3U2DA

S. aureus gyrb atpase domain in complex with small molecule inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolamide DNA gyrase inhibitors: fragment-based nuclear magnetic resonance screening to identify antibacterial agents.
pubmed doi rcsb
molecule keywords DNA gyrase subunit B
molecule tags Isomerase/isomerase inhibitor
source organism Staphylococcus aureus
total genus 63
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3u2dA00
1AJ6A 2YKIA 4WUBA 2PNRA 4AWQA 1I58A 4XIPA 3B28A 2Q2EB 2YJWA 1NHJA 5M4KA 4KFGA 3A0WA 1AH8A 2WI1A 2ZKJA 4XIQA 4BQJA 1I5BA 2YEGA 3RLPA 4FCQA 4YKYA 4YKRA 4O09A 1ZWHA 2CG9A 4AWPA 2CCSA 3WHAA 2BYHA 5FNFA 5CTUA 4BIZA 5FNDA 2YKJA 4NH7A 3HHUA 2YEEA 1UYLA 3CWVA 2YEBA 4KSGA 1I5CA 2IWSA 1ZXMA 3MNRP 2QG2A 4FMTA 1PVGA 1TC0A 3T0ZA 4MPNA 1UYMA 2XD6A 3D0BA 4U7OA 2ZDYA 2XDLA 4I5SA 1ID0A 3D2RA 4FPPA 5CTYA 4PL9A 3VHCA 4LWEA 4U7NA 3HYZA 4MP2A 4Q20A 3FV5A 4LWHA 5CTXA 5IDJA 4GQTA 1B63A 4CWRA 4L93A 3D36A 4R1FA 1U2OA 2H8MA 1YSRA 2YE4A 3INWA 1UYIA 4AWOA 4XITA 1YT0A 2ESAA 2YKBA 2VCJA 3GIFA 4X9LA 4JASA 4L91A 5D7RA 2JJCA 3OW6A 2YE9A 1Y8OA 4I3HA 3LNUA 3NMQA 4LWGA 4KQVA 5CF0A 5GGZA 4E01A 4EFTA 2YK9A 4HYPA 1QZRA 5J71A 2WI5A 4MPEA 1I5AA 4BIUA 4EM7A 4E00A 5D6QA 4O07A 1UY8A 2GQPA 4BQGA 1B3QA 2H55A 4FCRA 2YI5A 4LP0A 2YJXA 1TILA 4U93A 4XCJA 3VADA 3SL2A 4GEEA 4HY6A 4O04A 3TZ4A 4FCPA 1B62A 2XDKA 4KP4A 5M4PA 4WUDA 3TUHA 1US7A 2XDUA 4CWSA 4CE2A 2YECA 4EGKA 3DGEA 1I5DA 2BSMA 2CCTA 4EMVA 3TZ5A 1YC3A 3RLRA 4AS9A 1KIJA 2WI4A 4YKQA 4ASAA 2JKIA 2FWZA 3C0EA 4XKAA 4YKZA 3K98A 3A0TA 2XJJA 4XD8A 3B27A 2YE3A 2BT0A 3TZ0A 4URLA 4LWFA 4ZKIA 1YERA 4HZ0A 4PRXA 4YKTA 3QTFA 5IDMA 3Q5LA 3ZKBA 2XJXA 2YE8A 3CGZA 1BGQA 4H7QA 1Z5AA 3VHAA 1S14A 2IWUA 4GCZA 4HXWA 3RKZA 4PRVA 3HYYA 2HCHA 2O1UA 1UY9A 3PEJA 5FNCA 4CWTA 4NH8A 2IOPA 3A0ZA 4DZYA 3IEDA 2QF6A 1UYKA 2E0AA 2QG0A 2YEIA 4HZ5A 2XX2A 2Q8HA 1OSFA 3CRKA 5L3JA 1UYFA 2Q8IA 3GIGA 2YKEA 1GKZA 1YC4A 2VWCA 5D7CA 1UYHA 4YKWA 4JAUA 2K5BA 3PEHA 4EFUA 2YEFA 4XIRA 2YGFA 1NHHA 4MBCA 4K4OA 4GFNA 4CWNA 4EEHA 2O1VA 2YE7A 3RLQA 3H80A 2EXLA 1Y8NA 4XE2A 4XC0A 1UYDA 3EHHA 1EI1A 3U2DA 4H81A 1Y8PA 2IWXA 2YEAA 3EHGA 5D6PA 3A0XA 1S16A 1UY6A 2XX4A 2GFDA 4DUHA 4HXZA 3GIGB 2IORA 1GKXA 1KZNA 3FT5A 1AMWA 4KTNA 1TH8A 1L0OA 2XHRA 4XKKA 2HKJA 3R4PA 3O6OA 2YEJA 1EA6A 2WERA 1BYQA 2WEQA 2YI0A 3BM9A 1THNA 3KE6A 4XTJA 5F5RA 4ASGA 2BU2A 5M4HA 4CE3A 1TIDA 1UYEA 4HYMA 1BKNA 3R92A 3OWDA 3O0IA 2FYPA 4V25A 2WI6A 3EKOA 2YGAA 4CE1A 1UY7A 1ZXNA 4L94A 3K99A 2FWYA 2BYIA 3R4NA 3K97A 1TC6A 2AKPA 3B25A 4P7AA 3HEKA 2YKCA 3Q5JA 4EGHA 3R4MA 3HZ5A 4BAEA 1GJVA 2HG1A 1BXDA 3JZ3A 4HY1A 1YC1A 1UYGA 4MB9A 3U67A 1Y4SA 1H7UA 2BU6A 3TZ2A 4QPKA 3ZKDA 5IN9A 3GIEA 4URMA 5D7DA 3ZXOA 3G7EA 5BODA 2ZDXA 4ASBA 4CWPA 4LWIA 5M4MA 2XDXA 4MPCA 2XJGA 3G75A 2XCMA 4L8ZA 1TBWA 3A0YA 4GGLA 3B24A 4CWOA 3QDDA 1YS3A 3G7BA 2YI6A 3T0HA 2O1WA 4MP7A 4L90A 1NHIA 3B26A 3OWBA 2XX5A 3ZM7A 3EHJA 1A4HA 2ZBKB 5BOCA 4URNA 4EGIA 3INXA 4P8OA 2BU5A 1Z5CA 1YT1A 4V26A 2YEDA 2BTZA 2YE5A 4R3MA 5M4NA 3C11A 4CWFA 1AM1A 3CRLA 3R91A 2BU7A 2CH4A 2VW5A 3R4OA 2BRCA 1Z59A 4XDMA 4W7TA 4PU9A 1YT2A 4UROA 4O0BA 1U0ZA 2YK2A 3ZXQA 5C93A 3BMYA 4MOTA 4QPJA 1YSZA 3U2KA 