3U2DA

S. aureus gyrb atpase domain in complex with small molecule inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolamide DNA gyrase inhibitors: fragment-based nuclear magnetic resonance screening to identify antibacterial agents.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 63
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3u2dA00
5FWKA 1Z5CA 2Q8GA 3JZ3A 3WQ9A 2YEDA 2O1WA 4KSGA 4XIQA 1YERA 4B6CA 2YE4A 4YKRA 3D0BA 3INWA 4Q20A 1YC1A 1I5BA 1UYGA 2UWDA 1KZNA 2YI0A 3INXA 1YT2A 2ZDXA 3OPDA 4XDMA 2VCJA 2XDSA 4AWPA 4GQTA 4ASGA 3A0ZA 3WHAA 2XX5A 1ZWHA 2FWZA 3LPSA 4YKQA 5M4HA 3ZXQA 5J71A 3TZ2A 4BIZA 2XJJA 2YI6A 1YSRA 3CGYA 2YJWA 3NMQA 4NH8A 3GIGB 1Y4UA 2WI6A 3Q5JA 5D7DA 4LP0A 1NHHA 3T0HA 4U7OA 4XTJA 2WI7A 1UY8A 3R92A 4B7PA 1MU5A 2YK2A 3TUHA 3TZ0A 4CE2A 2XCMA 4XITA 4I3HA 3O6OA 4CE3A 1ID0A 3RLPA 1ZW9A 3BM9A 3TTZA 2YGFA 3B28A 1AH8A 1UY6A 1GJVA 3EKRA 4XCJA 3TZ4A 2CGFA 2YGEA 3FT8A 4EGKA 4R1FA 2YJXA 5M4NA 5M4KA 3B26A 2E0AA 4YKUA 1YC4A 2YEBA 1I58A 2CCUA 4L93A 2BU5A 1YC3A 3T10A 3Q5LA 1BGQA 2BTZA 5D6QA 2BZ5A 1EI1A 4EFTA 4BXIA 5F3KA 4HYMA 3VHCA 2BU8A 4L8ZA 4EM7A 3ZKBA 4CWOA 3GIEA 4GFNA 1Y8NA 4E02A 5IDMA 5BOCA 1UY7A 1TC0A 4EMVA 2YEIA 1BYQA 1UYMA 3O2FA 2JJCA 4JASA 2WERA 3RKZA 3EHJA 5D6PA 4MP2A 4EGIA 2Q8IA 4DZYA 1YS3A 4QPJA 2JKIA 5F5RA 4EGHA 2YKBA 3C0EA 3GIFA 2BSMA 2YI7A 4O0BA 3OW6A 5BODA 3EHGA 4YKYA 4KFGA 4AWOA 3R4OA 2YKIA 1JM6A 3TZ5A 3R91A 4DUHA 4KQVA 4AS9A 1AJ6A 1YESA 2XJGA 2YI5A 4ZVIA 5D7RA 2XHTA 5CTUA 2VWCA 1S16A 4I5SA 4E00A 4HZ0A 2YKEA 2K5BA 4JAUA 1QY8A 3U67A 1Y8OA 4L90A 3RLRA 3K99A 2PNRA 2YE7A 3G7EA 3R4NA 2VW5A 3CGZA 2IORA 4HY6A 5L3JA 2Q8FA 1TIDA 5FNDA 3K60A 4H85A 4P8OA 3O0IA 4ASBA 2YKCA 2YEGA 1U2OA 4HXZA 4CWSA 2ESAA 2XHRA 3QDDA 1B63A 4FCRA 4FCQA 1NHIA 1H7SA 2BU7A 4U7NA 3HZ1A 4FMTA 3D36A 3OWBA 1UYHA 2YK9A 2XK2A 4ASFA 2H8MA 1AM1A 1MX0A 4QPKA 4XKOA 4O04A 2XDXA 3U2DA 3HHUA 1UYDA 2Q2EB 1I5DA 2FYPA 5J6AA 3T0ZA 2YGAA 1YT1A 2VCIA 4KP4A 1AH6A 1BKNA 4YKXA 4CWQA 3H4LA 4L91A 4CE1A 2YEFA 1PVGA 5IDJA 5CTWA 1UYFA 5M4EA 1UYEA 1I5CA 2HG1A 2IWXA 4GCZA 3K97A 4PU9A 2H55A 3HYZA 3Q5KA 3A0XA 2XDUA 4LPBA 3B27A 1EA6A 2BU2A 5M4MA 2ZKJA 4BQGA 1B62A 2QG2A 2BRCA 2YE9A 1YT0A 4GGLA 4U93A 3VHAA 1Y4SA 4CWNA 1TILA 3EHHA 2GQPA 3PEHA 1AMWA 4FCPA 2XHXA 2WEQA 2YE3A 1Z5BA 4KTNA 2XDLA 4XIPA 3ZXOA 1UYCA 4XD8A 2YE6A 1TH8A 4WUCA 2BYIA 5FNCA 5D7CA 2YEAA 1A4HA 3VHDA 3OMUA 2YEEA 4XCLA 1GKZA 1NHJA 3HZ5A 4ZKIA 3K98A 4MPNA 4CWRA 5CTYA 5CTXA 1B3QA 3D2RA 2YECA 2YKJA 1UY9A 4XKAA 4FPPA 3IEDA 4KSHA 4LWHA 1I59A 4L94A 4LWGA 1ZXMA 1H7UA 4URNA 2WI2A 4LWEA 1Z5AA 5M4PA 3CWVA 2XABA 3H80A 4HZ5A 2XJXA 4BIUA 1GKXA 3FT5A 3ZM7A 2BYHA 3A0TA 1TC6A 4CWPA 3CRKA 3G7BA 4R3AA 3DGEA 5GGZA 4H7QA 3ZKDA 2FWYA 4O09A 2IWSA 2CCTA 2EXLA 4MP7A 5C93A 4ASAA 2XX2A 2YEHA 2GFDA 2YE5A 4MPEA 3R4MA 3T2SA 4E01A 4URLA 3OWDA 4CWFA 2BT0A 4YKZA 5CPHA 3CRLA 4W7TA 2HKJA 2IOQA 4WUBA 1OSFA 2Q8HA 4YKTA 1I5AA 1US7A 2QFOA 1UYKA 4X9LA 2FXSA 2WEPA 4GEEA 3B25A 4MOTA 2ZDYA 2YEJA 1U0ZA 5CF0A 2XX4A 4JAVA 2WI4A 2AKPA 4PL9A 2QG0A 2ZBKB 1R62A 1ZXNA 2CG9A 4CWTA 2WI5A 4P7AA 1YSZA 1Y8PA 1BXDA 4LWIA 3FV5A 2O1UA 3PEJA 2XD6A 4XC0A 4O05A 3EKOA 4WUDA 2BU6A 4UROA 2C2AA 2CH4A 4XE2A 3HYYA 2HCHA 3QTFA 2O1VA 4K4OA 2YE2A 4O07A 1TBWA 5IN9A 3SL2A 4MB9A 1QYEA 2IWUA 4HYPA 4V26A 1UYIA 3HEKA 5FNFA 3G75A 3T1KA 2XDKA 3A0RA 4LWFA 1THNA 3RLQA 3C11A 4PRXA 3MNRP 4V25A 4MPCA 4MBCA 4GT8A 4XKKA 1Z59A 2IOPA 1YETA 4PRVA 2WI3A 3BMYA 2QF6A 2BREA 2CCSA 1UYLA 3GIGA 3KE6A 2YE8A 4R3MA 4JQLA 3B24A 4NH7A 4URMA 3LNUA 3EHFA 4AWQA 4HXWA 4EFUA 3U2KA 2WI1A 1S14A 3A0WA 1KIJA 1L0OA 4EEHA 4YKWA 3A0YA 3R4PA 4BAEA 3VADA 4BQJA 4H81A 4XIRA 4NH9A 4HY1A 1QZRA
