  2GZ7 A;  4GHQ A;  5DP3 A;  2F83 A;  2FEQ H;  3GY2 A;  4KEL A;  1KIG H;  1VIT G;  3TGK E;  1E1R D;  2CN0 H;  1K21 H;  4ABI A;  3MNC A;  5FL7 D;  3S9C A;  1C2L A;  1MUE B;  5T6F A;  1ZHP A;  1C9T A;  2VID A;  2G51 A;  4Y8X A;  2G5N A;  4ABG A;  1ELA A;  3S7K B;  3AK5 A;  3ATL A;  2H9H A;  4PRO A;  1AVG H;  1CHO F;  1T8L A;  2XC0 A;  1NS3 A;  1P9U A;  1TX7 A;  1UVU H;  2ZDA H;  1MBQ A;  1AMH A;  1W0K D;  2J97 A;  2FOM B;  1JRT A;  3HKJ B;  2OQ5 A;  1H9L B;  1UCY H;  2AGG X;  2AGI X;  1O2T A;  3ZZ5 A;  6EST A;  3FP6 E;  2HPP H;  1CO7 E;  4WY3 A;  5C67 A;  2PKA A;  2QXJ A;  2Y5H A;  1FN6 A;  1B0E A;  3CNR A;  3ZV8 A;  4YXW D;  1CA0 C;  4YES B;  1WUN H;  2Z9I A;  3M5N A;  4BAM B;  3B23 B;  1ID5 H;  3S9A A;  2STA E;  5DKM A;  2J95 A;  4A7I B;  1TIO A;  2SGP E;  1RXP A;  2NU2 E;  2ZFS A;  3P6Z B;  1O3D A;  1S6F A;  2PGB B;  1CBW B;  1THS H;  3STI A;  1P06 A;  2TIO A;  1P11 E;  1KY9 A;  2BX4 A;  4NCY A;  3URC A;  4WMF A;  2O8U A;  2AEI H;  2R0K A;  1O2R A;  1FX0 B;  2GP9 B;  1O3M A;  1LMW B;  2HNT F;  5AHG H;  6CHA B;  1LHG H;  2PLX A;  5DJ7 A;  4X1N U;  1O3L A;  4TWW A;  5T3H A;  2JH0 D;  2EI6 A;  2C8X B;  3ZZ4 A;  4NA9 H;  5EJZ A;  5J4Q A;  3TNT A;  1O3P B;  3BIV H;  2ZKS A;  1C2K A;  3U28 C;  4WME A;  1FIZ A;  2GGV B;  3N7O A;  1ANE A;  3TPI Z;  3MO3 A;  4NSV A;  5LPE A;  1TPP A;  1SG8 B;  2Y82 A;  2M2A A;  2Z9J A;  4INL A;  2J9N A;  1GI2 A;  2H6M A;  4RN6 A;  2KX4 A;  2WIN I;  1P3C A;  3DFL A;  1SGN E;  1RTK A;  2GT7 A;  1HRT H;  3AAV A;  4ABH A;  1Y5B T;  1MAY A;  3S0N A;  2HPQ H;  4Q80 A;  4BAQ B;  1HDT H;  1FPH H;  1V2U T;  1CQQ A;  1MZA A;  2GCH G;  1O5C B;  1E79 D;  5TCC A;  5HM9 A;  3RLW H;  4CBN A;  2OXS A;  1O2L A;  1HGT H;  3EA8 A;  1DIC A;  3SNC A;  1UK3 A;  4DCD A;  2FI5 E;  2ALP A;  1Z8I B;  2WYG A;  1ZHR A;  1W7X H;  3E90 B;  3GDV A;  4YM9 A;  1O5F H;  1GHZ A;  1O3K A;  1KXE A;  1YCP H;  1O3C A;  1FY8 E;  1B5G H;  2BZ6 H;  2R2M B;  1BOQ A;  4MPU A;  5B6O A;  1NBM E;  2AGE X;  2R3Y A;  2YMS B;  3P8F A;  4CRG A;  2C90 B;  2OLG A;  2I6S A;  3V7T A;  2FLR H;  3FFG A;  5E0G A;  3SUF A;  4AGJ A;  1SVP A;  2F4L A;  2PP6 A;  2JH6 D;  2WV9 A;  1CBW C;  4OGX A;  4B6E A;  2ZHD A;  3ENS B;  1XUK A;  1DWC H;  5AVD A;  1F0S A;  1RGQ A;  2FOD A;  2PR3 A;  4LZ1 H;  5H4I B;  4A6L A;  1C2H A;  1QHR B;  4GHT A;  2WUC A;  2IJO B;  3SGB E;  5FXL A;  1K28 D;  2A32 A;  6CHA C;  2YNA A;  3Q3Y A;  5LPR A;  3F6U H;  6GCH G;  2ODY B;  1WCZ A;  1C5Y B;  8EST E;  2ZWL H;  4ABE A;  4Z1M D;  3UNS A;  1G9I E;  4CR9 A;  1UHB A;  2GCT B;  3SJ8 A;  2R2W U;  1T8O A;  3M36 A;  3CS0 A;  3M3T A;  4F48 B;  2O8L A;  3RXJ A;  5HXF A;  2L74 A;  3WW7 A;  1ELT A;  1AWF H;  1KXA A;  2QF3 A;  3P8N A;  1SI5 H;  3K2U A;  4K3J A;  1FNI A;  1AHT H;  3K6Y A;  4IMZ A;  1AQ7 A;  1A2C H;  1GHA F;  3FVF B;  1M9U A;  1G30 B;  4K2Y A;  3SO3 A;  1NFU A;  1XKB C;  4VGC B;  4UE7 