2WI7A 3EHFA 2WI3A 2WI2A 4WUCA 3HZ1A 2YE2A 4LPBA 4H85A 1I59A 1ZW9A 2YEHA 4E02A 4YKUA 5J6AA 4XCLA 2BU8A 3WQ9A 2XHXA 3OMUA 2WEPA 2XDSA 3A0RA 2Q8FA 4B7PA 1MU5A 2IOQA 4CWQA 3FT8A 4ZVIA 4KSHA 5CPHA 2CGFA 1YETA 3VHDA 3H4LA 1R62A 2QFOA 2Q8GA 1JM6A 4JAVA 2CCUA 4B6CA 3EKRA 4O05A 4ASFA 4YKXA 3CGYA 5CTWA 1QY8A 4JQLA 2YGEA 2BREA 1Y4UA 2FXSA 3T1KA 3K60A 3O2FA 1YESA 4GT8A 3T10A 4BXIA 2XABA 1Z5BA 2UWDA 2VCIA 3T2SA 3Q5KA 5M4EA 5F3KA 2C2AA 3LPSA 1MX0A 1QYEA 3TTZA 1H7SA 2XHTA 4NH9A 4R3AA 5FWKA 1UYCA 2YE6A 1AH6A 4XKOA 2BZ5A 2YI7A 3OPDA 2XK2A
chains in the Genus database with same CATH superfamily
1AJ6A 2YKIA 4WUBA 2PNRA 4AWQA 1I58A 4XIPA 3B28A 2Q2EB 2YJWA 1NHJA 5M4KA 4KFGA 3A0WA 1AH8A 2WI1A 2ZKJA 4XIQA 4BQJA 1I5BA 2YEGA 3RLPA 4FCQA 4YKYA 4YKRA 4O09A 1ZWHA 2CG9A 4AWPA 2CCSA 3WHAA 2BYHA 5FNFA 5CTUA 4BIZA 5FNDA 2YKJA 4NH7A 3HHUA 2YEEA 1UYLA 3CWVA 2YEBA 4KSGA 1I5CA 2IWSA 1ZXMA 3MNRP 2QG2A 4FMTA 1PVGA 1TC0A 3T0ZA 4MPNA 1UYMA 2XD6A 3D0BA 4U7OA 2ZDYA 2XDLA 4I5SA 1ID0A 3D2RA 4FPPA 5CTYA 4PL9A 3VHCA 4LWEA 4U7NA 3HYZA 4MP2A 4Q20A 3FV5A 4LWHA 5CTXA 5IDJA 4GQTA 1B63A 4CWRA 4L93A 3D36A 4R1FA 1U2OA 2H8MA 1YSRA 2YE4A 3INWA 1UYIA 4AWOA 4XITA 1YT0A 2ESAA 2YKBA 2VCJA 3GIFA 4X9LA 4JASA 4L91A 5D7RA 2JJCA 3OW6A 2YE9A 1Y8OA 4I3HA 3LNUA 3NMQA 4LWGA 4KQVA 5CF0A 5GGZA 4E01A 4EFTA 2YK9A 4HYPA 1QZRA 5J71A 2WI5A 1IXMA 4MPEA 1I5AA 4BIUA 4EM7A 4E00A 5D6QA 4O07A 1UY8A 2GQPA 4BQGA 1B3QA 2H55A 4FCRA 2YI5A 4LP0A 2YJXA 1TILA 4U93A 4XCJA 3VADA 3SL2A 4GEEA 4HY6A 4O04A 3TZ4A 4FCPA 1B62A 2XDKA 4KP4A 5M4PA 4WUDA 3TUHA 1US7A 2XDUA 4CWSA 4CE2A 2YECA 4EGKA 3DGEA 1I5DA 2BSMA 2CCTA 4EMVA 3TZ5A 1YC3A 3LMMA 3RLRA 1KIJA 4AS9A 2WI4A 4YKQA 4ASAA 2JKIA 2FWZA 3C0EA 4XKAA 4YKZA 3K98A 3A0TA 2XJJA 4XD8A 3B27A 2YE3A 2BT0A 3TZ0A 4URLA 4LWFA 4ZKIA 1YERA 4HZ0A 4PRXA 4YKTA 3QTFA 5IDMA 3Q5LA 3ZKBA 2XJXA 2YE8A 3CGZA 1BGQA 1F51A 1Z5AA 4H7QA 3VHAA 1S14A 2IWUA 4GCZA 4HXWA 3RKZA 4PRVA 3HYYA 2HCHA 2O1UA 1UY9A 3PEJA 5FNCA 4CWTA 4NH8A 2IOPA 3A0ZA 4DZYA 3IEDA 2QF6A 1UYKA 2E0AA 2QG0A 2HHIA 2YEIA 4HZ5A 2XX2A 2Q8HA 1OSFA 3CRKA 5L3JA 1UYFA 2Q8IA 3GIGA 2YKEA 1GKZA 1YC4A 2VWCA 5D7CA 1UYHA 4YKWA 4JAUA 2K5BA 3PEHA 2C1GA 4EFUA 2YEFA 4XIRA 2YGFA 1NHHA 4MBCA 4K4OA 3S5TA 4GFNA 4CWNA 4EEHA 2O1VA 2YE7A 3RLQA 3H80A 2EXLA 1Y8NA 4XE2A 4XC0A 1UYDA 3EHHA 1EI1A 3U2DA 4H81A 1Y8PA 2IWXA 2YEAA 3EHGA 5D6PA 3A0XA 1S16A 1UY6A 2XX4A 2GFDA 4DUHA 4HXZA 3GIGB 2IORA 1GKXA 1KZNA 3FT5A 1AMWA 4KTNA 1TH8A 1L0OA 2XHRA 4XKKA 2HKJA 3R4PA 3O6OA 2YEJA 1EA6A 2WERA 1BYQA 2WEQA 2YI0A 3BM9A 1THNA 3KE6A 4XTJA 5F5RA 4ASGA 2BU2A 5M4HA 4CE3A 1TIDA 1UYEA 4HYMA 1BKNA 3R92A 3OWDA 3O0IA 2FYPA 4V25A 2WI6A 3EKOA 2YGAA 4CE1A 1UY7A 1ZXNA 4L94A 3K99A 2FWYA 2BYIA 3R4NA 3K97A 1TC6A 2AKPA 3B25A 4P7AA 3HEKA 2YKCA 3Q5JA 4EGHA 3R4MA 3HZ5A 4BAEA 1GJVA 2HG1A 1BXDA 3JZ3A 4HY1A 1YC1A 4E72A 1UYGA 4MB9A 3U67A 1Y4SA 1H7UA 2FTKA 2BU6A 3TZ2A 4QPKA 3ZKDA 5IN9A 3GIEA 4URMA 5D7DA 3ZXOA 3G7EA 5BODA 2ZDXA 4ASBA 4CWPA 4LWIA 5M4MA 2XDXA 4MPCA 2XJGA 3G75A 2XCMA 4L8ZA 1TBWA 3A0YA 4GGLA 3B24A 4CWOA 3QDDA 1YS3A 3G7BA 2YI6A 3T0HA 2O1WA 4MP7A 4L90A 1NHIA 3B26A 3OWBA 2XX5A 3ZM7A 3EHJA 1A4HA 2ZBKB 5BOCA 4URNA 4EGIA 3INXA 4P8OA 2BU5A 1Z5CA 1YT1A 4V26A 