3U30A

Crystal structure of a linear-specific ubiquitin fab bound to linear ubiquitin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
b'SHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords linear di-ubiquitin
publication title Engineering and structural characterization of a linear polyubiquitin-specific antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u30A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u30A01
4W9CA 3RUIB 3A1QB 4ANXA 4BKSD 4XX5A 2FUHB 3PHWB 5C23A 3VH3B 4K7SA 2KOXA 4JL9A 2KJRA 3L10B 4MSMB 3IHPC 2DX5B 4DDID 3M63B 4LCDE 1P0RA 3VDZA 2JY6A 3A9KA 1RAXA 4M0WB 4CHKA 1Z5SB 2C7MB 1RFAA 2KMCA 1LM8B 2FCQA 2HJ8A 2LASA 2M8SA 2MSED 4HXDA 5FR6A 1NDDA 2N9EB 3TJPA 3ZNGC 4B6WA 2PEAA 4PS3A 4MSQB 4HCPB 3EHVA 4NJ6A 3V62A 4EKUA 4A3PA 1YD8U 5J2RA 1OEYJ 1WGHA 4MM3A 2ZJDA 2RPQA 4RMAA 1GUAB 1R4NI 3L54A 2C5LC 3UIOB 2CHZA 3N32A 1WR1A 2PJHA 3UF8A 3N3KB 3CF6E 4MJSA 4GMVA 2MWSB 1Y8RC 2CHXA 5DPRA 4HLEA 1WXVA 1IP9A 4P7IA 2N1VA 2KK8A 3V6CB 3KUCB 1V49A 2BGFA 1WX8A 1FXTB 2WWZA 3QC8B 1V5OA 2KKCA 5DPSA 3L16A 2K25A 3ZTDA 2N9XA 3ZNHB 4KDIC 2CR5A 1WH3A 1WYWB 4KV2A 3AU5A 4K81A 2HE7A 2KFJA 2KDFB 4LJOB 3D32A 5D2MB 5JHBA 2ZNVC 2JZZA 4DDGD 2KDIA 3I3TB 2J0MA 4EUTA 2K6QA 3AULA 4RM9A 1F9JA 3PTFC 2ZCCA 2ZEQA 2CHWA 1QZEA 4EFOA 3CSFA 2C9WB 3R7QA 1SIFA 4EZKA 1KLVA 1LQBA 4IM3A 3QCAA 2LXCA 2LI5A 4W9FA 4IWPA 1V9JA 3ECIA 2K39A 4WJQA 4EEWA 4NQLB 4BKSA 5LXIB 2MBEA 4IC7B 2WYQA 1ZGUB 1MG8A 2NS5A 5JZEB 1P9DU 2NPTB 4PS8A 1C1YB 2LVQA 4GU2A 3SU8X 2BYEA 2LRWA 4TQ0A 2KC2A 1WE7A 3TMPB 3UGBB 4GN1A 2GBKA 2DAFA 2IZVB 4GDKB 4ZRKA 1WX7A 2KJ6A 2XBBC 1E8XA 4NY0A 2ZNVB 4G0NB 4DWFA 2ZZPB 4HPMB 1WE6A 3JW0X 3PZDA 4FBJB 2JRHA 3QX1A 3L17A 4FHJA 2NBWB 3H1UA 2K8HA 3HHMA 5AZHA 3DBSA 2WX0A 2NR2A 3KH0A 1WY8A 2DHZA 3VH4B 2BWES 1I42A 1E7VA 4PS7A 2IO3B 2FIDA 2K8BA 2O6VB 2KTFA 3KYCD 4IUMB 2J0KA 2OJRA 2LJ5A 1YIWA 3IVFA 2MQJA 3K9OB 1P3QU 3DVGY 1YJ1A 4XC2A 3DPDA 3H7PB 1JRUA 4F8CB 2L76A 3PVLA 2OOBB 3VAWA 1WGYA 2RR9A 1GC7A 1L7YA 3AXCA 3OJ4B 3P2BA 2G4SA 4FADA 1XT9B 2XK5B 4MGKE 3UQAA 2BYFA 3CSTA 3OJ3A 4GGQA 2L0TA 2XK5A 3QK0A 2I1JA 3WANA 1UGMA 2ZVNA 1GJZA 4E74A 2LGYA 1XQQA 1S3SG 2JT4B 4HVBA 4MGYE 3QIJA 1OTRB 2L7RA 1ISNA 2LGXA 3NOBA 4LDTB 4W9HA 5CTRC 1LXDA 4KDLB 4MH0E 4DXAB 4FJVB 4B95A 1TTNA 1WJNA 1WX9A 4ICVA 1SE9A 5CHVC 2FCNA 2LVPA 3OLMD 3PHXB 4IG7B 1WXAA 2BPSA 3B1LX 1AARA 1PQSA 2KJHB 4PYUA 3ZUNA 2FCSA 3A1QA 1M94A 3VHTC 2MBOA 3B0AA 3DDCB 3VUXA 2V3SA 3Q3JA 3QAQA 2KWUB 3W1SA 2KX0A 3A4SC 3MJWA 4IM0A 1S1QB 4K7UA 3VQIA 1WZ0A 3ZKJC 3OAWA 3JVZX 4IM2A 4IWOA 1EF1A 1OEYA 1R4MI 3ZDMC 3KYDD 1YX5B 3LDZE 1D3ZA 4GXBA 2KVRA 4NPNA 5CHFA 1UBIA 3WAMA 1LFDA 3X23A 4BOSC 4HDQA 5DCNA 2MBBB 3PGEA 2ZCBA 3QWZB 1IPGA 2O6VD 5J17A 3H9DA 2AWTA 2KLCA 2KZRA 2REXA 2J7QB 3A9JB 4HDOA 4BVUC 5TR5A 1WGDA 2KQSA 2D11A 2IO2B 5CX3A 5LXHA 1WZ3A 1EUVB 2UWQA 3NS8A 1TBEA 4KVGB 4A3OA 2JUOA 2CU1A 4PYZA 4W9KA 4HK2A 4DHZE 2BYVE 3DOWA 3RYTA 4BOZB 3WAPA 5KHQA 3IFWB 1J19A 2PE6B 1J0GA 5LLIA 2KX3A 2BWFA 2B3AA 3M3JA 3O65B 2I1KA 5E6PA 2W9NA 2D3GA 4W9LA 3ZVVA 3RZFA 3RT3B 2MBQA 3QARA 2G45B 2M17A 5AEKB 2KFKB 3EC8A 1E90A 3K9PB 4LDTD 5J18A 2ZPYA 2UYZB 1Z2MA 2NBVB 4W9IA 1T0YA 2HTHA 4TQ1A 4TKNA 1H8CA 3T8MA 2FCMA 3DBRI 1WMHB 2JWZA 4NAWB 2M0XA 3UIPB 3APFA 3WAOA 2L00B 2LXAA 2PE9A 4GOCA 1WJUA 4OVUA 2WX1A 2MX2A 1UZXB 3DBLI 4FJYA 5JHAA 4DHJD 2MLBA 2NPTA 3CMMB 1WM3A 1WJ6A 2N1WA 2KNBA 4DBGA 4F7ZA 1EO6A 1TGZB 4EZJA 2MW5A 3VTWA 2KTRB 3PT2B 2LRUA 3JYUA 4TUUA 2O2VB 2WDTB 3BINA 3VFKA 2DYOA 4GDKA 4NNJB 3ZDTA 2KTRA 4M8MA 1VCBA 2C7HA 2YVCA 1NBFC 2EKEC 3PLVA 3RZWC 3W1YA 4FA6A 2MP2B 1L2NA 3V61A 1Q1OA 2CKHB 3PREA 2KWCA 3SHQA 3N30A 5IAAC 1IYFA 3PS6A 4BBNF 2LD9A 2KMAA 5AZGA 2KLGA 3DCGA 4NQKE 3VVWB 4ZRIA 4IW0A 3ZW3A 2KWVB 4KIKB 3ALBA 4ZYNA 4FHKA 2IYDB 3KVFB 2BKRB 2O6VA 3QQ8B 4K7WA 4MEMA 2MBHA 4BKTA 3HIZA 5IA7A 2IO0B 4JGHB 3ZLZA 5D7GA 4I6NB 2D2QA 2Z0DB 2N7DA 3H7PA 4JIOU 2QHOA 3JSVB 4BFRA 5G2NA 3M95A 3DQVA 1V86A 3JSVA 4E71A 2ZPNA 1KOTA 1U4AA 4LJPB 2FAZA 3SD5A 2KANA 2ASQA 3IBEA 3PRPB 4ANWA 2G3QB 3ZRFA 3KUZA 4ANUA 3PV1A 1G6JA 5CHWA 2DZJA 2M1MA 2Z59B 3TL5A 1WJ4A 2PPHA 1OQYA 4WQOB 1I35A 1GG3A 2V1YA 4JLCA 3VUWA 2RGFA 2IBIB 5D6JB 2FNJB 4WJPA 2BF8B 4BBNC 4URKA 1E5WA 4KSLC 2ZVOA 1H4RA 2KN5A 1E8YA 2A4ZA 2KHWB 3NHEB 4WWOA 3M62B 5JH5C 3TCAA 3ML8A 2KXJA 2LGDA 3S2AA 1Q5WB 2GOWA 5L95C 2KDBA 1OGWA 4DHJB 1RLFA 1ZKHA 4I6LB 5HKHA 5DPWA 3WALA 