3U2DA

S. aureus gyrb atpase domain in complex with small molecule inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
b'YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Pyrrolamide DNA gyrase inhibitors: fragment-based nuclear magnetic resonance screening to identify antibacterial agents.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 63
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3u2dA00
2ESAA 1TIDA 2BRCA 3INXA 4GFNA 2K5BA 4HXZA 4P8OA 4CWSA 3OWBA 1US7A 3G7BA 3VHAA 3U67A 3EHHA 3FV5A 4CWTA 2BZ5A 5CTXA 5FNDA 3HYYA 4XCJA 3RLQA 3HZ5A 1BGQA 1QY8A 4EM7A 3EKRA 4JAVA 4LWGA 1S16A 2E0AA 1ZXMA 3U2DA 5CF0A 2YEAA 4H81A 2XK2A 1THNA 4GQTA 3D2RA 3O6OA 2VW5A 1OSFA 2IORA 4MPEA 5D6PA 4KSHA 4LPBA 3GIEA 3JZ3A 1YC4A 2ZDYA 1UYGA 4AS9A 2IOPA 5M4HA 2WEQA 1Y8NA 3HYZA 4O07A 2Q8HA 1GJVA 2PNRA 1KZNA 3TZ4A 2XD6A 3G75A 4QPKA 3U2KA 3ZKDA 4H85A 4AWOA 5M4KA 4MPNA 4O09A 2CCSA 4KP4A 1YESA 4ASBA 2ZDXA 1UYMA 3KE6A 3D0BA 2XDKA 1UYIA 3C0EA 4XD8A 3T2SA 1UYLA 4ASAA 3WQ9A 1ZW9A 1YT2A 4B6CA 3K97A 4DUHA 5BODA 1UYEA 2HG1A 3T1KA 4O05A 1H7UA 3A0ZA 3O0IA 4BIZA 1I5DA 3T0ZA 5M4MA 4GEEA 1GKZA 4LWIA 4FPPA 4HZ5A 4FCPA 1UYKA 3RLPA 3NMQA 3LPSA 2CCUA 4KSGA 4PL9A 4KQVA 3R4NA 4CWFA 4YKQA 2EXLA 2XABA 5CTWA 2YGFA 2XDXA 2WI6A 2O1UA 1UY8A 3Q5KA 2BSMA 2WI1A 4UROA 3RKZA 5IDJA 3TUHA 4FCQA 3VHCA 4CWNA 1UYDA 2WI3A 4YKRA 1TC0A 3CRLA 1Y4SA 4Q20A 2VCIA 5CPHA 3OMUA 1AH8A 4EFTA 3OPDA 3RLRA 1NHHA 2XHXA 4U7NA 4E00A 2AKPA 1NHIA 4NH9A 4XITA 1UY6A 4ASFA 3EHFA 2YKBA 4KFGA 4DZYA 2JKIA 3PEJA 4V26A 2UWDA 1EI1A 4HY1A 4YKXA 2YE2A 4FMTA 2YK2A 3SL2A 2C2AA 3K99A 4XC0A 2YE7A 2FYPA 2QG2A 2VCJA 2O1WA 2YE3A 2WI2A 3HEKA 3A0WA 2QF6A 2XDLA 1TILA 5M4EA 2HCHA 4YKUA 4ASGA 3PEHA 4XDMA 3R91A 3IEDA 5D7DA 5IDMA 2BYIA 2YEBA 1MU5A 1JM6A 4URNA 2IOQA 1Z59A 3EKOA 3EHJA 4HY6A 4L93A 5F3KA 3H4LA 3CGZA 3WHAA 4EFUA 3TZ2A 1MX0A 3R4MA 1YC3A 4P7AA 4O0BA 4CWOA 4L8ZA 2XDUA 4XCLA 5GGZA 4E02A 2BU8A 4JAUA 4WUCA 1YSZA 2BTZA 4CWRA 2XDSA 1QZRA 2Q2EB 2ZKJA 2YKEA 4JASA 4B7PA 1I5CA 1ZXNA 2XJJA 1YS3A 3LNUA 3FT8A 3GIGA 2XHTA 3DGEA 2BU5A 1U2OA 2WEPA 4L94A 4PU9A 1BXDA 3TZ5A 1S14A 2YE9A 3A0RA 4XKKA 2YEEA 4WUDA 5FNFA 4CWPA 4ZKIA 2YI0A 2YE6A 3T0HA 1U0ZA 3INWA 4MOTA 5D7CA 1I59A 2YEDA 3B26A 5F5RA 1GKXA 1YC1A 3Q5LA 1I58A 5BOCA 1AMWA 4EGKA 1QYEA 2H55A 2YGEA 1H7SA 1UY7A 1TH8A 2CH4A 4XTJA 1PVGA 2BU7A 3QDDA 2YI7A 3FT5A 1ZWHA 4BIUA 4EGIA 1Z5BA 4LWFA 4YKTA 4LWEA 3CGYA 2CG9A 2YI5A 2Q8FA 3B27A 2XX4A 4AWPA 4MP7A 2YKCA 1YT1A 4H7QA 3H80A 3O2FA 4CWQA 3R4OA 4PRVA 2YEIA 3K60A 4YKYA 4V25A 1TC6A 2WI4A 1YERA 3TZ0A 2JJCA 4QPJA 1BYQA 4URMA 4EGHA 3C11A 4GT8A 2YKJA 2CGFA 4GGLA 3TTZA 3EHGA 4AWQA 4MPCA 3B28A 3ZKBA 4EMVA 4JQLA 2YEGA 2YEFA 3A0TA 4WUBA 2WERA 4CE3A 3GIGB 2YK9A 5CTUA 3B25A 3CWVA 4K4OA 3VADA 4U7OA 2XJXA 4NH8A 1EA6A 2FXSA 1KIJA 3R4PA 2XJGA 3G7EA 3HHUA 2IWXA 3CRKA 2YEHA 4FCRA 3A0YA 4PRXA 5M4NA 3GIFA 4XIRA 5J71A 1I5BA 4O04A 1A4HA 4XIPA 2BT0A 2YKIA 1Y4UA 3D36A 2Q8IA 2IWUA 4BXIA 4GCZA 3Q5JA 3ZM7A 2YJXA 4YKWA 2YECA 2BU6A 4XKAA 4KTNA 1UYCA 1YSRA 4L90A 4HYMA 1UY9A 2YE8A 3A0XA 3OW6A 1TBWA 4HZ0A 4XIQA 3T10A 4CE2A 2YE4A 2XX5A 2BREA 1B3QA 1B63A 2BYHA 1I5AA 5CTYA 2CCTA 2WI7A 2GFDA 4I3HA 4URLA 4X9LA 5L3JA 2YEJA 