3U2KA

S. aureus gyrb atpase domain in complex with a small molecule inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Pyrrolamide DNA gyrase inhibitors: fragment-based nuclear magnetic resonance screening to identify antibacterial agents.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3u2kA00
1L0OA 3SL2A 2XCMA 1OSFA 1AMWA 2BSMA 2CG9A 2YKIA 3VHCA 3BM9A 3TZ5A 2IWSA 5C93A 1AM1A 2BU7A 2YE9A 4LWHA 4P8OA 3K98A 3TZ2A 2YEIA 3R92A 3FT5A 3Q5KA 4YKRA 5D7RA 2JJCA 5D7DA 1Z5CA 2YE3A 4JAUA 3CGZA 2CH4A 3OPDA 2YEFA 4U7OA 3A0RA 5D6PA 4B7PA 4K4OA 4MOTA 1TC0A 3C0EA 2YEHA 4I5SA 4CWNA 3VADA 3CGYA 4XIRA 5F5RA 3CRLA 3WQ9A 4KSGA 4KSHA 1KZNA 2YKBA 5CTXA 4O0BA 2XDLA 4AS9A 1AJ6A 4MP7A 4EMVA 4BAEA 4CE3A 4HYPA 4URMA 3IEDA 5CPHA 4I3HA 2YI0A 5J71A 1QY8A 1YETA 2XJGA 4YKZA 5M4MA 2JKIA 2WI3A 1PVGA 1UYCA 3PEJA 1QZRA 4LWFA 4XTJA 4JAVA 4HXZA 3JZ3A 4GEEA 2ZKJA 4QPJA 2C2AA 1Y4UA 2BYIA 4W7TA 5M4KA 2VCIA 5CF0A 2GFDA 3OW6A 3TZ4A 1Y8PA 3INWA 4WUBA 4EFUA 2BU5A 1THNA 1UYLA 4FCQA 4BIUA 3RLQA 2XX2A 4O05A 1MX0A 2YE8A 3GIEA 4E00A 2XDSA 3CRKA 4AWPA 1AH6A 4KTNA 3MNRP 3T2SA 1YC1A 4FMTA 4R3AA 2HCHA 4CWQA 1I5AA 2XHRA 3ZM7A 4KP4A 2Q8HA 2BT0A 4L8ZA 1US7A 2YJWA 3FT8A 1B62A 4E02A 2ZBKB 3R4PA 4ASAA 4CWPA 1BYQA 4LPBA 3A0ZA 4NH9A 4EGHA 1B3QA 3T10A 2XABA 5M4NA 1Y8NA 4GFNA 3U2KA 4CWOA 3G75A 3G7BA 3RLPA 5FNCA 4L91A 4YKWA 2XJXA 4PL9A 4CWSA 4URNA 1U2OA 2QG0A 2WI6A 2YK9A 1I5BA 1YT2A 4XCJA 1I59A 2BTZA 3ZKBA 3U67A 3HYZA 4HXWA 4LWGA 4X9LA 2E0AA 4MPCA 2YKEA 4LP0A 4KFGA 3TUHA 3K60A 1ZXNA 1YSZA 3H80A 4MP2A 5CTWA 2GQPA 2YEBA 3CWVA 2YGEA 1B63A 4ASBA 2O1WA 4URLA 2O1VA 3B27A 4HZ5A 3HYYA 3Q5LA 4ASGA 5BODA 4XIPA 3T1KA 4PRVA 4ASFA 3O2FA 4BIZA 1GKZA 2VCJA 4L90A 4ZKIA 3QTFA 3B26A 5L3JA 3NMQA 2K5BA 2YEJA 4H85A 2WI4A 4H7QA 4EGKA 4CWRA 2QF6A 2YEAA 2BZ5A 1GJVA 4CE2A 5IDMA 4EGIA 4AWQA 2YI5A 1UY9A 2QFOA 4CWTA 3R4MA 3C11A 3B28A 2FWYA 1YS3A 3K99A 2Q8FA 5GGZA 3FV5A 4O04A 3A0WA 2HKJA 2IOQA 2XDUA 1YT1A 5D7CA 1ID0A 3ZXQA 2CCSA 4P7AA 3EHHA 3OWDA 3T0HA 4YKXA 3O6OA 2EXLA 2WI1A 1R62A 3G7EA 4AWOA 1TH8A 1UY7A 3T0ZA 2FYPA 2IWUA 5F3KA 4V26A 1UYIA 4EEHA 2WERA 4L93A 4DZYA 4V25A 4MPEA 3OMUA 4PRXA 4XD8A 1YC4A 2YE7A 2O1UA 3GIGB 1YC3A 2CGFA 2YE2A 4FCPA 3DGEA 5M4PA 3RKZA 1NHHA 3A0YA 2ZDXA 4XKAA 2XDKA 3ZXOA 1JM6A 2VWCA 4HYMA 4KQVA 4H81A 4E01A 3RLRA 1ZW9A 3WHAA 1A4HA 1ZXMA 4XITA 1NHJA 5M4HA 2VW5A 4YKQA 4JASA 2YECA 2UWDA 4CWFA 3TTZA 1BGQA 2YK2A 1KIJA 3Q5JA 1EA6A 4GT8A 1UYDA 1TIDA 4WUCA 1S16A 3B24A 2YEEA 1Z59A 3PEHA 3EKRA 4EFTA 1H7UA 1AH8A 1YESA 4XDMA 5IDJA 4BQGA 3R4OA 2YE4A 2YE6A 4ZVIA 2PNRA 1I5DA 5D6QA 1I5CA 4GGLA 3D36A 4XIQA 2WEQA 5FWKA 3D2RA 3H4LA 3VHDA 3BMYA 4O09A 4WUDA 1BXDA 2BU6A 4BXIA 4L94A 4LWEA 2YKCA 1Y8OA 3EHFA 5J6AA 3ZKDA 1S14A 4HY6A 1NHIA 3D0BA 2BU8A 4Q20A 1UYHA 4MBCA 4LWIA 4MPNA 1ZWHA 2WEPA 3HHUA 5CTUA 5M4EA 2WI7A 3O0IA 2BRCA 2H55A 3A0XA 1UYFA 4B6CA 2AKPA 4XC0A 2WI2A 1UYEA 3GIFA 1Z5BA 2IOPA 1YSRA 3U2DA 4MB9A 2ESAA 2YEDA 4XCLA 2BREA 4CE1A 3R4NA 4YKTA 2BU2A 4UROA 2IWXA 1UY8A 2YE5A 4XKKA 2XJJA 3INXA 2BYHA 1YT0A 4PU9A 1QYEA 2CCTA 4R3MA 1U0ZA 4HZ0A 1UYKA 3GIGA 5BOCA 2H8MA 4YKYA 2YEGA 3KE6A 1H7SA 4DUHA 2FXSA 1Y4SA 1MU5A 1UYGA 4U93A 3R91A 1I58A 5FNDA 1BKNA 4HY1A 2XDXA 2XHXA 2YI6A 3LPSA 2XX5A 3B25A 2YGAA 4O07A 3TZ0A 4FPPA 2HG1A 3QDDA 3HEKA 3VHAA 4FCRA 5FNFA 4XKOA 3K97A 2XK2A 3A0TA 4EM7A 1UYMA 2XX4A 4NH8A 2WI5A 2ZDYA 2XD6A 3LNUA 1TILA 2FWZA 1YERA 1Z5AA 1TC6A 4QPKA 2Q8IA 1GKXA 4R1FA 5IN9A 3EHJA 2YKJA 4JQLA 1EI1A 5CTYA 3EHGA 3EKOA 4GCZA 2YI7A 3OWBA 4GQTA 2XHTA 2Q8GA 4U7NA 2YGFA 1UY6A 4NH7A 4XE2A 3HZ1A 4BQJA 2CCUA 2Q2EB 4YKUA 1TBWA 2YJXA 2IORA 3HZ5A 2QG2A