chains in the Genus database with same CATH superfamily
5FWKA 1Z5CA 2Q8GA 3JZ3A 3WQ9A 2YEDA 2O1WA 4KSGA 4XIQA 1YERA 4B6CA 2YE4A 4YKRA 3D0BA 3INWA 4Q20A 1YC1A 1I5BA 1UYGA 2UWDA 1KZNA 2YI0A 3INXA 1YT2A 2ZDXA 3OPDA 4XDMA 2VCJA 2XDSA 4AWPA 4GQTA 4ASGA 3A0ZA 3WHAA 2XX5A 1ZWHA 2FWZA 3LPSA 4YKQA 5M4HA 1IXMA 3ZXQA 5J71A 3TZ2A 4BIZA 2XJJA 2YI6A 1YSRA 3CGYA 3CYGA 2YJWA 3NMQA 4NH8A 3GIGB 1Y4UA 2WI6A 3Q5JA 5D7DA 4LP0A 1NHHA 3T0HA 4U7OA 4XTJA 2WI7A 1UY8A 3R92A 4B7PA 1MU5A 2YK2A 3TUHA 3TZ0A 4CE2A 2XCMA 4XITA 4I3HA 3O6OA 4CE3A 1ID0A 3RLPA 1ZW9A 3BM9A 3TTZA 2YGFA 3B28A 1AH8A 1UY6A 3S5TA 1GJVA 3EKRA 4XCJA 3TZ4A 2CGFA 2YGEA 3FT8A 4EGKA 4R1FA 2YJXA 5M4NA 5M4KA 3B26A 2E0AA 4YKUA 1YC4A 2YEBA 1I58A 2CCUA 4L93A 2BU5A 1YC3A 3T10A 3Q5LA 1BGQA 2BTZA 5D6QA 2BZ5A 1EI1A 4EFTA 4BXIA 5F3KA 4HYMA 3VHCA 2BU8A 4L8ZA 4EM7A 3ZKBA 4CWOA 3GIEA 4GFNA 1Y8NA 4E02A 5IDMA 5BOCA 1UY7A 1TC0A 4EMVA 2YEIA 1BYQA 1UYMA 3O2FA 2JJCA 4JASA 2WERA 3RKZA 3EHJA 5D6PA 4MP2A 4EGIA 2Q8IA 4DZYA 1YS3A 4QPJA 2JKIA 5F5RA 2FTKA 4EGHA 2YKBA 3C0EA 3GIFA 2BSMA 2YI7A 4O0BA 3OW6A 5BODA 3EHGA 4YKYA 4KFGA 4AWOA 3R4OA 2YKIA 1JM6A 3TZ5A 3R91A 4DUHA 4KQVA 4AS9A 1AJ6A 1YESA 2XJGA 2YI5A 4ZVIA 5D7RA 2XHTA 5CTUA 2VWCA 1S16A 4I5SA 4E00A 4HZ0A 2YKEA 2K5BA 4JAUA 1QY8A 3U67A 1Y8OA 4L90A 3RLRA 3K99A 2PNRA 2YE7A 3G7EA 3R4NA 2VW5A 3CGZA 2IORA 4HY6A 3LMMA 5L3JA 2Q8FA 1TIDA 5FNDA 3K60A 4H85A 4P8OA 3O0IA 2HHIA 4ASBA 2YKCA 2YEGA 1U2OA 4HXZA 4CWSA 2ESAA 2XHRA 3QDDA 1B63A 4FCRA 4FCQA 1NHIA 1H7SA 2BU7A 4U7NA 3HZ1A 4FMTA 3D36A 3OWBA 1UYHA 2YK9A 2XK2A 4ASFA 2H8MA 1AM1A 1MX0A 4QPKA 4XKOA 4O04A 2XDXA 3U2DA 3HHUA 1UYDA 2Q2EB 1I5DA 2FYPA 5J6AA 3T0ZA 2YGAA 1YT1A 2VCIA 4KP4A 1AH6A 1BKNA 4YKXA 4CWQA 3H4LA 4L91A 4CE1A 2YEFA 1PVGA 5IDJA 5CTWA 1UYFA 5M4EA 1UYEA 1I5CA 2HG1A 2IWXA 4GCZA 3K97A 4PU9A 2H55A 3HYZA 3Q5KA 3A0XA 2XDUA 4LPBA 1F51A 3B27A 1EA6A 2BU2A 5M4MA 2ZKJA 4BQGA 1B62A 2QG2A 2BRCA 2YE9A 1YT0A 4GGLA 4U93A 3VHAA 1Y4SA 4CWNA 1TILA 3EHHA 2GQPA 3PEHA 1AMWA 4FCPA 2XHXA 2WEQA 2YE3A 1Z5BA 4KTNA 2C1IA 2XDLA 4XIPA 3ZXOA 1UYCA 4XD8A 2YE6A 5JENA 1TH8A 4WUCA 2BYIA 5FNCA 5D7CA 2YEAA 1A4HA 3VHDA 3OMUA 2YEEA 4XCLA 1GKZA 1NHJA 3HZ5A 4ZKIA 3K98A 4MPNA 4CWRA 5CTYA 5CTXA 1B3QA 3D2RA 2YECA 2YKJA 1UY9A 4XKAA 4FPPA 3IEDA 4KSHA 4LWHA 1I59A 4L94A 4LWGA 1ZXMA 1H7UA 4URNA 2WI2A 4LWEA 1Z5AA 5M4PA 3CWVA 2XABA 3H80A 4HZ5A 2XJXA 4BIUA 1GKXA 3FT5A 3ZM7A 2BYHA 3A0TA 1TC6A 4CWPA 3CRKA 3G7BA 4R3AA 3DGEA 5GGZA 4H7QA 3ZKDA 2FWYA 4O09A 2IWSA 2CCTA 2EXLA 4MP7A 5C93A 4ASAA 2XX2A 2YEHA 2GFDA 2YE5A 4MPEA 3R4MA 4E72A 3T2SA 4E01A 4URLA 3OWDA 4CWFA 2BT0A 4YKZA 5CPHA 3CRLA 4W7TA 2HKJA 2IOQA 4WUBA 1OSFA 2Q8HA 4YKTA 1I5AA 1US7A 2QFOA 1UYKA 4X9LA 2FXSA 2WEPA 4GEEA 3B25A 