4U93A 1Y8PA 4ZVIA 1ID0A 2YE5A 1B62A 3HZ1A 5M4PA 1L0OA 2YI6A 4R1FA 4I5SA 4E01A 2HKJA 2QFOA 3QTFA 4BAEA 3BM9A 2XX2A 2BU2A 2XHRA 4MP2A 4W7TA 2YJWA 4LP0A 4L91A 1AM1A 2Q8GA 2FWZA 3B24A 4XE2A 3MNRP 5FWKA 3R92A 2FWYA 4BQGA 1AJ6A 3K98A 5D6QA 3ZXQA 1R62A 4MB9A 5IN9A 5C93A 2H8MA 1AH6A 3OWDA 2O1VA 4EEHA 1Z5AA 1BKNA 2IWSA 4LWHA 4R3MA 3VHDA 1Z5CA 2VWCA 3ZXOA 4HXWA 4HYPA 5FNCA 4R3AA 1YT0A 2ZBKB 5D7RA 2WI5A 4XKOA 2YGAA 2GQPA 3BMYA 1Y8OA 4NH7A 2XCMA 4CE1A 1YETA 4BQJA 1NHJA 2QG0A 1UYFA 1UYHA 4MBCA 4YKZA 5J6AA
chains in the Genus database with same CATH superfamily
2ESAA 1TIDA 2BRCA 3INXA 4GFNA 2K5BA 4HXZA 4P8OA 4CWSA 3OWBA 1US7A 3G7BA 3VHAA 3U67A 3EHHA 3FV5A 4CWTA 2BZ5A 5CTXA 5FNDA 3HYYA 4XCJA 3RLQA 3HZ5A 1BGQA 1QY8A 4EM7A 3EKRA 4JAVA 4LWGA 1S16A 2E0AA 1ZXMA 3U2DA 3CYGA 5CF0A 2YEAA 4H81A 2XK2A 1THNA 4GQTA 3D2RA 3O6OA 2VW5A 1OSFA 2IORA 4MPEA 5D6PA 4KSHA 4LPBA 3GIEA 3JZ3A 1YC4A 2ZDYA 1UYGA 4AS9A 2IOPA 5M4HA 2WEQA 1Y8NA 3HYZA 4O07A 2Q8HA 1GJVA 2PNRA 1KZNA 3TZ4A 2XD6A 3G75A 4QPKA 3U2KA 3ZKDA 4H85A 2C1GA 4AWOA 5M4KA 4MPNA 4O09A 2CCSA 4KP4A 1YESA 4ASBA 2ZDXA 1UYMA 3KE6A 3D0BA 2XDKA 1UYIA 3C0EA 4XD8A 3T2SA 1UYLA 4ASAA 3WQ9A 1ZW9A 1YT2A 4B6CA 3K97A 4DUHA 5BODA 1UYEA 2HG1A 3T1KA 4O05A 1H7UA 3A0ZA 3O0IA 4BIZA 1I5DA 3T0ZA 5M4MA 4GEEA 1GKZA 4LWIA 4FPPA 4HZ5A 4FCPA 1UYKA 3RLPA 3NMQA 3LPSA 2CCUA 4KSGA 4PL9A 2FTKA 4KQVA 3R4NA 4CWFA 4YKQA 2EXLA 2XABA 5CTWA 2YGFA 2XDXA 2WI6A 2O1UA 1UY8A 3Q5KA 2BSMA 2WI1A 4UROA 3RKZA 5IDJA 3TUHA 4FCQA 3VHCA 4CWNA 1UYDA 2WI3A 4YKRA 1TC0A 3CRLA 1Y4SA 4Q20A 2VCIA 5CPHA 3OMUA 1AH8A 4E72A 4EFTA 3OPDA 3RLRA 1F51A 1NHHA 2XHXA 4U7NA 4E00A 2AKPA 1NHIA 4NH9A 4XITA 1UY6A 4ASFA 3EHFA 2YKBA 4KFGA 4DZYA 2JKIA 3PEJA 4V26A 2UWDA 1EI1A 4HY1A 4YKXA 2YE2A 4FMTA 2YK2A 3SL2A 2C2AA 3K99A 4XC0A 2YE7A 2FYPA 2QG2A 2VCJA 2O1WA 2YE3A 2WI2A 3HEKA 3A0WA 2QF6A 2XDLA 1TILA 5M4EA 2HCHA 4YKUA 4ASGA 3PEHA 3LMMA 4XDMA 3R91A 3IEDA 5D7DA 5IDMA 2BYIA 2YEBA 1MU5A 1JM6A 4URNA 2IOQA 1Z59A 3EKOA 3EHJA 4HY6A 4L93A 5F3KA 3H4LA 3CGZA 3WHAA 4EFUA 3TZ2A 1MX0A 3R4MA 1YC3A 4P7AA 4O0BA 4CWOA 4L8ZA 2XDUA 4XCLA 5GGZA 4E02A 2BU8A 4JAUA 4WUCA 1YSZA 2BTZA 4CWRA 2XDSA 1QZRA 2Q2EB 2ZKJA 2YKEA 4JASA 4B7PA 1I5CA 1ZXNA 2XJJA 1YS3A 3LNUA 3FT8A 3GIGA 2XHTA 3DGEA 2BU5A 1U2OA 2WEPA 4L94A 4PU9A 1BXDA 3TZ5A 1S14A 2YE9A 3A0RA 4XKKA 2YEEA 4WUDA 5FNFA 4CWPA 4ZKIA 2YI0A 2YE6A 3T0HA 1U0ZA 3INWA 4MOTA 5D7CA 1I59A 2YEDA 3B26A 5F5RA 1GKXA 1YC1A 3Q5LA 1I58A 5BOCA 1AMWA 4EGKA 1QYEA 2H55A 2YGEA 1H7SA 1UY7A 1TH8A 2CH4A 4XTJA 1PVGA 2BU7A 3QDDA 2YI7A 3FT5A 1ZWHA 4BIUA 4EGIA 1Z5BA 4LWFA 4YKTA 4LWEA 3CGYA 2CG9A 2YI5A 2Q8FA 3B27A 2XX4A 4AWPA 4MP7A 2YKCA 1YT1A 4H7QA 3H80A 3O2FA 4CWQA 3R4OA 4PRVA 2YEIA 3K60A 4YKYA 4V25A 1TC6A 2C1IA 2WI4A 1YERA 3S5TA 3TZ0A 2JJCA 4QPJA 1BYQA 4URMA 4EGHA 3C11A 4GT8A 2YKJA 2CGFA 4GGLA 3TTZA 3EHGA 4AWQA 4MPCA 3B28A 3ZKBA 4EMVA 4JQLA 2YEGA 2YEFA 3A0TA 4WUBA 2WERA 4CE3A 3GIGB 2YK9A 5CTUA 3B25A 3CWVA 4K4OA 3VADA 4U7OA 2XJXA 4NH8A 1EA6A 2FXSA 1KIJA 3R4PA 2XJGA 3G7EA 5JENA 3HHUA 2IWXA 3CRKA 2YEHA 4FCRA 3A0YA 4PRXA 5M4NA 3GIFA 4XIRA 5J71A 1I5BA 4O04A 1A4HA 4XIPA 2BT0A 2YKIA 1Y4UA 3D36A 2Q8IA 2IWUA 4BXIA 3Q5JA 4GCZA 3ZM7A 2YJXA 4YKWA 2YECA 