3U2KA

S. aureus gyrb atpase domain in complex with a small molecule inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
YGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolamide DNA gyrase inhibitors: fragment-based nuclear magnetic resonance screening to identify antibacterial agents.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 64
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3u2kA00
4NH8A 1GJVA 2WI5A 4WUBA 5FNCA 4CWSA 2CH4A 2WEQA 4ASAA 1ZW9A 2H55A 4XKAA 4YKQA 4YKZA 5IDJA 1UYEA 2IWUA 4AWQA 4EGHA 1UYFA 1UYCA 1YETA 3A0RA 4ZKIA 2WI3A 3R4PA 3RLQA 3ZXOA 1GKZA 3OMUA 4HXWA 2YI7A 1YT0A 2XDKA 1Y8NA 2BU7A 1UY9A 4LWGA 2JKIA 3A0TA 2BYIA 2BU6A 3TZ4A 4BXIA 4CWNA 2CG9A 4HYPA 2XHTA 2YE9A 4XC0A 4PRXA 2XDXA 5CTXA 2BU8A 5IDMA 2YEDA 3PEJA 5IN9A 2VCIA 1I5DA 3B25A 3IEDA 3A0YA 5D6PA 1I5CA 4HXZA 2QF6A 3K99A 3HYZA 4XKOA 4B6CA 1YT1A 2XCMA 1QZRA 5C93A 2CCUA 5CTWA 2XX2A 5J6AA 2Q8FA 3G75A 2YI0A 4X9LA 2HKJA 3TZ0A 5FNFA 2ESAA 3BMYA 3EKOA 3HZ5A 2XD6A 5F3KA 2YECA 4FCQA 1ZXNA 4URLA 2WI6A 1BYQA 4O07A 5M4EA 1BXDA 3CWVA 4MB9A 3T2SA 3G7BA 2O1WA 4YKUA 4BIZA 4BQJA 3QDDA 4MPEA 4PRVA 4V26A 2ZDXA 2VCJA 4CE1A 5BOCA 4BAEA 3INWA 2XDLA 4MP2A 1TILA 5L3JA 4MBCA 1S16A 3O0IA 1UYMA 4DUHA 1YERA 1YESA 1QY8A 2HCHA 1ZXMA 3QTFA 2WI2A 3R92A 3RLRA 1UYHA 2BRCA 2BYHA 1A4HA 3CRLA 1UYGA 3H80A 5M4KA 5M4MA 4HY1A 2ZBKB 3B27A 4H81A 3HZ1A 4XITA 1ID0A 2Q8GA 4K4OA 4ASBA 2WERA 4GQTA 4CWQA 3LPSA 3K60A 2YI6A 2YK9A 2JJCA 1Y4SA 4L93A 2QG0A 1ZWHA 2XHRA 4EFUA 2YEFA 4H85A 1AH6A 2WI4A 3B26A 3EHGA 3R91A 4I5SA 2YEGA 2QFOA 4XCLA 3Q5LA 3TUHA 4GEEA 2YI5A 1I5AA 2FYPA 2O1UA 1YT2A 3GIGB 4JAUA 1B3QA 3VHCA 2BSMA 4HZ5A 1EA6A 1AJ6A 4KTNA 4MPCA 2YJWA 2BT0A 4MP7A 4LWIA 2XK2A 4LWFA 1YSRA 2O1VA 3K97A 4I3HA 3O2FA 1UYLA 4WUDA 2YE5A 4WUCA 1Z5BA 3EHFA 3OWDA 2IWXA 4GGLA 1KIJA 1GKXA 2YE8A 4FCRA 3GIEA 2Q8HA 1YC3A 4KSGA 4L90A 3T0HA 2IORA 3FT5A 3PEHA 1H7SA 2XDUA 3WHAA 4MPNA 4LPBA 4EMVA 4ASGA 2YEBA 3CGZA 2CCTA 1TC6A 2BREA 2EXLA 2YEAA 1US7A 2YKBA 4CE2A 3A0XA 4AS9A 4KFGA 4XTJA 2YGFA 4HYMA 1NHHA 3FT8A 3GIGA 4O09A 1NHJA 2YEHA 3T10A 4JQLA 4MOTA 4H7QA 5CPHA 2Q8IA 1YS3A 2YGEA 4EFTA 1AM1A 5M4PA 1NHIA 3C0EA 4CWRA 4LWEA 1UYKA 3VHDA 1BGQA 3TZ5A 2XABA 2YKCA 3MNRP 2VWCA 3CGYA 2WEPA 2UWDA 3FV5A 2GQPA 2ZKJA 4CE3A 3B24A 1Z5AA 2WI7A 3EKRA 4E00A 1B62A 4B7PA 3C11A 3VHAA 2IOQA 1UY8A 3Q5JA 2Q2EB 3U2KA 4ASFA 2IOPA 4PL9A 3OW6A 4HY6A 1JM6A 1QYEA 4UROA 4LP0A 1TH8A 4XKKA 4KP4A 5D6QA 4URMA 1YSZA 1Y8OA 2YKJA 2BTZA 2H8MA 2XJJA 1MU5A 1R62A 3U67A 1L0OA 2YE7A 4XDMA 1BKNA 4HZ0A 4QPKA 1Y8PA 2GFDA 4U7OA 4GT8A 4YKXA 1EI1A 1B63A 4GCZA 3R4NA 3ZKBA 3H4LA 5CTYA 4EGIA 2YGAA 4P7AA 2YE3A 5F5RA 5BODA 4EM7A 4W7TA 4ZVIA 5D7CA 5FNDA 4O05A 1U0ZA 3K98A 2YJXA 4EEHA 3BM9A 4PU9A 2XJXA 2YEJA 1KZNA 4AWOA 4E01A 4JAVA 1UY6A 2BU2A 4AWPA 4YKTA 1MX0A 1I59A 3B28A 4EGKA 5GGZA 1Z59A 4KQVA 1I5BA 3Q5KA 1AH8A 4R1FA 3D2RA 4KSHA 3U2DA 3CRKA 2YEIA 2C2AA 3HEKA 2YE6A 3T1KA 3EHHA 4R3MA 2IWSA 3R4MA 3DGEA 1I58A 1TBWA 3HYYA 4BQGA 4Q20A 3ZM7A 3WQ9A 4YKRA 1UY7A 4XIPA 4XE2A 3SL2A 4L91A 4R3AA 3KE6A 5M4HA 3HHUA 1YC4A 5J71A 4V25A 2CGFA 2K5BA 2XJGA 3LNUA 1S14A 2QG2A 4FMTA 1YC1A 4FPPA 4XD8A 3ZKDA 4YKYA 4E02A 5FWKA 2FXSA 3EHJA 1UYDA 