2EMTA 2JVCA 4AP4C 3B08A 4MGIE 1YQBA 5AZFA 1X1MA 3PLUA 1WFYA 1WF9A 2MRPA 5BO4B 3UINB 2JF5A 2C60A 2L0FA 2D10A 3KW5B 2A5UA 3SDLC 2K8CA 2M4NA 2AL6A 1K8RB 1V81A 1BT0A 1P1AA 1XD3B 2XEWA 3A9KB 3V6EB 1VD2A 3T9LA 3ZNID 2Y5BB 1SGHA 3U7DA 3A33B 3EFUA 2N4FA 2DZIA 3MHSD 1E8WA 4KZCA 2G4DB 2L05A 3RD2A 4DHZB 3GOEA 4TV3A 4AUQC 3A9JA 4W9EA 4JQWC 3APCA 3MTNB 4G11A 3VTUA 3VUYA 1WXSA 1V80A 2RD0A 1GC6A 4GDLB 3VXWA 1WI0A 4CO7A 2DENB 3L08A 4GDLA 4ICUA 4MJSB 3V60A 2GMIC 3GZNI 4HJKA 2DZMA 3ZTCA 3KUDB 2AEHA 4J6IA 1C3TA 4MELA 4IWQA 4BKGA 4CYEA 1WRDB 2KD0A 3R66C 1NI2A 5G55A 4HPLB 3DVNV 3WA0A 1WM2A 4ANVA 2KC1A 2KFKA 2DAJA 3NZUA 4EOYA 3HM3A 2JXXA 5E6NA 2DYMA 3HM6X 2L8JA 1V5TA 1WGGA 4FN2A 4M8NA 1WMHA 4NAWA 2MCNB 1UH6A 2GBRA 4KZ0A 2EMSA 2R2OA 3H7SA 4WJNA 4XZ4A 3L0WB 2V4LA 1HE8A 1Q0WB 5EDSA 3QJZA 1TZ1A 3QHTA 2LZ6A 4ZDVA 2FIFA 3LJ3A 4MDKE 4W9JA 1EF5A 2O2VA 5C1ZA 2N9PC 4A20A 4WWPA 4AWJA 2GBMA 2LUEA 1WR6E 3AI5A 2NVUI 2LWPA 2N7EA 2IY0B 2MP2A 3L13A 4G3XB 4W9GA 3C0RB 2MA9B 3PRZA 3BY4B 4I6PA 2HD5B 2RSUA 4G50A 4AJWA 4WWNA 4E3CA 3TIXA 3QA8A 4KIKA 4II2B 3ONSA 2R2QA 2GBNA 3NY5A 2NBUA 4F1SA 2JPHA 4EZLA 4NJ7A 4FLHA 5L83A 3DVGX 3R3MA 3RULA 1V6EA 3DBHI 4GIVA 4DK5A 1UELA 2JZ3B 4II3B 3H6NA 3EECA 2CS4A 2JRIB 3PSEB 3R7RA 1GNUA 3U8ZA 2LVOA 3UQBA 4FULA 3X0WA 2BKFA 2IY1B 4YL8A 4W9DA 5DPTA 4WJOA 3ZRCA 3ZO5B 3AU4A 3APDA 2DYBA 4KSKC 3WIMA 4N9F4 2VRRB 3TBLD 1KJTA 4OVVA 1UBQA 3W1SC 1E7UA 2L3ZA 3DVNU 4K1RB 1WGRA 2Z0EB 4MGZE 2D07B 1J8CA 2NCNA 1WXMA 1WIAA 3Q3FA 3VTVA 1CMXB 1A5RA 1KM7A 4GSWA 1V2YA 4HCNB 4WAAA 2C7NB 3IG3A 3ML9A 3NZSA 4ASWC 1YX6B 3HK0A 4GB9A 2KDEB 4FJZA 2K6DB 5KHOA 3RCZA 4AOFA 2KQ7A 2YLMA 2DZKA 2AL3A 2K1FA 5E6OA 3ZIMA 4B9KA 2KO3A 2AYOB 1ZW7A 3ENEA 2IO1B 3U30A 3ZNZB 3A4RA 5D94A 3PPAA 4ZRJA 5GMVA 4HWIB 1P98A 1RRBA 2GBJA 3PRMB 4RM8A 4AJYB 1E8ZA 1UD7A 4X57B 2J0JA
chains in the Genus database with same CATH superfamily
4W9CA 4XX5A 2ONQA 2QC8A 5C23A 4RNAA 1E7PB 2DX5B 3A9KA 4M0WB 3AE9B 3N20C 2FCQA 3TJPA 2LASA 1D4BA 3J9CA 4PS3A 4MSQB 1WGHA 4MM3A 2INPE 5G5GA 1GUAB 3DHGC 2CHZA 1FFUA 3C8YA 2WU2B 1XO3A 4MJSA 2CHXA 3RMKC 5DPRA 2WXPA 1VDVA 2TSSA 3DBLB 2N1VA 3AE7B 2W82A 3KUCB 3N1XC 4HKZE 1V49A 1WX8A 2L52A 1V5OA 4OZBA 2YEPF 2N9XA 4HROA 2WXGA 2BS2B 3GS2A 2ZNVC 4DDGD 1SJED 2KDIA 4EUTA 1C9FA 1F9JA 2ZCCA 2GI9A 3L4PA 1LGRA 1SIFA 2NTSA 4HPPA 4W9FA 4EEWA 5LXIB 2MBEA 2B76B 4PS8A 3MHZA 1V8CA 1WX7A 3I57A 2XBBC 4WH4A 4ZRPA 2K9XA 4G0NB 3JW0X 2JRHA 3QX1A 3L17A 2NBWB 3KH0A 4YXDB 1I42A 1E7VA 2FIDA 4S17A 2J0KA 2OJRA 3IVFA 3K9OB 3DVGY 2AQ1B 3E56A 2ON8A 1N5WA 3H7PB 4F8CB 1N6ZA 3KWLA 1OQQA 2RR9A 2H88B 3AXCA 3OJ4B 2G4SA 1JWUD 3CSTA 3IXSA 2I1JA 3WANA 4E74A 1S3SG 4MGYE 1TYGB 1ISNA 1ZPSA 4ZOHC 4LDTB 4URKA 5CTRC 4MH0E 4B95A 1WX9A 1C76A 2LVPA 1QOFA 2VZKD 1MPEA 3V05A 4YTPB 1S1QB 4RFBA 3ZKJC 3GZNB 3OAWA 4IM2A 1R4MI 1OEYA 1Q10A 2Y5CA 5BYRA 4L1BA 5FR3A 1JW9D 4GXBA 4JWUC 2J4XA 3MC0B 1WWTA 3WAMA 2W55A 4BOSC 3HUIA 4HDQA 2MBBB 3PGEA 5HG2A 2AWTA 2KLCA 3A9JB 1WGDA 2KQSA 2IO2B 3AE2B 2VH2A 5CX3A 1WZ3A 1EUVB 2UWQA 3NS8A 1UF0A 4KVGB 2CU1A 4W9KA 5IKCM 2BYVE 4LNOA 4BOZB 1V1PB 1B1ZA 3AH7A 3BWUD 2KX3A 2BWFA 2B3AA 3ZVVA 1YMHE 1J7BA 3RPFC 2G45B 2M17A 3EC8A 4LDTD 1RFKA 5J18A 3ZJTA 2D5GA 2ZPYA 4OZCA 1Z2MA 5IP4D 3NS1A 4TQ1A 2INCC 3DBRI 1WMHB 2M0XA 3UIPB 3APFA 3WAOA 2L00B 1FRRA 2LXAA 4GOCA 1WJUA 4OVUA 4NAMA 1UZXB 4FJYA 5JHAA 2FUG1 4ACFA 1R7SA 1WJ6A 2KNBA 1EO6A 2I38A 1T0SC 2KTRB 3PT2B 1FPYA 2O2VB 2WDTB 1D5XC 1L2NA 2WXLA 2CKHB 5IAAC 1SF0A 1ZXIA 3AECB 3ZW3A 4ZRIA 4IW0A 4KIKB 3QQ8B 4MEMA 2MBHA 4ZHPA 2DLBA 1TKEA 2IO0B 4HJGE 3H7PA 3N1ZC 1N5XA 1HQRD 4ITKA 1V86A 1N60A 4E71A 3SD5A 1L6UA 1NYRA 2G3QB 3ZRFA 1C78A 2DZJA 2M1MA 2PPHA 1OQYA 4WQOB 3ZJUA 1GG3A 3WCQA 3VUWA 2RGFA 4NZLB 3PZ7A 5D6JB 2JYEA 2FNJB 4BBNC 1ENFA 2INNE 3LYYA 4KSLC 1BMLC 5EE9A 3Q8AA 1NI3A 2A4ZA 2KHWB 1KFYB 1I4HA 1GOZA 1YNTE 2GOWA 5L95C 4DHJB 1F2RC 1RLFA 1ZKHA 5HKHA 3WALA 4AP4C 1XLNA 2JVCA 3B08A 2MRPA 1WF9A 3FC4A 1XCTL 2RDBC 2WP9B 3B2GA 2A5UA 3AN1A 2M4NA 2NMQA 1XD3B 1C79A 3T9LA 2G4DB 3NVYA 4TV3A 3A9JA 4BAXA 1ZDXA 4JQWC 5BYSA 1YN3A 3MTNB 3VUYA 3SFEB 2K3UA 1WI0A 3L08A 1VZ8A 1AYFA 2D3BA 2DWQA 4ARCA 2Q5WD 1V1PA 4HJKA 4J6IA 1SEBD 4UDUC 2KD0A 3BVGA 3HM3A 5E6NA 1WGGA 4FN2A 4M8NA 1WMHA 1PYWD 3ETRA 1KLGD 2Y3AA 2GBRA 4KZ0A 4XZ4A 4XGAB 2LZ6A 1YJJA 4MDKE 3NVWA 3AMZA 1EF5A 1ZDVA 2O2VA 2N9PC 3B9JA 1FNUA 3AI5A 1WR6E 2LWPA 5HI1A 4G3XB 2WDVB 4LNIA 4W9GA 3C0RB 