2BU6A 4XKAA 4KTNA 1UYCA 1YSRA 4L90A 4HYMA 1UY9A 2YE8A 3A0XA 3OW6A 1TBWA 4HZ0A 4XIQA 3T10A 4CE2A 2YE4A 2XX5A 2BREA 1B3QA 1B63A 2BYHA 1I5AA 5CTYA 2CCTA 2WI7A 2GFDA 4I3HA 4URLA 4X9LA 5L3JA 2YEJA 4U93A 1Y8PA 4ZVIA 2HHIA 1ID0A 2YE5A 1B62A 3HZ1A 5M4PA 1L0OA 2YI6A 4R1FA 4I5SA 4E01A 2HKJA 2QFOA 3QTFA 4BAEA 3BM9A 2XX2A 2BU2A 2XHRA 4MP2A 4W7TA 2YJWA 4LP0A 4L91A 1AM1A 2Q8GA 2FWZA 1IXMA 3B24A 4XE2A 3MNRP 5FWKA 3R92A 2FWYA 4BQGA 1AJ6A 3K98A 5D6QA 3ZXQA 1R62A 4MB9A 5IN9A 5C93A 2H8MA 1AH6A 3OWDA 2O1VA 4EEHA 1Z5AA 1BKNA 2IWSA 4LWHA 4R3MA 3VHDA 1Z5CA 2VWCA 3ZXOA 4HXWA 4HYPA 5FNCA 4R3AA 1YT0A 2ZBKB 5D7RA 2WI5A 4XKOA 2YGAA 2GQPA 3BMYA 1Y8OA 4NH7A 2XCMA 4CE1A 1YETA 4BQJA 1NHJA 2QG0A 1UYFA 1UYHA 4MBCA 4YKZA 5J6AA
chains in the Genus database with same CATH topology
2ESAA 1TIDA 2BRCA 3INXA 4GFNA 2K5BA 4HXZA 4P8OA 4CWSA 3OWBA 1US7A 3G7BA 3VHAA 3U67A 3EHHA 3FV5A 4CWTA 2BZ5A 5CTXA 5FNDA 3HYYA 4XCJA 3RLQA 3HZ5A 1BGQA 1QY8A 4EM7A 3EKRA 4JAVA 4LWGA 1S16A 2E0AA 1ZXMA 3U2DA 5CF0A 2YEAA 4H81A 2XK2A 1THNA 4GQTA 3D2RA 3O6OA 2VW5A 1OSFA 2IORA 4MPEA 5D6PA 4KSHA 4LPBA 3GIEA 3JZ3A 1YC4A 2ZDYA 1UYGA 4AS9A 2IOPA 5M4HA 2WEQA 1Y8NA 3HYZA 4O07A 2Q8HA 1GJVA 2PNRA 1KZNA 3TZ4A 2XD6A 3G75A 4QPKA 3U2KA 3ZKDA 4H85A 4AWOA 5M4KA 4MPNA 4O09A 2CCSA 4KP4A 1YESA 4ASBA 2ZDXA 1UYMA 3KE6A 3D0BA 2XDKA 1UYIA 3C0EA 4XD8A 3T2SA 1UYLA 4ASAA 3WQ9A 1ZW9A 1YT2A 4B6CA 3K97A 4DUHA 5BODA 1UYEA 2HG1A 3T1KA 4O05A 1H7UA 3A0ZA 3O0IA 4BIZA 1I5DA 3T0ZA 5M4MA 4GEEA 1GKZA 4LWIA 4FPPA 4HZ5A 4FCPA 1UYKA 3RLPA 3NMQA 3LPSA 2CCUA 4KSGA 4PL9A 4KQVA 3R4NA 4CWFA 4YKQA 2EXLA 2XABA 5CTWA 2YGFA 2XDXA 2WI6A 2O1UA 1UY8A 3Q5KA 2BSMA 2WI1A 4UROA 3RKZA 5IDJA 3TUHA 4FCQA 3VHCA 4CWNA 1UYDA 2WI3A 4YKRA 1TC0A 3CRLA 1Y4SA 4Q20A 2VCIA 5CPHA 3OMUA 1AH8A 4EFTA 3OPDA 3RLRA 1NHHA 2XHXA 4U7NA 4E00A 2AKPA 1NHIA 4NH9A 4XITA 1UY6A 4ASFA 3EHFA 2YKBA 4KFGA 4DZYA 2JKIA 3PEJA 4V26A 2UWDA 1EI1A 4HY1A 4YKXA 2YE2A 4FMTA 2YK2A 3SL2A 2C2AA 3K99A 4XC0A 2YE7A 2FYPA 2QG2A 2VCJA 2O1WA 2YE3A 2WI2A 3HEKA 3A0WA 2QF6A 2XDLA 1TILA 5M4EA 2HCHA 4YKUA 4ASGA 3PEHA 4XDMA 3R91A 3IEDA 5D7DA 5IDMA 2BYIA 2YEBA 1MU5A 1JM6A 4URNA 2IOQA 1Z59A 3EKOA 3EHJA 4HY6A 4L93A 5F3KA 3H4LA 3CGZA 3WHAA 4EFUA 3TZ2A 1MX0A 3R4MA 1YC3A 4P7AA 4O0BA 4CWOA 4L8ZA 2XDUA 4XCLA 5GGZA 4E02A 2BU8A 4JAUA 4WUCA 1YSZA 2BTZA 4CWRA 2XDSA 1QZRA 2Q2EB 2ZKJA 2YKEA 4JASA 4B7PA 1I5CA 1ZXNA 2XJJA 1YS3A 3LNUA 3FT8A 3GIGA 2XHTA 3DGEA 2BU5A 1U2OA 2WEPA 4L94A 4PU9A 1BXDA 3TZ5A 1S14A 2YE9A 3A0RA 4XKKA 2YEEA 4WUDA 5FNFA 4CWPA 4ZKIA 2YI0A 2YE6A 3T0HA 1U0ZA 3INWA 4MOTA 5D7CA 1I59A 2YEDA 3B26A 5F5RA 1GKXA 1YC1A 3Q5LA 1I58A 5BOCA 1AMWA 4EGKA 1QYEA 2H55A 2YGEA 1H7SA 1UY7A 1TH8A 2CH4A 4XTJA 1PVGA 2BU7A 3QDDA 2YI7A 3FT5A 1ZWHA 4BIUA 4EGIA 1Z5BA 4LWFA 4YKTA 4LWEA 3CGYA 2CG9A 2YI5A 2Q8FA 3B27A 2XX4A 4AWPA 4MP7A 2YKCA 1YT1A 4H7QA 3H80A 3O2FA 4CWQA 3R4OA 4PRVA 2YEIA 3K60A 4YKYA 4V25A 1TC6A 2WI4A 1YERA 3TZ0A 2JJCA 4QPJA 1BYQA 4URMA 4EGHA 3C11A 4GT8A 2YKJA 2CGFA 4GGLA 3TTZA 3EHGA 4AWQA 4MPCA 3B28A 3ZKBA 4EMVA 4JQLA 2YEGA 2YEFA 3A0TA 4WUBA 2WERA 4CE3A 3GIGB 2YK9A 5CTUA 3B25A 3CWVA 4K4OA 3VADA 4U7OA 2XJXA 4NH8A 1EA6A 2FXSA 1KIJA 3R4PA 2XJGA 3G7EA 3HHUA 2IWXA 3CRKA 