2BZ5A 4L8ZA 1OSFA 3R4OA 3INXA 4NH9A 4BIUA 4CWPA 3A0ZA 3D36A 4L94A 3GIFA 4GFNA 2HG1A 2AKPA 2YKEA 4CWOA 4CWFA 2XX5A 4XIQA 1U2OA 3RLPA 2FWZA 4U7NA 4URNA 3T0ZA 4XCJA 4NH7A 1Z5CA 3A0WA 1THNA 2XHXA 5D7DA 2PNRA 2YK2A 3D0BA 3O6OA 1UYIA 3VADA 3TTZA 3OWBA 4LWHA 3NMQA 3JZ3A 3TZ2A 2XDSA 2YE2A 4CWTA 2WI1A 4O04A 4XIRA 4FCPA 3G7EA 4O0BA 4JASA 2FWYA 3RKZA 1H7UA 5CF0A 2E0AA 4YKWA 4QPJA 1TC0A 2CCSA 5D7RA 1AMWA 2BU5A 5M4NA 2YKIA 2YEEA 3ZXQA 2ZDYA 1PVGA 3OPDA 4P8OA 2VW5A 1TIDA 5CTUA 4DZYA 2XX4A 4U93A 2YE4A 1Y4UA
chains in the Genus database with same CATH superfamily
4NH8A 1GJVA 2WI5A 4WUBA 5FNCA 4CWSA 2CH4A 2WEQA 4ASAA 1ZW9A 2H55A 4XKAA 4YKQA 4YKZA 5IDJA 1UYEA 2IWUA 4AWQA 4EGHA 1UYFA 1UYCA 1YETA 3A0RA 4ZKIA 2WI3A 3R4PA 3RLQA 3ZXOA 1GKZA 3OMUA 4HXWA 2YI7A 1YT0A 2XDKA 1Y8NA 2BU7A 1UY9A 4LWGA 2JKIA 3A0TA 2BYIA 2BU6A 3TZ4A 4BXIA 4CWNA 3CYGA 2CG9A 4HYPA 2XHTA 2YE9A 4XC0A 4PRXA 2XDXA 5CTXA 2BU8A 5IDMA 2YEDA 3PEJA 5IN9A 2VCIA 1I5DA 3B25A 3IEDA 3A0YA 5D6PA 1I5CA 4HXZA 2QF6A 3K99A 3HYZA 4XKOA 4B6CA 1YT1A 2XCMA 1QZRA 5C93A 2CCUA 5CTWA 2XX2A 5J6AA 2Q8FA 3G75A 2YI0A 4X9LA 2HKJA 3TZ0A 5FNFA 2ESAA 3BMYA 3EKOA 3HZ5A 2XD6A 5F3KA 2YECA 4FCQA 1ZXNA 4URLA 2WI6A 1BYQA 4O07A 5M4EA 1BXDA 3CWVA 4MB9A 3T2SA 3G7BA 2O1WA 5JENA 4YKUA 4BIZA 4BQJA 3QDDA 4E72A 4MPEA 4PRVA 4V26A 2ZDXA 2VCJA 4CE1A 5BOCA 4BAEA 3INWA 2XDLA 4MP2A 1TILA 5L3JA 4MBCA 1S16A 3O0IA 1UYMA 4DUHA 1YERA 1YESA 1QY8A 2HCHA 1ZXMA 3QTFA 2WI2A 3R92A 3RLRA 1UYHA 2BRCA 2BYHA 1A4HA 3CRLA 1UYGA 3H80A 5M4KA 5M4MA 4HY1A 2ZBKB 3B27A 4H81A 3HZ1A 4XITA 1ID0A 2Q8GA 4K4OA 4ASBA 2WERA 4GQTA 4CWQA 3LPSA 3K60A 2YI6A 2YK9A 2JJCA 1Y4SA 4L93A 3S5TA 2QG0A 1ZWHA 2XHRA 4EFUA 2YEFA 4H85A 1AH6A 2WI4A 3B26A 3EHGA 3R91A 4I5SA 2YEGA 2QFOA 4XCLA 3Q5LA 3TUHA 4GEEA 2YI5A 1I5AA 2FYPA 2O1UA 1YT2A 3GIGB 4JAUA 1B3QA 3VHCA 2BSMA 4HZ5A 1EA6A 1AJ6A 4KTNA 4MPCA 2YJWA 2BT0A 4MP7A 4LWIA 2XK2A 4LWFA 1YSRA 2O1VA 3K97A 4I3HA 3O2FA 1UYLA 4WUDA 2YE5A 4WUCA 1Z5BA 3EHFA 3OWDA 2IWXA 4GGLA 1KIJA 1GKXA 2YE8A 4FCRA 3GIEA 2Q8HA 1YC3A 4KSGA 4L90A 3T0HA 2IORA 3FT5A 3PEHA 1IXMA 1H7SA 1F51A 2FTKA 2XDUA 3WHAA 4MPNA 4LPBA 4EMVA 4ASGA 2YEBA 3CGZA 2CCTA 1TC6A 2BREA 2EXLA 2YEAA 1US7A 2YKBA 4CE2A 3A0XA 4AS9A 4KFGA 4XTJA 2YGFA 3LMMA 4HYMA 1NHHA 3FT8A 3GIGA 4O09A 1NHJA 2YEHA 3T10A 4JQLA 4MOTA 4H7QA 5CPHA 2Q8IA 1YS3A 2YGEA 4EFTA 1AM1A 5M4PA 1NHIA 3C0EA 4CWRA 4LWEA 1UYKA 3VHDA 1BGQA 3TZ5A 2XABA 2YKCA 3MNRP 2VWCA 3CGYA 2WEPA 2UWDA 3FV5A 2GQPA 2ZKJA 4CE3A 3B24A 1Z5AA 2WI7A 3EKRA 4E00A 1B62A 4B7PA 3C11A 3VHAA 2IOQA 1UY8A 3Q5JA 2Q2EB 3U2KA 4ASFA 2IOPA 4PL9A 3OW6A 4HY6A 1JM6A 1QYEA 4UROA 4LP0A 1TH8A 4XKKA 4KP4A 5D6QA 4URMA 1YSZA 1Y8OA 2YKJA 2BTZA 2H8MA 2XJJA 1MU5A 1R62A 3U67A 1L0OA 2YE7A 4XDMA 1BKNA 4HZ0A 4QPKA 1Y8PA 2GFDA 4U7OA 4GT8A 4YKXA 1EI1A 1B63A 4GCZA 3R4NA 3ZKBA 3H4LA 5CTYA 4EGIA 2YGAA 4P7AA 2HHIA 2YE3A 5F5RA 5BODA 4EM7A 4W7TA 4ZVIA 5D7CA 5FNDA 4O05A 1U0ZA 3K98A 2YJXA 2C1IA 4EEHA 3BM9A 4PU9A 2XJXA 2YEJA 1KZNA 4AWOA 4E01A 4JAVA 1UY6A 2BU2A 4AWPA 4YKTA 1MX0A 1I59A 3B28A 4EGKA 5GGZA 1Z59A 4KQVA 1I5BA 3Q5KA 1AH8A 4R1FA 3D2RA 4KSHA 3U2DA 3CRKA 2YEIA 2C2AA 3HEKA 2YE6A 3T1KA 3EHHA 4R3MA 2IWSA 3R4MA 3DGEA 1I58A 1TBWA 3HYYA 