2N7JA 1FXAA 2HD5B 4AJWA 1HZ6A 4KIKA 1GB4A 3ONSA 2R2QA 2GBNA 2LGIA 3NY5A 3DVGX 4OZAA 1SIJA 3RULA 1V6EA 3DBHI 4GIVA 1WXQA 3H6NA 2JRIB 2K5PA 4FULA 1PFDA 3X0WA 2BKFA 2AX5A 1VZ6A 4Q2JA 3APDA 2DYBA 2HTME 4IOIE 1EU4A 3TBLD 3GE3C 1KJTA 1UBQA 1PGXA 1Y56A 2L3ZA 5D3DA 5G5HA 4MGZE 2D07B 3AE3B 2NCNA 5BMGA 3Q3FA 2HDEA 1QKZA 2C7NB 3NZSA 3Q8CA 1AWDA 2WXNA 1JQ4A 4AOFA 1D5MC 2YLMA 1B9RA 2K1FA 4O1NA 4B9KA 2LEKA 2AYOB 1ZW7A 3A4RA 1UGJA 5GMVA 1UUPA 1P98A 1RRBA 2QILA 5BMIA 2FUHB 4JL9A 1C4PA 2KJRA 4XWWA 3VDZA 3Q8EA 3Q69A 5IOIA 2C7MB 3HVDA 1RFAA 2KMCA 5E6JA 5HFYA 3TEZA 3EHVA 1YD8U 4L2YA 1HA5A 3MC8A 3RNBC 1WR1A 3N3KB 3IAM1 2BYTA 4DXGA 1Y8RC 3GB1A 4P7IA 2KK8A 3HVZA 2WXKA 4XWTA 2KKCA 3NG0A 3L16A 4BZAA 1WH3A 3KLSX 1WYWB 4KV2A 4K81A 2KFJA 3W5UB 2J0MA 3NUHB 1F2RI 1QZEA 4EFOA 2G9HD 2D3CA 1HEZE 2IDYA 2C9WB 4L23A 1LQBA 3MJ5A 4IM3A 3VR8B 1AW7A 2LI5A 4A6QA 4IWPA 1V9JA 4NQLB 4HRSA 1ZGUB 2PLPA 3KWVA 5JZEB 2NPTB 2MHJA 2BYEA 2LRWA 1PGBA 2KC2A 1WE7A 3TMPB 1QT9A 4GN1A 2E6XA 4GDKB 4ZRKA 1MI0A 1DYQA 1E8XA 3AV8A 5JXVA 3UI3A 3P1MA 1JROA 4C7ZA 2K8HA 3DBSA 3VH4B 3AEDB 4PS7A 2IO3B 1D6EC 1QILA 1YIWA 4XC2A 2L76A 1YJIA 1GC7A 1L7YA 1XT9B 3OJ3A 3TEYA 2L0TA 4RF1A 1UGMA 1GJZA 2QEJC 1WGKA 3ZQ4A 2MJDA 4HVBA 3QIJA 2L7RA 3R2IA 2LGXA 3U52E 2V9HA 4DXAB 1SE9A 4ZYSA 3BK2A 1WXAA 3B1LX 1PQSA 2KJHB 2FCSA 3VUXA 3QAQA 2KWUB 3W1SA 4K7UA 1J7AA 5H8YE 1ET6A 1F52A 3Q8FA 3LDZE 5EE0A 2KVRA 5CHFA 2WNMA 4US9A 1C77A 1LFDA 1CZPA 3ZGZA 3AEFB 5DCNA 3ZXRA 2ZCBA 1IPGA 2JWUA 1FNVA 2JSVX 2KZRA 2REXA 4HDOA 4BVUC 2D11A 4US8A 4EE2A 1TBEA 2WQYB 4PYZA 3I5JC 4DHZE 2UU7A 3PZ8A 3WAPA 1J19A 2PE6B 1JRPA 3O65B 5E6PA 3OG5A 4QAYA 1FNWA 3RZFA 2MBQA 2V0GA 2KFKB 4C4VA 2UYZB 1JWSD 3Q2AC 1T0YA 2HTHA 3NJTA 1H8CA 2KAJA 1ZXHA 4OVZA 2GB1A 2VZKB 3DBLI 2N9LA 1UWMA 3CMMB 2NPTA 4DBGA 4TMAB 1SE3A 1TGZB 4DXFA 4EZJA 4TUUA 4GDKA 4NNJB 2BQQA 3SFDB 2V3NA 2KACA 4FA6A 2EKEC 3BVZA 2MP2B 4LNKA 1Q1OA 2CU3A 2WXJA 5AZGA 2KLGA 1FM0D 2LFIA 3ALBA 4FHKA 1QOAA 4BKTA 3NRZA 3HIZA 3MC9A 2D2QA 1XLOA 2N7DA 4JIOU 1VJKA 4BFRA 3M95A 4LJPB 2KANA 2YEPB 2ASQA 2K0PA 3IBEA 4P6VF 2Z59B 3TL5A 1N63A 1I35A 2LMCA 3HRDD 1SBBB 4WJPA 2BF8B 1I4XA 4B0EA 2ZVOA 3TUOA 1H4RA 4D2KA 1E8YA 4WWOA 1D5ZC 5JH5C 1HTQA 2LGDA 2PIAA 1Q5WB 1OGWA 3NZ3A 1STEA 4WURA 4C00A 2BS4B 3BIID 2ICIA 5AZFA 1X1MA 1F1HA 1TKGA 2C60A 5FKAC 1WYGA 2K8CA 1TS2A 1V81A 1P1AA 4KGRA 3ZNID 2Y5BB 2N4FA 1E8WA 2L05A 3RD2A 4DHZB 3GE8C 3APCA 4G11A 2M19A 1WXSA 1BUIC 4CO7A 2WXIA 2DENB 3Q8BA 3DBRB 5C2TB 2GMIC 3V60A 3GZNI 2DZMA 4RCOA 3ZTCA 2AEHA 4MELA 2LUMA 1NI2A 3DVNV 4ANVA 2KFKA 2DAJA 4EOYA 1E10A 4RGTA 2JXXA 3HM6X 4KGTA 1V5TA 4C7YA 1UH6A 4REZA 3H7SA 4WJNA 3L0WB 1KTKA 2V4LA 2VH1A 5EDSA 1JALA 1XLQA 1TZ1A 3QJZA 1L0VB 3KQ4A 4PK1A 4AWJA 4A20A 1F0ZA 2X38A 2MP2A 2SEBD 4KGSA 2MA9B 4M02A 3FAHA 2WXOA 1FXIA 2RSUA 4PT5A 4YT0B 2GRIA 4RF0A 3EA6A 2HJ1A 4NJ7A 2RDHA 5EE1A 1SJHD 1FFVA 3CIRB 3EECA 1V97A 2ZW0A 3U8ZA 2LVOA 2QMTA 2IY1B 1HXYD 4TSSA 5DPTA 1M4VA 3AU4A 4A9AA 1VRAB 2PVOD 3AE6B 4OVVA 5D3IB 3W1SC 1E7UA 1KRHA 3BZDB 2MJEA 3ZJVA 1TIFA 1J8CA 1WIAA 3VTVA 1CMXB 1A5RA 4HCNB 3ML9A 3EGRA 4ASWC 5TSSA 1YX6B 4YSYB 5KHOA 3RCZA 5E6OA 1TZOA 3I63C 3N1YC 2KMMA 3PPAA 4HKQA 1HTOA 3VRAB 2GBJA 3PRMB 4RM8A 1E8ZA 4X57B 4ANXA 2FE8A 2MH7A 4BKSD 1WRIA 1RM6C 2PVGC 3P4RB 3L10B 4MSMB 2GLSA 4YWGG 3IHPC 3M63B 4LCDE 2JY6A 1I4RA 1RAXA 3Q6BA 3AE4B 1LM8B 2M8SA 2HJ8A 2MSED 5FR6A 4ANWA 1NVID 2N9EB 4B6WA 3V62A 4A3PA 2LGSA 5J2RA 2ZJDA 4RMAA 2QDFA 4KKJA 1R4NI 1MHXA 3N32A 2OHFA 2LHEA 1FRDA 4GMVA 2MWSB 2KWDA 2Z8LA 1IP9A 2BGFA 4IKGA 3ZNHB 4KDIC 2CR5A 1I4GA 4R3DA 1YOVB 3AU5A 4LJOB 1E6EB 1QQRA 5JHBA 2JZZA 3DHHC 3I3TB 2K6QA 4RM9A 1DGJA 4RGMA 3CSFA 3R7QA 5HHDG 2Y5PA 1FO4A 4JE3B 2MJ3A 1IGDA 3ECIA 1MJDA 2K39A 4WJQA 4BKSA 1MG8A 2BT6A 4N6EB 1P9DU 1C1YB 1ET9A 4GU2A 5EE3A 1VLBA 4P16A 2GBKA 2DAFA 2IZVB 4YTNB 1GB1A 2W3SA 1OQRA 2RDGA 2ZZPB 3P4PB 1NEKB 4HPMB 3PZDA 4FBJB 3ABVB 4FHJA 3H1UA 3HHMA 1ESFA 2WX0A 2NR2A 1TY2A 2DHZA 2BWES 1QOBA 4OW0A 4IUMB 1SB3C 1YJ1A 3DPDA 2WXMA 2ACZB 3P63A 1F77A 3PVLA 4K3BA 3VAWA 1WGYA 2V3PA 2WU5B 3UQAA 4MGKE 2OEDA 1HZ5A 2XK5A 1BXTA 3QK0A 2ZVNA 2BW2A 1XQQA 2JT4B 4MT5A 3NOBA 4W9HA 1LXDA 1WJNA 2R61A 4ICVA 1YQ4B 2PW9A 2FCNA 3OLMD 4IG7B 3PHXB 2BPSA 1IGCA 2RMMA 1AARA 1I4QA 2BB6A 3Q3NC 5GXGB 3DDCB 3Q3JA 2X8XX 1L6VA 4USAA 2KX0A 3A4SC 3MJWA 2IGGA 1OFFA 1PGAA 4JX1C 4WIPA 3AM9A 3JVZX 1MHHE 4IWOA 3ZDMC 1SXTA 3KYDD 3N9YC 3ZYYX 4NPNA 