2YEHA 4FCRA 3A0YA 4PRXA 5M4NA 3GIFA 4XIRA 5J71A 1I5BA 4O04A 1A4HA 4XIPA 2BT0A 2YKIA 1Y4UA 3D36A 2Q8IA 2IWUA 4BXIA 4GCZA 3Q5JA 3ZM7A 2YJXA 4YKWA 2YECA 2BU6A 4XKAA 4KTNA 1UYCA 1YSRA 4L90A 4HYMA 1UY9A 2YE8A 3A0XA 3OW6A 1TBWA 4HZ0A 4XIQA 3T10A 4CE2A 2YE4A 2XX5A 2BREA 1B3QA 1B63A 2BYHA 1I5AA 5CTYA 2CCTA 2WI7A 2GFDA 4I3HA 4URLA 4X9LA 5L3JA 2YEJA 4U93A 1Y8PA 4ZVIA 1ID0A 2YE5A 1B62A 3HZ1A 5M4PA 1L0OA 2YI6A 4R1FA 4I5SA 4E01A 2HKJA 2QFOA 3QTFA 4BAEA 3BM9A 2XX2A 2BU2A 2XHRA 4MP2A 4W7TA 2YJWA 4LP0A 4L91A 1AM1A 2Q8GA 2FWZA 3B24A 4XE2A 3MNRP 5FWKA 3R92A 2FWYA 4BQGA 1AJ6A 3K98A 5D6QA 3ZXQA 1R62A 4MB9A 5IN9A 5C93A 2H8MA 1AH6A 3OWDA 2O1VA 4EEHA 1Z5AA 1BKNA 2IWSA 4LWHA 4R3MA 3VHDA 1Z5CA 2VWCA 3ZXOA 4HXWA 4HYPA 5FNCA 4R3AA 1YT0A 2ZBKB 5D7RA 2WI5A 4XKOA 2YGAA 2GQPA 3BMYA 1Y8OA 4NH7A 2XCMA 4CE1A 1YETA 4BQJA 1NHJA 2QG0A 1UYFA 1UYHA 4MBCA 4YKZA 5J6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESA A;  1TID A;  2BRC A;  3INX A;  4GFN A;  2K5B A;  4HXZ A;  4P8O A;  4CWS A;  3OWB A;  1US7 A;  3G7B A;  3VHA A;  3U67 A;  3EHH A;  3FV5 A;  4CWT A;  2BZ5 A;  5CTX A;  5FND A;  3HYY A;  4XCJ A;  3RLQ A;  3HZ5 A;  1BGQ A;  1QY8 A;  4EM7 A;  3EKR A;  4JAV A;  4LWG A;  1S16 A;  2E0A A;  1ZXM A;  3U2D A;  5CF0 A;  2YEA A;  4H81 A;  2XK2 A;  1THN A;  4GQT A;  3D2R A;  3O6O A;  2VW5 A;  1OSF A;  2IOR A;  4MPE A;  5D6P A;  4KSH A;  4LPB A;  3GIE A;  3JZ3 A;  1YC4 A;  2ZDY A;  1UYG A;  4AS9 A;  2IOP A;  5M4H A;  2WEQ A;  1Y8N A;  3HYZ A;  4O07 A;  2Q8H A;  1GJV A;  2PNR A;  1KZN A;  3TZ4 A;  2XD6 A;  3G75 A;  4QPK A;  3U2K A;  3ZKD A;  4H85 A;  4AWO A;  5M4K A;  4MPN A;  4O09 A;  2CCS A;  4KP4 A;  1YES A;  4ASB A;  2ZDX A;  1UYM A;  3KE6 A;  3D0B A;  2XDK A;  1UYI A;  3C0E A;  4XD8 A;  3T2S A;  1UYL A;  4ASA A;  3WQ9 A;  1ZW9 A;  1YT2 A;  4B6C A;  3K97 A;  4DUH A;  5BOD A;  1UYE A;  2HG1 A;  3T1K A;  4O05 A;  1H7U A;  3A0Z A;  3O0I A;  4BIZ A;  1I5D A;  3T0Z A;  5M4M A;  4GEE A;  1GKZ A;  4LWI A;  4FPP A;  4HZ5 A;  4FCP A;  1UYK A;  3RLP A;  3NMQ A;  3LPS A;  2CCU A;  4KSG A;  4PL9 A;  4KQV A;  3R4N A;  4CWF A;  4YKQ A;  2EXL A;  2XAB A;  5CTW A;  2YGF A;  2XDX A;  2WI6 A;  2O1U A;  1UY8 A;  3Q5K A;  2BSM A;  2WI1 A;  4URO A;  3RKZ A;  5IDJ A;  3TUH A;  4FCQ A;  3VHC A;  4CWN A;  1UYD A;  2WI3 A;  4YKR A;  1TC0 A;  3CRL A;  1Y4S A;  4Q20 A;  2VCI A;  5CPH A;  3OMU A;  1AH8 A;  4EFT A;  3OPD A;  3RLR A;  1NHH A;  2XHX A;  4U7N A;  4E00 A;  2AKP A;  1NHI A;  4NH9 A;  4XIT A;  1UY6 A;  4ASF A;  3EHF A;  2YKB A;  4KFG A;  4DZY A;  2JKI A;  3PEJ A;  4V26 A;  2UWD A;  1EI1 A;  4HY1 A;  4YKX A;  2YE2 A;  4FMT A;  2YK2 A;  3SL2 A;  2C2A A;  3K99 A;  4XC0 A;  2YE7 A;  2FYP A;  2QG2 A;  2VCJ A;  2O1W A;  2YE3 A;  2WI2 A;  3HEK A;  3A0W A;  2QF6 A;  2XDL A;  1TIL A;  5M4E A;  2HCH A;  4YKU A;  4ASG A;  3PEH A;  4XDM A;  3R91 A;  3IED A;  5D7D A;  5IDM A;  2BYI A;  2YEB A;  1MU5 A;  1JM6 A;  4URN A;  2IOQ A;  1Z59 A;  3EKO A;  3EHJ A;  4HY6 A;  4L93 A;  5F3K A;  3H4L A;  3CGZ A;  3WHA A;  4EFU A;  3TZ2 A;  1MX0 A;  3R4M A;  1YC3 A;  4P7A A;  4O0B A;  4CWO A;  4L8Z A;  2XDU A;  4XCL A;  5GGZ A;  4E02 A;  2BU8 A;  4JAU A;  