H;  2NU4 E;  1WAY B;  2GV7 A;  3TNS A;  1BJV A;  1ZYO A;  1ZMJ A;  4THN H;  3SUG A;  1CVW H;  2FXR A;  1LQD B;  5L2Z H;  1GI3 A;  3RMM H;  2PUX B;  4RSP A;  5G4B A;  2ZU2 A;  5A0B A;  3S9B A;  3F0P A;  1GMH G;  1O3A A;  2Z3C A;  3F9E A;  1TON A;  1QL9 A;  4B73 A;  2W3K A;  3E1X B;  3LC5 A;  1W13 U;  3BTD E;  2VWM A;  4ZKS U;  4Y7A A;  1GJ5 H;  2ZO3 H;  3HGN A;  1GDU A;  1DLE A;  2VVC A;  1TMB H;  3SW2 B;  2YMS C;  3RU4 D;  5L6N H;  3SJO A;  1KDQ A;  2FOE A;  2BY9 X;  1MBM A;  1P2I A;  1QJ6 B;  1A3E H;  2GD4 B;  1BHX F;  3IWM A;  1HIA B;  2K8I A;  4YT6 H;  3MU1 A;  1NRN H;  1TYN A;  1ZJD A;  2EST E;  4EST E;  3R0F A;  1AI8 H;  1F5L A;  1A5H A;  2OC1 A;  5JBC S;  1GJ9 B;  2Y80 A;  1COW D;  2J98 A;  4JZ1 A;  4AG2 A;  2ZZU H;  1H9H E;  3EAJ A;  1C1M A;  2SFA A;  4ZKN U;  1YLC A;  1C2F A;  4D8N A;  3U1I B;  3RXI A;  3UPE A;  2KAI B;  1AWH B;  4KTC A;  3DA9 B;  1DLK B;  2W5E A;  3BTF E;  1P0S H;  3SI4 H;  3GDS A;  1GMH F;  2GCT C;  2WPL S;  1W10 U;  1WTH D;  2PHB A;  1GI0 A;  4MPX A;  1EB2 A;  2A45 B;  1C1V H;  2VWN A;  3E16 B;  1D3T B;  3U8T H;  4X6N A;  1OWJ A;  4VGC C;  1BJU A;  3F3B A;  2GDE H;  5EXM A;  3DSO A;  1GDN A;  1TFX A;  1KYN A;  4K1S A;  4KGA A;  1W2K H;  1QQU A;  3T27 A;  2V3O H;  1GBE A;  1AKS A;  2ZPQ A;  4YTA A;  1D3D B;  1SOZ A;  3HK3 B;  3ZZD A;  1V2N T;  2QE7 D;  3O8C A;  1SLW B;  1VIT H;  3DCL A;  1C1N A;  2FTL E;  4SGB E;  4WF8 A;  3W1E A;  2ZGB H;  3E0P B;  1EZU C;  5ABW A;  2XWA A;  1EJM A;  1HAZ B;  3D65 E;  5IK2 D;  2WV4 A;  3W95 A;  1NO9 H;  1DY8 A;  3MO6 A;  3QGN B;  1A0H B;  3T2N A;  1IHT H;  2AYW A;  4NSY A;  5FCR A;  3RXL A;  3SNE A;  3MNX A;  4OS5 A;  1FXY A;  5CDF E;  1WSS H;  2SGD E;  4ZAE A;  3A84 A;  4Z0K A;  2TGP Z;  4MDS A;  1WU1 A;  1QJ1 B;  2GZ8 A;  1O2Z A;  5HIZ A;  2GV6 A;  1LVM A;  1FY4 A;  3Q76 A;  3BN9 A;  2QXI A;  1FPC H;  5CHA B;  1TNI A;  3WWF A;  5A09 A;  1C1R A;  1V2P T;  3SQE E;  1GL1 A;  1UTK A;  1MAX A;  5GIB A;  4LOY H;  1P09 A;  2ILN A;  1HJ9 A;  1WYK A;  3NK8 A;  2OD3 B;  1OOK B;  1S82 A;  4U2W A;  1T8M A;  4JK5 A;  1SFQ B;  3PTB A;  1S85 A;  1GDQ A;  3M7T A;  4MNV A;  1Y3Y A;  1XX9 A;  1ETS H;  5DGJ A;  5DP9 A;  1QRX A;  3U8O H;  1KXC A;  3MI4 A;  1O2H A;  3BTM E;  1P2K A;  4MPV A;  4DOQ A;  3A87 A;  3G01 A;  3KQ5 A;  4IC5 A;  1SMF E;  1C4U 2;  1L1J A;  4D7F A;  1PQ7 A;  4I86 A;  1QB9 A;  4M7G A;  4NA8 A;  1O32 A;  1Z6J H;  3EGK H;  4TY6 A;  2WSS D;  1GJD B;  3D49 H;  5CE1 A;  5FAH A;  4DGJ A;  1FV9 A;  2ZPR A;  1J8A A;  3NPS A;  1ZML A;  1QFK H;  4MNX A;  2J94 A;  3SU0 A;  1O2N A;  4O9V A;  3MTY A;  1KTT B;  1ZGI A;  3LGU A;  1O38 A;  2CV3 A;  2FDA A;  3GY4 A;  1EJN A;  4KTS A;  1LTO A;  4LK4 A;  1Z8J B;  3LC3 A;  4YOI A;  3P92 A;  3ZVE A;  4H42 U;  1GBM A;  1HXF H;  4IN2 A;  1SC8 U;  4ZXX H;  5EQR A;  1P02 A;  1GPZ A;  3H7T A;  3ZVB A;  1C5T A;  1ESB A;  4FUF A;  2PSX A;  