chains in the Genus database with same CATH superfamily
1L0OA 3SL2A 2XCMA 1OSFA 1AMWA 2BSMA 2CG9A 2YKIA 3VHCA 3BM9A 3TZ5A 2IWSA 5C93A 1AM1A 2BU7A 2YE9A 4LWHA 4P8OA 3K98A 3TZ2A 2YEIA 3R92A 3FT5A 3Q5KA 4YKRA 5D7RA 2JJCA 5D7DA 1Z5CA 2YE3A 4JAUA 3CGZA 2CH4A 3OPDA 2YEFA 4U7OA 3A0RA 5D6PA 4B7PA 4K4OA 4MOTA 1TC0A 3C0EA 2YEHA 4I5SA 4CWNA 3VADA 3CGYA 4XIRA 5F5RA 3CRLA 3WQ9A 4KSGA 4KSHA 1KZNA 2YKBA 5CTXA 4O0BA 2XDLA 4AS9A 1AJ6A 4MP7A 4EMVA 4BAEA 4CE3A 4HYPA 4URMA 3IEDA 5CPHA 4I3HA 2YI0A 5J71A 1QY8A 1YETA 2XJGA 4YKZA 5M4MA 2JKIA 2WI3A 1PVGA 1UYCA 3PEJA 1QZRA 4LWFA 4XTJA 4JAVA 4HXZA 3JZ3A 4GEEA 2ZKJA 4QPJA 2C2AA 1Y4UA 2BYIA 4W7TA 5M4KA 2VCIA 5CF0A 2GFDA 3OW6A 3TZ4A 1Y8PA 3INWA 4WUBA 4EFUA 2BU5A 1THNA 1UYLA 4FCQA 4BIUA 3RLQA 2XX2A 4O05A 1MX0A 2YE8A 3GIEA 4E00A 2XDSA 3CRKA 4AWPA 1AH6A 4KTNA 3MNRP 3T2SA 1YC1A 4FMTA 4R3AA 2HCHA 4CWQA 2C1GA 1I5AA 2XHRA 3ZM7A 4KP4A 2Q8HA 2BT0A 4L8ZA 1US7A 2YJWA 3FT8A 1B62A 4E02A 2ZBKB 3R4PA 4ASAA 4CWPA 1BYQA 4LPBA 3A0ZA 4NH9A 4EGHA 1B3QA 3T10A 2XABA 5M4NA 1Y8NA 4GFNA 3U2KA 4CWOA 3G75A 3G7BA 3RLPA 5FNCA 4L91A 4YKWA 2XJXA 4PL9A 4CWSA 4URNA 1U2OA 2QG0A 2WI6A 2YK9A 1I5BA 1YT2A 4XCJA 1I59A 2BTZA 3ZKBA 3U67A 3HYZA 4HXWA 4LWGA 4X9LA 2E0AA 4MPCA 2YKEA 4LP0A 4KFGA 3TUHA 3K60A 1ZXNA 1YSZA 3H80A 4MP2A 5CTWA 2GQPA 2YEBA 3CWVA 2YGEA 1B63A 4ASBA 2O1WA 4URLA 2O1VA 3B27A 4HZ5A 3HYYA 3Q5LA 4ASGA 5BODA 4XIPA 3T1KA 4PRVA 4ASFA 3O2FA 4BIZA 1GKZA 2VCJA 4L90A 4ZKIA 3QTFA 3B26A 5L3JA 3NMQA 2K5BA 2YEJA 4H85A 2WI4A 2C1IA 4H7QA 4EGKA 4CWRA 2QF6A 2YEAA 2BZ5A 1GJVA 4CE2A 5IDMA 4EGIA 4AWQA 2YI5A 1UY9A 2QFOA 4CWTA 3R4MA 3C11A 3B28A 2FWYA 1YS3A 3K99A 2Q8FA 5GGZA 3FV5A 4O04A 3A0WA 2HKJA 2IOQA 2XDUA 1YT1A 5D7CA 1ID0A 3ZXQA 2CCSA 4P7AA 3EHHA 3OWDA 3T0HA 4YKXA 3O6OA 2EXLA 2WI1A 1R62A 3G7EA 4AWOA 1TH8A 1UY7A 3T0ZA 2FYPA 2IWUA 5F3KA 4V26A 1UYIA 4EEHA 2WERA 4L93A 4DZYA 3LMMA 4V25A 4MPEA 3OMUA 4PRXA 4XD8A 1YC4A 2YE7A 2O1UA 3GIGB 1YC3A 2CGFA 2YE2A 4FCPA 3DGEA 5M4PA 3RKZA 1NHHA 3A0YA 2ZDXA 4XKAA 2XDKA 3ZXOA 1JM6A 2VWCA 4HYMA 4KQVA 3CYGA 4H81A 4E01A 3RLRA 1ZW9A 3WHAA 5JENA 1A4HA 1ZXMA 4XITA 1NHJA 5M4HA 2VW5A 4YKQA 4JASA 4E72A 2YECA 2UWDA 4CWFA 3TTZA 1BGQA 2YK2A 1KIJA 3Q5JA 2HHIA 1EA6A 4GT8A 1UYDA 1TIDA 4WUCA 1F51A 1S16A 3B24A 2YEEA 1Z59A 3PEHA 3EKRA 4EFTA 1AH8A 1H7UA 1YESA 4XDMA 5IDJA 4BQGA 3R4OA 2YE4A 2YE6A 1IXMA 4ZVIA 2PNRA 1I5DA 5D6QA 1I5CA 4GGLA 3D36A 4XIQA 2WEQA 5FWKA 3D2RA 3H4LA 3VHDA 3BMYA 4O09A 4WUDA 1BXDA 2BU6A 4BXIA 4L94A 4LWEA 2YKCA 1Y8OA 3EHFA 5J6AA 3ZKDA 1S14A 4HY6A 1NHIA 3D0BA 2BU8A 4Q20A 1UYHA 4MBCA 4LWIA 4MPNA 1ZWHA 2WEPA 3HHUA 5CTUA 5M4EA 2WI7A 3O0IA 2BRCA 2H55A 3A0XA 1UYFA 4B6CA 2AKPA 4XC0A 2WI2A 1UYEA 3GIFA 1Z5BA 2IOPA 1YSRA 3U2DA 4MB9A 2ESAA 2YEDA 4XCLA 2BREA 4CE1A 3R4NA 4YKTA 