4MOTA 2ZDYA 2YEJA 1U0ZA 5CF0A 2XX4A 4JAVA 2WI4A 2AKPA 4PL9A 2QG0A 2ZBKB 1R62A 1ZXNA 2CG9A 4CWTA 2WI5A 4P7AA 1YSZA 1Y8PA 1BXDA 4LWIA 3FV5A 2O1UA 3PEJA 2XD6A 4XC0A 4O05A 2C1GA 3EKOA 4WUDA 2BU6A 4UROA 2C2AA 2CH4A 4XE2A 3HYYA 2HCHA 3QTFA 2O1VA 4K4OA 2YE2A 4O07A 1TBWA 5IN9A 3SL2A 4MB9A 1QYEA 2IWUA 4HYPA 4V26A 1UYIA 3HEKA 5FNFA 3G75A 3T1KA 2XDKA 3A0RA 4LWFA 1THNA 3RLQA 3C11A 4PRXA 3MNRP 4V25A 4MPCA 4MBCA 4GT8A 4XKKA 1Z59A 2IOPA 1YETA 4PRVA 2WI3A 3BMYA 2QF6A 2BREA 2CCSA 1UYLA 3GIGA 3KE6A 2YE8A 4R3MA 4JQLA 3B24A 4NH7A 4URMA 3LNUA 3EHFA 4AWQA 4HXWA 4EFUA 3U2KA 2WI1A 1S14A 3A0WA 1KIJA 1L0OA 4EEHA 4YKWA 3A0YA 3R4PA 4BAEA 3VADA 4BQJA 4H81A 4XIRA 4NH9A 4HY1A 1QZRA
chains in the Genus database with same CATH topology
5FWKA 1Z5CA 2Q8GA 3JZ3A 3WQ9A 2YEDA 2O1WA 4KSGA 4XIQA 1YERA 4B6CA 2YE4A 4YKRA 3D0BA 3INWA 4Q20A 1YC1A 1I5BA 1UYGA 2UWDA 1KZNA 2YI0A 3INXA 1YT2A 2ZDXA 3OPDA 4XDMA 2VCJA 2XDSA 4AWPA 4GQTA 4ASGA 3A0ZA 3WHAA 2XX5A 1ZWHA 2FWZA 3LPSA 4YKQA 5M4HA 3ZXQA 5J71A 3TZ2A 4BIZA 2XJJA 2YI6A 1YSRA 3CGYA 2YJWA 3NMQA 4NH8A 3GIGB 1Y4UA 2WI6A 3Q5JA 5D7DA 4LP0A 1NHHA 3T0HA 4U7OA 4XTJA 2WI7A 1UY8A 3R92A 4B7PA 1MU5A 2YK2A 3TUHA 3TZ0A 4CE2A 2XCMA 4XITA 4I3HA 3O6OA 4CE3A 1ID0A 3RLPA 1ZW9A 3BM9A 3TTZA 2YGFA 3B28A 1AH8A 1UY6A 1GJVA 3EKRA 4XCJA 3TZ4A 2CGFA 2YGEA 3FT8A 4EGKA 4R1FA 2YJXA 5M4NA 5M4KA 3B26A 2E0AA 4YKUA 1YC4A 2YEBA 1I58A 2CCUA 4L93A 2BU5A 1YC3A 3T10A 3Q5LA 1BGQA 2BTZA 5D6QA 2BZ5A 1EI1A 4EFTA 4BXIA 5F3KA 4HYMA 3VHCA 2BU8A 4L8ZA 4EM7A 3ZKBA 4CWOA 3GIEA 4GFNA 1Y8NA 4E02A 5IDMA 5BOCA 1UY7A 1TC0A 4EMVA 2YEIA 1BYQA 1UYMA 3O2FA 2JJCA 4JASA 2WERA 3RKZA 3EHJA 5D6PA 4MP2A 4EGIA 2Q8IA 4DZYA 1YS3A 4QPJA 2JKIA 5F5RA 4EGHA 2YKBA 3C0EA 3GIFA 2BSMA 2YI7A 4O0BA 3OW6A 5BODA 3EHGA 4YKYA 4KFGA 4AWOA 3R4OA 2YKIA 1JM6A 3TZ5A 3R91A 4DUHA 4KQVA 4AS9A 1AJ6A 1YESA 2XJGA 2YI5A 4ZVIA 5D7RA 2XHTA 5CTUA 2VWCA 1S16A 4I5SA 4E00A 4HZ0A 2YKEA 2K5BA 4JAUA 1QY8A 3U67A 1Y8OA 4L90A 3RLRA 3K99A 2PNRA 2YE7A 3G7EA 3R4NA 2VW5A 3CGZA 2IORA 4HY6A 5L3JA 2Q8FA 1TIDA 5FNDA 3K60A 4H85A 4P8OA 3O0IA 4ASBA 2YKCA 2YEGA 1U2OA 4HXZA 4CWSA 2ESAA 2XHRA 3QDDA 1B63A 4FCRA 4FCQA 1NHIA 1H7SA 2BU7A 4U7NA 3HZ1A 4FMTA 3D36A 3OWBA 1UYHA 2YK9A 2XK2A 4ASFA 2H8MA 1AM1A 1MX0A 4QPKA 4XKOA 4O04A 2XDXA 3U2DA 3HHUA 1UYDA 2Q2EB 1I5DA 2FYPA 5J6AA 3T0ZA 2YGAA 1YT1A 2VCIA 4KP4A 1AH6A 1BKNA 4YKXA 4CWQA 3H4LA 4L91A 4CE1A 2YEFA 1PVGA 5IDJA 5CTWA 1UYFA 5M4EA 1UYEA 1I5CA 2HG1A 2IWXA 4GCZA 3K97A 4PU9A 2H55A 3HYZA 3Q5KA 3A0XA 2XDUA 4LPBA 3B27A 1EA6A 2BU2A 5M4MA 2ZKJA 4BQGA 1B62A 2QG2A 2BRCA 2YE9A 1YT0A 4GGLA 4U93A 3VHAA 1Y4SA 4CWNA 1TILA 3EHHA 2GQPA 3PEHA 1AMWA 4FCPA 2XHXA 2WEQA 2YE3A 1Z5BA 4KTNA 2XDLA 4XIPA 3ZXOA 1UYCA 4XD8A 2YE6A 1TH8A 4WUCA 2BYIA 5FNCA 5D7CA 2YEAA 1A4HA 3VHDA 3OMUA 2YEEA 4XCLA 1GKZA 1NHJA 3HZ5A 4ZKIA 3K98A 4MPNA 4CWRA 5CTYA 5CTXA 1B3QA 3D2RA 2YECA 2YKJA 1UY9A 4XKAA 4FPPA 3IEDA 4KSHA 4LWHA 1I59A 4L94A 4LWGA 1ZXMA 1H7UA 4URNA 2WI2A 4LWEA 1Z5AA 5M4PA 3CWVA 2XABA 3H80A 4HZ5A 2XJXA 4BIUA 1GKXA 3FT5A 3ZM7A 2BYHA 3A0TA 1TC6A 4CWPA 3CRKA 3G7BA 4R3AA 3DGEA 5GGZA 4H7QA 3ZKDA 2FWYA 4O09A 2IWSA 2CCTA 2EXLA 4MP7A 5C93A 4ASAA 2XX2A 2YEHA 2GFDA 2YE5A 4MPEA 3R4MA 3T2SA 