1V2J T;  2RDE A;  4X2X A;  2KCA A;  3SND A;  1DVA H;  1SGI B;  5CHA C;  3PV4 A;  1HAI H;  2OP9 A;  1ESA A;  3GY6 A;  2Y5G A;  2O8T A;  4MLF B;  4WVP E;  3B9F H;  1C5P A;  2RFK C;  1MTS A;  3Q3X A;  4HGC A;  5GJ4 B;  4JZE H;  2QC2 A;  1WBG B;  3KN2 A;  2UWP A;  3DUX H;  2STB E;  1C1U H;  1JIM A;  1OS8 A;  1C4Y 2;  1ETR H;  1V2R T;  1DOJ A;  3RXG A;  1ZMN A;  2ZGJ A;  4Y79 A;  3DD2 H;  3ZV9 A;  3DHK H;  3PB1 E;  5SGA E;  1GI5 A;  3KQE A;  1PPF E;  2A31 A;  3A8B A;  3PO1 B;  1QA7 A;  1O2M A;  1TOM H;  1AZ8 A;  1ZSK A;  4P02 A;  1ELG A;  3TJN A;  2TGD A;  1MD7 A;  2VIV A;  1WQV H;  2ZU5 A;  4CHA B;  1GHB F;  1C1T A;  4ZHA A;  4Y6D A;  1D6W A;  2ZQ2 A;  1SGP E;  1F5K U;  3BEU A;  1H8E D;  1K1M A;  4MG3 A;  1W0J D;  1ZJK A;  1L4Z A;  3SU3 A;  4TWY A;  3VB7 A;  3HGP A;  3KNX A;  3SV7 A;  3ATK A;  4INH A;  1V2M T;  1DUE A;  1H8I H;  2THF B;  1GBH A;  4ABA A;  1AU8 A;  1EPT A;  1T32 A;  2XXL A;  1GVK B;  1MD8 A;  4ISH H;  1XUJ A;  1D9I A;  2JET B;  1P2M A;  1WXR A;  3T62 A;  1NFX A;  1MMJ N;  2FZZ A;  2Q6D A;  3F2G A;  1C5V A;  2EEK A;  1O35 A;  2K0Q A;  3F9F A;  1QA0 A;  3MH4 A;  3SV6 A;  2D2D A;  3LDX H;  1IOE A;  2P3F H;  3GCN A;  4ZUH A;  3RXE A;  1SGT A;  3RXK A;  1F0U A;  1XXD A;  1GMC G;  1GJC B;  1UK4 A;  1XVM A;  1C5S A;  5F8T A;  2JH5 D;  3ZVD A;  2FMJ A;  2LNC A;  4X6O A;  1DDJ A;  3I78 A;  2ZTZ A;  1TRM A;  4AG1 A;  2ZGH A;  2LEL A;  2QIQ A;  3OE7 D;  3ODF A;  3ZVA A;  1TGB A;  2VIP A;  3FZZ A;  1QRW A;  3VEQ B;  4IBL H;  1NRP H;  1LDT T;  1UCY E;  3BTG E;  3CS7 A;  1K1L A;  1GMD G;  1WQS A;  5T6G A;  1MQ6 A;  1DWB H;  2BD2 A;  1GHV H;  1PPH E;  2IJD 1;  2J92 A;  2OC8 A;  2SNW A;  1A61 H;  1ELB A;  1Y3V A;  2FIR H;  4IW4 E;  1NY2 2;  4X8S H;  3RXV A;  2BYA X;  2NU0 E;  1V2K T;  1NPM A;  1SGR E;  2XC5 A;  4X1Q U;  3PO1 C;  3I29 A;  3KYF A;  1Z1J A;  1GBK A;  3QX5 H;  4CHA C;  1P10 A;  2RA0 A;  1XUH A;  1IQI A;  1QNJ A;  2EI7 A;  2EQN A;  1GVZ A;  4Y11 E;  3N7E A;  2V35 A;  3ZVF A;  1THR H;  2BD8 A;  4Q2K A;  1GHW H;  3T5F H;  3NUM A;  1BMM H;  2OC0 A;  2ZFT A;  1CHO G;  5EJL A;  1FZZ A;  4HFP B;  3SV8 A;  1J17 T;  2BVX H;  3RXC A;  1OYQ A;  2XBV A;  3NZI A;  2J2U A;  3OAA D;  1PPZ A;  1C1P A;  1T4U H;  2Y81 A;  4O3T A;  3QWC H;  1GJ4 H;  3HAT H;  5DG6 A;  3RXS A;  2W26 A;  1GG6 B;  3O8R A;  3SZN A;  2JET C;  1UTP A;  2BD5 A;  2J38 A;  2WPJ S;  2WZQ A;  5JB9 S;  3GY8 A;  1UHB B;  4F4O C;  5EIY A;  4NFF A;  2QGR A;  5KGO A;  4XD7 D;  5A2M H;  4ISI H;  1H8H D;  1QBV H;  2O9Q A;  3BSQ A;  3SN8 A;  1Z7K A;  3MH5 A;  4ZCN A;  1LO6 A;  2VH6 A;  1C1S A;  5AFY H;  3A85 A;  1IQJ A;  4JZD H;  3UAI C;  1TGS Z;  1NBM D;  2ALV A;  4HZH A;  5EJ1 A;  1EAS A;  1SLX B;  1DPO A;  1GBJ A;  1YLD A;  1N1L A;  1YWU A;  3PRD A;  2ZGC A;  5A0C A;  3KQB A;  3P95 A;  1W0Y H;  1KXF A;  3KQC A;  1IQN A;  1SQT A;  1EQ9 A;  1C5N H;  3M7U A;  3UNR A;  1V2W T;  