2BU2A 4UROA 2IWXA 1UY8A 2YE5A 4XKKA 2XJJA 3INXA 2BYHA 1YT0A 4PU9A 1QYEA 2CCTA 4R3MA 1U0ZA 4HZ0A 1UYKA 3GIGA 5BOCA 2H8MA 4YKYA 2YEGA 3KE6A 1H7SA 4DUHA 2FXSA 1Y4SA 1MU5A 1UYGA 4U93A 3R91A 1I58A 3S5TA 5FNDA 1BKNA 4HY1A 2XDXA 2XHXA 2YI6A 3LPSA 2XX5A 3B25A 2YGAA 4O07A 3TZ0A 4FPPA 2HG1A 3QDDA 3HEKA 3VHAA 4FCRA 5FNFA 4XKOA 3K97A 2XK2A 3A0TA 4EM7A 1UYMA 2XX4A 4NH8A 2WI5A 2ZDYA 2XD6A 3LNUA 1TILA 2FWZA 1YERA 1Z5AA 1TC6A 4QPKA 2Q8IA 1GKXA 4R1FA 5IN9A 3EHJA 2YKJA 4JQLA 1EI1A 5CTYA 3EHGA 3EKOA 4GCZA 2YI7A 3OWBA 4GQTA 2XHTA 2Q8GA 4U7NA 2YGFA 1UY6A 4NH7A 4XE2A 3HZ1A 4BQJA 2CCUA 2Q2EB 4YKUA 1TBWA 2FTKA 2IORA 2YJXA 3HZ5A 2QG2A
chains in the Genus database with same CATH topology
1L0OA 3SL2A 2XCMA 1OSFA 1AMWA 2BSMA 2CG9A 2YKIA 3VHCA 3BM9A 3TZ5A 2IWSA 5C93A 1AM1A 2BU7A 2YE9A 4LWHA 4P8OA 3K98A 3TZ2A 2YEIA 3R92A 3FT5A 3Q5KA 4YKRA 5D7RA 2JJCA 5D7DA 1Z5CA 2YE3A 4JAUA 3CGZA 2CH4A 3OPDA 2YEFA 4U7OA 3A0RA 5D6PA 4B7PA 4K4OA 4MOTA 1TC0A 3C0EA 2YEHA 4I5SA 4CWNA 3VADA 3CGYA 4XIRA 5F5RA 3CRLA 3WQ9A 4KSGA 4KSHA 1KZNA 2YKBA 5CTXA 4O0BA 2XDLA 4AS9A 1AJ6A 4MP7A 4EMVA 4BAEA 4CE3A 4HYPA 4URMA 3IEDA 5CPHA 4I3HA 2YI0A 5J71A 1QY8A 1YETA 2XJGA 4YKZA 5M4MA 2JKIA 2WI3A 1PVGA 1UYCA 3PEJA 1QZRA 4LWFA 4XTJA 4JAVA 4HXZA 3JZ3A 4GEEA 2ZKJA 4QPJA 2C2AA 1Y4UA 2BYIA 4W7TA 5M4KA 2VCIA 5CF0A 2GFDA 3OW6A 3TZ4A 1Y8PA 3INWA 4WUBA 4EFUA 2BU5A 1THNA 1UYLA 4FCQA 4BIUA 3RLQA 2XX2A 4O05A 1MX0A 2YE8A 3GIEA 4E00A 2XDSA 3CRKA 4AWPA 1AH6A 4KTNA 3MNRP 3T2SA 1YC1A 4FMTA 4R3AA 2HCHA 4CWQA 1I5AA 2XHRA 3ZM7A 4KP4A 2Q8HA 2BT0A 4L8ZA 1US7A 2YJWA 3FT8A 1B62A 4E02A 2ZBKB 3R4PA 4ASAA 4CWPA 1BYQA 4LPBA 3A0ZA 4NH9A 4EGHA 1B3QA 3T10A 2XABA 5M4NA 1Y8NA 4GFNA 3U2KA 4CWOA 3G75A 3G7BA 3RLPA 5FNCA 4L91A 4YKWA 2XJXA 4PL9A 4CWSA 4URNA 1U2OA 2QG0A 2WI6A 2YK9A 1I5BA 1YT2A 4XCJA 1I59A 2BTZA 3ZKBA 3U67A 3HYZA 4HXWA 4LWGA 4X9LA 2E0AA 4MPCA 2YKEA 4LP0A 4KFGA 3TUHA 3K60A 1ZXNA 1YSZA 3H80A 4MP2A 5CTWA 2GQPA 2YEBA 3CWVA 2YGEA 1B63A 4ASBA 2O1WA 4URLA 2O1VA 3B27A 4HZ5A 3HYYA 3Q5LA 4ASGA 5BODA 4XIPA 3T1KA 4PRVA 4ASFA 3O2FA 4BIZA 1GKZA 2VCJA 4L90A 4ZKIA 3QTFA 3B26A 5L3JA 3NMQA 2K5BA 2YEJA 4H85A 2WI4A 4H7QA 4EGKA 4CWRA 2QF6A 2YEAA 2BZ5A 1GJVA 4CE2A 5IDMA 4EGIA 4AWQA 2YI5A 1UY9A 2QFOA 4CWTA 3R4MA 3C11A 3B28A 2FWYA 1YS3A 3K99A 2Q8FA 5GGZA 3FV5A 4O04A 3A0WA 2HKJA 2IOQA 2XDUA 1YT1A 5D7CA 1ID0A 3ZXQA 2CCSA 4P7AA 3EHHA 3OWDA 3T0HA 4YKXA 3O6OA 2EXLA 2WI1A 1R62A 3G7EA 4AWOA 1TH8A 1UY7A 3T0ZA 2FYPA 2IWUA 5F3KA 4V26A 1UYIA 4EEHA 2WERA 4L93A 4DZYA 4V25A 4MPEA 3OMUA 4PRXA 4XD8A 1YC4A 2YE7A 2O1UA 3GIGB 1YC3A 2CGFA 2YE2A 4FCPA 3DGEA 5M4PA 3RKZA 1NHHA 3A0YA 2ZDXA 4XKAA 2XDKA 3ZXOA 1JM6A 2VWCA 4HYMA 4KQVA 4H81A 4E01A 3RLRA 1ZW9A 3WHAA 1A4HA 1ZXMA 4XITA 1NHJA 5M4HA 2VW5A 4YKQA 4JASA 2YECA 2UWDA 4CWFA 3TTZA 1BGQA 2YK2A 1KIJA 3Q5JA 1EA6A 4GT8A 1UYDA 1TIDA 4WUCA 1S16A 3B24A 2YEEA 1Z59A 3PEHA 3EKRA 4EFTA 1H7UA 1AH8A 1YESA 4XDMA 5IDJA 4BQGA 3R4OA 2YE4A 2YE6A 4ZVIA 2PNRA 1I5DA 5D6QA 1I5CA 4GGLA 3D36A 4XIQA 2WEQA 5FWKA 3D2RA 3H4LA 3VHDA 3BMYA 4O09A 4WUDA 1BXDA 2BU6A 4BXIA 4L94A 4LWEA 2YKCA 1Y8OA 3EHFA 5J6AA 3ZKDA 1S14A 4HY6A 1NHIA 3D0BA 2BU8A 4Q20A 1UYHA 4MBCA 4LWIA 4MPNA 1ZWHA 2WEPA 