4E01A 4URLA 3OWDA 4CWFA 2BT0A 4YKZA 5CPHA 3CRLA 4W7TA 2HKJA 2IOQA 4WUBA 1OSFA 2Q8HA 4YKTA 1I5AA 1US7A 2QFOA 1UYKA 4X9LA 2FXSA 2WEPA 4GEEA 3B25A 4MOTA 2ZDYA 2YEJA 1U0ZA 5CF0A 2XX4A 4JAVA 2WI4A 2AKPA 4PL9A 2QG0A 2ZBKB 1R62A 1ZXNA 2CG9A 4CWTA 2WI5A 4P7AA 1YSZA 1Y8PA 1BXDA 4LWIA 3FV5A 2O1UA 3PEJA 2XD6A 4XC0A 4O05A 3EKOA 4WUDA 2BU6A 4UROA 2C2AA 2CH4A 4XE2A 3HYYA 2HCHA 3QTFA 2O1VA 4K4OA 2YE2A 4O07A 1TBWA 5IN9A 3SL2A 4MB9A 1QYEA 2IWUA 4HYPA 4V26A 1UYIA 3HEKA 5FNFA 3G75A 3T1KA 2XDKA 3A0RA 4LWFA 1THNA 3RLQA 3C11A 4PRXA 3MNRP 4V25A 4MPCA 4MBCA 4GT8A 4XKKA 1Z59A 2IOPA 1YETA 4PRVA 2WI3A 3BMYA 2QF6A 2BREA 2CCSA 1UYLA 3GIGA 3KE6A 2YE8A 4R3MA 4JQLA 3B24A 4NH7A 4URMA 3LNUA 3EHFA 4AWQA 4HXWA 4EFUA 3U2KA 2WI1A 1S14A 3A0WA 1KIJA 1L0OA 4EEHA 4YKWA 3A0YA 3R4PA 4BAEA 3VADA 4BQJA 4H81A 4XIRA 4NH9A 4HY1A 1QZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWK A;  1Z5C A;  2Q8G A;  3JZ3 A;  3WQ9 A;  2YED A;  2O1W A;  4KSG A;  4XIQ A;  1YER A;  4B6C A;  2YE4 A;  4YKR A;  3D0B A;  3INW A;  4Q20 A;  1YC1 A;  1I5B A;  1UYG A;  2UWD A;  1KZN A;  2YI0 A;  3INX A;  1YT2 A;  2ZDX A;  3OPD A;  4XDM A;  2VCJ A;  2XDS A;  4AWP A;  4GQT A;  4ASG A;  3A0Z A;  3WHA A;  2XX5 A;  1ZWH A;  2FWZ A;  3LPS A;  4YKQ A;  5M4H A;  3ZXQ A;  5J71 A;  3TZ2 A;  4BIZ A;  2XJJ A;  2YI6 A;  1YSR A;  3CGY A;  2YJW A;  3NMQ A;  4NH8 A;  3GIG B;  1Y4U A;  2WI6 A;  3Q5J A;  5D7D A;  4LP0 A;  1NHH A;  3T0H A;  4U7O A;  4XTJ A;  2WI7 A;  1UY8 A;  3R92 A;  4B7P A;  1MU5 A;  2YK2 A;  3TUH A;  3TZ0 A;  4CE2 A;  2XCM A;  4XIT A;  4I3H A;  3O6O A;  4CE3 A;  1ID0 A;  3RLP A;  1ZW9 A;  3BM9 A;  3TTZ A;  2YGF A;  3B28 A;  1AH8 A;  1UY6 A;  1GJV A;  3EKR A;  4XCJ A;  3TZ4 A;  2CGF A;  2YGE A;  3FT8 A;  4EGK A;  4R1F A;  2YJX A;  5M4N A;  5M4K A;  3B26 A;  2E0A A;  4YKU A;  1YC4 A;  2YEB A;  1I58 A;  2CCU A;  4L93 A;  2BU5 A;  1YC3 A;  3T10 A;  3Q5L A;  1BGQ A;  2BTZ A;  5D6Q A;  2BZ5 A;  1EI1 A;  4EFT A;  4BXI A;  5F3K A;  4HYM A;  3VHC A;  2BU8 A;  4L8Z A;  4EM7 A;  3ZKB A;  4CWO A;  3GIE A;  4GFN A;  1Y8N A;  4E02 A;  5IDM A;  5BOC A;  1UY7 A;  1TC0 A;  4EMV A;  2YEI A;  1BYQ A;  1UYM A;  3O2F A;  2JJC A;  4JAS A;  2WER A;  3RKZ A;  3EHJ A;  5D6P A;  4MP2 A;  4EGI A;  2Q8I A;  4DZY A;  1YS3 A;  4QPJ A;  2JKI A;  5F5R A;  4EGH A;  2YKB A;  3C0E A;  3GIF A;  2BSM A;  2YI7 A;  4O0B A;  3OW6 A;  5BOD A;  3EHG A;  4YKY A;  4KFG A;  4AWO A;  3R4O A;  2YKI A;  1JM6 A;  3TZ5 A;  3R91 A;  4DUH A;  4KQV A;  4AS9 A;  1AJ6 A;  1YES A;  2XJG A;  2YI5 A;  4ZVI A;  5D7R A;  2XHT A;  5CTU A;  2VWC A;  1S16 A;  4I5S A;  4E00 A;  4HZ0 A;  2YKE A;  2K5B A;  4JAU A;  1QY8 A;  3U67 A;  1Y8O A;  4L90 A;  3RLR A;  3K99 A;  2PNR A;  2YE7 A;  3G7E A;  3R4N A;  2VW5 A;  3CGZ A;  2IOR A;  4HY6 A;  5L3J A;  2Q8F A;  1TID A;  5FND A;  3K60 A;  4H85 A;  4P8O A;  3O0I A;  4ASB A;  2YKC A;  2YEG A;  1U2O A;  4HXZ A;  4CWS A;  2ESA A;  2XHR A;  3QDD A;  1B63 A;  4FCR A;  4FCQ A;  1NHI A;  1H7S A;  2BU7 A;  4U7N A;  3HZ1 A;  4FMT A;  3D36 A;  3OWB A;  1UYH A;  2YK9 A;  2XK2 A;  4ASF A;  2H8M A;  1AM1 A;  1MX0 A;  4QPK A;  4XKO A;  4O04 A;  2XDX A;  3U2D A;  3HHU