1YPK H;  4BAN B;  5ESB A;  2BXU H;  2ZCK P;  4I8K A;  2B9L A;  3O8B A;  3HK6 B;  4UFG H;  4B6F A;  1BZX E;  1O3J A;  2P95 A;  1AE5 A;  3SV9 A;  4UFD H;  1MAB B;  4WH6 A;  3MU0 A;  4HG6 A;  5EST E;  4YZU A;  2Q6G A;  1AVW A;  1O37 A;  1VGC B;  1GWA A;  2KFW A;  1PQ5 A;  1ZLR A;  5DP6 A;  4IMQ A;  4OS1 A;  4CRC A;  2A4Q A;  2RCE A;  1SBW A;  3M5L A;  4KTU A;  2O8M A;  2W6I D;  2KZ4 A;  5TJX A;  2NU3 E;  2PTN A;  1JBU H;  1LCY A;  2M5T A;  1P05 A;  2A7J A;  3M5O A;  1W12 U;  4WXI A;  2J98 B;  1K22 H;  4BAK B;  1Z71 A;  4DII H;  1SGC A;  3OEH D;  4X2Y A;  2ZU1 A;  1YPH E;  1SKY E;  1TNG A;  2ZPS A;  1PQA A;  3SOS A;  1H8D H;  3ZZ3 A;  2P8O B;  2XRC A;  1G37 A;  2V6N A;  1O33 A;  4O03 A;  3RUO A;  1LPK B;  1GG6 C;  5HKK D;  3ZZC A;  1JXP A;  1FUJ A;  2BD9 A;  2F9V A;  1AND A;  3UOU A;  4OS7 A;  4U30 A;  4BXW A;  3QK1 A;  3DT0 H;  1F5R A;  4XE4 A;  5C5O A;  1O3N A;  2IN2 A;  1HJ8 A;  4AFZ A;  3H09 A;  1GI1 A;  2A4R A;  4XDE A;  1AE8 H;  1O30 A;  1EXF A;  1Z8G A;  2QYI A;  2AS9 A;  3RM2 H;  1NES E;  3KCG H;  5DP7 A;  1FIW A;  1A5G H;  1EZX C;  1AKS B;  1GBA A;  5E2O A;  1ZTJ A;  3UOP A;  3O8D A;  1W0Z U;  2KR7 A;  1FLE E;  4O3U A;  3VFE A;  2XBY A;  2Z3D A;  4FUH A;  1P8V C;  4CH8 B;  2TGA A;  1O2Y A;  2NWN A;  2FLB H;  3SU1 A;  4NFE A;  2ZHF H;  1ACB E;  4ZXY H;  5FBE A;  3VGC B;  3RC5 A;  4IC6 A;  1OX1 A;  2P59 A;  4H4F A;  1JRS A;  1QTF A;  2EY4 C;  2VH0 A;  1TAW A;  5FPS A;  1GHA G;  5J4S A;  2FOG A;  1VGC C;  1AUT C;  4WH8 A;  2BD4 A;  1LKA A;  3T28 A;  1AIX H;  1O31 A;  1BBR K;  1ZRK A;  3BTT E;  4NG9 H;  3OTP A;  1D3P B;  2AH4 X;  1HAV B;  3Q3K A;  1NC6 A;  1C5X B;  1CGI E;  1QB1 A;  2GX4 A;  4DT7 B;  4LXB H;  1TLD A;  1F92 A;  3LH1 A;  4MQA A;  4X1R U;  3BEF B;  3Q77 A;  3PLB A;  2FX4 A;  1CT4 E;  5FBI A;  1GGD B;  2F9N A;  1P03 A;  1CT0 E;  3L3T A;  7GCH F;  2AER H;  2B0F A;  1TBQ H;  4RKO B;  4LZ4 B;  3BG4 B;  1CU1 A;  3BF6 H;  1K0H A;  1EJA A;  3BTH E;  4U01 A;  2VVU A;  1O2P A;  1DIT H;  1FY3 A;  2P8O C;  5FX5 A;  3TH3 H;  2QF0 A;  3ZZ9 A;  1C5Q A;  1BTH H;  2QA9 E;  2L6O A;  1A4W H;  1MKW K;  1K9O E;  1B0F A;  3AAS A;  2ZTY A;  2GZ9 A;  1UO6 A;  4MPW A;  2BB4 A;  2GMT B;  1P2N A;  1TNH A;  4BTI B;  5B6L A;  1ZPC A;  1G3C A;  1BDA A;  1CA8 B;  1NT1 A;  2FYQ A;  3F2H A;  2P94 A;  3KGP A;  5I46 H;  1BTU A;  2XOK D;  1O2G H;  1OYT H;  1UTM A;  1RRK A;  3ATW A;  3KYG A;  1TBZ H;  3SU2 A;  1ANB A;  2VB0 A;  2UUK B;  4Y0Y E;  3Q00 A;  4ACB A;  3V12 A;  1TQ7 B;  3JZ2 B;  3RXH A;  3QZQ A;  4Y71 A;  4JYT A;  1GBF A;  3EA7 A;  1Y5A T;  5GCH F;  5DP4 A;  1TWX B;  5BRR E;  1O5E H;  1BRU P;  1F7Z A;  1O2Q A;  3SBK A;  4JCN A;  3VGC C;  4MTB A;  2Y5F A;  1SL3 A;  4J2Y B;  1EAU A;  1HBT H;  2ZI2 H;  3GCO A;  5C1X A;  1TPO A;  3M3V A;  1ZR0 A;  4A92 A;  2FOF A;  3FOA A;  2BOK A;  1MU6 B;  3UTU H;  1MH0 A;  1BIT A;  1N8O B;  5C94 A;  1NU7 