2YEDA 2BTZA 2YE5A 4R3MA 5M4NA 3C11A 4CWFA 1AM1A 3CRLA 3R91A 2BU7A 2CH4A 2VW5A 3R4OA 2BRCA 3CYGA 1Z59A 4XDMA 4W7TA 4PU9A 1YT2A 4UROA 4O0BA 1U0ZA 2YK2A 3ZXQA 5C93A 3BMYA 4MOTA 4QPJA 1YSZA 3U2KA 2WI7A 3EHFA 2WI3A 2WI2A 4WUCA 3HZ1A 2YE2A 4LPBA 4H85A 1I59A 2C1IA 1ZW9A 2YEHA 4E02A 4YKUA 5J6AA 4XCLA 2BU8A 3WQ9A 2XHXA 3OMUA 2WEPA 2XDSA 3A0RA 2Q8FA 4B7PA 1MU5A 2IOQA 4CWQA 3FT8A 4ZVIA 4KSHA 5CPHA 2CGFA 1YETA 3VHDA 3H4LA 1R62A 2QFOA 2Q8GA 5JENA 1JM6A 4JAVA 2CCUA 4B6CA 3EKRA 4O05A 4ASFA 4YKXA 3CGYA 5CTWA 1QY8A 4JQLA 2YGEA 2BREA 1Y4UA 2FXSA 3T1KA 3K60A 3O2FA 1YESA 4GT8A 3T10A 4BXIA 2XABA 1Z5BA 2UWDA 2VCIA 3T2SA 3Q5KA 5M4EA 5F3KA 2C2AA 3LPSA 1MX0A 1QYEA 3TTZA 1H7SA 2XHTA 4NH9A 4R3AA 5FWKA 1UYCA 2YE6A 1AH6A 4XKOA 2BZ5A 2YI7A 3OPDA 2XK2A
chains in the Genus database with same CATH topology
1AJ6A 2YKIA 4WUBA 2PNRA 4AWQA 1I58A 4XIPA 3B28A 2Q2EB 2YJWA 1NHJA 5M4KA 4KFGA 3A0WA 1AH8A 2WI1A 2ZKJA 4XIQA 4BQJA 1I5BA 2YEGA 3RLPA 4FCQA 4YKYA 4YKRA 4O09A 1ZWHA 2CG9A 4AWPA 2CCSA 3WHAA 2BYHA 5FNFA 5CTUA 4BIZA 5FNDA 2YKJA 4NH7A 3HHUA 2YEEA 1UYLA 3CWVA 2YEBA 4KSGA 1I5CA 2IWSA 1ZXMA 3MNRP 2QG2A 4FMTA 1PVGA 1TC0A 3T0ZA 4MPNA 1UYMA 2XD6A 3D0BA 4U7OA 2ZDYA 2XDLA 4I5SA 1ID0A 3D2RA 4FPPA 5CTYA 4PL9A 3VHCA 4LWEA 4U7NA 3HYZA 4MP2A 4Q20A 3FV5A 4LWHA 5CTXA 5IDJA 4GQTA 1B63A 4CWRA 4L93A 3D36A 4R1FA 1U2OA 2H8MA 1YSRA 2YE4A 3INWA 1UYIA 4AWOA 4XITA 1YT0A 2ESAA 2YKBA 2VCJA 3GIFA 4X9LA 4JASA 4L91A 5D7RA 2JJCA 3OW6A 2YE9A 1Y8OA 4I3HA 3LNUA 3NMQA 4LWGA 4KQVA 5CF0A 5GGZA 4E01A 4EFTA 2YK9A 4HYPA 1QZRA 5J71A 2WI5A 4MPEA 1I5AA 4BIUA 4EM7A 4E00A 5D6QA 4O07A 1UY8A 2GQPA 4BQGA 1B3QA 2H55A 4FCRA 2YI5A 4LP0A 2YJXA 1TILA 4U93A 4XCJA 3VADA 3SL2A 4GEEA 4HY6A 4O04A 3TZ4A 4FCPA 1B62A 2XDKA 4KP4A 5M4PA 4WUDA 3TUHA 1US7A 2XDUA 4CWSA 4CE2A 2YECA 4EGKA 3DGEA 1I5DA 2BSMA 2CCTA 4EMVA 3TZ5A 1YC3A 3RLRA 4AS9A 1KIJA 2WI4A 4YKQA 4ASAA 2JKIA 2FWZA 3C0EA 4XKAA 4YKZA 3K98A 3A0TA 2XJJA 4XD8A 3B27A 2YE3A 2BT0A 3TZ0A 4URLA 4LWFA 4ZKIA 1YERA 4HZ0A 4PRXA 4YKTA 3QTFA 5IDMA 3Q5LA 3ZKBA 2XJXA 2YE8A 3CGZA 1BGQA 4H7QA 1Z5AA 3VHAA 1S14A 2IWUA 4GCZA 4HXWA 3RKZA 4PRVA 3HYYA 2HCHA 2O1UA 1UY9A 3PEJA 5FNCA 4CWTA 4NH8A 2IOPA 3A0ZA 4DZYA 3IEDA 2QF6A 1UYKA 2E0AA 2QG0A 2YEIA 4HZ5A 2XX2A 2Q8HA 1OSFA 3CRKA 5L3JA 1UYFA 2Q8IA 3GIGA 2YKEA 1GKZA 1YC4A 2VWCA 5D7CA 1UYHA 4YKWA 4JAUA 2K5BA 3PEHA 4EFUA 2YEFA 4XIRA 2YGFA 1NHHA 4MBCA 4K4OA 4GFNA 4CWNA 4EEHA 2O1VA 2YE7A 3RLQA 3H80A 2EXLA 1Y8NA 4XE2A 4XC0A 1UYDA 3EHHA 1EI1A 3U2DA 4H81A 1Y8PA 2IWXA 2YEAA 3EHGA 5D6PA 3A0XA 1S16A 1UY6A 2XX4A 2GFDA 4DUHA 4HXZA 3GIGB 2IORA 1GKXA 1KZNA 3FT5A 1AMWA 4KTNA 1TH8A 1L0OA 2XHRA 4XKKA 2HKJA 3R4PA 3O6OA 2YEJA 1EA6A 2WERA 1BYQA 2WEQA 2YI0A 3BM9A 1THNA 3KE6A 4XTJA 5F5RA 4ASGA 2BU2A 5M4HA 4CE3A 1TIDA 1UYEA 4HYMA 1BKNA 3R92A 3OWDA 3O0IA 2FYPA 4V25A 2WI6A 3EKOA 2YGAA 4CE1A 1UY7A 1ZXNA 4L94A 3K99A 2FWYA 2BYIA 3R4NA 3K97A 1TC6A 2AKPA 3B25A 4P7AA 3HEKA 2YKCA 3Q5JA 4EGHA 3R4MA 3HZ5A 4BAEA 1GJVA 2HG1A 1BXDA 3JZ3A 4HY1A 1YC1A 1UYGA 4MB9A 3U67A 1Y4SA 1H7UA 2BU6A 3TZ2A 4QPKA 3ZKDA 5IN9A 3GIEA 4URMA 5D7DA 3ZXOA 3G7EA 5BODA 2ZDXA 4ASBA 4CWPA 4LWIA 5M4MA 2XDXA 4MPCA 2XJGA 3G75A 2XCMA 4L8ZA 1TBWA 3A0YA 4GGLA 3B24A 4CWOA 3QDDA 