A;  1UYD A;  2Q2E B;  1I5D A;  2FYP A;  5J6A A;  3T0Z A;  2YGA A;  1YT1 A;  2VCI A;  4KP4 A;  1AH6 A;  1BKN A;  4YKX A;  4CWQ A;  3H4L A;  4L91 A;  4CE1 A;  2YEF A;  1PVG A;  5IDJ A;  5CTW A;  1UYF A;  5M4E A;  1UYE A;  1I5C A;  2HG1 A;  2IWX A;  4GCZ A;  3K97 A;  4PU9 A;  2H55 A;  3HYZ A;  3Q5K A;  3A0X A;  2XDU A;  4LPB A;  3B27 A;  1EA6 A;  2BU2 A;  5M4M A;  2ZKJ A;  4BQG A;  1B62 A;  2QG2 A;  2BRC A;  2YE9 A;  1YT0 A;  4GGL A;  4U93 A;  3VHA A;  1Y4S A;  4CWN A;  1TIL A;  3EHH A;  2GQP A;  3PEH A;  1AMW A;  4FCP A;  2XHX A;  2WEQ A;  2YE3 A;  1Z5B A;  4KTN A;  2XDL A;  4XIP A;  3ZXO A;  1UYC A;  4XD8 A;  2YE6 A;  1TH8 A;  4WUC A;  2BYI A;  5FNC A;  5D7C A;  2YEA A;  1A4H A;  3VHD A;  3OMU A;  2YEE A;  4XCL A;  1GKZ A;  1NHJ A;  3HZ5 A;  4ZKI A;  3K98 A;  4MPN A;  4CWR A;  5CTY A;  5CTX A;  1B3Q A;  3D2R A;  2YEC A;  2YKJ A;  1UY9 A;  4XKA A;  4FPP A;  3IED A;  4KSH A;  4LWH A;  1I59 A;  4L94 A;  4LWG A;  1ZXM A;  1H7U A;  4URN A;  2WI2 A;  4LWE A;  1Z5A A;  5M4P A;  3CWV A;  2XAB A;  3H80 A;  4HZ5 A;  2XJX A;  4BIU A;  1GKX A;  3FT5 A;  3ZM7 A;  2BYH A;  3A0T A;  1TC6 A;  4CWP A;  3CRK A;  3G7B A;  4R3A A;  3DGE A;  5GGZ A;  4H7Q A;  3ZKD A;  2FWY A;  4O09 A;  2IWS A;  2CCT A;  2EXL A;  4MP7 A;  5C93 A;  4ASA A;  2XX2 A;  2YEH A;  2GFD A;  2YE5 A;  4MPE A;  3R4M A;  3T2S A;  4E01 A;  4URL A;  3OWD A;  4CWF A;  2BT0 A;  4YKZ A;  5CPH A;  3CRL A;  4W7T A;  2HKJ A;  2IOQ A;  4WUB A;  1OSF A;  2Q8H A;  4YKT A;  1I5A A;  1US7 A;  2QFO A;  1UYK A;  4X9L A;  2FXS A;  2WEP A;  4GEE A;  3B25 A;  4MOT A;  2ZDY A;  2YEJ A;  1U0Z A;  5CF0 A;  2XX4 A;  4JAV A;  2WI4 A;  2AKP A;  4PL9 A;  2QG0 A;  2ZBK B;  1R62 A;  1ZXN A;  2CG9 A;  4CWT A;  2WI5 A;  4P7A A;  1YSZ A;  1Y8P A;  1BXD A;  4LWI A;  3FV5 A;  2O1U A;  3PEJ A;  2XD6 A;  4XC0 A;  4O05 A;  3EKO A;  4WUD A;  2BU6 A;  4URO A;  2C2A A;  2CH4 A;  4XE2 A;  3HYY A;  2HCH A;  3QTF A;  2O1V A;  4K4O A;  2YE2 A;  4O07 A;  1TBW A;  5IN9 A;  3SL2 A;  4MB9 A;  1QYE A;  2IWU A;  4HYP A;  4V26 A;  1UYI A;  3HEK A;  5FNF A;  3G75 A;  3T1K A;  2XDK A;  3A0R A;  4LWF A;  1THN A;  3RLQ A;  3C11 A;  4PRX A;  3MNR P;  4V25 A;  4MPC A;  4MBC A;  4GT8 A;  4XKK A;  1Z59 A;  2IOP A;  1YET A;  4PRV A;  2WI3 A;  3BMY A;  2QF6 A;  2BRE A;  2CCS A;  1UYL A;  3GIG A;  3KE6 A;  2YE8 A;  4R3M A;  4JQL A;  3B24 A;  4NH7 A;  4URM A;  3LNU A;  3EHF A;  4AWQ A;  4HXW A;  4EFU A;  3U2K A;  2WI1 A;  1S14 A;  3A0W A;  1KIJ A;  1L0O A;  4EEH A;  4YKW A;  3A0Y A;  3R4P A;  4BAE A;  3VAD A;  4BQJ A;  4H81 A;  4XIR A;  4NH9 A;  4HY1 A;  1QZR A; 
#chains in the Genus database with same CATH topology
 5FWK A;  1Z5C A;  2Q8G A;  3JZ3 A;  3WQ9 A;  2YED A;  2O1W A;  4KSG A;  4XIQ A;  1YER A;  4B6C A;  2YE4 A;  4YKR A;  3D0B A;  3INW A;  4Q20 A;  1YC1 A;  1I5B A;  1UYG A;  2UWD A;  1KZN A;  2YI0 A;  3INX A;  1YT2 A;  2ZDX A;  3OPD A;  4XDM A;  2VCJ A;  2XDS A;  4AWP A;  4GQT A;  4ASG A;  3A0Z A;  3WHA A;  2XX5 A;  1ZWH A;  2FWZ A;  3LPS A;  4YKQ A;  5M4H A;  1IXM A;  3ZXQ A;  5J71 A;  3TZ2 A;  4BIZ A;  2XJJ A;  2YI6 A;  1YSR A;  3CGY A;  3CYG A;  2YJW A;  3NMQ A;  4NH8 