3HHUA 5CTUA 5M4EA 2WI7A 3O0IA 2BRCA 2H55A 3A0XA 1UYFA 4B6CA 2AKPA 4XC0A 2WI2A 1UYEA 3GIFA 1Z5BA 2IOPA 1YSRA 3U2DA 4MB9A 2ESAA 2YEDA 4XCLA 2BREA 4CE1A 3R4NA 4YKTA 2BU2A 4UROA 2IWXA 1UY8A 2YE5A 4XKKA 2XJJA 3INXA 2BYHA 1YT0A 4PU9A 1QYEA 2CCTA 4R3MA 1U0ZA 4HZ0A 1UYKA 3GIGA 5BOCA 2H8MA 4YKYA 2YEGA 3KE6A 1H7SA 4DUHA 2FXSA 1Y4SA 1MU5A 1UYGA 4U93A 3R91A 1I58A 5FNDA 1BKNA 4HY1A 2XDXA 2XHXA 2YI6A 3LPSA 2XX5A 3B25A 2YGAA 4O07A 3TZ0A 4FPPA 2HG1A 3QDDA 3HEKA 3VHAA 4FCRA 5FNFA 4XKOA 3K97A 2XK2A 3A0TA 4EM7A 1UYMA 2XX4A 4NH8A 2WI5A 2ZDYA 2XD6A 3LNUA 1TILA 2FWZA 1YERA 1Z5AA 1TC6A 4QPKA 2Q8IA 1GKXA 4R1FA 5IN9A 3EHJA 2YKJA 4JQLA 1EI1A 5CTYA 3EHGA 3EKOA 4GCZA 2YI7A 3OWBA 4GQTA 2XHTA 2Q8GA 4U7NA 2YGFA 1UY6A 4NH7A 4XE2A 3HZ1A 4BQJA 2CCUA 2Q2EB 4YKUA 1TBWA 2YJXA 2IORA 3HZ5A 2QG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0O A;  3SL2 A;  2XCM A;  1OSF A;  1AMW A;  2BSM A;  2CG9 A;  2YKI A;  3VHC A;  3BM9 A;  3TZ5 A;  2IWS A;  5C93 A;  1AM1 A;  2BU7 A;  2YE9 A;  4LWH A;  4P8O A;  3K98 A;  3TZ2 A;  2YEI A;  3R92 A;  3FT5 A;  3Q5K A;  4YKR A;  5D7R A;  2JJC A;  5D7D A;  1Z5C A;  2YE3 A;  4JAU A;  3CGZ A;  2CH4 A;  3OPD A;  2YEF A;  4U7O A;  3A0R A;  5D6P A;  4B7P A;  4K4O A;  4MOT A;  1TC0 A;  3C0E A;  2YEH A;  4I5S A;  4CWN A;  3VAD A;  3CGY A;  4XIR A;  5F5R A;  3CRL A;  3WQ9 A;  4KSG A;  4KSH A;  1KZN A;  2YKB A;  5CTX A;  4O0B A;  2XDL A;  4AS9 A;  1AJ6 A;  4MP7 A;  4EMV A;  4BAE A;  4CE3 A;  4HYP A;  4URM A;  3IED A;  5CPH A;  4I3H A;  2YI0 A;  5J71 A;  1QY8 A;  1YET A;  2XJG A;  4YKZ A;  5M4M A;  2JKI A;  2WI3 A;  1PVG A;  1UYC A;  3PEJ A;  1QZR A;  4LWF A;  4XTJ A;  4JAV A;  4HXZ A;  3JZ3 A;  4GEE A;  2ZKJ A;  4QPJ A;  2C2A A;  1Y4U A;  2BYI A;  4W7T A;  5M4K A;  2VCI A;  5CF0 A;  2GFD A;  3OW6 A;  3TZ4 A;  1Y8P A;  3INW A;  4WUB A;  4EFU A;  2BU5 A;  1THN A;  1UYL A;  4FCQ A;  4BIU A;  3RLQ A;  2XX2 A;  4O05 A;  1MX0 A;  2YE8 A;  3GIE A;  4E00 A;  2XDS A;  3CRK A;  4AWP A;  1AH6 A;  4KTN A;  3MNR P;  3T2S A;  1YC1 A;  4FMT A;  4R3A A;  2HCH A;  4CWQ A;  1I5A A;  2XHR A;  3ZM7 A;  4KP4 A;  2Q8H A;  2BT0 A;  4L8Z A;  1US7 A;  2YJW A;  3FT8 A;  1B62 A;  4E02 A;  2ZBK B;  3R4P A;  4ASA A;  4CWP A;  1BYQ A;  4LPB A;  3A0Z A;  4NH9 A;  4EGH A;  1B3Q A;  3T10 A;  2XAB A;  5M4N A;  1Y8N A;  4GFN A;  3U2K A;  4CWO A;  3G75 A;  3G7B A;  3RLP A;  5FNC A;  4L91 A;  4YKW A;  2XJX A;  4PL9 A;  4CWS A;  4URN A;  1U2O A;  2QG0 A;  2WI6 A;  2YK9 A;  1I5B A;  1YT2 A;  4XCJ A;  1I59 A;  2BTZ A;  3ZKB A;  3U67 A;  3HYZ A;  4HXW A;  4LWG A;  4X9L A;  2E0A A;  4MPC A;  2YKE A;  4LP0 A;  4KFG A;  3TUH A;  3K60 A;  1ZXN A;  1YSZ A;  3H80 A;  4MP2 A;  5CTW A;  2GQP A;  2YEB A;  3CWV A;  2YGE A;  1B63 A;  4ASB A;  2O1W A;  4URL A;  2O1V A;  3B27 A;  4HZ5 A;  3HYY A;  3Q5L A;  4ASG A;  5BOD A;  4XIP A;  3T1K A;  4PRV A;  4ASF A;  3O2F A;  4BIZ A;  1GKZ A;  2VCJ A;  4L90 A;  4ZKI A;  3QTF A;  3B26 A;  5L3J A;  3NMQ A;  2K5B A;  2YEJ A;  4H85 A;  2WI4 A;  4H7Q A;  4EGK A;  4CWR A;  2QF6 A;  2YEA A;  2BZ5 A;  1GJV A;  4CE2 A;  5IDM A;  4EGI A;  4AWQ A;  2YI5 A;  1UY9 A;  2QFO A;  4CWT A;  3R4M A;  3C11 