4BQGA 4Q20A 3ZM7A 3WQ9A 4YKRA 1UY7A 4XIPA 4XE2A 3SL2A 4L91A 4R3AA 3KE6A 5M4HA 3HHUA 1YC4A 5J71A 4V25A 2CGFA 2K5BA 2XJGA 3LNUA 1S14A 2QG2A 4FMTA 1YC1A 4FPPA 4XD8A 3ZKDA 4YKYA 4E02A 5FWKA 2FXSA 3EHJA 1UYDA 2BZ5A 4L8ZA 1OSFA 3R4OA 3INXA 4NH9A 4BIUA 4CWPA 3A0ZA 3D36A 4L94A 3GIFA 4GFNA 2HG1A 2AKPA 2YKEA 4CWOA 4CWFA 2XX5A 4XIQA 1U2OA 3RLPA 2FWZA 4U7NA 4URNA 3T0ZA 4XCJA 4NH7A 1Z5CA 3A0WA 1THNA 2XHXA 5D7DA 2PNRA 2YK2A 3D0BA 3O6OA 1UYIA 3VADA 3TTZA 3OWBA 4LWHA 3NMQA 3JZ3A 3TZ2A 2XDSA 2YE2A 4CWTA 2WI1A 4O04A 4XIRA 4FCPA 3G7EA 4O0BA 4JASA 2FWYA 3RKZA 1H7UA 5CF0A 2E0AA 4YKWA 4QPJA 1TC0A 2CCSA 5D7RA 1AMWA 2BU5A 5M4NA 2YKIA 2YEEA 3ZXQA 2ZDYA 1PVGA 3OPDA 4P8OA 2VW5A 1TIDA 5CTUA 2C1GA 4DZYA 2XX4A 4U93A 2YE4A 1Y4UA
chains in the Genus database with same CATH topology
4NH8A 1GJVA 2WI5A 4WUBA 5FNCA 4CWSA 2CH4A 2WEQA 4ASAA 1ZW9A 2H55A 4XKAA 4YKQA 4YKZA 5IDJA 1UYEA 2IWUA 4AWQA 4EGHA 1UYFA 1UYCA 1YETA 3A0RA 4ZKIA 2WI3A 3R4PA 3RLQA 3ZXOA 1GKZA 3OMUA 4HXWA 2YI7A 1YT0A 2XDKA 1Y8NA 2BU7A 1UY9A 4LWGA 2JKIA 3A0TA 2BYIA 2BU6A 3TZ4A 4BXIA 4CWNA 2CG9A 4HYPA 2XHTA 2YE9A 4XC0A 4PRXA 2XDXA 5CTXA 2BU8A 5IDMA 2YEDA 3PEJA 5IN9A 2VCIA 1I5DA 3B25A 3IEDA 3A0YA 5D6PA 1I5CA 4HXZA 2QF6A 3K99A 3HYZA 4XKOA 4B6CA 1YT1A 2XCMA 1QZRA 5C93A 2CCUA 5CTWA 2XX2A 5J6AA 2Q8FA 3G75A 2YI0A 4X9LA 2HKJA 3TZ0A 5FNFA 2ESAA 3BMYA 3EKOA 3HZ5A 2XD6A 5F3KA 2YECA 4FCQA 1ZXNA 4URLA 2WI6A 1BYQA 4O07A 5M4EA 1BXDA 3CWVA 4MB9A 3T2SA 3G7BA 2O1WA 4YKUA 4BIZA 4BQJA 3QDDA 4MPEA 4PRVA 4V26A 2ZDXA 2VCJA 4CE1A 5BOCA 4BAEA 3INWA 2XDLA 4MP2A 1TILA 5L3JA 4MBCA 1S16A 3O0IA 1UYMA 4DUHA 1YERA 1YESA 1QY8A 2HCHA 1ZXMA 3QTFA 2WI2A 3R92A 3RLRA 1UYHA 2BRCA 2BYHA 1A4HA 3CRLA 1UYGA 3H80A 5M4KA 5M4MA 4HY1A 2ZBKB 3B27A 4H81A 3HZ1A 4XITA 1ID0A 2Q8GA 4K4OA 4ASBA 2WERA 4GQTA 4CWQA 3LPSA 3K60A 2YI6A 2YK9A 2JJCA 1Y4SA 4L93A 2QG0A 1ZWHA 2XHRA 4EFUA 2YEFA 4H85A 1AH6A 2WI4A 3B26A 3EHGA 3R91A 4I5SA 2YEGA 2QFOA 4XCLA 3Q5LA 3TUHA 4GEEA 2YI5A 1I5AA 2FYPA 2O1UA 1YT2A 3GIGB 4JAUA 1B3QA 3VHCA 2BSMA 4HZ5A 1EA6A 1AJ6A 4KTNA 4MPCA 2YJWA 2BT0A 4MP7A 4LWIA 2XK2A 4LWFA 1YSRA 2O1VA 3K97A 4I3HA 3O2FA 1UYLA 4WUDA 2YE5A 4WUCA 1Z5BA 3EHFA 3OWDA 2IWXA 4GGLA 1KIJA 1GKXA 2YE8A 4FCRA 3GIEA 2Q8HA 1YC3A 4KSGA 4L90A 3T0HA 2IORA 3FT5A 3PEHA 1H7SA 2XDUA 3WHAA 4MPNA 4LPBA 4EMVA 4ASGA 2YEBA 3CGZA 2CCTA 1TC6A 2BREA 2EXLA 2YEAA 1US7A 2YKBA 4CE2A 3A0XA 4AS9A 4KFGA 4XTJA 2YGFA 4HYMA 1NHHA 3FT8A 3GIGA 4O09A 1NHJA 2YEHA 3T10A 4JQLA 4MOTA 4H7QA 5CPHA 2Q8IA 1YS3A 2YGEA 4EFTA 1AM1A 5M4PA 1NHIA 3C0EA 4CWRA 4LWEA 1UYKA 3VHDA 1BGQA 3TZ5A 2XABA 2YKCA 3MNRP 2VWCA 3CGYA 2WEPA 2UWDA 3FV5A 2GQPA 2ZKJA 4CE3A 3B24A 1Z5AA 2WI7A 3EKRA 4E00A 1B62A 4B7PA 3C11A 3VHAA 2IOQA 1UY8A 3Q5JA 2Q2EB 3U2KA 4ASFA 2IOPA 4PL9A 3OW6A 4HY6A 1JM6A 1QYEA 4UROA 4LP0A 1TH8A 4XKKA 4KP4A 5D6QA 4URMA 1YSZA 1Y8OA 2YKJA 2BTZA 2H8MA 2XJJA 1MU5A 1R62A 3U67A 1L0OA 2YE7A 4XDMA 1BKNA 4HZ0A 4QPKA 1Y8PA 2GFDA 4U7OA 4GT8A 4YKXA 1EI1A 1B63A 4GCZA 3R4NA 3ZKBA 3H4LA 5CTYA 4EGIA 2YGAA 4P7AA 2YE3A 5F5RA 5BODA 4EM7A 4W7TA 4ZVIA 5D7CA 5FNDA 4O05A 1U0ZA 3K98A 2YJXA 4EEHA 3BM9A 4PU9A 2XJXA 2YEJA 1KZNA 4AWOA 4E01A 4JAVA 1UY6A 2BU2A 4AWPA 4YKTA 1MX0A 1I59A 3B28A 4EGKA 