B;  5JBB S;  3BTQ E;  3SU6 A;  3S69 A;  1XVO A;  4NIW A;  4XBC A;  1GGD C;  3E0N B;  3MNS A;  3A89 A;  1FJS A;  1IQH A;  1QL8 A;  3BG4 C;  5C1Y A;  4NIV A;  1TPS A;  2EC9 H;  1XKA C;  1QL7 A;  2G81 E;  7LPR A;  1N6Y A;  2G52 A;  5EQQ A;  5HGG A;  1UTL M;  3N7D A;  2ZNK H;  3VPK A;  1EP5 A;  1DWE H;  1SR5 C;  1O36 A;  3A7X A;  1JOU B;  1C2J A;  1PPB H;  5EG4 A;  4ABJ A;  1BUI A;  1LVO A;  3SNA A;  2Z9K A;  3A8C A;  2RA3 A;  2ZP0 H;  5C1U A;  2BMG B;  1GCT B;  1QQ4 A;  4AZ2 B;  3A86 A;  4JZI A;  2H9T H;  1TPA E;  1HYL A;  5E8E H;  1VJA U;  1O2W A;  1BTX A;  2LPR A;  7KME H;  4D7G A;  2GMT C;  1F0T A;  3DFJ A;  1V3X A;  1HNE E;  2C8Z B;  4GAW A;  1DE7 H;  3A82 A;  4CRB A;  4GUX A;  4NWL A;  3OU0 A;  4FU7 A;  2ODQ A;  5KED A;  1W11 U;  3AW1 A;  1UVS H;  3TIT A;  1W3C A;  2JKH A;  2G00 A;  3A81 A;  3SU4 A;  3LGY A;  1C5U A;  2HWL B;  2B8O H;  1ZPZ A;  2IPQ X;  3ITI A;  3RP2 A;  3WY8 A;  2KCP A;  3TU7 H;  1J16 A;  2BX3 A;  2F9U A;  4X8V H;  2XTT B;  1C2D A;  3SNB A;  2BY5 X;  4YLU A;  1GI7 B;  1C2M A;  3PLK A;  2QAA A;  1L2E A;  1YPH C;  3U98 H;  3AW0 A;  2A2X H;  5FX6 A;  3F9G A;  1O3E A;  3CEN A;  5T6D A;  3M7Q A;  1HUT H;  3GY7 A;  4A5T S;  1YPM H;  1EUF A;  1TNJ A;  1G3E A;  5C17 A;  4YLQ H;  1BRB E;  2BDB A;  4NZL A;  4CBO A;  4X1P U;  4X8T H;  1N8O C;  2ZDL A;  2FI4 E;  3RXT A;  3QTO H;  4YT7 H;  2ZFR H;  3H7O A;  3SJK A;  1C1W H;  4X6M A;  1J14 A;  5F8Z A;  3LGW A;  1O2O A;  2BY8 X;  3LT3 A;  1EOL A;  3MQK C;  2WPK S;  4TPI Z;  1K1J A;  3GIS B;  3TK6 A;  3BV9 B;  4FUJ A;  1IQF A;  5A8Y A;  1FAX A;  4AFS A;  2BOH B;  2SNV A;  2H5C A;  4AOQ A;  8KME 2;  1A7S A;  1GCT C;  1BB0 B;  3FP7 E;  4ASH A;  3UQV A;  2WPI S;  5EXN A;  3NXP A;  2AMP A;  1PYT C;  2C8W B;  5IDK A;  2G55 A;  1CT2 E;  1C5L H;  4AX9 H;  1W8B H;  6LPR A;  1UW7 A;  2VVV A;  4BOH A;  1AB9 B;  1RFN A;  4DJZ B;  3QTV H;  3VB4 A;  1O34 A;  1S0R A;  1ELV A;  4CH2 B;  2G4T A;  1B7X B;  1H4W A;  3PRB A;  3PV5 A;  4BAH B;  1PJP A;  4I31 A;  3PWB A;  1S5S A;  5DN6 D;  2C8Y B;  1SOT A;  2ZDV H;  4Y8Z A;  1V2O T;  1O5A B;  5EGM A;  1VCW A;  1OHH D;  2ZGX H;  1GHY H;  2Q6F A;  4ZHM U;  4AOR A;  4DUR A;  1P2Q A;  4E06 H;  3UWJ H;  1BTZ A;  1GBI A;  1XUF A;  2G5V A;  2CHA B;  4ISN A;  4YOG A;  2PGQ B;  4ABD A;  4E7R G;  2PKS B;  1BMN H;  1GHB G;  3ZYE A;  2AMQ A;  2HVY B;  3LPR A;  1C9P A;  1LHC H;  2OC7 A;  2F43 B;  1EFR D;  1CGH A;  1ELD E;  1HAY B;  3L6P A;  4JZF H;  3GYM A;  4H6T A;  2BLQ A;  3GS9 A;  5E0J A;  1YPE H;  3PWC A;  3FAN A;  2ZDM A;  1OKX A;  1ZSL A;  3OFN D;  1YPG H;  4K5Z A;  4XBB A;  1AGJ A;  1MTV A;  1BBR H;  4FVB A;  3SGA E;  3RLY H;  1BRA A;  1GJ7 B;  1GVL A;  3ELA H;  3OTJ E;  4DG4 A;  1IQK A;  1FON A;  2HNT C;  3RXM A;  3UB0 A;  3KID U;  2QN5 T;  2R9P A;  3A7Y A;  2FOA A;  4Y8Y A;  2ZCH P;  2TPI Z;  1EAT A;  2D1J A;  1HIA A;  1NRQ H;  1HV7 A;  1E34 B;  3A7T