A;  3B28 A;  2FWY A;  1YS3 A;  3K99 A;  2Q8F A;  5GGZ A;  3FV5 A;  4O04 A;  3A0W A;  2HKJ A;  2IOQ A;  2XDU A;  1YT1 A;  5D7C A;  1ID0 A;  3ZXQ A;  2CCS A;  4P7A A;  3EHH A;  3OWD A;  3T0H A;  4YKX A;  3O6O A;  2EXL A;  2WI1 A;  1R62 A;  3G7E A;  4AWO A;  1TH8 A;  1UY7 A;  3T0Z A;  2FYP A;  2IWU A;  5F3K A;  4V26 A;  1UYI A;  4EEH A;  2WER A;  4L93 A;  4DZY A;  4V25 A;  4MPE A;  3OMU A;  4PRX A;  4XD8 A;  1YC4 A;  2YE7 A;  2O1U A;  3GIG B;  1YC3 A;  2CGF A;  2YE2 A;  4FCP A;  3DGE A;  5M4P A;  3RKZ A;  1NHH A;  3A0Y A;  2ZDX A;  4XKA A;  2XDK A;  3ZXO A;  1JM6 A;  2VWC A;  4HYM A;  4KQV A;  4H81 A;  4E01 A;  3RLR A;  1ZW9 A;  3WHA A;  1A4H A;  1ZXM A;  4XIT A;  1NHJ A;  5M4H A;  2VW5 A;  4YKQ A;  4JAS A;  2YEC A;  2UWD A;  4CWF A;  3TTZ A;  1BGQ A;  2YK2 A;  1KIJ A;  3Q5J A;  1EA6 A;  4GT8 A;  1UYD A;  1TID A;  4WUC A;  1S16 A;  3B24 A;  2YEE A;  1Z59 A;  3PEH A;  3EKR A;  4EFT A;  1H7U A;  1AH8 A;  1YES A;  4XDM A;  5IDJ A;  4BQG A;  3R4O A;  2YE4 A;  2YE6 A;  4ZVI A;  2PNR A;  1I5D A;  5D6Q A;  1I5C A;  4GGL A;  3D36 A;  4XIQ A;  2WEQ A;  5FWK A;  3D2R A;  3H4L A;  3VHD A;  3BMY A;  4O09 A;  4WUD A;  1BXD A;  2BU6 A;  4BXI A;  4L94 A;  4LWE A;  2YKC A;  1Y8O A;  3EHF A;  5J6A A;  3ZKD A;  1S14 A;  4HY6 A;  1NHI A;  3D0B A;  2BU8 A;  4Q20 A;  1UYH A;  4MBC A;  4LWI A;  4MPN A;  1ZWH A;  2WEP A;  3HHU A;  5CTU A;  5M4E A;  2WI7 A;  3O0I A;  2BRC A;  2H55 A;  3A0X A;  1UYF A;  4B6C A;  2AKP A;  4XC0 A;  2WI2 A;  1UYE A;  3GIF A;  1Z5B A;  2IOP A;  1YSR A;  3U2D A;  4MB9 A;  2ESA A;  2YED A;  4XCL A;  2BRE A;  4CE1 A;  3R4N A;  4YKT A;  2BU2 A;  4URO A;  2IWX A;  1UY8 A;  2YE5 A;  4XKK A;  2XJJ A;  3INX A;  2BYH A;  1YT0 A;  4PU9 A;  1QYE A;  2CCT A;  4R3M A;  1U0Z A;  4HZ0 A;  1UYK A;  3GIG A;  5BOC A;  2H8M A;  4YKY A;  2YEG A;  3KE6 A;  1H7S A;  4DUH A;  2FXS A;  1Y4S A;  1MU5 A;  1UYG A;  4U93 A;  3R91 A;  1I58 A;  5FND A;  1BKN A;  4HY1 A;  2XDX A;  2XHX A;  2YI6 A;  3LPS A;  2XX5 A;  3B25 A;  2YGA A;  4O07 A;  3TZ0 A;  4FPP A;  2HG1 A;  3QDD A;  3HEK A;  3VHA A;  4FCR A;  5FNF A;  4XKO A;  3K97 A;  2XK2 A;  3A0T A;  4EM7 A;  1UYM A;  2XX4 A;  4NH8 A;  2WI5 A;  2ZDY A;  2XD6 A;  3LNU A;  1TIL A;  2FWZ A;  1YER A;  1Z5A A;  1TC6 A;  4QPK A;  2Q8I A;  1GKX A;  4R1F A;  5IN9 A;  3EHJ A;  2YKJ A;  4JQL A;  1EI1 A;  5CTY A;  3EHG A;  3EKO A;  4GCZ A;  2YI7 A;  3OWB A;  4GQT A;  2XHT A;  2Q8G A;  4U7N A;  2YGF A;  1UY6 A;  4NH7 A;  4XE2 A;  3HZ1 A;  4BQJ A;  2CCU A;  2Q2E B;  4YKU A;  1TBW A;  2YJX A;  2IOR A;  3HZ5 A;  2QG2 A; 
#chains in the Genus database with same CATH topology
 1L0O A;  3SL2 A;  2XCM A;  1OSF A;  1AMW A;  2BSM A;  2CG9 A;  2YKI A;  3VHC A;  3BM9 A;  3TZ5 A;  2IWS A;  5C93 A;  1AM1 A;  2BU7 A;  2YE9 A;  4LWH A;  4P8O A;  3K98 A;  3TZ2 A;  2YEI A;  3R92 A;  3FT5 A;  3Q5K A;  4YKR A;  5D7R A;  2JJC A;  5D7D A;  1Z5C A;  2YE3 A;  4JAU A;  3CGZ A;  2CH4 A;  3OPD A;  2YEF A;  4U7O A;  3A0R A;  5D6P A;  4B7P A;  4K4O A;  4MOT A;  1TC0 A;  3C0E A;  2YEH A;  4I5S A;  4CWN A;  3VAD A;  3CGY A;  4XIR A;  5F5R A;  3CRL A;  3WQ9 A;  4KSG A;  4KSH A;  1KZN