5GGZA 1Z59A 4KQVA 1I5BA 3Q5KA 1AH8A 4R1FA 3D2RA 4KSHA 3U2DA 3CRKA 2YEIA 2C2AA 3HEKA 2YE6A 3T1KA 3EHHA 4R3MA 2IWSA 3R4MA 3DGEA 1I58A 1TBWA 3HYYA 4BQGA 4Q20A 3ZM7A 3WQ9A 4YKRA 1UY7A 4XIPA 4XE2A 3SL2A 4L91A 4R3AA 3KE6A 5M4HA 3HHUA 1YC4A 5J71A 4V25A 2CGFA 2K5BA 2XJGA 3LNUA 1S14A 2QG2A 4FMTA 1YC1A 4FPPA 4XD8A 3ZKDA 4YKYA 4E02A 5FWKA 2FXSA 3EHJA 1UYDA 2BZ5A 4L8ZA 1OSFA 3R4OA 3INXA 4NH9A 4BIUA 4CWPA 3A0ZA 3D36A 4L94A 3GIFA 4GFNA 2HG1A 2AKPA 2YKEA 4CWOA 4CWFA 2XX5A 4XIQA 1U2OA 3RLPA 2FWZA 4U7NA 4URNA 3T0ZA 4XCJA 4NH7A 1Z5CA 3A0WA 1THNA 2XHXA 5D7DA 2PNRA 2YK2A 3D0BA 3O6OA 1UYIA 3VADA 3TTZA 3OWBA 4LWHA 3NMQA 3JZ3A 3TZ2A 2XDSA 2YE2A 4CWTA 2WI1A 4O04A 4XIRA 4FCPA 3G7EA 4O0BA 4JASA 2FWYA 3RKZA 1H7UA 5CF0A 2E0AA 4YKWA 4QPJA 1TC0A 2CCSA 5D7RA 1AMWA 2BU5A 5M4NA 2YKIA 2YEEA 3ZXQA 2ZDYA 1PVGA 3OPDA 4P8OA 2VW5A 1TIDA 5CTUA 4DZYA 2XX4A 4U93A 2YE4A 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH8 A;  1GJV A;  2WI5 A;  4WUB A;  5FNC A;  4CWS A;  2CH4 A;  2WEQ A;  4ASA A;  1ZW9 A;  2H55 A;  4XKA A;  4YKQ A;  4YKZ A;  5IDJ A;  1UYE A;  2IWU A;  4AWQ A;  4EGH A;  1UYF A;  1UYC A;  1YET A;  3A0R A;  4ZKI A;  2WI3 A;  3R4P A;  3RLQ A;  3ZXO A;  1GKZ A;  3OMU A;  4HXW A;  2YI7 A;  1YT0 A;  2XDK A;  1Y8N A;  2BU7 A;  1UY9 A;  4LWG A;  2JKI A;  3A0T A;  2BYI A;  2BU6 A;  3TZ4 A;  4BXI A;  4CWN A;  2CG9 A;  4HYP A;  2XHT A;  2YE9 A;  4XC0 A;  4PRX A;  2XDX A;  5CTX A;  2BU8 A;  5IDM A;  2YED A;  3PEJ A;  5IN9 A;  2VCI A;  1I5D A;  3B25 A;  3IED A;  3A0Y A;  5D6P A;  1I5C A;  4HXZ A;  2QF6 A;  3K99 A;  3HYZ A;  4XKO A;  4B6C A;  1YT1 A;  2XCM A;  1QZR A;  5C93 A;  2CCU A;  5CTW A;  2XX2 A;  5J6A A;  2Q8F A;  3G75 A;  2YI0 A;  4X9L A;  2HKJ A;  3TZ0 A;  5FNF A;  2ESA A;  3BMY A;  3EKO A;  3HZ5 A;  2XD6 A;  5F3K A;  2YEC A;  4FCQ A;  1ZXN A;  4URL A;  2WI6 A;  1BYQ A;  4O07 A;  5M4E A;  1BXD A;  3CWV A;  4MB9 A;  3T2S A;  3G7B A;  2O1W A;  4YKU A;  4BIZ A;  4BQJ A;  3QDD A;  4MPE A;  4PRV A;  4V26 A;  2ZDX A;  2VCJ A;  4CE1 A;  5BOC A;  4BAE A;  3INW A;  2XDL A;  4MP2 A;  1TIL A;  5L3J A;  4MBC A;  1S16 A;  3O0I A;  1UYM A;  4DUH A;  1YER A;  1YES A;  1QY8 A;  2HCH A;  1ZXM A;  3QTF A;  2WI2 A;  3R92 A;  3RLR A;  1UYH A;  2BRC A;  2BYH A;  1A4H A;  3CRL A;  1UYG A;  3H80 A;  5M4K A;  5M4M A;  4HY1 A;  2ZBK B;  3B27 A;  4H81 A;  3HZ1 A;  4XIT A;  1ID0 A;  2Q8G A;  4K4O A;  4ASB A;  2WER A;  4GQT A;  4CWQ A;  3LPS A;  3K60 A;  2YI6 A;  2YK9 A;  2JJC A;  1Y4S A;  4L93 A;  2QG0 A;  1ZWH A;  2XHR A;  4EFU A;  2YEF A;  4H85 A;  1AH6 A;  2WI4 A;  3B26 A;  3EHG A;  3R91 A;  4I5S A;  2YEG A;  2QFO A;  4XCL A;  3Q5L A;  3TUH A;  4GEE A;  2YI5 A;  1I5A A;  2FYP A;  2O1U A;  1YT2 A;  3GIG B;  4JAU A;  1B3Q A;  3VHC A;  2BSM A;  4HZ5 A;  1EA6 A;  1AJ6 A;  4KTN A;  4MPC A;  2YJW A;  2BT0 A;  4MP7 A;  4LWI A;  2XK2 A;  4LWF A;  1YSR A;  2O1V A;  3K97 A;  4I3H A;  3O2F A;  1UYL A;  4WUD A;  2YE5 A;  4WUC A;  1Z5B A;  3EHF A;  3OWD A;  2IWX A;  4GGL A;  1KIJ A;  1GKX A;  2YE8 A;  4FCR A;  3GIE A;  2Q8H A;  1YC3 A;  4KSG A;  4L90 A;  3T0H A;  2IOR A;  3FT5 A;  3PEH A;  1H7S A;  2XDU A;  3WHA A;  4MPN A;  4LPB A;  4EMV