4WUC A;  1YSZ A;  2BTZ A;  4CWR A;  2XDS A;  1QZR A;  2Q2E B;  2ZKJ A;  2YKE A;  4JAS A;  4B7P A;  1I5C A;  1ZXN A;  2XJJ A;  1YS3 A;  3LNU A;  3FT8 A;  3GIG A;  2XHT A;  3DGE A;  2BU5 A;  1U2O A;  2WEP A;  4L94 A;  4PU9 A;  1BXD A;  3TZ5 A;  1S14 A;  2YE9 A;  3A0R A;  4XKK A;  2YEE A;  4WUD A;  5FNF A;  4CWP A;  4ZKI A;  2YI0 A;  2YE6 A;  3T0H A;  1U0Z A;  3INW A;  4MOT A;  5D7C A;  1I59 A;  2YED A;  3B26 A;  5F5R A;  1GKX A;  1YC1 A;  3Q5L A;  1I58 A;  5BOC A;  1AMW A;  4EGK A;  1QYE A;  2H55 A;  2YGE A;  1H7S A;  1UY7 A;  1TH8 A;  2CH4 A;  4XTJ A;  1PVG A;  2BU7 A;  3QDD A;  2YI7 A;  3FT5 A;  1ZWH A;  4BIU A;  4EGI A;  1Z5B A;  4LWF A;  4YKT A;  4LWE A;  3CGY A;  2CG9 A;  2YI5 A;  2Q8F A;  3B27 A;  2XX4 A;  4AWP A;  4MP7 A;  2YKC A;  1YT1 A;  4H7Q A;  3H80 A;  3O2F A;  4CWQ A;  3R4O A;  4PRV A;  2YEI A;  3K60 A;  4YKY A;  4V25 A;  1TC6 A;  2WI4 A;  1YER A;  3TZ0 A;  2JJC A;  4QPJ A;  1BYQ A;  4URM A;  4EGH A;  3C11 A;  4GT8 A;  2YKJ A;  2CGF A;  4GGL A;  3TTZ A;  3EHG A;  4AWQ A;  4MPC A;  3B28 A;  3ZKB A;  4EMV A;  4JQL A;  2YEG A;  2YEF A;  3A0T A;  4WUB A;  2WER A;  4CE3 A;  3GIG B;  2YK9 A;  5CTU A;  3B25 A;  3CWV A;  4K4O A;  3VAD A;  4U7O A;  2XJX A;  4NH8 A;  1EA6 A;  2FXS A;  1KIJ A;  3R4P A;  2XJG A;  3G7E A;  3HHU A;  2IWX A;  3CRK A;  2YEH A;  4FCR A;  3A0Y A;  4PRX A;  5M4N A;  3GIF A;  4XIR A;  5J71 A;  1I5B A;  4O04 A;  1A4H A;  4XIP A;  2BT0 A;  2YKI A;  1Y4U A;  3D36 A;  2Q8I A;  2IWU A;  4BXI A;  4GCZ A;  3Q5J A;  3ZM7 A;  2YJX A;  4YKW A;  2YEC A;  2BU6 A;  4XKA A;  4KTN A;  1UYC A;  1YSR A;  4L90 A;  4HYM A;  1UY9 A;  2YE8 A;  3A0X A;  3OW6 A;  1TBW A;  4HZ0 A;  4XIQ A;  3T10 A;  4CE2 A;  2YE4 A;  2XX5 A;  2BRE A;  1B3Q A;  1B63 A;  2BYH A;  1I5A A;  5CTY A;  2CCT A;  2WI7 A;  2GFD A;  4I3H A;  4URL A;  4X9L A;  5L3J A;  2YEJ A;  4U93 A;  1Y8P A;  4ZVI A;  1ID0 A;  2YE5 A;  1B62 A;  3HZ1 A;  5M4P A;  1L0O A;  2YI6 A;  4R1F A;  4I5S A;  4E01 A;  2HKJ A;  2QFO A;  3QTF A;  4BAE A;  3BM9 A;  2XX2 A;  2BU2 A;  2XHR A;  4MP2 A;  4W7T A;  2YJW A;  4LP0 A;  4L91 A;  1AM1 A;  2Q8G A;  2FWZ A;  3B24 A;  4XE2 A;  3MNR P;  5FWK A;  3R92 A;  2FWY A;  4BQG A;  1AJ6 A;  3K98 A;  5D6Q A;  3ZXQ A;  1R62 A;  4MB9 A;  5IN9 A;  5C93 A;  2H8M A;  1AH6 A;  3OWD A;  2O1V A;  4EEH A;  1Z5A A;  1BKN A;  2IWS A;  4LWH A;  4R3M A;  3VHD A;  1Z5C A;  2VWC A;  3ZXO A;  4HXW A;  4HYP A;  5FNC A;  4R3A A;  1YT0 A;  2ZBK B;  5D7R A;  2WI5 A;  4XKO A;  2YGA A;  2GQP A;  3BMY A;  1Y8O A;  4NH7 A;  2XCM A;  4CE1 A;  1YET A;  4BQJ A;  1NHJ A;  2QG0 A;  1UYF A;  1UYH A;  4MBC A;  4YKZ A;  5J6A A; 
#chains in the Genus database with same CATH topology