1YS3A 3G7BA 2YI6A 3T0HA 2O1WA 4MP7A 4L90A 1NHIA 3B26A 3OWBA 2XX5A 3ZM7A 3EHJA 1A4HA 2ZBKB 5BOCA 4URNA 4EGIA 3INXA 4P8OA 2BU5A 1Z5CA 1YT1A 4V26A 2YEDA 2BTZA 2YE5A 4R3MA 5M4NA 3C11A 4CWFA 1AM1A 3CRLA 3R91A 2BU7A 2CH4A 2VW5A 3R4OA 2BRCA 1Z59A 4XDMA 4W7TA 4PU9A 1YT2A 4UROA 4O0BA 1U0ZA 2YK2A 3ZXQA 5C93A 3BMYA 4MOTA 4QPJA 1YSZA 3U2KA 2WI7A 3EHFA 2WI3A 2WI2A 4WUCA 3HZ1A 2YE2A 4LPBA 4H85A 1I59A 1ZW9A 2YEHA 4E02A 4YKUA 5J6AA 4XCLA 2BU8A 3WQ9A 2XHXA 3OMUA 2WEPA 2XDSA 3A0RA 2Q8FA 4B7PA 1MU5A 2IOQA 4CWQA 3FT8A 4ZVIA 4KSHA 5CPHA 2CGFA 1YETA 3VHDA 3H4LA 1R62A 2QFOA 2Q8GA 1JM6A 4JAVA 2CCUA 4B6CA 3EKRA 4O05A 4ASFA 4YKXA 3CGYA 5CTWA 1QY8A 4JQLA 2YGEA 2BREA 1Y4UA 2FXSA 3T1KA 3K60A 3O2FA 1YESA 4GT8A 3T10A 4BXIA 2XABA 1Z5BA 2UWDA 2VCIA 3T2SA 3Q5KA 5M4EA 5F3KA 2C2AA 3LPSA 1MX0A 1QYEA 3TTZA 1H7SA 2XHTA 4NH9A 4R3AA 5FWKA 1UYCA 2YE6A 1AH6A 4XKOA 2BZ5A 2YI7A 3OPDA 2XK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJ6 A;  2YKI A;  4WUB A;  2PNR A;  4AWQ A;  1I58 A;  4XIP A;  3B28 A;  2Q2E B;  2YJW A;  1NHJ A;  5M4K A;  4KFG A;  3A0W A;  1AH8 A;  2WI1 A;  2ZKJ A;  4XIQ A;  4BQJ A;  1I5B A;  2YEG A;  3RLP A;  4FCQ A;  4YKY A;  4YKR A;  4O09 A;  1ZWH A;  2CG9 A;  4AWP A;  2CCS A;  3WHA A;  2BYH A;  5FNF A;  5CTU A;  4BIZ A;  5FND A;  2YKJ A;  4NH7 A;  3HHU A;  2YEE A;  1UYL A;  3CWV A;  2YEB A;  4KSG A;  1I5C A;  2IWS A;  1ZXM A;  3MNR P;  2QG2 A;  4FMT A;  1PVG A;  1TC0 A;  3T0Z A;  4MPN A;  1UYM A;  2XD6 A;  3D0B A;  4U7O A;  2ZDY A;  2XDL A;  4I5S A;  1ID0 A;  3D2R A;  4FPP A;  5CTY A;  4PL9 A;  3VHC A;  4LWE A;  4U7N A;  3HYZ A;  4MP2 A;  4Q20 A;  3FV5 A;  4LWH A;  5CTX A;  5IDJ A;  4GQT A;  1B63 A;  4CWR A;  4L93 A;  3D36 A;  4R1F A;  1U2O A;  2H8M A;  1YSR A;  2YE4 A;  3INW A;  1UYI A;  4AWO A;  4XIT A;  1YT0 A;  2ESA A;  2YKB A;  2VCJ A;  3GIF A;  4X9L A;  4JAS A;  4L91 A;  5D7R A;  2JJC A;  3OW6 A;  2YE9 A;  1Y8O A;  4I3H A;  3LNU A;  3NMQ A;  4LWG A;  4KQV A;  5CF0 A;  5GGZ A;  4E01 A;  4EFT A;  2YK9 A;  4HYP A;  1QZR A;  5J71 A;  2WI5 A;  4MPE A;  1I5A A;  4BIU A;  4EM7 A;  4E00 A;  5D6Q A;  4O07 A;  1UY8 A;  2GQP A;  4BQG A;  1B3Q A;  2H55 A;  4FCR A;  2YI5 A;  4LP0 A;  2YJX A;  1TIL A;  4U93 A;  4XCJ A;  3VAD A;  3SL2 A;  4GEE A;  4HY6 A;  4O04 A;  3TZ4 A;  4FCP A;  1B62 A;  2XDK A;  4KP4 A;  5M4P A;  4WUD A;  3TUH A;  1US7 A;  2XDU A;  4CWS A;  4CE2 A;  2YEC A;  4EGK A;  3DGE A;  1I5D A;  2BSM A;  2CCT A;  4EMV A;  3TZ5 A;  1YC3 A;  3RLR A;  4AS9 A;  1KIJ A;  2WI4 A;  4YKQ A;  4ASA A;  2JKI A;  2FWZ A;  3C0E A;  4XKA A;  4YKZ A;  3K98 A;  3A0T A;  2XJJ A;  4XD8 A;  3B27 A;  2YE3 A;  2BT0 A;  3TZ0 A;  4URL A;  4LWF A;  4ZKI A;  1YER A;  4HZ0 A;  4PRX A;  4YKT A;  3QTF A;  5IDM A;  3Q5L A;  3ZKB A;  2XJX A;  2YE8 A;  3CGZ A;  1BGQ A;  4H7Q A;  1Z5A A;  3VHA A;  1S14 A;  2IWU A;  4GCZ A;  4HXW A;  3RKZ A;  4PRV A;  3HYY A;  2HCH A;  2O1U A;  1UY9 A;  3PEJ A;  5FNC A;  4CWT A;  4NH8 A;  2IOP A;  3A0Z A;  4DZY A;  3IED A;  2QF6 A;  1UYK A;  2E0A A;  2QG0 A;  2YEI A;  4HZ5 A;  2XX2 A;  2Q8H A;  1OSF A;  3CRK A;  5L3J A;  1UYF A;  2Q8I A;  3GIG A;  2YKE A;  1GKZ A;  1YC4 A;  2VWC A;  5D7C A;  1UYH