A;  4ASG A;  2YEB A;  3CGZ A;  2CCT A;  1TC6 A;  2BRE A;  2EXL A;  2YEA A;  1US7 A;  2YKB A;  4CE2 A;  3A0X A;  4AS9 A;  4KFG A;  4XTJ A;  2YGF A;  4HYM A;  1NHH A;  3FT8 A;  3GIG A;  4O09 A;  1NHJ A;  2YEH A;  3T10 A;  4JQL A;  4MOT A;  4H7Q A;  5CPH A;  2Q8I A;  1YS3 A;  2YGE A;  4EFT A;  1AM1 A;  5M4P A;  1NHI A;  3C0E A;  4CWR A;  4LWE A;  1UYK A;  3VHD A;  1BGQ A;  3TZ5 A;  2XAB A;  2YKC A;  3MNR P;  2VWC A;  3CGY A;  2WEP A;  2UWD A;  3FV5 A;  2GQP A;  2ZKJ A;  4CE3 A;  3B24 A;  1Z5A A;  2WI7 A;  3EKR A;  4E00 A;  1B62 A;  4B7P A;  3C11 A;  3VHA A;  2IOQ A;  1UY8 A;  3Q5J A;  2Q2E B;  3U2K A;  4ASF A;  2IOP A;  4PL9 A;  3OW6 A;  4HY6 A;  1JM6 A;  1QYE A;  4URO A;  4LP0 A;  1TH8 A;  4XKK A;  4KP4 A;  5D6Q A;  4URM A;  1YSZ A;  1Y8O A;  2YKJ A;  2BTZ A;  2H8M A;  2XJJ A;  1MU5 A;  1R62 A;  3U67 A;  1L0O A;  2YE7 A;  4XDM A;  1BKN A;  4HZ0 A;  4QPK A;  1Y8P A;  2GFD A;  4U7O A;  4GT8 A;  4YKX A;  1EI1 A;  1B63 A;  4GCZ A;  3R4N A;  3ZKB A;  3H4L A;  5CTY A;  4EGI A;  2YGA A;  4P7A A;  2YE3 A;  5F5R A;  5BOD A;  4EM7 A;  4W7T A;  4ZVI A;  5D7C A;  5FND A;  4O05 A;  1U0Z A;  3K98 A;  2YJX A;  4EEH A;  3BM9 A;  4PU9 A;  2XJX A;  2YEJ A;  1KZN A;  4AWO A;  4E01 A;  4JAV A;  1UY6 A;  2BU2 A;  4AWP A;  4YKT A;  1MX0 A;  1I59 A;  3B28 A;  4EGK A;  5GGZ A;  1Z59 A;  4KQV A;  1I5B A;  3Q5K A;  1AH8 A;  4R1F A;  3D2R A;  4KSH A;  3U2D A;  3CRK A;  2YEI A;  2C2A A;  3HEK A;  2YE6 A;  3T1K A;  3EHH A;  4R3M A;  2IWS A;  3R4M A;  3DGE A;  1I58 A;  1TBW A;  3HYY A;  4BQG A;  4Q20 A;  3ZM7 A;  3WQ9 A;  4YKR A;  1UY7 A;  4XIP A;  4XE2 A;  3SL2 A;  4L91 A;  4R3A A;  3KE6 A;  5M4H A;  3HHU A;  1YC4 A;  5J71 A;  4V25 A;  2CGF A;  2K5B A;  2XJG A;  3LNU A;  1S14 A;  2QG2 A;  4FMT A;  1YC1 A;  4FPP A;  4XD8 A;  3ZKD A;  4YKY A;  4E02 A;  5FWK A;  2FXS A;  3EHJ A;  1UYD A;  2BZ5 A;  4L8Z A;  1OSF A;  3R4O A;  3INX A;  4NH9 A;  4BIU A;  4CWP A;  3A0Z A;  3D36 A;  4L94 A;  3GIF A;  4GFN A;  2HG1 A;  2AKP A;  2YKE A;  4CWO A;  4CWF A;  2XX5 A;  4XIQ A;  1U2O A;  3RLP A;  2FWZ A;  4U7N A;  4URN A;  3T0Z A;  4XCJ A;  4NH7 A;  1Z5C A;  3A0W A;  1THN A;  2XHX A;  5D7D A;  2PNR A;  2YK2 A;  3D0B A;  3O6O A;  1UYI A;  3VAD A;  3TTZ A;  3OWB A;  4LWH A;  3NMQ A;  3JZ3 A;  3TZ2 A;  2XDS A;  2YE2 A;  4CWT A;  2WI1 A;  4O04 A;  4XIR A;  4FCP A;  3G7E A;  4O0B A;  4JAS A;  2FWY A;  3RKZ A;  1H7U A;  5CF0 A;  2E0A A;  4YKW A;  4QPJ A;  1TC0 A;  2CCS A;  5D7R A;  1AMW A;  2BU5 A;  5M4N A;  2YKI A;  2YEE A;  3ZXQ A;  2ZDY A;  1PVG A;  3OPD A;  4P8O A;  2VW5 A;  1TID A;  5CTU A;  4DZY A;  2XX4 A;  4U93 A;  2YE4 A;  1Y4U A; 
#chains in the Genus database with same CATH topology