A;  2YKB A;  5CTX A;  4O0B A;  2XDL A;  4AS9 A;  1AJ6 A;  4MP7 A;  4EMV A;  4BAE A;  4CE3 A;  4HYP A;  4URM A;  3IED A;  5CPH A;  4I3H A;  2YI0 A;  5J71 A;  1QY8 A;  1YET A;  2XJG A;  4YKZ A;  5M4M A;  2JKI A;  2WI3 A;  1PVG A;  1UYC A;  3PEJ A;  1QZR A;  4LWF A;  4XTJ A;  4JAV A;  4HXZ A;  3JZ3 A;  4GEE A;  2ZKJ A;  4QPJ A;  2C2A A;  1Y4U A;  2BYI A;  4W7T A;  5M4K A;  2VCI A;  5CF0 A;  2GFD A;  3OW6 A;  3TZ4 A;  1Y8P A;  3INW A;  4WUB A;  4EFU A;  2BU5 A;  1THN A;  1UYL A;  4FCQ A;  4BIU A;  3RLQ A;  2XX2 A;  4O05 A;  1MX0 A;  2YE8 A;  3GIE A;  4E00 A;  2XDS A;  3CRK A;  4AWP A;  1AH6 A;  4KTN A;  3MNR P;  3T2S A;  1YC1 A;  4FMT A;  4R3A A;  2HCH A;  4CWQ A;  2C1G A;  1I5A A;  2XHR A;  3ZM7 A;  4KP4 A;  2Q8H A;  2BT0 A;  4L8Z A;  1US7 A;  2YJW A;  3FT8 A;  1B62 A;  4E02 A;  2ZBK B;  3R4P A;  4ASA A;  4CWP A;  1BYQ A;  4LPB A;  3A0Z A;  4NH9 A;  4EGH A;  1B3Q A;  3T10 A;  2XAB A;  5M4N A;  1Y8N A;  4GFN A;  3U2K A;  4CWO A;  3G75 A;  3G7B A;  3RLP A;  5FNC A;  4L91 A;  4YKW A;  2XJX A;  4PL9 A;  4CWS A;  4URN A;  1U2O A;  2QG0 A;  2WI6 A;  2YK9 A;  1I5B A;  1YT2 A;  4XCJ A;  1I59 A;  2BTZ A;  3ZKB A;  3U67 A;  3HYZ A;  4HXW A;  4LWG A;  4X9L A;  2E0A A;  4MPC A;  2YKE A;  4LP0 A;  4KFG A;  3TUH A;  3K60 A;  1ZXN A;  1YSZ A;  3H80 A;  4MP2 A;  5CTW A;  2GQP A;  2YEB A;  3CWV A;  2YGE A;  1B63 A;  4ASB A;  2O1W A;  4URL A;  2O1V A;  3B27 A;  4HZ5 A;  3HYY A;  3Q5L A;  4ASG A;  5BOD A;  4XIP A;  3T1K A;  4PRV A;  4ASF A;  3O2F A;  4BIZ A;  1GKZ A;  2VCJ A;  4L90 A;  4ZKI A;  3QTF A;  3B26 A;  5L3J A;  3NMQ A;  2K5B A;  2YEJ A;  4H85 A;  2WI4 A;  2C1I A;  4H7Q A;  4EGK A;  4CWR A;  2QF6 A;  2YEA A;  2BZ5 A;  1GJV A;  4CE2 A;  5IDM A;  4EGI A;  4AWQ A;  2YI5 A;  1UY9 A;  2QFO A;  4CWT A;  3R4M A;  3C11 A;  3B28 A;  2FWY A;  1YS3 A;  3K99 A;  2Q8F A;  5GGZ A;  3FV5 A;  4O04 A;  3A0W A;  2HKJ A;  2IOQ A;  2XDU A;  1YT1 A;  5D7C A;  1ID0 A;  3ZXQ A;  2CCS A;  4P7A A;  3EHH A;  3OWD A;  3T0H A;  4YKX A;  3O6O A;  2EXL A;  2WI1 A;  1R62 A;  3G7E A;  4AWO A;  1TH8 A;  1UY7 A;  3T0Z A;  2FYP A;  2IWU A;  5F3K A;  4V26 A;  1UYI A;  4EEH A;  2WER A;  4L93 A;  4DZY A;  3LMM A;  4V25 A;  4MPE A;  3OMU A;  4PRX A;  4XD8 A;  1YC4 A;  2YE7 A;  2O1U A;  3GIG B;  1YC3 A;  2CGF A;  2YE2 A;  4FCP A;  3DGE A;  5M4P A;  3RKZ A;  1NHH A;  3A0Y A;  2ZDX A;  4XKA A;  2XDK A;  3ZXO A;  1JM6 A;  2VWC A;  4HYM A;  4KQV A;  3CYG A;  4H81 A;  4E01 A;  3RLR A;  1ZW9 A;  3WHA A;  5JEN A;  1A4H A;  1ZXM A;  4XIT A;  1NHJ A;  5M4H A;  2VW5 A;  4YKQ A;  4JAS A;  4E72 A;  2YEC A;  2UWD A;  4CWF A;  3TTZ A;  1BGQ A;  2YK2 A;  1KIJ A;  3Q5J A;  2HHI A;  1EA6 A;  4GT8 A;  1UYD A;  1TID A;  4WUC A;  1F51 A;  1S16 A;  3B24 A;  2YEE A;  1Z59 A;  3PEH A;  3EKR A;  4EFT A;  1AH8 A;  1H7U A;  1YES A;  4XDM A;  5IDJ A;  4BQG A;  3R4O A;  2YE4 A;  2YE6 A;  1IXM A;  4ZVI A;  2PNR A;  1I5D A;  5D6Q A;  1I5C A;  4GGL A;  3D36 A;  4XIQ A;  2WEQ A;  5FWK A;  3D2R A;  3H4L A;  3VHD A;  3BMY A;  4O09 A;  4WUD A;  1BXD A;  2BU6 A;  4BXI A;  4L94 A;  4LWE A;  2YKC A;  1Y8O A;  3EHF A;  5J6A A;  3ZKD A;  1S14 A;  4HY6 A;  