2ZW1A 3X23A 3QWZB 2IPKD 3H9DA 2AQ2B 1E9MA 3T3OA 5LXHA 4XDDA 2LHDA 4A3OA 2JUOA 3DOWA 2J53A 1ACCA 1QF6A 4YTMB 1YN5A 3DHIC 1XEEA 2WXRA 3I9V1 4S0RA 4W9LA 4C4VB 3RT3B 3QARA 1MG4A 2JYTA 4MACA 4JPSA 1E90A 1MVKA 1FCCC 2KDMA 3EFCA 3RFZB 4TKNA 3T3NA 1DOXA 4OHJA 2PE9A 1QLBB 2INDC 4F7ZA 2MW5A 3VTWA 2LRUA 3BINA 5MPOA 2DYOA 1YQ3B 1VCBA 2C7HA 2YVCA 3PLVA 3RZWC 3W1YA 1GAQB 3SHQA 3N30A 1IYFA 3PS6A 2LD9A 3DCGA 4ZYNA 2IYDB 4K7WA 4JGHB 3ZLZA 2QHOA 1RWSA 2BS3B 4ZHOA 1LO5D 2QSDA 3JSVA 3C19A 1KOTA 1U4AA 2FAZA 2J52A 3IT4B 3PV1A 1G6JA 5CHWA 1WJ4A 4B0MA 2D3AA 2IBIB 1J7CA 1T0RC 4ARIA 1E5WA 5BMHA 2BB5A 3AE1B 4IDIA 3M62B 2WDRB 3ML8A 1L0YB 2KXJA 3S2AA 2KDBA 4P1BC 1DOYA 2KQ4X 4XYCA 3AEGB 2EMTA 2E3TA 1YQBA 3PLUA 1WFYA 3MFGA 3UINB 3RNEC 1T5XD 2D10A 3KW5B 4WQMA 2KYWA 1FEHA 1K8RB 3TEWA 2L83A 2XEWA 3V6EB 1VD2A 3A33B 1NYQA 3AEBB 2DZIA 2KVZA 4AUQC 4W9EA 2PMVA 2WXHA 1SE4A 2RD0A 1RYJA 1PUTA 4GDLA 2NTTA 2I2YA 1P7FA 1K52A 3CWIA 1C3TA 4DQOC 4IWQA 4BKGA 4CYEA 2DNFA 3R66C 5G55A 1GPXA 4HPLB 1WM2A 3NZUA 1P7EA 4A90A 2L8JA 1ZUD2 2MEKA 2EMSA 2H89B 3AEAB 1HE8A 2QJLA 1N61A 1VZ7A 2N9KA 4ZDVA 2FIFA 5BYQA 1SE2A 1TJEA 4WWPA 2N7EA 3L13A 2IGDA 1K50A 3W2DA 3H8HA 4E3CA 3TIXA 4II2B 2NBUA 4F1SA 2EELA 2JPHA 4FLHA 5AUKA 3R3MA 4DK5A 1UELA 2JZ3B 4II3B 4RH6A 3R7RA 1GNUA 4WJOA 3ZRCA 3ZO5B 2EKIA 4N58A 4N9F4 3URYA 1CQVA 1XF5L 2JU6X 1A70A 3DVNU 4K1RB 1WGRA 2Z0EB 2PTLA 4M01A 1R4MB 1KM7A 4GSWA 3DWMA 2KDEB 4FJZA 3EUB2 2KQ7A 2DZKA 2AL3A 4JWSC 3P4SB 2KO3A 3U30A 3ZNZB 5D94A 1FIQA 4ZRJA 4HWIB 2L32A 3U4EG 2J0JA 4C56C 1EM7A 2FBWB 3RUIB 3A1QB 3PHWB 3VH3B 4K7SA 2KOXA 2KN4A 4DDID 1QOGA 4J3OD 1P0RA 4CHKA 1Z5SB 1TKYA 4M00A 4M0WA 3ZNGC 4HXDA 1NDDA 2PEAA 4HCPB 4NJ6A 4EKUA 4WAFA 1L4ZB 1OEYJ 2QCZA 1TY0A 1EWCA 2RPQA 3LXFA 1YN4A 4XE0A 3L54A 3UIOB 2C5LC 3RNCC 2PJHA 2WXQA 3UF8A 3CF6E 5C3JB 1FMAD 4HLEA 1WXVA 4N59A 3V6CB 3QC8B 2WWZA 5DPSA 1FXTB 3ZTDA 2K25A 4FXCA 5LNK1 4YSZB 1UWXA 1KH0A 2HE7A 2KDFB 5D2MB 3D32A 1TS4A 3W9CB 3AULA 3PTFC 3W5VB 2ZEQA 2CHWA 1I4PA 1DOIA 4EZKA 1KLVA 2CJNA 3QCAA 2LXCA 1WSPA 4IC7B 2WYQA 2NS5A 1C4AA 3RI7C 3SU8X 2LVQA 4MH8A 1PDXA 1JCKB 4TQ0A 3UGBB 1T3QA 3RNAC 1K51A 1JWMD 2KJ6A 3R2TA 4NY0A 2ZNVB 4DWFA 4LK0M 1WE6A 1IBXB 4WWMA 5AZHA 1WY8A 1ZP0B 2K8BA 2O6VB 2KTFA 3FILB 3KYCD 2V4IB 2LJ5A 3SEBA 2MQJA 1P3QU 1JRUA 2OOBB 3P2BA 2AQ3B 4FADA 2XK5B 2BYFA 4GLSC 4GGQA 2OJWA 2DBYA 4AQ7A 3Q3OC 2LGYA 1L0XB 1OTRB 2L1AA 2W54A 4KDLB 4FJVB 1JMLA 1TTNA 5CHVC 2JX5A 1XCQL 4PYUA 4AS1A 3ZUNA 3Q14C 3A1QA 3VHTC 1M94A 1JWAD 2MBOA 3B0AA 2V3SA 2IGHA 5H92C 2JQRB 4IM0A 1R4NB 3VQIA 1WZ0A 1I7HA 4H2AA 1EF1A 5IO9A 5IN7A 2LJIA 1YX5B 1D3ZA 3RN9C 4RGNA 1KLUD 1UBIA 2M56B 3IAS1 4KX6B 2O6VD 3BYYB 5J17A 1K53A 1IUEA 2J7QB 4XDCA 5TR5A 1KF6B 3V3XA 1FCLA 4HK2A 2N0SB 1SSNA 1UNSA 4P1CC 3RYTA 5KHQA 3IFWB 1J0GA 5LLIA 2XN9C 2W3RA 3M3JA 2I1KA 2W9NA 2D3GA 3OWEB 5AEKB 4LLGM 3K9PB 3RNFC 3TEXA 2NBVB 4W9IA 2JXTA 3GP7A 3T8MA 2FCMA 2JWZA 4NAWB 3Q3MC 3ZXVA 3U7ZA 4NJCA 2WX1A 3DBHB 2MX2A 4DHJD 3B2FA 2MLBA 4RGOS 1WM3A 2N1WA 3VVWB 3JYUA 3ZDTA 3VFKA 2KTRA 4M8MA 1NBFC 4A8XC 1JWBD 3V61A 2RPVA 3PREA 2KWCA 1ROEA 2M0AA 4BBNF 1IBXA 2KMAA 3DWGC 4NQKE 2KWVB 3AB5A 1XLPA 3KVFB 2BKRB 2O6VA 3FILA 1EU3A 3PO0A 5IA7A 5D7GA 4I6NB 2Z0DB 3P4QB 3JSVB 4LNFA 3NVVA 5G2NA 3DQVA 2ZPNA 4ZRQA 3PRPB 3KUZA 4ANUA 3E9SA 2QIEB 4YSXB 5I4DA 3BK1A 4JLCA 2V1YA 3VR9B 1MFWA 2IJ0A 2KN5A 3NHEB 1CJEA 3TCAA 3FKYA 2WLBA 4I6LB 5DPWA 1VR9A 4MGIE 3BVMA 3U2SC 5BO4B 2JF5A 4KKIA 2L0FA 3P42A 3LB8C 2SAKA 3SDLC 2BBCA 2AL6A 2K22A 1BT0A 3A9KB 1FD6A 1T6BX 3U7DA 1SGHA 4K3CA 1ZE3D 3EFUA 4LTUA 3MHSD 4A55A 4KZCA 2WDQB 3GOEA 2KT7A 3MP9A 4MM3B 3VTUA 4HEA1 1V80A 4GDLB 1GC6A 3VXWA 4ICUA 2J42A 4MJSB 2CJOA 1L5PA 3KUDB 1TT5B 1WRDB 2JZPA 1L4DB 3TSSA 3WA0A 2KC1A 3AE8B 3VRBB 1TS3A 2DYMA 4NAWA 2MCNB 3AEEB 2R2OA 1V1OA 1ZOYB 1Q0WB 3RNGC 3QHTA 1TS5A 5FK9C 1NENB 3LJ3A 4W9JA 5T8IA 2G1EA 3IT6B 5C1ZA 2GBMA 2LUEA 2NVUI 2IY0B 5AUIA 3BYTB 3PRZA 3BY4B 4I6PA 4G50A 2WS3B 4WWNA 3SR6A 3QA8A 2XNAC 1C4CA 4EZLA 5L83A 2CS4A 3PSEB 3O13A 2BTEA 3AE5B 3UQBA 4YL8A 4W9DA 1EWYC 2BVCA 4KSKC 3WIMA 2VRRB 4LNNA 2PKOA 3R8BA 4CQNA 1E0ZA 3NVZA 1WXMA 1V2YA 4WAAA 3IG3A 3HK0A 4GB9A 1T0QC 2K6DB 2WHIA 3ZIMA 1AN8A 3ENEA 2IO1B 1CK1A 1XXGA 1N62A 2WGSA 4C80A 4AJYB 2WXFA 1UD7A
chains in the Genus database with same CATH topology