A;  4YKW A;  4JAU A;  2K5B A;  3PEH A;  4EFU A;  2YEF A;  4XIR A;  2YGF A;  1NHH A;  4MBC A;  4K4O A;  4GFN A;  4CWN A;  4EEH A;  2O1V A;  2YE7 A;  3RLQ A;  3H80 A;  2EXL A;  1Y8N A;  4XE2 A;  4XC0 A;  1UYD A;  3EHH A;  1EI1 A;  3U2D A;  4H81 A;  1Y8P A;  2IWX A;  2YEA A;  3EHG A;  5D6P A;  3A0X A;  1S16 A;  1UY6 A;  2XX4 A;  2GFD A;  4DUH A;  4HXZ A;  3GIG B;  2IOR A;  1GKX A;  1KZN A;  3FT5 A;  1AMW A;  4KTN A;  1TH8 A;  1L0O A;  2XHR A;  4XKK A;  2HKJ A;  3R4P A;  3O6O A;  2YEJ A;  1EA6 A;  2WER A;  1BYQ A;  2WEQ A;  2YI0 A;  3BM9 A;  1THN A;  3KE6 A;  4XTJ A;  5F5R A;  4ASG A;  2BU2 A;  5M4H A;  4CE3 A;  1TID A;  1UYE A;  4HYM A;  1BKN A;  3R92 A;  3OWD A;  3O0I A;  2FYP A;  4V25 A;  2WI6 A;  3EKO A;  2YGA A;  4CE1 A;  1UY7 A;  1ZXN A;  4L94 A;  3K99 A;  2FWY A;  2BYI A;  3R4N A;  3K97 A;  1TC6 A;  2AKP A;  3B25 A;  4P7A A;  3HEK A;  2YKC A;  3Q5J A;  4EGH A;  3R4M A;  3HZ5 A;  4BAE A;  1GJV A;  2HG1 A;  1BXD A;  3JZ3 A;  4HY1 A;  1YC1 A;  1UYG A;  4MB9 A;  3U67 A;  1Y4S A;  1H7U A;  2BU6 A;  3TZ2 A;  4QPK A;  3ZKD A;  5IN9 A;  3GIE A;  4URM A;  5D7D A;  3ZXO A;  3G7E A;  5BOD A;  2ZDX A;  4ASB A;  4CWP A;  4LWI A;  5M4M A;  2XDX A;  4MPC A;  2XJG A;  3G75 A;  2XCM A;  4L8Z A;  1TBW A;  3A0Y A;  4GGL A;  3B24 A;  4CWO A;  3QDD A;  1YS3 A;  3G7B A;  2YI6 A;  3T0H A;  2O1W A;  4MP7 A;  4L90 A;  1NHI A;  3B26 A;  3OWB A;  2XX5 A;  3ZM7 A;  3EHJ A;  1A4H A;  2ZBK B;  5BOC A;  4URN A;  4EGI A;  3INX A;  4P8O A;  2BU5 A;  1Z5C A;  1YT1 A;  4V26 A;  2YED A;  2BTZ A;  2YE5 A;  4R3M A;  5M4N A;  3C11 A;  4CWF A;  1AM1 A;  3CRL A;  3R91 A;  2BU7 A;  2CH4 A;  2VW5 A;  3R4O A;  2BRC A;  1Z59 A;  4XDM A;  4W7T A;  4PU9 A;  1YT2 A;  4URO A;  4O0B A;  1U0Z A;  2YK2 A;  3ZXQ A;  5C93 A;  3BMY A;  4MOT A;  4QPJ A;  1YSZ A;  3U2K A;  2WI7 A;  3EHF A;  2WI3 A;  2WI2 A;  4WUC A;  3HZ1 A;  2YE2 A;  4LPB A;  4H85 A;  1I59 A;  1ZW9 A;  2YEH A;  4E02 A;  4YKU A;  5J6A A;  4XCL A;  2BU8 A;  3WQ9 A;  2XHX A;  3OMU A;  2WEP A;  2XDS A;  3A0R A;  2Q8F A;  4B7P A;  1MU5 A;  2IOQ A;  4CWQ A;  3FT8 A;  4ZVI A;  4KSH A;  5CPH A;  2CGF A;  1YET A;  3VHD A;  3H4L A;  1R62 A;  2QFO A;  2Q8G A;  1JM6 A;  4JAV A;  2CCU A;  4B6C A;  3EKR A;  4O05 A;  4ASF A;  4YKX A;  3CGY A;  5CTW A;  1QY8 A;  4JQL A;  2YGE A;  2BRE A;  1Y4U A;  2FXS A;  3T1K A;  3K60 A;  3O2F A;  1YES A;  4GT8 A;  3T10 A;  4BXI A;  2XAB A;  1Z5B A;  2UWD A;  2VCI A;  3T2S A;  3Q5K A;  5M4E A;  5F3K A;  2C2A A;  3LPS A;  1MX0 A;  1QYE A;  3TTZ A;  1H7S A;  2XHT A;  4NH9 A;  4R3A A;  5FWK A;  1UYC A;  2YE6 A;  1AH6 A;  4XKO A;  2BZ5 A;  2YI7 A;  3OPD A;  2XK2 A; 
#chains in the Genus database with same CATH topology