 2ESA A;  1TID A;  2BRC A;  3INX A;  4GFN A;  2K5B A;  4HXZ A;  4P8O A;  4CWS A;  3OWB A;  1US7 A;  3G7B A;  3VHA A;  3U67 A;  3EHH A;  3FV5 A;  4CWT A;  2BZ5 A;  5CTX A;  5FND A;  3HYY A;  4XCJ A;  3RLQ A;  3HZ5 A;  1BGQ A;  1QY8 A;  4EM7 A;  3EKR A;  4JAV A;  4LWG A;  1S16 A;  2E0A A;  1ZXM A;  3U2D A;  3CYG A;  5CF0 A;  2YEA A;  4H81 A;  2XK2 A;  1THN A;  4GQT A;  3D2R A;  3O6O A;  2VW5 A;  1OSF A;  2IOR A;  4MPE A;  5D6P A;  4KSH A;  4LPB A;  3GIE A;  3JZ3 A;  1YC4 A;  2ZDY A;  1UYG A;  4AS9 A;  2IOP A;  5M4H A;  2WEQ A;  1Y8N A;  3HYZ A;  4O07 A;  2Q8H A;  1GJV A;  2PNR A;  1KZN A;  3TZ4 A;  2XD6 A;  3G75 A;  4QPK A;  3U2K A;  3ZKD A;  4H85 A;  2C1G A;  4AWO A;  5M4K A;  4MPN A;  4O09 A;  2CCS A;  4KP4 A;  1YES A;  4ASB A;  2ZDX A;  1UYM A;  3KE6 A;  3D0B A;  2XDK A;  1UYI A;  3C0E A;  4XD8 A;  3T2S A;  1UYL A;  4ASA A;  3WQ9 A;  1ZW9 A;  1YT2 A;  4B6C A;  3K97 A;  4DUH A;  5BOD A;  1UYE A;  2HG1 A;  3T1K A;  4O05 A;  1H7U A;  3A0Z A;  3O0I A;  4BIZ A;  1I5D A;  3T0Z A;  5M4M A;  4GEE A;  1GKZ A;  4LWI A;  4FPP A;  4HZ5 A;  4FCP A;  1UYK A;  3RLP A;  3NMQ A;  3LPS A;  2CCU A;  4KSG A;  4PL9 A;  2FTK A;  4KQV A;  3R4N A;  4CWF A;  4YKQ A;  2EXL A;  2XAB A;  5CTW A;  2YGF A;  2XDX A;  2WI6 A;  2O1U A;  1UY8 A;  3Q5K A;  2BSM A;  2WI1 A;  4URO A;  3RKZ A;  5IDJ A;  3TUH A;  4FCQ A;  3VHC A;  4CWN A;  1UYD A;  2WI3 A;  4YKR A;  1TC0 A;  3CRL A;  1Y4S A;  4Q20 A;  2VCI A;  5CPH A;  3OMU A;  1AH8 A;  4E72 A;  4EFT A;  3OPD A;  3RLR A;  1F51 A;  1NHH A;  2XHX A;  4U7N A;  4E00 A;  2AKP A;  1NHI A;  4NH9 A;  4XIT A;  1UY6 A;  4ASF A;  3EHF A;  2YKB A;  4KFG A;  4DZY A;  2JKI A;  3PEJ A;  4V26 A;  2UWD A;  1EI1 A;  4HY1 A;  4YKX A;  2YE2 A;  4FMT A;  2YK2 A;  3SL2 A;  2C2A A;  3K99 A;  4XC0 A;  2YE7 A;  2FYP A;  2QG2 A;  2VCJ A;  2O1W A;  2YE3 A;  2WI2 A;  3HEK A;  3A0W A;  2QF6 A;  2XDL A;  1TIL A;  5M4E A;  2HCH A;  4YKU A;  4ASG A;  3PEH A;  3LMM A;  4XDM A;  3R91 A;  3IED A;  5D7D A;  5IDM A;  2BYI A;  2YEB A;  1MU5 A;  1JM6 A;  4URN A;  2IOQ A;  1Z59 A;  3EKO A;  3EHJ A;  4HY6 A;  4L93 A;  5F3K A;  3H4L A;  3CGZ A;  3WHA A;  4EFU A;  3TZ2 A;  1MX0 A;  3R4M A;  1YC3 A;  4P7A A;  4O0B A;  4CWO A;  4L8Z A;  2XDU A;  4XCL A;  5GGZ A;  4E02 A;  2BU8 A;  4JAU A;  4WUC A;  1YSZ A;  2BTZ A;  4CWR A;  2XDS A;  1QZR A;  2Q2E B;  2ZKJ A;  2YKE A;  4JAS A;  4B7P A;  1I5C A;  1ZXN A;  2XJJ A;  1YS3 A;  3LNU A;  3FT8 A;  3GIG A;  2XHT A;  3DGE A;  2BU5 A;  1U2O A;  2WEP A;  4L94 A;  4PU9 A;  1BXD A;  3TZ5 A;  1S14 A;  2YE9 A;  3A0R A;  4XKK A;  2YEE A;  4WUD A;  5FNF A;  4CWP A;  4ZKI A;  2YI0 A;  2YE6 A;  3T0H A;  1U0Z A;  3INW A;  4MOT A;  5D7C A;  1I59 A;  2YED A;  3B26 A;  5F5R A;  1GKX A;  1YC1 A;  3Q5L A;  1I58 A;  5BOC A;  1AMW A;  4EGK A;  1QYE A;  2H55 A;  2YGE A;  1H7S A;  1UY7 A;  1TH8 A;  2CH4 A;  4XTJ A;  1PVG A;  2BU7 A;  3QDD A;  2YI7 A;  3FT5 A;  1ZWH A;  4BIU A;  4EGI A;  1Z5B A;  4LWF A;  4YKT A;  4LWE A;  3CGY A;  2CG9 A;  2YI5 A;  2Q8F A;  3B27 A;  2XX4 A;  4AWP A;  4MP7 A;  2YKC A;  1YT1 A;  4H7Q A;  3H80 A;  3O2F A;  4CWQ A;  3R4O A;  4PRV A;  2YEI A;  3K60 A;  4YKY A;  4V25 A;  1TC6 A;  2C1I A;  2WI4 A;  1YER A;  3S5T A;  3TZ0 A;  2JJC A;  4QPJ A;  1BYQ A;  4URM A;  4EGH A;  3C11 A;  4GT8 A;  2YKJ A;  2CGF A;  4GGL A;  3TTZ A;  3EHG A;  4AWQ A;  4MPC A;  3B28 A;  3ZKB A;  4EMV A;  4JQL A;  2YEG A;  2YEF A;  3A0T A;  4WUB A;  2WER A;  4CE3 A;  3GIG B;  2YK9 A;  5CTU A;  3B25 A;  3CWV A;  4K4O A;  3VAD A;  4U7O A;  2XJX A;  4NH8 A;  1EA6 A;  2FXS A;  1KIJ A;  3R4P A;  2XJG A;  3G7E A;  5JEN A;  3HHU A;  2IWX A;  