A;  3GIG B;  1Y4U A;  2WI6 A;  3Q5J A;  5D7D A;  4LP0 A;  1NHH A;  3T0H A;  4U7O A;  4XTJ A;  2WI7 A;  1UY8 A;  3R92 A;  4B7P A;  1MU5 A;  2YK2 A;  3TUH A;  3TZ0 A;  4CE2 A;  2XCM A;  4XIT A;  4I3H A;  3O6O A;  4CE3 A;  1ID0 A;  3RLP A;  1ZW9 A;  3BM9 A;  3TTZ A;  2YGF A;  3B28 A;  1AH8 A;  1UY6 A;  3S5T A;  1GJV A;  3EKR A;  4XCJ A;  3TZ4 A;  2CGF A;  2YGE A;  3FT8 A;  4EGK A;  4R1F A;  2YJX A;  5M4N A;  5M4K A;  3B26 A;  2E0A A;  4YKU A;  1YC4 A;  2YEB A;  1I58 A;  2CCU A;  4L93 A;  2BU5 A;  1YC3 A;  3T10 A;  3Q5L A;  1BGQ A;  2BTZ A;  5D6Q A;  2BZ5 A;  1EI1 A;  4EFT A;  4BXI A;  5F3K A;  4HYM A;  3VHC A;  2BU8 A;  4L8Z A;  4EM7 A;  3ZKB A;  4CWO A;  3GIE A;  4GFN A;  1Y8N A;  4E02 A;  5IDM A;  5BOC A;  1UY7 A;  1TC0 A;  4EMV A;  2YEI A;  1BYQ A;  1UYM A;  3O2F A;  2JJC A;  4JAS A;  2WER A;  3RKZ A;  3EHJ A;  5D6P A;  4MP2 A;  4EGI A;  2Q8I A;  4DZY A;  1YS3 A;  4QPJ A;  2JKI A;  5F5R A;  2FTK A;  4EGH A;  2YKB A;  3C0E A;  3GIF A;  2BSM A;  2YI7 A;  4O0B A;  3OW6 A;  5BOD A;  3EHG A;  4YKY A;  4KFG A;  4AWO A;  3R4O A;  2YKI A;  1JM6 A;  3TZ5 A;  3R91 A;  4DUH A;  4KQV A;  4AS9 A;  1AJ6 A;  1YES A;  2XJG A;  2YI5 A;  4ZVI A;  5D7R A;  2XHT A;  5CTU A;  2VWC A;  1S16 A;  4I5S A;  4E00 A;  4HZ0 A;  2YKE A;  2K5B A;  4JAU A;  1QY8 A;  3U67 A;  1Y8O A;  4L90 A;  3RLR A;  3K99 A;  2PNR A;  2YE7 A;  3G7E A;  3R4N A;  2VW5 A;  3CGZ A;  2IOR A;  4HY6 A;  3LMM A;  5L3J A;  2Q8F A;  1TID A;  5FND A;  3K60 A;  4H85 A;  4P8O A;  3O0I A;  2HHI A;  4ASB A;  2YKC A;  2YEG A;  1U2O A;  4HXZ A;  4CWS A;  2ESA A;  2XHR A;  3QDD A;  1B63 A;  4FCR A;  4FCQ A;  1NHI A;  1H7S A;  2BU7 A;  4U7N A;  3HZ1 A;  4FMT A;  3D36 A;  3OWB A;  1UYH A;  2YK9 A;  2XK2 A;  4ASF A;  2H8M A;  1AM1 A;  1MX0 A;  4QPK A;  4XKO A;  4O04 A;  2XDX A;  3U2D A;  3HHU A;  1UYD A;  2Q2E B;  1I5D A;  2FYP A;  5J6A A;  3T0Z A;  2YGA A;  1YT1 A;  2VCI A;  4KP4 A;  1AH6 A;  1BKN A;  4YKX A;  4CWQ A;  3H4L A;  4L91 A;  4CE1 A;  2YEF A;  1PVG A;  5IDJ A;  5CTW A;  1UYF A;  5M4E A;  1UYE A;  1I5C A;  2HG1 A;  2IWX A;  4GCZ A;  3K97 A;  4PU9 A;  2H55 A;  3HYZ A;  3Q5K A;  3A0X A;  2XDU A;  4LPB A;  1F51 A;  3B27 A;  1EA6 A;  2BU2 A;  5M4M A;  2ZKJ A;  4BQG A;  1B62 A;  2QG2 A;  2BRC A;  2YE9 A;  1YT0 A;  4GGL A;  4U93 A;  3VHA A;  1Y4S A;  4CWN A;  1TIL A;  3EHH A;  2GQP A;  3PEH A;  1AMW A;  4FCP A;  2XHX A;  2WEQ A;  2YE3 A;  1Z5B A;  4KTN A;  2C1I A;  2XDL A;  4XIP A;  3ZXO A;  1UYC A;  4XD8 A;  2YE6 A;  5JEN A;  1TH8 A;  4WUC A;  2BYI A;  5FNC A;  5D7C A;  2YEA A;  1A4H A;  3VHD A;  3OMU A;  2YEE A;  4XCL A;  1GKZ A;  1NHJ A;  3HZ5 A;  4ZKI A;  3K98 A;  4MPN A;  4CWR A;  5CTY A;  5CTX A;  1B3Q A;  3D2R A;  2YEC A;  2YKJ A;  1UY9 A;  4XKA A;  4FPP A;  3IED A;  4KSH A;  4LWH A;  1I59 A;  4L94 A;  4LWG A;  1ZXM A;  1H7U A;  4URN A;  2WI2 A;  4LWE A;  1Z5A A;  5M4P A;  3CWV A;  2XAB A;  3H80 A;  4HZ5 A;  2XJX A;  4BIU A;  1GKX A;  3FT5 A;  3ZM7 A;  2BYH A;  3A0T A;  1TC6 A;  4CWP A;  3CRK A;  3G7B A;  4R3A A;  3DGE A;  5GGZ A;  4H7Q A;  3ZKD A;  2FWY A;  4O09 A;  2IWS A;  2CCT A;  2EXL A;  4MP7 A;  5C93 A;  4ASA A;  2XX2 