4W9CA 3RUIB 3A1QB 4ANXA 4BKSD 4XX5A 2FUHB 3PHWB 5C23A 3VH3B 4K7SA 2KOXA 4JL9A 2KJRA 3L10B 4MSMB 3IHPC 2DX5B 4DDID 3M63B 4LCDE 1P0RA 3VDZA 2JY6A 3A9KA 1RAXA 4M0WB 4CHKA 1Z5SB 2C7MB 1RFAA 2KMCA 1LM8B 2FCQA 2HJ8A 2LASA 2M8SA 2MSED 4HXDA 5FR6A 1NDDA 2N9EB 3TJPA 3ZNGC 4B6WA 2PEAA 4PS3A 4MSQB 4HCPB 3EHVA 4NJ6A 3V62A 4EKUA 4A3PA 1YD8U 5J2RA 1OEYJ 1WGHA 4MM3A 2ZJDA 2RPQA 4RMAA 1GUAB 1R4NI 3L54A 2C5LC 3UIOB 2CHZA 3N32A 1WR1A 2PJHA 3UF8A 3N3KB 3CF6E 4MJSA 4GMVA 2MWSB 1Y8RC 2CHXA 5DPRA 4HLEA 1WXVA 1IP9A 4P7IA 2N1VA 2KK8A 3V6CB 3KUCB 1V49A 2BGFA 1WX8A 1FXTB 2WWZA 3QC8B 1V5OA 2KKCA 5DPSA 3L16A 2K25A 3ZTDA 2N9XA 3ZNHB 4KDIC 2CR5A 1WH3A 1WYWB 4KV2A 3AU5A 4K81A 2HE7A 2KFJA 2KDFB 4LJOB 3D32A 5D2MB 5JHBA 2ZNVC 2JZZA 4DDGD 2KDIA 3I3TB 2J0MA 4EUTA 2K6QA 3AULA 4RM9A 1F9JA 3PTFC 2ZCCA 2ZEQA 2CHWA 1QZEA 4EFOA 3CSFA 2C9WB 3R7QA 1SIFA 4EZKA 1KLVA 1LQBA 4IM3A 3QCAA 2LXCA 2LI5A 4W9FA 4IWPA 1V9JA 3ECIA 2K39A 4WJQA 4EEWA 4NQLB 4BKSA 5LXIB 2MBEA 4IC7B 2WYQA 1ZGUB 1MG8A 2NS5A 5JZEB 1P9DU 2NPTB 4PS8A 1C1YB 2LVQA 4GU2A 3SU8X 2BYEA 2LRWA 4TQ0A 2KC2A 1WE7A 3TMPB 3UGBB 4GN1A 2GBKA 2DAFA 2IZVB 4GDKB 4ZRKA 1WX7A 2KJ6A 2XBBC 1E8XA 4NY0A 2ZNVB 4G0NB 4DWFA 2ZZPB 4HPMB 1WE6A 3JW0X 3PZDA 4FBJB 2JRHA 3QX1A 3L17A 4FHJA 2NBWB 3H1UA 2K8HA 3HHMA 5AZHA 3DBSA 2WX0A 2NR2A 3KH0A 1WY8A 2DHZA 3VH4B 2BWES 1I42A 1E7VA 4PS7A 2IO3B 2FIDA 2K8BA 2O6VB 2KTFA 3KYCD 4IUMB 2J0KA 2OJRA 2LJ5A 1YIWA 3IVFA 2MQJA 3K9OB 1P3QU 3DVGY 1YJ1A 4XC2A 3DPDA 3H7PB 1JRUA 4F8CB 2L76A 3PVLA 2OOBB 3VAWA 1WGYA 2RR9A 1GC7A 1L7YA 3AXCA 3OJ4B 3P2BA 2G4SA 4FADA 1XT9B 2XK5B 4MGKE 3UQAA 2BYFA 3CSTA 3OJ3A 4GGQA 2L0TA 2XK5A 3QK0A 2I1JA 3WANA 1UGMA 2ZVNA 1GJZA 4E74A 2LGYA 1XQQA 1S3SG 2JT4B 4HVBA 4MGYE 3QIJA 1OTRB 2L7RA 1ISNA 2LGXA 3NOBA 4LDTB 4W9HA 5CTRC 1LXDA 4KDLB 4MH0E 4DXAB 4FJVB 4B95A 1TTNA 1WJNA 1WX9A 4ICVA 1SE9A 5CHVC 2FCNA 2LVPA 3OLMD 3PHXB 4IG7B 1WXAA 2BPSA 3B1LX 1AARA 1PQSA 2KJHB 4PYUA 3ZUNA 2FCSA 3A1QA 1M94A 3VHTC 2MBOA 3B0AA 3DDCB 3VUXA 2V3SA 3Q3JA 3QAQA 2KWUB 3W1SA 2KX0A 3A4SC 3MJWA 4IM0A 1S1QB 4K7UA 3VQIA 1WZ0A 3ZKJC 3OAWA 3JVZX 4IM2A 4IWOA 1EF1A 1OEYA 1R4MI 3ZDMC 3KYDD 1YX5B 3LDZE 1D3ZA 4GXBA 2KVRA 4NPNA 5CHFA 1UBIA 3WAMA 1LFDA 3X23A 4BOSC 4HDQA 5DCNA 2MBBB 3PGEA 2ZCBA 3QWZB 1IPGA 2O6VD 5J17A 3H9DA 2AWTA 2KLCA 2KZRA 2REXA 2J7QB 3A9JB 4HDOA 4BVUC 5TR5A 1WGDA 2KQSA 2D11A 2IO2B 5CX3A 5LXHA 1WZ3A 1EUVB 2UWQA 3NS8A 1TBEA 4KVGB 4A3OA 2JUOA 2CU1A 4PYZA 4W9KA 4HK2A 4DHZE 2BYVE 3DOWA 3RYTA 4BOZB 3WAPA 5KHQA 3IFWB 1J19A 2PE6B 1J0GA 5LLIA 2KX3A 2BWFA 2B3AA 3M3JA 3O65B 2I1KA 5E6PA 2W9NA 2D3GA 4W9LA 3ZVVA 3RZFA 3RT3B 2MBQA 3QARA 2G45B 2M17A 5AEKB 2KFKB 3EC8A 1E90A 3K9PB 4LDTD 5J18A 2ZPYA 2UYZB 1Z2MA 2NBVB 4W9IA 1T0YA 2HTHA 4TQ1A 4TKNA 1H8CA 3T8MA 2FCMA 3DBRI 1WMHB 2JWZA 4NAWB 2M0XA 3UIPB 3APFA 3WAOA 2L00B 2LXAA 2PE9A 4GOCA 1WJUA 4OVUA 2WX1A 2MX2A 1UZXB 3DBLI 4FJYA 5JHAA 4DHJD 2MLBA 2NPTA 3CMMB 1WM3A 1WJ6A 2N1WA 2KNBA 4DBGA 4F7ZA 1EO6A 1TGZB 4EZJA 2MW5A 3VTWA 2KTRB 3PT2B 2LRUA 3JYUA 4TUUA 2O2VB 2WDTB 3BINA 3VFKA 2DYOA 4GDKA 4NNJB 3ZDTA 2KTRA 4M8MA 1VCBA 2C7HA 2YVCA 1NBFC 2EKEC 3PLVA 3RZWC 3W1YA 4FA6A 2MP2B 1L2NA 3V61A 1Q1OA 2CKHB 3PREA 2KWCA 3SHQA 3N30A 5IAAC 1IYFA 3PS6A 4BBNF 2LD9A 2KMAA 5AZGA 2KLGA 3DCGA 4NQKE 3VVWB 4ZRIA 4IW0A 3ZW3A 2KWVB 4KIKB 3ALBA 4ZYNA 4FHKA 2IYDB 3KVFB 2BKRB 2O6VA 3QQ8B 4K7WA 4MEMA 2MBHA 4BKTA 3HIZA 5IA7A 2IO0B 4JGHB 3ZLZA 5D7GA 4I6NB 2D2QA 2Z0DB 2N7DA 3H7PA 4JIOU 2QHOA 3JSVB 4BFRA 5G2NA 3M95A 3DQVA 1V86A 3JSVA 4E71A 2ZPNA 1KOTA 1U4AA 4LJPB 2FAZA 3SD5A 2KANA 2ASQA 3IBEA 3PRPB 4ANWA 2G3QB 3ZRFA 3KUZA 4ANUA 3PV1A 1G6JA 5CHWA 2DZJA 2M1MA 2Z59B 3TL5A 1WJ4A 2PPHA 1OQYA 4WQOB 1I35A 1GG3A 2V1YA 4JLCA 3VUWA 2RGFA 2IBIB 5D6JB 2FNJB 4WJPA 2BF8B 4BBNC 4URKA 1E5WA 4KSLC 2ZVOA 1H4RA 2KN5A 1E8YA 2A4ZA 2KHWB 3NHEB 4WWOA 3M62B 5JH5C 3TCAA 3ML8A 2KXJA 2LGDA 3S2AA 1Q5WB 2GOWA 5L95C 2KDBA 1OGWA 4DHJB 1RLFA 1ZKHA 4I6LB 5HKHA 5DPWA 3WALA 2EMTA 2JVCA 4AP4C 3B08A 4MGIE 1YQBA 5AZFA 1X1MA 3PLUA 1WFYA 1WF9A 2MRPA 5BO4B 3UINB 2JF5A 2C60A 2L0FA 2D10A 3KW5B 2A5UA 3SDLC 2K8CA 2M4NA 2AL6A 1K8RB 1V81A 1BT0A 1P1AA 1XD3B 2XEWA 3A9KB 3V6EB 1VD2A 3T9LA 3ZNID 2Y5BB 1SGHA 3U7DA 3A33B 3EFUA 2N4FA 2DZIA 3MHSD 1E8WA 4KZCA 2G4DB 2L05A 3RD2A 4DHZB 3GOEA 4TV3A 4AUQC 3A9JA 4W9EA 4JQWC 3APCA 3MTNB 4G11A 3VTUA 3VUYA 1WXSA 1V80A 2RD0A 1GC6A 4GDLB 3VXWA 1WI0A 4CO7A 2DENB 3L08A 4GDLA 4ICUA 4MJSB 3V60A 2GMIC 3GZNI 4HJKA 2DZMA 3ZTCA 3KUDB 2AEHA 4J6IA 1C3TA 4MELA 4IWQA 4BKGA 4CYEA 1WRDB 2KD0A 3R66C 