3CRK A;  2YEH A;  4FCR A;  3A0Y A;  4PRX A;  5M4N A;  3GIF A;  4XIR A;  5J71 A;  1I5B A;  4O04 A;  1A4H A;  4XIP A;  2BT0 A;  2YKI A;  1Y4U A;  3D36 A;  2Q8I A;  2IWU A;  4BXI A;  3Q5J A;  4GCZ A;  3ZM7 A;  2YJX A;  4YKW A;  2YEC A;  2BU6 A;  4XKA A;  4KTN A;  1UYC A;  1YSR A;  4L90 A;  4HYM A;  1UY9 A;  2YE8 A;  3A0X A;  3OW6 A;  1TBW A;  4HZ0 A;  4XIQ A;  3T10 A;  4CE2 A;  2YE4 A;  2XX5 A;  2BRE A;  1B3Q A;  1B63 A;  2BYH A;  1I5A A;  5CTY A;  2CCT A;  2WI7 A;  2GFD A;  4I3H A;  4URL A;  4X9L A;  5L3J A;  2YEJ A;  4U93 A;  1Y8P A;  4ZVI A;  2HHI A;  1ID0 A;  2YE5 A;  1B62 A;  3HZ1 A;  5M4P A;  1L0O A;  2YI6 A;  4R1F A;  4I5S A;  4E01 A;  2HKJ A;  2QFO A;  3QTF A;  4BAE A;  3BM9 A;  2XX2 A;  2BU2 A;  2XHR A;  4MP2 A;  4W7T A;  2YJW A;  4LP0 A;  4L91 A;  1AM1 A;  2Q8G A;  2FWZ A;  1IXM A;  3B24 A;  4XE2 A;  3MNR P;  5FWK A;  3R92 A;  2FWY A;  4BQG A;  1AJ6 A;  3K98 A;  5D6Q A;  3ZXQ A;  1R62 A;  4MB9 A;  5IN9 A;  5C93 A;  2H8M A;  1AH6 A;  3OWD A;  2O1V A;  4EEH A;  1Z5A A;  1BKN A;  2IWS A;  4LWH A;  4R3M A;  3VHD A;  1Z5C A;  2VWC A;  3ZXO A;  4HXW A;  4HYP A;  5FNC A;  4R3A A;  1YT0 A;  2ZBK B;  5D7R A;  2WI5 A;  4XKO A;  2YGA A;  2GQP A;  3BMY A;  1Y8O A;  4NH7 A;  2XCM A;  4CE1 A;  1YET A;  4BQJ A;  1NHJ A;  2QG0 A;  1UYF A;  1UYH A;  4MBC A;  4YKZ A;  5J6A A; 
#chains in the Genus database with same CATH homology
 2ESA A;  1TID A;  2BRC A;  3INX A;  4GFN A;  2K5B A;  4HXZ A;  4P8O A;  4CWS A;  3OWB A;  1US7 A;  3G7B A;  3VHA A;  3U67 A;  3EHH A;  3FV5 A;  4CWT A;  2BZ5 A;  5CTX A;  5FND A;  3HYY A;  4XCJ A;  3RLQ A;  3HZ5 A;  1BGQ A;  1QY8 A;  4EM7 A;  3EKR A;  4JAV A;  4LWG A;  1S16 A;  2E0A A;  1ZXM A;  3U2D A;  5CF0 A;  2YEA A;  4H81 A;  2XK2 A;  1THN A;  4GQT A;  3D2R A;  3O6O A;  2VW5 A;  1OSF A;  2IOR A;  4MPE A;  5D6P A;  4KSH A;  4LPB A;  3GIE A;  3JZ3 A;  1YC4 A;  2ZDY A;  1UYG A;  4AS9 A;  2IOP A;  5M4H A;  2WEQ A;  1Y8N A;  3HYZ A;  4O07 A;  2Q8H A;  1GJV A;  2PNR A;  1KZN A;  3TZ4 A;  2XD6 A;  3G75 A;  4QPK A;  3U2K A;  3ZKD A;  4H85 A;  4AWO A;  5M4K A;  4MPN A;  4O09 A;  2CCS A;  4KP4 A;  1YES A;  4ASB A;  2ZDX A;  1UYM A;  3KE6 A;  3D0B A;  2XDK A;  1UYI A;  3C0E A;  4XD8 A;  3T2S A;  1UYL A;  4ASA A;  3WQ9 A;  1ZW9 A;  1YT2 A;  4B6C A;  3K97 A;  4DUH A;  5BOD A;  1UYE A;  2HG1 A;  3T1K A;  4O05 A;  1H7U A;  3A0Z A;  3O0I A;  4BIZ A;  1I5D A;  3T0Z A;  5M4M A;  4GEE A;  1GKZ A;  4LWI A;  4FPP A;  4HZ5 A;  4FCP A;  1UYK A;  3RLP A;  3NMQ A;  3LPS A;  2CCU A;  4KSG A;  4PL9 A;  4KQV A;  3R4N A;  4CWF A;  4YKQ A;  2EXL A;  2XAB A;  5CTW A;  2YGF A;  2XDX A;  2WI6 A;  2O1U A;  1UY8 A;  3Q5K A;  2BSM A;  2WI1 A;  4URO A;  3RKZ A;  5IDJ A;  3TUH A;  4FCQ A;  3VHC A;  4CWN A;  1UYD A;  2WI3 A;  4YKR A;  1TC0 A;  3CRL A;  1Y4S A;  4Q20 A;  2VCI A;  5CPH A;  3OMU A;  1AH8 A;  4EFT A;  3OPD A;  3RLR A;  1NHH A;  2XHX A;  4U7N A;  4E00 A;  2AKP A;  1NHI A;  4NH9 A;  4XIT A;  1UY6 A;  4ASF A;  3EHF A;  2YKB A;  4KFG A;  4DZY A;  2JKI A;  3PEJ A;  4V26 A;  2UWD A;  1EI1 A;  4HY1 A;  4YKX A;  2YE2 A;  4FMT A;  2YK2 A;  3SL2 A;  2C2A A;  3K99 A;  4XC0 A;  2YE7 A;  2FYP