A;  1E1Q D;  4GVU A;  1ZTL A;  1RS0 A;  1GBT A;  1ZRB A;  1LPZ B;  5AFZ H;  2YMS D;  5JB8 S;  3M35 A;  2PKA B;  3MFJ A;  2XC4 A;  3STJ A;  1MKW H;  1QR3 E;  2ZA5 A;  3ZVG A;  2H1U A;  1Z8R A;  1SGY E;  5DO4 H;  1TGC A;  2BDH A;  1TE0 A;  4I8J A;  1MTN B;  2I6Q A;  3U69 H;  2B7D H;  1AB9 C;  2G4U A;  2KAI A;  3QN7 A;  2ZEC A;  2CGA A;  3T26 A;  1T4V H;  1UJ1 A;  1GBB A;  1GJB B;  4P00 A;  1V2L T;  2HLD D;  3TJU A;  1ETT H;  4GCH F;  3URE A;  3SZE A;  3PMJ A;  1O2S A;  1L4D A;  3WWB A;  4Z6A H;  4J1Y A;  4AFU A;  1GI6 A;  1JMO H;  2J5U A;  3AVZ A;  3LIW A;  3MU5 A;  3P70 B;  1TNK A;  3RXO A;  1OP2 A;  2FPZ A;  3VB5 A;  2CHA C;  2PKS C;  4Q7Y A;  2BD3 A;  3A7W A;  1BHX B;  2AFQ B;  1EKB B;  1YM0 A;  2ZFQ H;  4NWK A;  3E6P H;  1PPC E;  2YNB A;  3MU8 A;  2JIZ D;  2ZQ1 A;  1GI9 B;  5K7R A;  1O2J A;  3LOX A;  5FPT A;  1DSU A;  4X2V A;  2K1Q A;  4F49 A;  4NIY A;  1L1N A;  3GCT G;  4CR5 A;  1NN6 A;  1O5G H;  3LON A;  3F68 H;  5BPE A;  1TA6 A;  2NU1 E;  1N6X A;  1OWK A;  2QCY A;  2Z6B D;  3TJO A;  4ASU D;  3E91 A;  4UD9 H;  1EAW A;  1UK2 A;  1O5D H;  5HMA A;  5GDS H;  2BLO A;  1BT7 A;  4FUB A;  4AN7 A;  1O5B B;  3JZ1 B;  3SJ9 A;  2GTB A;  1BMA A;  1YBW A;  1MTU A;  5E2P A;  4Q7Z A;  1Y3X A;  2FOB A;  2WHX A;  4B74 A;  1HAO H;  1AY6 H;  1NRR H;  3GOV B;  4Y7B A;  1MTN C;  4ABB A;  3LGV A;  4OS2 A;  3VXF H;  8LPR A;  1MZD A;  4AYV B;  3M37 A;  3C1K A;  2ANK H;  2Z3E A;  2OK5 A;  1HAX B;  3GY3 A;  1K1N A;  4ISO A;  4JYV H;  2VIN A;  1T31 A;  3M3S A;  1A0L A;  3LJO A;  3GCT F;  3RDZ A;  1AFQ B;  1P01 A;  1EOJ A;  3UFA A;  4I8H A;  4SGA E;  3ZVC A;  1F0R A;  1GHX H;  5L30 H;  4RT1 A;  1YLN A;  1TB6 H;  2HGT H;  2FO9 A;  4K60 A;  4NGA H;  2VNT A;  2JJ1 D;  3RMN H;  4B2B A;  1ORF A;  4AGK A;  3SQH E;  5C3N A;  1C2I A;  1Q2W A;  2CJI A;  2D26 C;  2P16 A;  2BM2 A;  1EZS C;  2DUC A;  3EA9 A;  1A46 H;  1MCT A;  2AIP A;  5KEC A;  3BTW E;  3SHC H;  3QZR A;  1TX8 A;  4BTU B;  5LPF A;  3FZD A;  4WXV A;  1O2X A;  2KCY A;  3NKK A;  3QLP H;  2VJ1 A;  3GCH B;  1FN8 A;  4X1S U;  1KXB A;  1OP0 A;  4A1V A;  3TK5 A;  2WPD D;  1O39 A;  3A80 A;  2KCO A;  4K1E A;  3GY5 A;  2V3M A;  1KLI H;  5JBA S;  1RJX B;  5F8X A;  1ARB A;  2FI3 E;  2ZU4 A;  1V2S T;  1YY3 A;  1K1I A;  3MH7 A;  3D23 A;  4IS5 A;  8GCH F;  4MNW A;  1SGQ E;  1IAU A;  2R3U A;  2UUJ B;  4I8G A;  2ZC9 H;  1ABJ H;  1HCG A;  1VR1 H;  1C1O A;  3R3G B;  4ZKR U;  1S83 A;  5JBT A;  5LGO A;  3UR6 A;  3OY5 U;  3NRL A;  3U8R H;  4RKJ B;  4R0I A;  1K1P A;  4I33 A;  1GJA B;  1YKT A;  1KDQ B;  2VIO A;  2ZHW H;  2P3T B;  2XBX A;  1TMT H;  3PTN A;  3SOR A;  1SGD E;  2XND D;  2F9P A;  1O3O A;  2Y7Z A;  4DVA U;  3TH4 H;  5DK1 A;  3BIU H;  1NRS H;  3A8A A;  1HXE H;  2BD7 A;  5FPY A;  4UEH H;  1LKB A;  2XWB I;  5EPN A;  2VIW A;  1TBR H;  2Y6T A;  5TCA A;  2WV5 A;  1KLT A;  1AFQ C;  3RC6 A;  4AYY B;  1Y59 T;  3LGI A;  