1NI2A 5G55A 4HPLB 3DVNV 3WA0A 1WM2A 4ANVA 2KC1A 2KFKA 2DAJA 3NZUA 4EOYA 3HM3A 2JXXA 5E6NA 2DYMA 3HM6X 2L8JA 1V5TA 1WGGA 4FN2A 4M8NA 1WMHA 4NAWA 2MCNB 1UH6A 2GBRA 4KZ0A 2EMSA 2R2OA 3H7SA 4WJNA 4XZ4A 3L0WB 2V4LA 1HE8A 1Q0WB 5EDSA 3QJZA 1TZ1A 3QHTA 2LZ6A 4ZDVA 2FIFA 3LJ3A 4MDKE 4W9JA 1EF5A 2O2VA 5C1ZA 2N9PC 4A20A 4WWPA 4AWJA 2GBMA 2LUEA 1WR6E 3AI5A 2NVUI 2LWPA 2N7EA 2IY0B 2MP2A 3L13A 4G3XB 4W9GA 3C0RB 2MA9B 3PRZA 3BY4B 4I6PA 2HD5B 2RSUA 4G50A 4AJWA 4WWNA 4E3CA 3TIXA 3QA8A 4KIKA 4II2B 3ONSA 2R2QA 2GBNA 3NY5A 2NBUA 4F1SA 2JPHA 4EZLA 4NJ7A 4FLHA 5L83A 3DVGX 3R3MA 3RULA 1V6EA 3DBHI 4GIVA 4DK5A 1UELA 2JZ3B 4II3B 3H6NA 3EECA 2CS4A 2JRIB 3PSEB 3R7RA 1GNUA 3U8ZA 2LVOA 3UQBA 4FULA 3X0WA 2BKFA 2IY1B 4YL8A 4W9DA 5DPTA 4WJOA 3ZRCA 3ZO5B 3AU4A 3APDA 2DYBA 4KSKC 3WIMA 4N9F4 2VRRB 3TBLD 1KJTA 4OVVA 1UBQA 3W1SC 1E7UA 2L3ZA 3DVNU 4K1RB 1WGRA 2Z0EB 4MGZE 2D07B 1J8CA 2NCNA 1WXMA 1WIAA 3Q3FA 3VTVA 1CMXB 1A5RA 1KM7A 4GSWA 1V2YA 4HCNB 4WAAA 2C7NB 3IG3A 3ML9A 3NZSA 4ASWC 1YX6B 3HK0A 4GB9A 2KDEB 4FJZA 2K6DB 5KHOA 3RCZA 4AOFA 2KQ7A 2YLMA 2DZKA 2AL3A 2K1FA 5E6OA 3ZIMA 4B9KA 2KO3A 2AYOB 1ZW7A 3ENEA 2IO1B 3U30A 3ZNZB 3A4RA 5D94A 3PPAA 4ZRJA 5GMVA 4HWIB 1P98A 1RRBA 2GBJA 3PRMB 4RM8A 4AJYB 1E8ZA 1UD7A 4X57B 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9C A;  3RUI B;  3A1Q B;  4ANX A;  4BKS D;  4XX5 A;  2FUH B;  3PHW B;  5C23 A;  3VH3 B;  4K7S A;  2KOX A;  4JL9 A;  2KJR A;  3L10 B;  4MSM B;  3IHP C;  2DX5 B;  4DDI D;  3M63 B;  4LCD E;  1P0R A;  3VDZ A;  2JY6 A;  3A9K A;  1RAX A;  4M0W B;  4CHK A;  1Z5S B;  2C7M B;  1RFA A;  2KMC A;  1LM8 B;  2FCQ A;  2HJ8 A;  2LAS A;  2M8S A;  2MSE D;  4HXD A;  5FR6 A;  1NDD A;  2N9E B;  3TJP A;  3ZNG C;  4B6W A;  2PEA A;  4PS3 A;  4MSQ B;  4HCP B;  3EHV A;  4NJ6 A;  3V62 A;  4EKU A;  4A3P A;  1YD8 U;  5J2R A;  1OEY J;  1WGH A;  4MM3 A;  2ZJD A;  2RPQ A;  4RMA A;  1GUA B;  1R4N I;  3L54 A;  2C5L C;  3UIO B;  2CHZ A;  3N32 A;  1WR1 A;  2PJH A;  3UF8 A;  3N3K B;  3CF6 E;  4MJS A;  4GMV A;  2MWS B;  1Y8R C;  2CHX A;  5DPR A;  4HLE A;  1WXV A;  1IP9 A;  4P7I A;  2N1V A;  2KK8 A;  3V6C B;  3KUC B;  1V49 A;  2BGF A;  1WX8 A;  1FXT B;  2WWZ A;  3QC8 B;  1V5O A;  2KKC A;  5DPS A;  3L16 A;  2K25 A;  3ZTD A;  2N9X A;  3ZNH B;  4KDI C;  2CR5 A;  1WH3 A;  1WYW B;  4KV2 A;  3AU5 A;  4K81 A;  2HE7 A;  2KFJ A;  2KDF B;  4LJO B;  3D32 A;  5D2M B;  5JHB A;  2ZNV C;  2JZZ A;  4DDG D;  2KDI A;  3I3T B;  2J0M A;  4EUT A;  2K6Q A;  3AUL A;  4RM9 A;  1F9J A;  3PTF C;  2ZCC A;  2ZEQ A;  2CHW A;  1QZE A;  4EFO A;  3CSF A;  2C9W B;  3R7Q A;  1SIF A;  4EZK A;  1KLV A;  1LQB A;  4IM3 A;  3QCA A;  2LXC A;  2LI5 A;  4W9F A;  4IWP A;  1V9J A;  3ECI A;  2K39 A;  4WJQ A;  4EEW A;  4NQL B;  4BKS A;  5LXI B;  2MBE A;  4IC7 B;  2WYQ A;  1ZGU B;  1MG8 A;  2NS5 A;  5JZE B;  1P9D U;  2NPT B;  4PS8 A;  1C1Y B;  2LVQ A;  4GU2 A;  3SU8 X;  2BYE A;  2LRW A;  4TQ0 A;  2KC2 A;  1WE7 A;  3TMP B;  3UGB B;  4GN1 A;  2GBK A;  2DAF A;  2IZV B;  4GDK B;  4ZRK A;  1WX7 A;  2KJ6 A;  2XBB C;  1E8X A;  4NY0 A;  2ZNV B;  4G0N B;  4DWF A;  2ZZP B;  4HPM B;  1WE6 A;  3JW0 X;  3PZD A;  4FBJ B;  2JRH A;  3QX1 A;  3L17 A;  4FHJ A;  2NBW B;  3H1U A;  2K8H A;  3HHM A;  5AZH A;  3DBS A;  2WX0 A;  2NR2 A;  3KH0 A;  1WY8 A;  2DHZ A;  3VH4 B;  2BWE S;  1I42 A;  1E7V A;  4PS7 A;  2IO3 B;  2FID A;  2K8B A;  2O6V B;  2KTF A;  3KYC D;  4IUM B;  2J0K A;  2OJR A;  2LJ5 A;  1YIW A;  3IVF A;  2MQJ A;  3K9O B;  1P3Q U;  3DVG Y;  1YJ1 A;  4XC2 A;  3DPD A;  3H7P B;  1JRU A;  4F8C B;  2L76 A;  3PVL A;  2OOB B;  3VAW A;  1WGY A;  2RR9 A;  1GC7 A;  1L7Y A;  3AXC A;  3OJ4 B;  3P2B A;  2G4S A;  4FAD A;  1XT9 B;  2XK5 B;  4MGK E;  3UQA A;  2BYF A;  3CST A;  3OJ3 A;  4GGQ A;  2L0T A;  2XK5 A;  3QK0 A;  2I1J A;  3WAN A;  1UGM A;  2ZVN A;  1GJZ A;  4E74 A;  2LGY A;  1XQQ A;  1S3S G;  2JT4 B;  4HVB A;  4MGY E;  3QIJ A;  1OTR B;  2L7R A;  1ISN A;  2LGX A;  3NOB A;  4LDT B;  4W9H A;  5CTR C;  1LXD A;  4KDL B;  4MH0 E;  4DXA B;  4FJV B;  4B95 A;  1TTN A;  1WJN A;  1WX9 A;  4ICV A;  1SE9 A;  5CHV C;  2FCN A;  2LVP A;  3OLM D;  3PHX B;  4IG7 B;  1WXA A;  2BPS A;  3B1L X;  1AAR A;  1PQS A;  2KJH B;  4PYU A;  3ZUN A;  2FCS A;  3A1Q A;  1M94 A;  3VHT C;  2MBO A;  3B0A A;  3DDC B;  3VUX A;  2V3S A;  3Q3J A;  3QAQ A;  2KWU B;  3W1S A;  2KX0 A;  3A4S C;  3MJW A;  4IM0 