A;  2QG2 A;  2VCJ A;  2O1W A;  2YE3 A;  2WI2 A;  3HEK A;  3A0W A;  2QF6 A;  2XDL A;  1TIL A;  5M4E A;  2HCH A;  4YKU A;  4ASG A;  3PEH A;  4XDM A;  3R91 A;  3IED A;  5D7D A;  5IDM A;  2BYI A;  2YEB A;  1MU5 A;  1JM6 A;  4URN A;  2IOQ A;  1Z59 A;  3EKO A;  3EHJ A;  4HY6 A;  4L93 A;  5F3K A;  3H4L A;  3CGZ A;  3WHA A;  4EFU A;  3TZ2 A;  1MX0 A;  3R4M A;  1YC3 A;  4P7A A;  4O0B A;  4CWO A;  4L8Z A;  2XDU A;  4XCL A;  5GGZ A;  4E02 A;  2BU8 A;  4JAU A;  4WUC A;  1YSZ A;  2BTZ A;  4CWR A;  2XDS A;  1QZR A;  2Q2E B;  2ZKJ A;  2YKE A;  4JAS A;  4B7P A;  1I5C A;  1ZXN A;  2XJJ A;  1YS3 A;  3LNU A;  3FT8 A;  3GIG A;  2XHT A;  3DGE A;  2BU5 A;  1U2O A;  2WEP A;  4L94 A;  4PU9 A;  1BXD A;  3TZ5 A;  1S14 A;  2YE9 A;  3A0R A;  4XKK A;  2YEE A;  4WUD A;  5FNF A;  4CWP A;  4ZKI A;  2YI0 A;  2YE6 A;  3T0H A;  1U0Z A;  3INW A;  4MOT A;  5D7C A;  1I59 A;  2YED A;  3B26 A;  5F5R A;  1GKX A;  1YC1 A;  3Q5L A;  1I58 A;  5BOC A;  1AMW A;  4EGK A;  1QYE A;  2H55 A;  2YGE A;  1H7S A;  1UY7 A;  1TH8 A;  2CH4 A;  4XTJ A;  1PVG A;  2BU7 A;  3QDD A;  2YI7 A;  3FT5 A;  1ZWH A;  4BIU A;  4EGI A;  1Z5B A;  4LWF A;  4YKT A;  4LWE A;  3CGY A;  2CG9 A;  2YI5 A;  2Q8F A;  3B27 A;  2XX4 A;  4AWP A;  4MP7 A;  2YKC A;  1YT1 A;  4H7Q A;  3H80 A;  3O2F A;  4CWQ A;  3R4O A;  4PRV A;  2YEI A;  3K60 A;  4YKY A;  4V25 A;  1TC6 A;  2WI4 A;  1YER A;  3TZ0 A;  2JJC A;  4QPJ A;  1BYQ A;  4URM A;  4EGH A;  3C11 A;  4GT8 A;  2YKJ A;  2CGF A;  4GGL A;  3TTZ A;  3EHG A;  4AWQ A;  4MPC A;  3B28 A;  3ZKB A;  4EMV A;  4JQL A;  2YEG A;  2YEF A;  3A0T A;  4WUB A;  2WER A;  4CE3 A;  3GIG B;  2YK9 A;  5CTU A;  3B25 A;  3CWV A;  4K4O A;  3VAD A;  4U7O A;  2XJX A;  4NH8 A;  1EA6 A;  2FXS A;  1KIJ A;  3R4P A;  2XJG A;  3G7E A;  3HHU A;  2IWX A;  3CRK A;  2YEH A;  4FCR A;  3A0Y A;  4PRX A;  5M4N A;  3GIF A;  4XIR A;  5J71 A;  1I5B A;  4O04 A;  1A4H A;  4XIP A;  2BT0 A;  2YKI A;  1Y4U A;  3D36 A;  2Q8I A;  2IWU A;  4BXI A;  4GCZ A;  3Q5J A;  3ZM7 A;  2YJX A;  4YKW A;  2YEC A;  2BU6 A;  4XKA A;  4KTN A;  1UYC A;  1YSR A;  4L90 A;  4HYM A;  1UY9 A;  2YE8 A;  3A0X A;  3OW6 A;  1TBW A;  4HZ0 A;  4XIQ A;  3T10 A;  4CE2 A;  2YE4 A;  2XX5 A;  2BRE A;  1B3Q A;  1B63 A;  2BYH A;  1I5A A;  5CTY A;  2CCT A;  2WI7 A;  2GFD A;  4I3H A;  4URL A;  4X9L A;  5L3J A;  2YEJ A;  4U93 A;  1Y8P A;  4ZVI A;  1ID0 A;  2YE5 A;  1B62 A;  3HZ1 A;  5M4P A;  1L0O A;  2YI6 A;  4R1F A;  4I5S A;  4E01 A;  2HKJ A;  2QFO A;  3QTF A;  4BAE A;  3BM9 A;  2XX2 A;  2BU2 A;  2XHR A;  4MP2 A;  4W7T A;  2YJW A;  4LP0 A;  4L91 A;  1AM1 A;  2Q8G A;  2FWZ A;  3B24 A;  4XE2 A;  3MNR P;  5FWK A;  3R92 A;  2FWY A;  4BQG A;  1AJ6 A;  3K98 A;  5D6Q A;  3ZXQ A;  1R62 A;  4MB9 A;  5IN9 A;  5C93 A;  2H8M A;  1AH6 A;  3OWD A;  2O1V A;  4EEH A;  1Z5A A;  1BKN A;  2IWS A;  4LWH A;  4R3M A;  3VHD A;  1Z5C A;  2VWC A;  3ZXO A;  4HXW A;  4HYP A;  5FNC A;  4R3A A;  1YT0 A;  2ZBK B;  5D7R A;  2WI5 A;  4XKO A;  2YGA A;  2GQP A;  3BMY A;  1Y8O A;  4NH7 A;  2XCM A;  4CE1 A;  1YET A;  4BQJ A;  1NHJ A;  2QG0 A;  1UYF A;  1UYH A;  4MBC A;  4YKZ A;  5J6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...