2V3H H;  4AFQ A;  4OS6 A;  5EPY A;  3CP7 A;  3F0O A;  4BAO B;  1O2V A;  1DXW A;  2A4G A;  1C5W B;  4M9F A;  2BQ7 B;  4KP0 A;  5F03 A;  3RXA A;  5GWZ A;  2TGT A;  2HAL A;  3TGJ E;  1VCP A;  1VIT F;  4HTC H;  1QBN A;  3OX7 U;  1H9I E;  2XNI A;  1E36 B;  2EI8 A;  4O97 A;  1ELF A;  1TGT A;  7GCH G;  1ELC A;  3GCH C;  3I77 A;  1DWD H;  2O8W A;  2A1D B;  3LGT A;  1S84 A;  4BXS A;  2OCV B;  1UMA H;  5GXP A;  1D3Q B;  1YC0 A;  1FY5 A;  1NM6 A;  1NTP A;  2FES H;  1O2U A;  5HM2 A;  2H5D A;  2RDL A;  3EE7 A;  3RXD A;  1ZTK A;  2OTV A;  2HOB A;  1A3B H;  4A1X A;  2YOL A;  4X6P A;  1Z1I A;  4DT4 A;  3GDU A;  1C4V 2;  5A8X A;  5FHT A;  1S6H A;  3FKS D;  3OSY A;  5DSF A;  2TRM A;  3ZYD A;  3DSP A;  1C5R A;  4E7N A;  1VKY A;  1ZGV A;  1TX6 A;  4X0W U;  3MMG A;  4IN1 A;  3SI3 H;  1DXP A;  5T1V A;  2BVR H;  2ASU B;  4AC9 A;  1SGE E;  3B8J A;  3PRO A;  1GI8 B;  5GPI B;  4WJG 2;  3UR9 A;  3PYH A;  2H9E H;  2ULL A;  5GCH G;  1OWH A;  1W7G H;  2FTM A;  2ZG0 H;  4TPY A;  4Q63 A;  1PPE E;  3T29 A;  4ZMA H;  3RM0 H;  1OSS A;  4XBD A;  3NWU A;  5EQS A;  5IYT A;  3IG6 B;  1HPG A;  1L0Z A;  1BA8 B;  2QV1 A;  2Z7F E;  2PTC E;  4FUI A;  3TH2 H;  2HRV A;  4XOJ A;  4ZHL U;  3GYL B;  2GDD A;  1IQG A;  2EA3 A;  4CRF A;  1GBL A;  1T7C A;  1WOF A;  3F9H A;  3KHV A;  3K65 B;  1TMU H;  3PM3 A;  3RXR A;  3EE0 B;  2BDY A;  2F9B H;  2LP6 A;  5C2Z A;  1IQE A;  1T8N A;  2XYA A;  1Y8T A;  1OPH B;  1UTN A;  2W6J D;  3AAU A;  2GT8 A;  1FY1 A;  1D4P B;  1V6D A;  2CK3 D;  1RTL A;  3ATM A;  5FCK A;  4Q4L A;  1C2E A;  2HNT E;  2ZTX A;  2DE9 A;  1OWE A;  2FOH A;  3NCL A;  1TAL A;  2GCH F;  3MO9 A;  5LH8 A;  1Y3W A;  2QF4 A;  1TQ0 B;  3QDZ B;  3U9A H;  4K8Y A;  3A8D A;  4OM9 A;  2D8W A;  5EU8 A;  4JK6 A;  2OUA A;  2Q1J A;  3RML H;  5JPM H;  1DM4 B;  3TLO A;  3VB3 A;  2B5T B;  1V2T T;  2PUQ H;  3RU4 T;  3W94 A;  2ANM H;  2J34 A;  5I25 A;  1SQA A;  2FOC A;  1KLJ H;  4TT3 D;  1SSX A;  1AN1 E;  1LQE A;  9EST A;  1SLU B;  1IQM A;  4DIH H;  1BRC E;  1EAI A;  2ZU3 A;  3SHA H;  1LVB A;  4UFF H;  3A83 A;  3BTE E;  2SGE E;  1F2S E;  5DPA A;  4XFQ A;  2BQ6 B;  3H5C B;  3SYJ A;  1EZQ A;  2Y7X A;  1JWT A;  3A88 A;  1EAX A;  1ABI H;  1O3F A;  3PV2 A;  1W14 U;  1NFY A;  4WMD A;  4WWY A;  1YP9 A;  3TIU A;  4H6S B;  1ARC A;  3C27 B;  1G3D A;  3V0X A;  5HIY A;  4YOJ A;  6GCH F;  1P3E A;  2BY6 X;  2FWW A;  3FO8 D;  2A5I A;  1HLT H;  4I8L A;  3ATI A;  5HYO A;  2Z94 A;  1DUA A;  1C2G A;  4Q7X A;  3TJV A;  2BZA A;  3FN8 A;  2PW8 H;  1GBD A;  2JDI D;  1ZHM A;  3PMH B;  4E05 H;  2ZDK A;  4CRD A;  1O2I A;  1HAH H;  3MYW A;  5JYI A;  1LHD H;  1G36 A;  1DFP A;  1UTO A;  4TYD A;  1DS2 E;  1O2K A;  1Q3X A;  3BEI B;  2SGF E;  3V13 A;  3F1S B;  3MNB A;  5L2Y H;  1XM1 A;  3RMO H;  2BXT H;  2OBQ A;  3L33 A;  2AMD A;  1BTY A;  1E37 B;  1P04 A;  2XBW A;  3DSG A;  3KQD A;  4ISL A;  4QT8 C;  4K1T A;  1EPT B;  1TOC B;  