A;  1S1Q B;  4K7U A;  3VQI A;  1WZ0 A;  3ZKJ C;  3OAW A;  3JVZ X;  4IM2 A;  4IWO A;  1EF1 A;  1OEY A;  1R4M I;  3ZDM C;  3KYD D;  1YX5 B;  3LDZ E;  1D3Z A;  4GXB A;  2KVR A;  4NPN A;  5CHF A;  1UBI A;  3WAM A;  1LFD A;  3X23 A;  4BOS C;  4HDQ A;  5DCN A;  2MBB B;  3PGE A;  2ZCB A;  3QWZ B;  1IPG A;  2O6V D;  5J17 A;  3H9D A;  2AWT A;  2KLC A;  2KZR A;  2REX A;  2J7Q B;  3A9J B;  4HDO A;  4BVU C;  5TR5 A;  1WGD A;  2KQS A;  2D11 A;  2IO2 B;  5CX3 A;  5LXH A;  1WZ3 A;  1EUV B;  2UWQ A;  3NS8 A;  1TBE A;  4KVG B;  4A3O A;  2JUO A;  2CU1 A;  4PYZ A;  4W9K A;  4HK2 A;  4DHZ E;  2BYV E;  3DOW A;  3RYT A;  4BOZ B;  3WAP A;  5KHQ A;  3IFW B;  1J19 A;  2PE6 B;  1J0G A;  5LLI A;  2KX3 A;  2BWF A;  2B3A A;  3M3J A;  3O65 B;  2I1K A;  5E6P A;  2W9N A;  2D3G A;  4W9L A;  3ZVV A;  3RZF A;  3RT3 B;  2MBQ A;  3QAR A;  2G45 B;  2M17 A;  5AEK B;  2KFK B;  3EC8 A;  1E90 A;  3K9P B;  4LDT D;  5J18 A;  2ZPY A;  2UYZ B;  1Z2M A;  2NBV B;  4W9I A;  1T0Y A;  2HTH A;  4TQ1 A;  4TKN A;  1H8C A;  3T8M A;  2FCM A;  3DBR I;  1WMH B;  2JWZ A;  4NAW B;  2M0X A;  3UIP B;  3APF A;  3WAO A;  2L00 B;  2LXA A;  2PE9 A;  4GOC A;  1WJU A;  4OVU A;  2WX1 A;  2MX2 A;  1UZX B;  3DBL I;  4FJY A;  5JHA A;  4DHJ D;  2MLB A;  2NPT A;  3CMM B;  1WM3 A;  1WJ6 A;  2N1W A;  2KNB A;  4DBG A;  4F7Z A;  1EO6 A;  1TGZ B;  4EZJ A;  2MW5 A;  3VTW A;  2KTR B;  3PT2 B;  2LRU A;  3JYU A;  4TUU A;  2O2V B;  2WDT B;  3BIN A;  3VFK A;  2DYO A;  4GDK A;  4NNJ B;  3ZDT A;  2KTR A;  4M8M A;  1VCB A;  2C7H A;  2YVC A;  1NBF C;  2EKE C;  3PLV A;  3RZW C;  3W1Y A;  4FA6 A;  2MP2 B;  1L2N A;  3V61 A;  1Q1O A;  2CKH B;  3PRE A;  2KWC A;  3SHQ A;  3N30 A;  5IAA C;  1IYF A;  3PS6 A;  4BBN F;  2LD9 A;  2KMA A;  5AZG A;  2KLG A;  3DCG A;  4NQK E;  3VVW B;  4ZRI A;  4IW0 A;  3ZW3 A;  2KWV B;  4KIK B;  3ALB A;  4ZYN A;  4FHK A;  2IYD B;  3KVF B;  2BKR B;  2O6V A;  3QQ8 B;  4K7W A;  4MEM A;  2MBH A;  4BKT A;  3HIZ A;  5IA7 A;  2IO0 B;  4JGH B;  3ZLZ A;  5D7G A;  4I6N B;  2D2Q A;  2Z0D B;  2N7D A;  3H7P A;  4JIO U;  2QHO A;  3JSV B;  4BFR A;  5G2N A;  3M95 A;  3DQV A;  1V86 A;  3JSV A;  4E71 A;  2ZPN A;  1KOT A;  1U4A A;  4LJP B;  2FAZ A;  3SD5 A;  2KAN A;  2ASQ A;  3IBE A;  3PRP B;  4ANW A;  2G3Q B;  3ZRF A;  3KUZ A;  4ANU A;  3PV1 A;  1G6J A;  5CHW A;  2DZJ A;  2M1M A;  2Z59 B;  3TL5 A;  1WJ4 A;  2PPH A;  1OQY A;  4WQO B;  1I35 A;  1GG3 A;  2V1Y A;  4JLC A;  3VUW A;  2RGF A;  2IBI B;  5D6J B;  2FNJ B;  4WJP A;  2BF8 B;  4BBN C;  4URK A;  1E5W A;  4KSL C;  2ZVO A;  1H4R A;  2KN5 A;  1E8Y A;  2A4Z A;  2KHW B;  3NHE B;  4WWO A;  3M62 B;  5JH5 C;  3TCA A;  3ML8 A;  2KXJ A;  2LGD A;  3S2A A;  1Q5W B;  2GOW A;  5L95 C;  2KDB A;  1OGW A;  4DHJ B;  1RLF A;  1ZKH A;  4I6L B;  5HKH A;  5DPW A;  3WAL A;  2EMT A;  2JVC A;  4AP4 C;  3B08 A;  4MGI E;  1YQB A;  5AZF A;  1X1M A;  3PLU A;  1WFY A;  1WF9 A;  2MRP A;  5BO4 B;  3UIN B;  2JF5 A;  2C60 A;  2L0F A;  2D10 A;  3KW5 B;  2A5U A;  3SDL C;  2K8C A;  2M4N A;  2AL6 A;  1K8R B;  1V81 A;  1BT0 A;  1P1A A;  1XD3 B;  2XEW A;  3A9K B;  3V6E B;  1VD2 A;  3T9L A;  3ZNI D;  2Y5B B;  1SGH A;  3U7D A;  3A33 B;  3EFU A;  2N4F A;  2DZI A;  3MHS D;  1E8W A;  4KZC A;  2G4D B;  2L05 A;  3RD2 A;  4DHZ B;  3GOE A;  4TV3 A;  4AUQ C;  3A9J A;  4W9E A;  4JQW C;  3APC A;  3MTN B;  4G11 A;  3VTU A;  3VUY A;  1WXS A;  1V80 A;  2RD0 A;  1GC6 A;  4GDL B;  3VXW A;  1WI0 A;  4CO7 A;  2DEN B;  3L08 A;  4GDL A;  4ICU A;  4MJS B;  3V60 A;  2GMI C;  3GZN I;  4HJK A;  2DZM A;  3ZTC A;  3KUD B;  2AEH A;  4J6I A;  1C3T A;  4MEL A;  4IWQ A;  4BKG A;  4CYE A;  1WRD B;  2KD0 A;  3R66 C;  1NI2 A;  5G55 A;  4HPL B;  3DVN V;  3WA0 A;  1WM2 A;  4ANV A;  2KC1 A;  2KFK A;  2DAJ A;  3NZU A;  4EOY A;  3HM3 A;  2JXX A;  5E6N A;  2DYM A;  3HM6 X;  2L8J A;  1V5T A;  1WGG A;  4FN2 A;  4M8N A;  1WMH A;  4NAW A;  2MCN B;  1UH6 A;  2GBR A;  4KZ0 A;  2EMS A;  2R2O A;  3H7S A;  4WJN A;  4XZ4 A;  3L0W B;  2V4L A;  1HE8 A;  1Q0W B;  5EDS A;  3QJZ A;  1TZ1 A;  3QHT A;  2LZ6 A;  4ZDV A;  2FIF A;  3LJ3 A;  4MDK E;  4W9J A;  1EF5 A;  2O2V A;  5C1Z A;  2N9P C;  4A20 A;  4WWP A;  4AWJ A;  2GBM A;  2LUE A;  1WR6 E;  3AI5 A;  2NVU I;  2LWP A;  2N7E A;  2IY0 B;  2MP2 A;  3L13 A;  4G3X B;  4W9G A;  3C0R B;  2MA9 B;  3PRZ A;  3BY4 B;  4I6P A;  2HD5 B;  2RSU A;  4G50 A;  4AJW A;  4WWN