 4NH8 A;  1GJV A;  2WI5 A;  4WUB A;  5FNC A;  4CWS A;  2CH4 A;  2WEQ A;  4ASA A;  1ZW9 A;  2H55 A;  4XKA A;  4YKQ A;  4YKZ A;  5IDJ A;  1UYE A;  2IWU A;  4AWQ A;  4EGH A;  1UYF A;  1UYC A;  1YET A;  3A0R A;  4ZKI A;  2WI3 A;  3R4P A;  3RLQ A;  3ZXO A;  1GKZ A;  3OMU A;  4HXW A;  2YI7 A;  1YT0 A;  2XDK A;  1Y8N A;  2BU7 A;  1UY9 A;  4LWG A;  2JKI A;  3A0T A;  2BYI A;  2BU6 A;  3TZ4 A;  4BXI A;  4CWN A;  3CYG A;  2CG9 A;  4HYP A;  2XHT A;  2YE9 A;  4XC0 A;  4PRX A;  2XDX A;  5CTX A;  2BU8 A;  5IDM A;  2YED A;  3PEJ A;  5IN9 A;  2VCI A;  1I5D A;  3B25 A;  3IED A;  3A0Y A;  5D6P A;  1I5C A;  4HXZ A;  2QF6 A;  3K99 A;  3HYZ A;  4XKO A;  4B6C A;  1YT1 A;  2XCM A;  1QZR A;  5C93 A;  2CCU A;  5CTW A;  2XX2 A;  5J6A A;  2Q8F A;  3G75 A;  2YI0 A;  4X9L A;  2HKJ A;  3TZ0 A;  5FNF A;  2ESA A;  3BMY A;  3EKO A;  3HZ5 A;  2XD6 A;  5F3K A;  2YEC A;  4FCQ A;  1ZXN A;  4URL A;  2WI6 A;  1BYQ A;  4O07 A;  5M4E A;  1BXD A;  3CWV A;  4MB9 A;  3T2S A;  3G7B A;  2O1W A;  5JEN A;  4YKU A;  4BIZ A;  4BQJ A;  3QDD A;  4E72 A;  4MPE A;  4PRV A;  4V26 A;  2ZDX A;  2VCJ A;  4CE1 A;  5BOC A;  4BAE A;  3INW A;  2XDL A;  4MP2 A;  1TIL A;  5L3J A;  4MBC A;  1S16 A;  3O0I A;  1UYM A;  4DUH A;  1YER A;  1YES A;  1QY8 A;  2HCH A;  1ZXM A;  3QTF A;  2WI2 A;  3R92 A;  3RLR A;  1UYH A;  2BRC A;  2BYH A;  1A4H A;  3CRL A;  1UYG A;  3H80 A;  5M4K A;  5M4M A;  4HY1 A;  2ZBK B;  3B27 A;  4H81 A;  3HZ1 A;  4XIT A;  1ID0 A;  2Q8G A;  4K4O A;  4ASB A;  2WER A;  4GQT A;  4CWQ A;  3LPS A;  3K60 A;  2YI6 A;  2YK9 A;  2JJC A;  1Y4S A;  4L93 A;  3S5T A;  2QG0 A;  1ZWH A;  2XHR A;  4EFU A;  2YEF A;  4H85 A;  1AH6 A;  2WI4 A;  3B26 A;  3EHG A;  3R91 A;  4I5S A;  2YEG A;  2QFO A;  4XCL A;  3Q5L A;  3TUH A;  4GEE A;  2YI5 A;  1I5A A;  2FYP A;  2O1U A;  1YT2 A;  3GIG B;  4JAU A;  1B3Q A;  3VHC A;  2BSM A;  4HZ5 A;  1EA6 A;  1AJ6 A;  4KTN A;  4MPC A;  2YJW A;  2BT0 A;  4MP7 A;  4LWI A;  2XK2 A;  4LWF A;  1YSR A;  2O1V A;  3K97 A;  4I3H A;  3O2F A;  1UYL A;  4WUD A;  2YE5 A;  4WUC A;  1Z5B A;  3EHF A;  3OWD A;  2IWX A;  4GGL A;  1KIJ A;  1GKX A;  2YE8 A;  4FCR A;  3GIE A;  2Q8H A;  1YC3 A;  4KSG A;  4L90 A;  3T0H A;  2IOR A;  3FT5 A;  3PEH A;  1IXM A;  1H7S A;  1F51 A;  2FTK A;  2XDU A;  3WHA A;  4MPN A;  4LPB A;  4EMV A;  4ASG A;  2YEB A;  3CGZ A;  2CCT A;  1TC6 A;  2BRE A;  2EXL A;  2YEA A;  1US7 A;  2YKB A;  4CE2 A;  3A0X A;  4AS9 A;  4KFG A;  4XTJ A;  2YGF A;  3LMM A;  4HYM A;  1NHH A;  3FT8 A;  3GIG A;  4O09 A;  1NHJ A;  2YEH A;  3T10 A;  4JQL A;  4MOT A;  4H7Q A;  5CPH A;  2Q8I A;  1YS3 A;  2YGE A;  4EFT A;  1AM1 A;  5M4P A;  1NHI A;  3C0E A;  4CWR A;  4LWE A;  1UYK A;  3VHD A;  1BGQ A;  3TZ5 A;  2XAB A;  2YKC A;  3MNR P;  2VWC A;  3CGY A;  2WEP A;  2UWD A;  3FV5 A;  2GQP A;  2ZKJ A;  4CE3 A;  3B24 A;  1Z5A A;  2WI7 A;  3EKR A;  4E00 A;  1B62 A;  4B7P A;  3C11 A;  3VHA A;  2IOQ A;  1UY8 A;  3Q5J A;  2Q2E B;  3U2K A;  4ASF A;  2IOP A;  4PL9 A;  3OW6 A;  4HY6 A;  1JM6 A;  1QYE A;  4URO A;  4LP0 A;  1TH8 A;  4XKK A;  4KP4 A;  5D6Q A;  4URM A;  1YSZ A;  1Y8O A;  2YKJ A;  2BTZ A;  2H8M A;  2XJJ A;  1MU5 A;  1R62 A;  3U67 A;  1L0O A;  2YE7 A;  4XDM A;  1BKN A;  4HZ0 A;  4QPK A;  1Y8P A;  2GFD A;  4U7O A;  4GT8 A;  4YKX A;  1EI1 A;  1B63 A;  4GCZ A;  3R4N A;  3ZKB A;  3H4L A;  5CTY A;  4EGI A;  2YGA A;  4P7A A;  2HHI A;  2YE3 A;  5F5R A;  5BOD A;  4EM7 A;  4W7T A;  4ZVI A;  5D7C A;  5FND A;  4O05 A;  1U0Z A;  3K98 A;  2YJX A;  2C1I A;  4EEH A;  3BM9 A;  4PU9 A;  2XJX A;  2YEJ A;  1KZN A;  4AWO A;  4E01 A;  4JAV A;  1UY6 A;  2BU2 A;  4AWP A;  4YKT A;  1MX0 A;  1I59 