1NHI A;  3D0B A;  2BU8 A;  4Q20 A;  1UYH A;  4MBC A;  4LWI A;  4MPN A;  1ZWH A;  2WEP A;  3HHU A;  5CTU A;  5M4E A;  2WI7 A;  3O0I A;  2BRC A;  2H55 A;  3A0X A;  1UYF A;  4B6C A;  2AKP A;  4XC0 A;  2WI2 A;  1UYE A;  3GIF A;  1Z5B A;  2IOP A;  1YSR A;  3U2D A;  4MB9 A;  2ESA A;  2YED A;  4XCL A;  2BRE A;  4CE1 A;  3R4N A;  4YKT A;  2BU2 A;  4URO A;  2IWX A;  1UY8 A;  2YE5 A;  4XKK A;  2XJJ A;  3INX A;  2BYH A;  1YT0 A;  4PU9 A;  1QYE A;  2CCT A;  4R3M A;  1U0Z A;  4HZ0 A;  1UYK A;  3GIG A;  5BOC A;  2H8M A;  4YKY A;  2YEG A;  3KE6 A;  1H7S A;  4DUH A;  2FXS A;  1Y4S A;  1MU5 A;  1UYG A;  4U93 A;  3R91 A;  1I58 A;  3S5T A;  5FND A;  1BKN A;  4HY1 A;  2XDX A;  2XHX A;  2YI6 A;  3LPS A;  2XX5 A;  3B25 A;  2YGA A;  4O07 A;  3TZ0 A;  4FPP A;  2HG1 A;  3QDD A;  3HEK A;  3VHA A;  4FCR A;  5FNF A;  4XKO A;  3K97 A;  2XK2 A;  3A0T A;  4EM7 A;  1UYM A;  2XX4 A;  4NH8 A;  2WI5 A;  2ZDY A;  2XD6 A;  3LNU A;  1TIL A;  2FWZ A;  1YER A;  1Z5A A;  1TC6 A;  4QPK A;  2Q8I A;  1GKX A;  4R1F A;  5IN9 A;  3EHJ A;  2YKJ A;  4JQL A;  1EI1 A;  5CTY A;  3EHG A;  3EKO A;  4GCZ A;  2YI7 A;  3OWB A;  4GQT A;  2XHT A;  2Q8G A;  4U7N A;  2YGF A;  1UY6 A;  4NH7 A;  4XE2 A;  3HZ1 A;  4BQJ A;  2CCU A;  2Q2E B;  4YKU A;  1TBW A;  2FTK A;  2IOR A;  2YJX A;  3HZ5 A;  2QG2 A; 
#chains in the Genus database with same CATH homology
 1L0O A;  3SL2 A;  2XCM A;  1OSF A;  1AMW A;  2BSM A;  2CG9 A;  2YKI A;  3VHC A;  3BM9 A;  3TZ5 A;  2IWS A;  5C93 A;  1AM1 A;  2BU7 A;  2YE9 A;  4LWH A;  4P8O A;  3K98 A;  3TZ2 A;  2YEI A;  3R92 A;  3FT5 A;  3Q5K A;  4YKR A;  5D7R A;  2JJC A;  5D7D A;  1Z5C A;  2YE3 A;  4JAU A;  3CGZ A;  2CH4 A;  3OPD A;  2YEF A;  4U7O A;  3A0R A;  5D6P A;  4B7P A;  4K4O A;  4MOT A;  1TC0 A;  3C0E A;  2YEH A;  4I5S A;  4CWN A;  3VAD A;  3CGY A;  4XIR A;  5F5R A;  3CRL A;  3WQ9 A;  4KSG A;  4KSH A;  1KZN A;  2YKB A;  5CTX A;  4O0B A;  2XDL A;  4AS9 A;  1AJ6 A;  4MP7 A;  4EMV A;  4BAE A;  4CE3 A;  4HYP A;  4URM A;  3IED A;  5CPH A;  4I3H A;  2YI0 A;  5J71 A;  1QY8 A;  1YET A;  2XJG A;  4YKZ A;  5M4M A;  2JKI A;  2WI3 A;  1PVG A;  1UYC A;  3PEJ A;  1QZR A;  4LWF A;  4XTJ A;  4JAV A;  4HXZ A;  3JZ3 A;  4GEE A;  2ZKJ A;  4QPJ A;  2C2A A;  1Y4U A;  2BYI A;  4W7T A;  5M4K A;  2VCI A;  5CF0 A;  2GFD A;  3OW6 A;  3TZ4 A;  1Y8P A;  3INW A;  4WUB A;  4EFU A;  2BU5 A;  1THN A;  1UYL A;  4FCQ A;  4BIU A;  3RLQ A;  2XX2 A;  4O05 A;  1MX0 A;  2YE8 A;  3GIE A;  4E00 A;  2XDS A;  3CRK A;  4AWP A;  1AH6 A;  4KTN A;  3MNR P;  3T2S A;  1YC1 A;  4FMT A;  4R3A A;  2HCH A;  4CWQ A;  1I5A A;  2XHR A;  3ZM7 A;  4KP4 A;  2Q8H A;  2BT0 A;  4L8Z A;  1US7 A;  2YJW A;  3FT8 A;  1B62 A;  4E02 A;  2ZBK B;  3R4P A;  4ASA A;  4CWP A;  1BYQ A;  4LPB A;  3A0Z A;  4NH9 A;  4EGH A;  1B3Q A;  3T10 A;  2XAB A;  5M4N A;  1Y8N A;  4GFN A;  3U2K A;  4CWO A;  3G75 A;  3G7B A;  3RLP A;  5FNC A;  4L91 A;  4YKW A;  2XJX A;  4PL9 A;  4CWS A;  4URN A;  1U2O A;  2QG0 A;  2WI6 A;  2YK9 A;  1I5B A;  1YT2 A;  4XCJ A;  1I59 A;  2BTZ A;  3ZKB A;  3U67 A;  3HYZ A;  4HXW A;  4LWG A;  4X9L A;  2E0A A;  4MPC A;  2YKE A;  4LP0 A;  4KFG A;  3TUH A;  