2JJ2 D;  3HKI B;  3MWI U;  4I32 A;  1K1O A;  3RXB A;  1NZQ H;  1KMH B;  1SLV B;  1P9S A;  1INC A;  2FX6 A;  1CGJ E;  4B75 A;  1E35 B;  1Y5U T;  2AHM E;  4D76 A;  2VGC B;  4CRE A;  5PTP A;  1AD8 H;  1H1B A;  2DE8 A;  1QRZ A;  1EB1 H;  2A4O A;  2P3U B;  3ZZB A;  1BBR E;  2BDC A;  5C20 A;  1YYY 1;  1YF4 A;  5CMX H;  2V7Q D;  4K69 A;  3UIR A;  1LHE H;  2ZDN A;  3A7Z A;  2PFE A;  3PLP A;  4UDW H;  3PMA B;  7EST E;  1QBO A;  4U32 A;  1MKX K;  2AIQ A;  4Y10 E;  3KEE A;  1WTG H;  1O0D H;  2VBC A;  3K9X B;  3SGQ E;  1X7A C;  3HPT B;  4RT0 A;  5AF9 H;  1QGF A;  1YGC H;  4IGD A;  3ZZ8 A;  1Z6E A;  1TA2 A;  3VG8 A;  2WUB A;  3V3M A;  1DY9 A;  3KL6 A;  1PPG E;  2QY0 B;  1SPJ A;  1BTW A;  3S7H B;  1UVO A;  1HAV A;  1VZQ H;  1D6R A;  2C4F H;  4B76 A;  1RTF B;  1ZOM A;  4JYU H;  1HJA B;  1CE5 A;  4DW2 U;  3N99 A;  1UTJ A;  2C3S A;  3K6Z A;  2BDI A;  4NA7 A;  1WV7 H;  2ODP A;  2BDA A;  3GIC B;  5C0T A;  5F6M A;  1IHS H;  3IIT A;  4FXG H;  4RI0 A;  1C1Q A;  2PWX A;  2UWO A;  5EW1 H;  1UCY K;  2GKV E;  4ACA A;  2VU8 E;  2GVF A;  4B2C A;  4UFE H;  9LPR A;  5ETX A;  4B2A A;  1MU8 B;  1OWD A;  3URD A;  1C5M D;  1SGF A;  2F3C E;  4DY7 B;  1A1R A;  1J9C H;  1QZ8 A;  3RU4 E;  2BTC E;  1MQ5 A;  1HAP H;  2WPH S;  2ANW A;  1A5I A;  3RXF A;  1NFW A;  1FMG A;  1V2V T;  1TRN A;  1KXD A;  1TNL A;  1S0Q A;  4KKD A;  1EPT C;  3SV2 H;  4FU8 A;  3SUD A;  4TY7 A;  1HAG E;  2VWO A;  3RXQ A;  1U6Q A;  2QXH A;  5CHB A;  1GJ6 A;  5EW2 H;  2J4I A;  3QO6 A;  2VGC C;  1SB1 H;  4AB9 A;  1O3I A;  5C5N A;  4OGY A;  1ZZZ A;  1QB6 A;  2OBO A;  1YPL H;  4GLY A;  1QCP A;  1AZZ A;  1C5Z B;  2A5A A;  4CRA A;  2F91 A;  2UUY A;  1THP B;  2IPH A;  4GCH G;  1UVP A;  3P8G A;  1PQ8 A;  1FQ3 A;  1AUJ A;  1NRO H;  2ANY A;  3P8O A;  4FU9 A;  4ZRO A;  1QJ7 B;  2BLV A;  3SJI A;  3MHW U;  1LVY A;  3D62 A;  1O3B A;  3ZZ6 A;  1RIW B;  3ZZ7 A;  2VIQ A;  3EQ0 H;  1J15 A;  2TBS A;  2OQU A;  3ZZA A;  4BTT B;  2QXG A;  3P17 H;  3BTK E;  1EX3 A;  2H2Z A;  3VXE H;  4B71 A;  5GND A;  4F55 A;  2BY7 X;  1KTS B;  1G2M A;  2UUF B;  1HJA C;  3TGI E;  2IOT A;  2A2Q H;  1MTW A;  3E3T A;  4X8U H;  2HVX A;  4XRN A;  2W7U A;  1SHY A;  5EOK A;  5EOD A;  5A8Z A;  1IQL A;  1G2L A;  3EST A;  1SFI A;  1E38 B;  1TGN A;  2WYJ A;  1FI8 A;  4XSK U;  5EXL A;  1GL0 E;  2ZIQ H;  3OY6 U;  1EP6 A;  1LPG B;  3OYP A;  1YCP K;  1DX5 M;  5JDU B;  1SGF G;  2PV9 B;  4MNY A;  4ABF A;  2CMY A;  1A0J A;  3EDX B;  4K8B A;  1DAN H;  1Q31 A;  3MU4 A;  3RXP A;  1CSO E;  1XMN B;  3T25 A;  4MVN A;  4UON A;  4ZKO U;  2BDG A;  4INK A;  3LKW A;  3RXU A;  2ZEB A;  1HFD A;  1FAK H;  4X2W A;  2G8T A;  3MH6 A;  3ODD A;  3A7V A;  3EYD A;  1ANC A;  1QIX B;  3LH3 A;  2A0Q B; 
#chains in the Genus database with same CATH homology
 3U28 C;  2V3M A;  2HVY B;  3UAI C;  2EY4 C;  2RFK C;  2EQN A;  3MQK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...