A;  3B28 A;  4EGK A;  5GGZ A;  1Z59 A;  4KQV A;  1I5B A;  3Q5K A;  1AH8 A;  4R1F A;  3D2R A;  4KSH A;  3U2D A;  3CRK A;  2YEI A;  2C2A A;  3HEK A;  2YE6 A;  3T1K A;  3EHH A;  4R3M A;  2IWS A;  3R4M A;  3DGE A;  1I58 A;  1TBW A;  3HYY A;  4BQG A;  4Q20 A;  3ZM7 A;  3WQ9 A;  4YKR A;  1UY7 A;  4XIP A;  4XE2 A;  3SL2 A;  4L91 A;  4R3A A;  3KE6 A;  5M4H A;  3HHU A;  1YC4 A;  5J71 A;  4V25 A;  2CGF A;  2K5B A;  2XJG A;  3LNU A;  1S14 A;  2QG2 A;  4FMT A;  1YC1 A;  4FPP A;  4XD8 A;  3ZKD A;  4YKY A;  4E02 A;  5FWK A;  2FXS A;  3EHJ A;  1UYD A;  2BZ5 A;  4L8Z A;  1OSF A;  3R4O A;  3INX A;  4NH9 A;  4BIU A;  4CWP A;  3A0Z A;  3D36 A;  4L94 A;  3GIF A;  4GFN A;  2HG1 A;  2AKP A;  2YKE A;  4CWO A;  4CWF A;  2XX5 A;  4XIQ A;  1U2O A;  3RLP A;  2FWZ A;  4U7N A;  4URN A;  3T0Z A;  4XCJ A;  4NH7 A;  1Z5C A;  3A0W A;  1THN A;  2XHX A;  5D7D A;  2PNR A;  2YK2 A;  3D0B A;  3O6O A;  1UYI A;  3VAD A;  3TTZ A;  3OWB A;  4LWH A;  3NMQ A;  3JZ3 A;  3TZ2 A;  2XDS A;  2YE2 A;  4CWT A;  2WI1 A;  4O04 A;  4XIR A;  4FCP A;  3G7E A;  4O0B A;  4JAS A;  2FWY A;  3RKZ A;  1H7U A;  5CF0 A;  2E0A A;  4YKW A;  4QPJ A;  1TC0 A;  2CCS A;  5D7R A;  1AMW A;  2BU5 A;  5M4N A;  2YKI A;  2YEE A;  3ZXQ A;  2ZDY A;  1PVG A;  3OPD A;  4P8O A;  2VW5 A;  1TID A;  5CTU A;  2C1G A;  4DZY A;  2XX4 A;  4U93 A;  2YE4 A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 4NH8 A;  1GJV A;  2WI5 A;  4WUB A;  5FNC A;  4CWS A;  2CH4 A;  2WEQ A;  4ASA A;  1ZW9 A;  2H55 A;  4XKA A;  4YKQ A;  4YKZ A;  5IDJ A;  1UYE A;  2IWU A;  4AWQ A;  4EGH A;  1UYF A;  1UYC A;  1YET A;  3A0R A;  4ZKI A;  2WI3 A;  3R4P A;  3RLQ A;  3ZXO A;  1GKZ A;  3OMU A;  4HXW A;  2YI7 A;  1YT0 A;  2XDK A;  1Y8N A;  2BU7 A;  1UY9 A;  4LWG A;  2JKI A;  3A0T A;  2BYI A;  2BU6 A;  3TZ4 A;  4BXI A;  4CWN A;  2CG9 A;  4HYP A;  2XHT A;  2YE9 A;  4XC0 A;  4PRX A;  2XDX A;  5CTX A;  2BU8 A;  5IDM A;  2YED A;  3PEJ A;  5IN9 A;  2VCI A;  1I5D A;  3B25 A;  3IED A;  3A0Y A;  5D6P A;  1I5C A;  4HXZ A;  2QF6 A;  3K99 A;  3HYZ A;  4XKO A;  4B6C A;  1YT1 A;  2XCM A;  1QZR A;  5C93 A;  2CCU A;  5CTW A;  2XX2 A;  5J6A A;  2Q8F A;  3G75 A;  2YI0 A;  4X9L A;  2HKJ A;  3TZ0 A;  5FNF A;  2ESA A;  3BMY A;  3EKO A;  3HZ5 A;  2XD6 A;  5F3K A;  2YEC A;  4FCQ A;  1ZXN A;  4URL A;  2WI6 A;  1BYQ A;  4O07 A;  5M4E A;  1BXD A;  3CWV A;  4MB9 A;  3T2S A;  3G7B A;  2O1W A;  4YKU A;  4BIZ A;  4BQJ A;  3QDD A;  4MPE A;  4PRV A;  4V26 A;  2ZDX A;  2VCJ A;  4CE1 A;  5BOC A;  4BAE A;  3INW A;  2XDL A;  4MP2 A;  1TIL A;  5L3J A;  4MBC A;  1S16 A;  3O0I A;  1UYM A;  4DUH A;  1YER A;  1YES A;  1QY8 A;  2HCH A;  1ZXM A;  3QTF A;  2WI2 A;  3R92 A;  3RLR A;  1UYH A;  2BRC A;  2BYH A;  1A4H A;  3CRL A;  1UYG A;  3H80 A;  5M4K A;  5M4M A;  4HY1 A;  2ZBK B;  3B27 A;  4H81 A;  3HZ1 A;  4XIT A;  1ID0 A;  2Q8G A;  4K4O A;  4ASB A;  2WER A;  4GQT A;  4CWQ A;  3LPS A;  3K60 A;  2YI6 A;  2YK9 A;  2JJC A;  1Y4S A;  4L93 A;  2QG0 A;  1ZWH A;  2XHR A;  4EFU A;  2YEF A;  4H85 A;  1AH6 A;  2WI4 A;  3B26 A;  3EHG A;  3R91 A;  4I5S A;  2YEG A;  2QFO A;  4XCL A;  3Q5L A;  3TUH A;  4GEE A;  2YI5 A;  1I5A A;  2FYP A;  2O1U