 1AJ6 A;  2YKI A;  4WUB A;  2PNR A;  4AWQ A;  1I58 A;  4XIP A;  3B28 A;  2Q2E B;  2YJW A;  1NHJ A;  5M4K A;  4KFG A;  3A0W A;  1AH8 A;  2WI1 A;  2ZKJ A;  4XIQ A;  4BQJ A;  1I5B A;  2YEG A;  3RLP A;  4FCQ A;  4YKY A;  4YKR A;  4O09 A;  1ZWH A;  2CG9 A;  4AWP A;  2CCS A;  3WHA A;  2BYH A;  5FNF A;  5CTU A;  4BIZ A;  5FND A;  2YKJ A;  4NH7 A;  3HHU A;  2YEE A;  1UYL A;  3CWV A;  2YEB A;  4KSG A;  1I5C A;  2IWS A;  1ZXM A;  3MNR P;  2QG2 A;  4FMT A;  1PVG A;  1TC0 A;  3T0Z A;  4MPN A;  1UYM A;  2XD6 A;  3D0B A;  4U7O A;  2ZDY A;  2XDL A;  4I5S A;  1ID0 A;  3D2R A;  4FPP A;  5CTY A;  4PL9 A;  3VHC A;  4LWE A;  4U7N A;  3HYZ A;  4MP2 A;  4Q20 A;  3FV5 A;  4LWH A;  5CTX A;  5IDJ A;  4GQT A;  1B63 A;  4CWR A;  4L93 A;  3D36 A;  4R1F A;  1U2O A;  2H8M A;  1YSR A;  2YE4 A;  3INW A;  1UYI A;  4AWO A;  4XIT A;  1YT0 A;  2ESA A;  2YKB A;  2VCJ A;  3GIF A;  4X9L A;  4JAS A;  4L91 A;  5D7R A;  2JJC A;  3OW6 A;  2YE9 A;  1Y8O A;  4I3H A;  3LNU A;  3NMQ A;  4LWG A;  4KQV A;  5CF0 A;  5GGZ A;  4E01 A;  4EFT A;  2YK9 A;  4HYP A;  1QZR A;  5J71 A;  2WI5 A;  1IXM A;  4MPE A;  1I5A A;  4BIU A;  4EM7 A;  4E00 A;  5D6Q A;  4O07 A;  1UY8 A;  2GQP A;  4BQG A;  1B3Q A;  2H55 A;  4FCR A;  2YI5 A;  4LP0 A;  2YJX A;  1TIL A;  4U93 A;  4XCJ A;  3VAD A;  3SL2 A;  4GEE A;  4HY6 A;  4O04 A;  3TZ4 A;  4FCP A;  1B62 A;  2XDK A;  4KP4 A;  5M4P A;  4WUD A;  3TUH A;  1US7 A;  2XDU A;  4CWS A;  4CE2 A;  2YEC A;  4EGK A;  3DGE A;  1I5D A;  2BSM A;  2CCT A;  4EMV A;  3TZ5 A;  1YC3 A;  3LMM A;  3RLR A;  1KIJ A;  4AS9 A;  2WI4 A;  4YKQ A;  4ASA A;  2JKI A;  2FWZ A;  3C0E A;  4XKA A;  4YKZ A;  3K98 A;  3A0T A;  2XJJ A;  4XD8 A;  3B27 A;  2YE3 A;  2BT0 A;  3TZ0 A;  4URL A;  4LWF A;  4ZKI A;  1YER A;  4HZ0 A;  4PRX A;  4YKT A;  3QTF A;  5IDM A;  3Q5L A;  3ZKB A;  2XJX A;  2YE8 A;  3CGZ A;  1BGQ A;  1F51 A;  1Z5A A;  4H7Q A;  3VHA A;  1S14 A;  2IWU A;  4GCZ A;  4HXW A;  3RKZ A;  4PRV A;  3HYY A;  2HCH A;  2O1U A;  1UY9 A;  3PEJ A;  5FNC A;  4CWT A;  4NH8 A;  2IOP A;  3A0Z A;  4DZY A;  3IED A;  2QF6 A;  1UYK A;  2E0A A;  2QG0 A;  2HHI A;  2YEI A;  4HZ5 A;  2XX2 A;  2Q8H A;  1OSF A;  3CRK A;  5L3J A;  1UYF A;  2Q8I A;  3GIG A;  2YKE A;  1GKZ A;  1YC4 A;  2VWC A;  5D7C A;  1UYH A;  4YKW A;  4JAU A;  2K5B A;  3PEH A;  2C1G A;  4EFU A;  2YEF A;  4XIR A;  2YGF A;  1NHH A;  4MBC A;  4K4O A;  3S5T A;  4GFN A;  4CWN A;  4EEH A;  2O1V A;  2YE7 A;  3RLQ A;  3H80 A;  2EXL A;  1Y8N A;  4XE2 A;  4XC0 A;  1UYD A;  3EHH A;  1EI1 A;  3U2D A;  4H81 A;  1Y8P A;  2IWX A;  2YEA A;  3EHG A;  5D6P A;  3A0X A;  1S16 A;  1UY6 A;  2XX4 A;  2GFD A;  4DUH A;  4HXZ A;  3GIG B;  2IOR A;  1GKX A;  1KZN A;  3FT5 A;  1AMW A;  4KTN A;  1TH8 A;  1L0O A;  2XHR A;  4XKK A;  2HKJ A;  3R4P A;  3O6O A;  2YEJ A;  1EA6 A;  2WER A;  1BYQ A;  2WEQ A;  2YI0 A;  3BM9 A;  1THN A;  3KE6 A;  4XTJ A;  5F5R A;  4ASG A;  2BU2 A;  5M4H A;  4CE3 A;  1TID A;  1UYE A;  4HYM A;  1BKN A;  3R92 A;  3OWD A;  3O0I A;  2FYP A;  4V25 A;  2WI6 A;  3EKO A;  2YGA A;  4CE1 A;  1UY7 A;  1ZXN A;  4L94 A;  3K99 A;  2FWY A;  2BYI A;  3R4N A;  3K97 A;  1TC6 A;  2AKP A;  3B25 A;  4P7A A;  3HEK A;  2YKC A;  3Q5J A;  4EGH A;  3R4M A;  3HZ5 A;  4BAE A;  1GJV A;  2HG1 A;  1BXD A;  3JZ3 A;  4HY1 A;  1YC1 A;  4E72 A;  1UYG A;  4MB9 A;  3U67 A;  1Y4S A;  1H7U A;  2FTK A;  2BU6 A;  3TZ2 A;  4QPK A;  3ZKD A;  5IN9 A;  3GIE A;  4URM A;  5D7D A;  3ZXO A;  3G7E A;  5BOD A;  2ZDX A;  4ASB A;  4CWP A;  4LWI A;  5M4M A;  2XDX A;  4MPC A;  2XJG A;  3G75 A;  2XCM A;  4L8Z A;  1TBW A;  3A0Y A;  4GGL A;  3B24 A;  4CWO A;  3QDD A;  1YS3 A;  3G7B A;  