A;  2YEH A;  2GFD A;  2YE5 A;  4MPE A;  3R4M A;  4E72 A;  3T2S A;  4E01 A;  4URL A;  3OWD A;  4CWF A;  2BT0 A;  4YKZ A;  5CPH A;  3CRL A;  4W7T A;  2HKJ A;  2IOQ A;  4WUB A;  1OSF A;  2Q8H A;  4YKT A;  1I5A A;  1US7 A;  2QFO A;  1UYK A;  4X9L A;  2FXS A;  2WEP A;  4GEE A;  3B25 A;  4MOT A;  2ZDY A;  2YEJ A;  1U0Z A;  5CF0 A;  2XX4 A;  4JAV A;  2WI4 A;  2AKP A;  4PL9 A;  2QG0 A;  2ZBK B;  1R62 A;  1ZXN A;  2CG9 A;  4CWT A;  2WI5 A;  4P7A A;  1YSZ A;  1Y8P A;  1BXD A;  4LWI A;  3FV5 A;  2O1U A;  3PEJ A;  2XD6 A;  4XC0 A;  4O05 A;  2C1G A;  3EKO A;  4WUD A;  2BU6 A;  4URO A;  2C2A A;  2CH4 A;  4XE2 A;  3HYY A;  2HCH A;  3QTF A;  2O1V A;  4K4O A;  2YE2 A;  4O07 A;  1TBW A;  5IN9 A;  3SL2 A;  4MB9 A;  1QYE A;  2IWU A;  4HYP A;  4V26 A;  1UYI A;  3HEK A;  5FNF A;  3G75 A;  3T1K A;  2XDK A;  3A0R A;  4LWF A;  1THN A;  3RLQ A;  3C11 A;  4PRX A;  3MNR P;  4V25 A;  4MPC A;  4MBC A;  4GT8 A;  4XKK A;  1Z59 A;  2IOP A;  1YET A;  4PRV A;  2WI3 A;  3BMY A;  2QF6 A;  2BRE A;  2CCS A;  1UYL A;  3GIG A;  3KE6 A;  2YE8 A;  4R3M A;  4JQL A;  3B24 A;  4NH7 A;  4URM A;  3LNU A;  3EHF A;  4AWQ A;  4HXW A;  4EFU A;  3U2K A;  2WI1 A;  1S14 A;  3A0W A;  1KIJ A;  1L0O A;  4EEH A;  4YKW A;  3A0Y A;  3R4P A;  4BAE A;  3VAD A;  4BQJ A;  4H81 A;  4XIR A;  4NH9 A;  4HY1 A;  1QZR A; 
#chains in the Genus database with same CATH homology
 5FWK A;  1Z5C A;  2Q8G A;  3JZ3 A;  3WQ9 A;  2YED A;  2O1W A;  4KSG A;  4XIQ A;  1YER A;  4B6C A;  2YE4 A;  4YKR A;  3D0B A;  3INW A;  4Q20 A;  1YC1 A;  1I5B A;  1UYG A;  2UWD A;  1KZN A;  2YI0 A;  3INX A;  1YT2 A;  2ZDX A;  3OPD A;  4XDM A;  2VCJ A;  2XDS A;  4AWP A;  4GQT A;  4ASG A;  3A0Z A;  3WHA A;  2XX5 A;  1ZWH A;  2FWZ A;  3LPS A;  4YKQ A;  5M4H A;  3ZXQ A;  5J71 A;  3TZ2 A;  4BIZ A;  2XJJ A;  2YI6 A;  1YSR A;  3CGY A;  2YJW A;  3NMQ A;  4NH8 A;  3GIG B;  1Y4U A;  2WI6 A;  3Q5J A;  5D7D A;  4LP0 A;  1NHH A;  3T0H A;  4U7O A;  4XTJ A;  2WI7 A;  1UY8 A;  3R92 A;  4B7P A;  1MU5 A;  2YK2 A;  3TUH A;  3TZ0 A;  4CE2 A;  2XCM A;  4XIT A;  4I3H A;  3O6O A;  4CE3 A;  1ID0 A;  3RLP A;  1ZW9 A;  3BM9 A;  3TTZ A;  2YGF A;  3B28 A;  1AH8 A;  1UY6 A;  1GJV A;  3EKR A;  4XCJ A;  3TZ4 A;  2CGF A;  2YGE A;  3FT8 A;  4EGK A;  4R1F A;  2YJX A;  5M4N A;  5M4K A;  3B26 A;  2E0A A;  4YKU A;  1YC4 A;  2YEB A;  1I58 A;  2CCU A;  4L93 A;  2BU5 A;  1YC3 A;  3T10 A;  3Q5L A;  1BGQ A;  2BTZ A;  5D6Q A;  2BZ5 A;  1EI1 A;  4EFT A;  4BXI A;  5F3K A;  4HYM A;  3VHC A;  2BU8 A;  4L8Z A;  4EM7 A;  3ZKB A;  4CWO A;  3GIE A;  4GFN A;  1Y8N A;  4E02 A;  5IDM A;  5BOC A;  1UY7 A;  1TC0 A;  4EMV A;  2YEI A;  1BYQ A;  1UYM A;  3O2F A;  2JJC A;  4JAS A;  2WER A;  3RKZ A;  3EHJ A;  5D6P A;  4MP2 A;  4EGI A;  2Q8I A;  4DZY A;  1YS3 A;  4QPJ A;  2JKI A;  5F5R A;  4EGH A;  2YKB A;  3C0E A;  3GIF A;  2BSM A;  2YI7 A;  4O0B A;  3OW6 A;  5BOD A;  3EHG A;  4YKY A;  4KFG A;  4AWO A;  3R4O A;  2YKI A;  1JM6 A;  3TZ5 A;  3R91 A;  4DUH A;  4KQV A;  4AS9 A;  1AJ6 A;  1YES A;  2XJG A;  2YI5 A;  4ZVI A;  5D7R A;  2XHT A;  5CTU A;  2VWC A;  1S16 A;  4I5S A;  4E00 A;  4HZ0 A;  2YKE A;  2K5B A;  4JAU A;  1QY8 A;  3U67 