A;  1YT2 A;  3GIG B;  4JAU A;  1B3Q A;  3VHC A;  2BSM A;  4HZ5 A;  1EA6 A;  1AJ6 A;  4KTN A;  4MPC A;  2YJW A;  2BT0 A;  4MP7 A;  4LWI A;  2XK2 A;  4LWF A;  1YSR A;  2O1V A;  3K97 A;  4I3H A;  3O2F A;  1UYL A;  4WUD A;  2YE5 A;  4WUC A;  1Z5B A;  3EHF A;  3OWD A;  2IWX A;  4GGL A;  1KIJ A;  1GKX A;  2YE8 A;  4FCR A;  3GIE A;  2Q8H A;  1YC3 A;  4KSG A;  4L90 A;  3T0H A;  2IOR A;  3FT5 A;  3PEH A;  1H7S A;  2XDU A;  3WHA A;  4MPN A;  4LPB A;  4EMV A;  4ASG A;  2YEB A;  3CGZ A;  2CCT A;  1TC6 A;  2BRE A;  2EXL A;  2YEA A;  1US7 A;  2YKB A;  4CE2 A;  3A0X A;  4AS9 A;  4KFG A;  4XTJ A;  2YGF A;  4HYM A;  1NHH A;  3FT8 A;  3GIG A;  4O09 A;  1NHJ A;  2YEH A;  3T10 A;  4JQL A;  4MOT A;  4H7Q A;  5CPH A;  2Q8I A;  1YS3 A;  2YGE A;  4EFT A;  1AM1 A;  5M4P A;  1NHI A;  3C0E A;  4CWR A;  4LWE A;  1UYK A;  3VHD A;  1BGQ A;  3TZ5 A;  2XAB A;  2YKC A;  3MNR P;  2VWC A;  3CGY A;  2WEP A;  2UWD A;  3FV5 A;  2GQP A;  2ZKJ A;  4CE3 A;  3B24 A;  1Z5A A;  2WI7 A;  3EKR A;  4E00 A;  1B62 A;  4B7P A;  3C11 A;  3VHA A;  2IOQ A;  1UY8 A;  3Q5J A;  2Q2E B;  3U2K A;  4ASF A;  2IOP A;  4PL9 A;  3OW6 A;  4HY6 A;  1JM6 A;  1QYE A;  4URO A;  4LP0 A;  1TH8 A;  4XKK A;  4KP4 A;  5D6Q A;  4URM A;  1YSZ A;  1Y8O A;  2YKJ A;  2BTZ A;  2H8M A;  2XJJ A;  1MU5 A;  1R62 A;  3U67 A;  1L0O A;  2YE7 A;  4XDM A;  1BKN A;  4HZ0 A;  4QPK A;  1Y8P A;  2GFD A;  4U7O A;  4GT8 A;  4YKX A;  1EI1 A;  1B63 A;  4GCZ A;  3R4N A;  3ZKB A;  3H4L A;  5CTY A;  4EGI A;  2YGA A;  4P7A A;  2YE3 A;  5F5R A;  5BOD A;  4EM7 A;  4W7T A;  4ZVI A;  5D7C A;  5FND A;  4O05 A;  1U0Z A;  3K98 A;  2YJX A;  4EEH A;  3BM9 A;  4PU9 A;  2XJX A;  2YEJ A;  1KZN A;  4AWO A;  4E01 A;  4JAV A;  1UY6 A;  2BU2 A;  4AWP A;  4YKT A;  1MX0 A;  1I59 A;  3B28 A;  4EGK A;  5GGZ A;  1Z59 A;  4KQV A;  1I5B A;  3Q5K A;  1AH8 A;  4R1F A;  3D2R A;  4KSH A;  3U2D A;  3CRK A;  2YEI A;  2C2A A;  3HEK A;  2YE6 A;  3T1K A;  3EHH A;  4R3M A;  2IWS A;  3R4M A;  3DGE A;  1I58 A;  1TBW A;  3HYY A;  4BQG A;  4Q20 A;  3ZM7 A;  3WQ9 A;  4YKR A;  1UY7 A;  4XIP A;  4XE2 A;  3SL2 A;  4L91 A;  4R3A A;  3KE6 A;  5M4H A;  3HHU A;  1YC4 A;  5J71 A;  4V25 A;  2CGF A;  2K5B A;  2XJG A;  3LNU A;  1S14 A;  2QG2 A;  4FMT A;  1YC1 A;  4FPP A;  4XD8 A;  3ZKD A;  4YKY A;  4E02 A;  5FWK A;  2FXS A;  3EHJ A;  1UYD A;  2BZ5 A;  4L8Z A;  1OSF A;  3R4O A;  3INX A;  4NH9 A;  4BIU A;  4CWP A;  3A0Z A;  3D36 A;  4L94 A;  3GIF A;  4GFN A;  2HG1 A;  2AKP A;  2YKE A;  4CWO A;  4CWF A;  2XX5 A;  4XIQ A;  1U2O A;  3RLP A;  2FWZ A;  4U7N A;  4URN A;  3T0Z A;  4XCJ A;  4NH7 A;  1Z5C A;  3A0W A;  1THN A;  2XHX A;  5D7D A;  2PNR A;  2YK2 A;  3D0B A;  3O6O A;  1UYI A;  3VAD A;  3TTZ A;  3OWB A;  4LWH A;  3NMQ A;  3JZ3 A;  3TZ2 A;  2XDS A;  2YE2 A;  4CWT A;  2WI1 A;  4O04 A;  4XIR A;  4FCP A;  3G7E A;  4O0B A;  4JAS A;  2FWY A;  3RKZ A;  1H7U A;  5CF0 A;  2E0A A;  4YKW A;  4QPJ A;  1TC0 A;  2CCS A;  5D7R A;  1AMW A;  2BU5 A;  5M4N A;  2YKI A;  2YEE A;  3ZXQ A;  2ZDY A;  1PVG A;  3OPD A;  4P8O A;  2VW5 A;  1TID A;  5CTU A;  4DZY A;  2XX4 A;  4U93 A;  2YE4 A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...