2YI6 A;  3T0H A;  2O1W A;  4MP7 A;  4L90 A;  1NHI A;  3B26 A;  3OWB A;  2XX5 A;  3ZM7 A;  3EHJ A;  1A4H A;  2ZBK B;  5BOC A;  4URN A;  4EGI A;  3INX A;  4P8O A;  2BU5 A;  1Z5C A;  1YT1 A;  4V26 A;  2YED A;  2BTZ A;  2YE5 A;  4R3M A;  5M4N A;  3C11 A;  4CWF A;  1AM1 A;  3CRL A;  3R91 A;  2BU7 A;  2CH4 A;  2VW5 A;  3R4O A;  2BRC A;  3CYG A;  1Z59 A;  4XDM A;  4W7T A;  4PU9 A;  1YT2 A;  4URO A;  4O0B A;  1U0Z A;  2YK2 A;  3ZXQ A;  5C93 A;  3BMY A;  4MOT A;  4QPJ A;  1YSZ A;  3U2K A;  2WI7 A;  3EHF A;  2WI3 A;  2WI2 A;  4WUC A;  3HZ1 A;  2YE2 A;  4LPB A;  4H85 A;  1I59 A;  2C1I A;  1ZW9 A;  2YEH A;  4E02 A;  4YKU A;  5J6A A;  4XCL A;  2BU8 A;  3WQ9 A;  2XHX A;  3OMU A;  2WEP A;  2XDS A;  3A0R A;  2Q8F A;  4B7P A;  1MU5 A;  2IOQ A;  4CWQ A;  3FT8 A;  4ZVI A;  4KSH A;  5CPH A;  2CGF A;  1YET A;  3VHD A;  3H4L A;  1R62 A;  2QFO A;  2Q8G A;  5JEN A;  1JM6 A;  4JAV A;  2CCU A;  4B6C A;  3EKR A;  4O05 A;  4ASF A;  4YKX A;  3CGY A;  5CTW A;  1QY8 A;  4JQL A;  2YGE A;  2BRE A;  1Y4U A;  2FXS A;  3T1K A;  3K60 A;  3O2F A;  1YES A;  4GT8 A;  3T10 A;  4BXI A;  2XAB A;  1Z5B A;  2UWD A;  2VCI A;  3T2S A;  3Q5K A;  5M4E A;  5F3K A;  2C2A A;  3LPS A;  1MX0 A;  1QYE A;  3TTZ A;  1H7S A;  2XHT A;  4NH9 A;  4R3A A;  5FWK A;  1UYC A;  2YE6 A;  1AH6 A;  4XKO A;  2BZ5 A;  2YI7 A;  3OPD A;  2XK2 A; 
#chains in the Genus database with same CATH homology
 1AJ6 A;  2YKI A;  4WUB A;  2PNR A;  4AWQ A;  1I58 A;  4XIP A;  3B28 A;  2Q2E B;  2YJW A;  1NHJ A;  5M4K A;  4KFG A;  3A0W A;  1AH8 A;  2WI1 A;  2ZKJ A;  4XIQ A;  4BQJ A;  1I5B A;  2YEG A;  3RLP A;  4FCQ A;  4YKY A;  4YKR A;  4O09 A;  1ZWH A;  2CG9 A;  4AWP A;  2CCS A;  3WHA A;  2BYH A;  5FNF A;  5CTU A;  4BIZ A;  5FND A;  2YKJ A;  4NH7 A;  3HHU A;  2YEE A;  1UYL A;  3CWV A;  2YEB A;  4KSG A;  1I5C A;  2IWS A;  1ZXM A;  3MNR P;  2QG2 A;  4FMT A;  1PVG A;  1TC0 A;  3T0Z A;  4MPN A;  1UYM A;  2XD6 A;  3D0B A;  4U7O A;  2ZDY A;  2XDL A;  4I5S A;  1ID0 A;  3D2R A;  4FPP A;  5CTY A;  4PL9 A;  3VHC A;  4LWE A;  4U7N A;  3HYZ A;  4MP2 A;  4Q20 A;  3FV5 A;  4LWH A;  5CTX A;  5IDJ A;  4GQT A;  1B63 A;  4CWR A;  4L93 A;  3D36 A;  4R1F A;  1U2O A;  2H8M A;  1YSR A;  2YE4 A;  3INW A;  1UYI A;  4AWO A;  4XIT A;  1YT0 A;  2ESA A;  2YKB A;  2VCJ A;  3GIF A;  4X9L A;  4JAS A;  4L91 A;  5D7R A;  2JJC A;  3OW6 A;  2YE9 A;  1Y8O A;  4I3H A;  3LNU A;  3NMQ A;  4LWG A;  4KQV A;  5CF0 A;  5GGZ A;  4E01 A;  4EFT A;  2YK9 A;  4HYP A;  1QZR A;  5J71 A;  2WI5 A;  4MPE A;  1I5A A;  4BIU A;  4EM7 A;  4E00 A;  5D6Q A;  4O07 A;  1UY8 A;  2GQP A;  4BQG A;  1B3Q A;  2H55 A;  4FCR A;  2YI5 A;  4LP0 A;  2YJX A;  1TIL A;  4U93 A;  4XCJ A;  3VAD A;  3SL2 A;  4GEE A;  4HY6 A;  4O04 A;  3TZ4 A;  4FCP A;  1B62 A;  2XDK A;  4KP4 A;  5M4P A;  4WUD A;  3TUH A;  1US7 A;  2XDU A;  4CWS A;  4CE2 A;  2YEC A;  4EGK A;  3DGE A;  1I5D A;  2BSM A;  2CCT A;  4EMV A;  3TZ5 A;  1YC3 A;  3RLR A;  4AS9 A;  1KIJ A;  2WI4 A;  4YKQ A;  4ASA A;  2JKI A;  2FWZ A;  3C0E A;  4XKA A;  4YKZ A;  3K98 A;  3A0T A;  2XJJ A;  4XD8 A;  3B27 A;  2YE3 A;  2BT0 A;  3TZ0 A;  4URL A;  4LWF A;  4ZKI A;  1YER A;  4HZ0 A;  4PRX A;  