A;  1Y8O A;  4L90 A;  3RLR A;  3K99 A;  2PNR A;  2YE7 A;  3G7E A;  3R4N A;  2VW5 A;  3CGZ A;  2IOR A;  4HY6 A;  5L3J A;  2Q8F A;  1TID A;  5FND A;  3K60 A;  4H85 A;  4P8O A;  3O0I A;  4ASB A;  2YKC A;  2YEG A;  1U2O A;  4HXZ A;  4CWS A;  2ESA A;  2XHR A;  3QDD A;  1B63 A;  4FCR A;  4FCQ A;  1NHI A;  1H7S A;  2BU7 A;  4U7N A;  3HZ1 A;  4FMT A;  3D36 A;  3OWB A;  1UYH A;  2YK9 A;  2XK2 A;  4ASF A;  2H8M A;  1AM1 A;  1MX0 A;  4QPK A;  4XKO A;  4O04 A;  2XDX A;  3U2D A;  3HHU A;  1UYD A;  2Q2E B;  1I5D A;  2FYP A;  5J6A A;  3T0Z A;  2YGA A;  1YT1 A;  2VCI A;  4KP4 A;  1AH6 A;  1BKN A;  4YKX A;  4CWQ A;  3H4L A;  4L91 A;  4CE1 A;  2YEF A;  1PVG A;  5IDJ A;  5CTW A;  1UYF A;  5M4E A;  1UYE A;  1I5C A;  2HG1 A;  2IWX A;  4GCZ A;  3K97 A;  4PU9 A;  2H55 A;  3HYZ A;  3Q5K A;  3A0X A;  2XDU A;  4LPB A;  3B27 A;  1EA6 A;  2BU2 A;  5M4M A;  2ZKJ A;  4BQG A;  1B62 A;  2QG2 A;  2BRC A;  2YE9 A;  1YT0 A;  4GGL A;  4U93 A;  3VHA A;  1Y4S A;  4CWN A;  1TIL A;  3EHH A;  2GQP A;  3PEH A;  1AMW A;  4FCP A;  2XHX A;  2WEQ A;  2YE3 A;  1Z5B A;  4KTN A;  2XDL A;  4XIP A;  3ZXO A;  1UYC A;  4XD8 A;  2YE6 A;  1TH8 A;  4WUC A;  2BYI A;  5FNC A;  5D7C A;  2YEA A;  1A4H A;  3VHD A;  3OMU A;  2YEE A;  4XCL A;  1GKZ A;  1NHJ A;  3HZ5 A;  4ZKI A;  3K98 A;  4MPN A;  4CWR A;  5CTY A;  5CTX A;  1B3Q A;  3D2R A;  2YEC A;  2YKJ A;  1UY9 A;  4XKA A;  4FPP A;  3IED A;  4KSH A;  4LWH A;  1I59 A;  4L94 A;  4LWG A;  1ZXM A;  1H7U A;  4URN A;  2WI2 A;  4LWE A;  1Z5A A;  5M4P A;  3CWV A;  2XAB A;  3H80 A;  4HZ5 A;  2XJX A;  4BIU A;  1GKX A;  3FT5 A;  3ZM7 A;  2BYH A;  3A0T A;  1TC6 A;  4CWP A;  3CRK A;  3G7B A;  4R3A A;  3DGE A;  5GGZ A;  4H7Q A;  3ZKD A;  2FWY A;  4O09 A;  2IWS A;  2CCT A;  2EXL A;  4MP7 A;  5C93 A;  4ASA A;  2XX2 A;  2YEH A;  2GFD A;  2YE5 A;  4MPE A;  3R4M A;  3T2S A;  4E01 A;  4URL A;  3OWD A;  4CWF A;  2BT0 A;  4YKZ A;  5CPH A;  3CRL A;  4W7T A;  2HKJ A;  2IOQ A;  4WUB A;  1OSF A;  2Q8H A;  4YKT A;  1I5A A;  1US7 A;  2QFO A;  1UYK A;  4X9L A;  2FXS A;  2WEP A;  4GEE A;  3B25 A;  4MOT A;  2ZDY A;  2YEJ A;  1U0Z A;  5CF0 A;  2XX4 A;  4JAV A;  2WI4 A;  2AKP A;  4PL9 A;  2QG0 A;  2ZBK B;  1R62 A;  1ZXN A;  2CG9 A;  4CWT A;  2WI5 A;  4P7A A;  1YSZ A;  1Y8P A;  1BXD A;  4LWI A;  3FV5 A;  2O1U A;  3PEJ A;  2XD6 A;  4XC0 A;  4O05 A;  3EKO A;  4WUD A;  2BU6 A;  4URO A;  2C2A A;  2CH4 A;  4XE2 A;  3HYY A;  2HCH A;  3QTF A;  2O1V A;  4K4O A;  2YE2 A;  4O07 A;  1TBW A;  5IN9 A;  3SL2 A;  4MB9 A;  1QYE A;  2IWU A;  4HYP A;  4V26 A;  1UYI A;  3HEK A;  5FNF A;  3G75 A;  3T1K A;  2XDK A;  3A0R A;  4LWF A;  1THN A;  3RLQ A;  3C11 A;  4PRX A;  3MNR P;  4V25 A;  4MPC A;  4MBC A;  4GT8 A;  4XKK A;  1Z59 A;  2IOP A;  1YET A;  4PRV A;  2WI3 A;  3BMY A;  2QF6 A;  2BRE A;  2CCS A;  1UYL A;  3GIG A;  3KE6 A;  2YE8 A;  4R3M A;  4JQL A;  3B24 A;  4NH7 A;  4URM A;  3LNU A;  3EHF A;  4AWQ A;  4HXW A;  4EFU A;  3U2K A;  2WI1 A;  1S14 A;  3A0W A;  1KIJ A;  1L0O A;  4EEH A;  4YKW A;  3A0Y A;  3R4P A;  4BAE A;  3VAD A;  4BQJ A;  4H81 A;  4XIR A;  4NH9 A;  4HY1 A;  1QZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...