3K60 A;  1ZXN A;  1YSZ A;  3H80 A;  4MP2 A;  5CTW A;  2GQP A;  2YEB A;  3CWV A;  2YGE A;  1B63 A;  4ASB A;  2O1W A;  4URL A;  2O1V A;  3B27 A;  4HZ5 A;  3HYY A;  3Q5L A;  4ASG A;  5BOD A;  4XIP A;  3T1K A;  4PRV A;  4ASF A;  3O2F A;  4BIZ A;  1GKZ A;  2VCJ A;  4L90 A;  4ZKI A;  3QTF A;  3B26 A;  5L3J A;  3NMQ A;  2K5B A;  2YEJ A;  4H85 A;  2WI4 A;  4H7Q A;  4EGK A;  4CWR A;  2QF6 A;  2YEA A;  2BZ5 A;  1GJV A;  4CE2 A;  5IDM A;  4EGI A;  4AWQ A;  2YI5 A;  1UY9 A;  2QFO A;  4CWT A;  3R4M A;  3C11 A;  3B28 A;  2FWY A;  1YS3 A;  3K99 A;  2Q8F A;  5GGZ A;  3FV5 A;  4O04 A;  3A0W A;  2HKJ A;  2IOQ A;  2XDU A;  1YT1 A;  5D7C A;  1ID0 A;  3ZXQ A;  2CCS A;  4P7A A;  3EHH A;  3OWD A;  3T0H A;  4YKX A;  3O6O A;  2EXL A;  2WI1 A;  1R62 A;  3G7E A;  4AWO A;  1TH8 A;  1UY7 A;  3T0Z A;  2FYP A;  2IWU A;  5F3K A;  4V26 A;  1UYI A;  4EEH A;  2WER A;  4L93 A;  4DZY A;  4V25 A;  4MPE A;  3OMU A;  4PRX A;  4XD8 A;  1YC4 A;  2YE7 A;  2O1U A;  3GIG B;  1YC3 A;  2CGF A;  2YE2 A;  4FCP A;  3DGE A;  5M4P A;  3RKZ A;  1NHH A;  3A0Y A;  2ZDX A;  4XKA A;  2XDK A;  3ZXO A;  1JM6 A;  2VWC A;  4HYM A;  4KQV A;  4H81 A;  4E01 A;  3RLR A;  1ZW9 A;  3WHA A;  1A4H A;  1ZXM A;  4XIT A;  1NHJ A;  5M4H A;  2VW5 A;  4YKQ A;  4JAS A;  2YEC A;  2UWD A;  4CWF A;  3TTZ A;  1BGQ A;  2YK2 A;  1KIJ A;  3Q5J A;  1EA6 A;  4GT8 A;  1UYD A;  1TID A;  4WUC A;  1S16 A;  3B24 A;  2YEE A;  1Z59 A;  3PEH A;  3EKR A;  4EFT A;  1H7U A;  1AH8 A;  1YES A;  4XDM A;  5IDJ A;  4BQG A;  3R4O A;  2YE4 A;  2YE6 A;  4ZVI A;  2PNR A;  1I5D A;  5D6Q A;  1I5C A;  4GGL A;  3D36 A;  4XIQ A;  2WEQ A;  5FWK A;  3D2R A;  3H4L A;  3VHD A;  3BMY A;  4O09 A;  4WUD A;  1BXD A;  2BU6 A;  4BXI A;  4L94 A;  4LWE A;  2YKC A;  1Y8O A;  3EHF A;  5J6A A;  3ZKD A;  1S14 A;  4HY6 A;  1NHI A;  3D0B A;  2BU8 A;  4Q20 A;  1UYH A;  4MBC A;  4LWI A;  4MPN A;  1ZWH A;  2WEP A;  3HHU A;  5CTU A;  5M4E A;  2WI7 A;  3O0I A;  2BRC A;  2H55 A;  3A0X A;  1UYF A;  4B6C A;  2AKP A;  4XC0 A;  2WI2 A;  1UYE A;  3GIF A;  1Z5B A;  2IOP A;  1YSR A;  3U2D A;  4MB9 A;  2ESA A;  2YED A;  4XCL A;  2BRE A;  4CE1 A;  3R4N A;  4YKT A;  2BU2 A;  4URO A;  2IWX A;  1UY8 A;  2YE5 A;  4XKK A;  2XJJ A;  3INX A;  2BYH A;  1YT0 A;  4PU9 A;  1QYE A;  2CCT A;  4R3M A;  1U0Z A;  4HZ0 A;  1UYK A;  3GIG A;  5BOC A;  2H8M A;  4YKY A;  2YEG A;  3KE6 A;  1H7S A;  4DUH A;  2FXS A;  1Y4S A;  1MU5 A;  1UYG A;  4U93 A;  3R91 A;  1I58 A;  5FND A;  1BKN A;  4HY1 A;  2XDX A;  2XHX A;  2YI6 A;  3LPS A;  2XX5 A;  3B25 A;  2YGA A;  4O07 A;  3TZ0 A;  4FPP A;  2HG1 A;  3QDD A;  3HEK A;  3VHA A;  4FCR A;  5FNF A;  4XKO A;  3K97 A;  2XK2 A;  3A0T A;  4EM7 A;  1UYM A;  2XX4 A;  4NH8 A;  2WI5 A;  2ZDY A;  2XD6 A;  3LNU A;  1TIL A;  2FWZ A;  1YER A;  1Z5A A;  1TC6 A;  4QPK A;  2Q8I A;  1GKX A;  4R1F A;  5IN9 A;  3EHJ A;  2YKJ A;  4JQL A;  1EI1 A;  5CTY A;  3EHG A;  3EKO A;  4GCZ A;  2YI7 A;  3OWB A;  4GQT A;  2XHT A;  2Q8G A;  4U7N A;  2YGF A;  1UY6 A;  4NH7 A;  4XE2 A;  3HZ1 A;  4BQJ A;  2CCU A;  2Q2E B;  4YKU A;  1TBW A;  2YJX A;  2IOR A;  3HZ5 A;  2QG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...