4YKT A;  3QTF A;  5IDM A;  3Q5L A;  3ZKB A;  2XJX A;  2YE8 A;  3CGZ A;  1BGQ A;  4H7Q A;  1Z5A A;  3VHA A;  1S14 A;  2IWU A;  4GCZ A;  4HXW A;  3RKZ A;  4PRV A;  3HYY A;  2HCH A;  2O1U A;  1UY9 A;  3PEJ A;  5FNC A;  4CWT A;  4NH8 A;  2IOP A;  3A0Z A;  4DZY A;  3IED A;  2QF6 A;  1UYK A;  2E0A A;  2QG0 A;  2YEI A;  4HZ5 A;  2XX2 A;  2Q8H A;  1OSF A;  3CRK A;  5L3J A;  1UYF A;  2Q8I A;  3GIG A;  2YKE A;  1GKZ A;  1YC4 A;  2VWC A;  5D7C A;  1UYH A;  4YKW A;  4JAU A;  2K5B A;  3PEH A;  4EFU A;  2YEF A;  4XIR A;  2YGF A;  1NHH A;  4MBC A;  4K4O A;  4GFN A;  4CWN A;  4EEH A;  2O1V A;  2YE7 A;  3RLQ A;  3H80 A;  2EXL A;  1Y8N A;  4XE2 A;  4XC0 A;  1UYD A;  3EHH A;  1EI1 A;  3U2D A;  4H81 A;  1Y8P A;  2IWX A;  2YEA A;  3EHG A;  5D6P A;  3A0X A;  1S16 A;  1UY6 A;  2XX4 A;  2GFD A;  4DUH A;  4HXZ A;  3GIG B;  2IOR A;  1GKX A;  1KZN A;  3FT5 A;  1AMW A;  4KTN A;  1TH8 A;  1L0O A;  2XHR A;  4XKK A;  2HKJ A;  3R4P A;  3O6O A;  2YEJ A;  1EA6 A;  2WER A;  1BYQ A;  2WEQ A;  2YI0 A;  3BM9 A;  1THN A;  3KE6 A;  4XTJ A;  5F5R A;  4ASG A;  2BU2 A;  5M4H A;  4CE3 A;  1TID A;  1UYE A;  4HYM A;  1BKN A;  3R92 A;  3OWD A;  3O0I A;  2FYP A;  4V25 A;  2WI6 A;  3EKO A;  2YGA A;  4CE1 A;  1UY7 A;  1ZXN A;  4L94 A;  3K99 A;  2FWY A;  2BYI A;  3R4N A;  3K97 A;  1TC6 A;  2AKP A;  3B25 A;  4P7A A;  3HEK A;  2YKC A;  3Q5J A;  4EGH A;  3R4M A;  3HZ5 A;  4BAE A;  1GJV A;  2HG1 A;  1BXD A;  3JZ3 A;  4HY1 A;  1YC1 A;  1UYG A;  4MB9 A;  3U67 A;  1Y4S A;  1H7U A;  2BU6 A;  3TZ2 A;  4QPK A;  3ZKD A;  5IN9 A;  3GIE A;  4URM A;  5D7D A;  3ZXO A;  3G7E A;  5BOD A;  2ZDX A;  4ASB A;  4CWP A;  4LWI A;  5M4M A;  2XDX A;  4MPC A;  2XJG A;  3G75 A;  2XCM A;  4L8Z A;  1TBW A;  3A0Y A;  4GGL A;  3B24 A;  4CWO A;  3QDD A;  1YS3 A;  3G7B A;  2YI6 A;  3T0H A;  2O1W A;  4MP7 A;  4L90 A;  1NHI A;  3B26 A;  3OWB A;  2XX5 A;  3ZM7 A;  3EHJ A;  1A4H A;  2ZBK B;  5BOC A;  4URN A;  4EGI A;  3INX A;  4P8O A;  2BU5 A;  1Z5C A;  1YT1 A;  4V26 A;  2YED A;  2BTZ A;  2YE5 A;  4R3M A;  5M4N A;  3C11 A;  4CWF A;  1AM1 A;  3CRL A;  3R91 A;  2BU7 A;  2CH4 A;  2VW5 A;  3R4O A;  2BRC A;  1Z59 A;  4XDM A;  4W7T A;  4PU9 A;  1YT2 A;  4URO A;  4O0B A;  1U0Z A;  2YK2 A;  3ZXQ A;  5C93 A;  3BMY A;  4MOT A;  4QPJ A;  1YSZ A;  3U2K A;  2WI7 A;  3EHF A;  2WI3 A;  2WI2 A;  4WUC A;  3HZ1 A;  2YE2 A;  4LPB A;  4H85 A;  1I59 A;  1ZW9 A;  2YEH A;  4E02 A;  4YKU A;  5J6A A;  4XCL A;  2BU8 A;  3WQ9 A;  2XHX A;  3OMU A;  2WEP A;  2XDS A;  3A0R A;  2Q8F A;  4B7P A;  1MU5 A;  2IOQ A;  4CWQ A;  3FT8 A;  4ZVI A;  4KSH A;  5CPH A;  2CGF A;  1YET A;  3VHD A;  3H4L A;  1R62 A;  2QFO A;  2Q8G A;  1JM6 A;  4JAV A;  2CCU A;  4B6C A;  3EKR A;  4O05 A;  4ASF A;  4YKX A;  3CGY A;  5CTW A;  1QY8 A;  4JQL A;  2YGE A;  2BRE A;  1Y4U A;  2FXS A;  3T1K A;  3K60 A;  3O2F A;  1YES A;  4GT8 A;  3T10 A;  4BXI A;  2XAB A;  1Z5B A;  2UWD A;  2VCI A;  3T2S A;  3Q5K A;  5M4E A;  5F3K A;  2C2A A;  3LPS A;  1MX0 A;  1QYE A;  3TTZ A;  1H7S A;  2XHT A;  4NH9 A;  4R3A A;  5FWK A;  1UYC A;  2YE6 A;  1AH6 A;  4XKO A;  2BZ5 A;  2YI7 A;  3OPD A;  2XK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...