A;  4E3C A;  3TIX A;  3QA8 A;  4KIK A;  4II2 B;  3ONS A;  2R2Q A;  2GBN A;  3NY5 A;  2NBU A;  4F1S A;  2JPH A;  4EZL A;  4NJ7 A;  4FLH A;  5L83 A;  3DVG X;  3R3M A;  3RUL A;  1V6E A;  3DBH I;  4GIV A;  4DK5 A;  1UEL A;  2JZ3 B;  4II3 B;  3H6N A;  3EEC A;  2CS4 A;  2JRI B;  3PSE B;  3R7R A;  1GNU A;  3U8Z A;  2LVO A;  3UQB A;  4FUL A;  3X0W A;  2BKF A;  2IY1 B;  4YL8 A;  4W9D A;  5DPT A;  4WJO A;  3ZRC A;  3ZO5 B;  3AU4 A;  3APD A;  2DYB A;  4KSK C;  3WIM A;  4N9F 4;  2VRR B;  3TBL D;  1KJT A;  4OVV A;  1UBQ A;  3W1S C;  1E7U A;  2L3Z A;  3DVN U;  4K1R B;  1WGR A;  2Z0E B;  4MGZ E;  2D07 B;  1J8C A;  2NCN A;  1WXM A;  1WIA A;  3Q3F A;  3VTV A;  1CMX B;  1A5R A;  1KM7 A;  4GSW A;  1V2Y A;  4HCN B;  4WAA A;  2C7N B;  3IG3 A;  3ML9 A;  3NZS A;  4ASW C;  1YX6 B;  3HK0 A;  4GB9 A;  2KDE B;  4FJZ A;  2K6D B;  5KHO A;  3RCZ A;  4AOF A;  2KQ7 A;  2YLM A;  2DZK A;  2AL3 A;  2K1F A;  5E6O A;  3ZIM A;  4B9K A;  2KO3 A;  2AYO B;  1ZW7 A;  3ENE A;  2IO1 B;  3U30 A;  3ZNZ B;  3A4R A;  5D94 A;  3PPA A;  4ZRJ A;  5GMV A;  4HWI B;  1P98 A;  1RRB A;  2GBJ A;  3PRM B;  4RM8 A;  4AJY B;  1E8Z A;  1UD7 A;  4X57 B;  2J0J A; 
#chains in the Genus database with same CATH topology
 4W9C A;  4XX5 A;  2ONQ A;  2QC8 A;  5C23 A;  4RNA A;  1E7P B;  2DX5 B;  3A9K A;  4M0W B;  3AE9 B;  3N20 C;  2FCQ A;  3TJP A;  2LAS A;  1D4B A;  3J9C A;  4PS3 A;  4MSQ B;  1WGH A;  4MM3 A;  2INP E;  5G5G A;  1GUA B;  3DHG C;  2CHZ A;  1FFU A;  3C8Y A;  2WU2 B;  1XO3 A;  4MJS A;  2CHX A;  3RMK C;  5DPR A;  2WXP A;  1VDV A;  2TSS A;  3DBL B;  2N1V A;  3AE7 B;  2W82 A;  3KUC B;  3N1X C;  4HKZ E;  1V49 A;  1WX8 A;  2L52 A;  1V5O A;  4OZB A;  2YEP F;  2N9X A;  4HRO A;  2WXG A;  2BS2 B;  3GS2 A;  2ZNV C;  4DDG D;  1SJE D;  2KDI A;  4EUT A;  1C9F A;  1F9J A;  2ZCC A;  2GI9 A;  3L4P A;  1LGR A;  1SIF A;  2NTS A;  4HPP A;  4W9F A;  4EEW A;  5LXI B;  2MBE A;  2B76 B;  4PS8 A;  3MHZ A;  1V8C A;  1WX7 A;  3I57 A;  2XBB C;  4WH4 A;  4ZRP A;  2K9X A;  4G0N B;  3JW0 X;  2JRH A;  3QX1 A;  3L17 A;  2NBW B;  3KH0 A;  4YXD B;  1I42 A;  1E7V A;  2FID A;  4S17 A;  2J0K A;  2OJR A;  3IVF A;  3K9O B;  3DVG Y;  2AQ1 B;  3E56 A;  2ON8 A;  1N5W A;  3H7P B;  4F8C B;  1N6Z A;  3KWL A;  1OQQ A;  2RR9 A;  2H88 B;  3AXC A;  3OJ4 B;  2G4S A;  1JWU D;  3CST A;  3IXS A;  2I1J A;  3WAN A;  4E74 A;  1S3S G;  4MGY E;  1TYG B;  1ISN A;  1ZPS A;  4ZOH C;  4LDT B;  4URK A;  5CTR C;  4MH0 E;  4B95 A;  1WX9 A;  1C76 A;  2LVP A;  1QOF A;  2VZK D;  1MPE A;  3V05 A;  4YTP B;  1S1Q B;  4RFB A;  3ZKJ C;  3GZN B;  3OAW A;  4IM2 A;  1R4M I;  1OEY A;  1Q10 A;  2Y5C A;  5BYR A;  4L1B A;  5FR3 A;  1JW9 D;  4GXB A;  4JWU C;  2J4X A;  3MC0 B;  1WWT A;  3WAM A;  2W55 A;  4BOS C;  3HUI A;  4HDQ A;  2MBB B;  3PGE A;  5HG2 A;  2AWT A;  2KLC A;  3A9J B;  1WGD A;  2KQS A;  2IO2 B;  3AE2 B;  2VH2 A;  5CX3 A;  1WZ3 A;  1EUV B;  2UWQ A;  3NS8 A;  1UF0 A;  4KVG B;  2CU1 A;  4W9K A;  5IKC M;  2BYV E;  4LNO A;  4BOZ B;  1V1P B;  1B1Z A;  3AH7 A;  3BWU D;  2KX3 A;  2BWF A;  2B3A A;  3ZVV A;  1YMH E;  1J7B A;  3RPF C;  2G45 B;  2M17 A;  3EC8 A;  4LDT D;  1RFK A;  5J18 A;  3ZJT A;  2D5G A;  2ZPY A;  4OZC A;  1Z2M A;  5IP4 D;  3NS1 A;  4TQ1 A;  2INC C;  3DBR I;  1WMH B;  2M0X A;  3UIP B;  3APF A;  3WAO A;  2L00 B;  1FRR A;  2LXA A;  4GOC A;  1WJU A;  4OVU A;  4NAM A;  1UZX B;  4FJY A;  5JHA A;  2FUG 1;  4ACF A;  1R7S A;  1WJ6 A;  2KNB A;  1EO6 A;  2I38 A;  1T0S C;  2KTR B;  3PT2 B;  1FPY A;  2O2V B;  2WDT B;  1D5X C;  1L2N A;  2WXL A;  2CKH B;  5IAA C;  1SF0 A;  1ZXI A;  3AEC B;  3ZW3 A;  4ZRI A;  4IW0 A;  4KIK B;  3QQ8 B;  4MEM A;  2MBH A;  4ZHP A;  2DLB A;  1TKE A;  2IO0 B;  4HJG E;  3H7P A;  3N1Z C;  1N5X A;  1HQR D;  4ITK A;  1V86 A;  1N60 A;  4E71 A;  3SD5 A;  1L6U A;  1NYR A;  2G3Q B;  3ZRF A;  1C78 A;  2DZJ A;  2M1M A;  2PPH A;  1OQY A;  4WQO B;  3ZJU A;  1GG3 A;  3WCQ A;  3VUW A;  2RGF A;  4NZL B;  3PZ7 A;  5D6J B;  2JYE A;  2FNJ B;  4BBN C;  1ENF A;  2INN E;  3LYY A;  4KSL C;  1BML C;  5EE9 A;  3Q8A A;  1NI3 A;  2A4Z A;  2KHW B;  1KFY B;  1I4H A;  1GOZ A;  1YNT E;  2GOW A;  5L95 C;  4DHJ B;  1F2R C;  1RLF A;  1ZKH A;  5HKH A;  3WAL A;  4AP4 C;  1XLN A;  2JVC A;  3B08 A;  2MRP A;  1WF9 A;  3FC4 A;  1XCT L;  2RDB C;  2WP9 B;  3B2G A;  2A5U A;  3AN1 A;  2M4N A;  2NMQ A;  1XD3 B;  1C79 A;  3T9L A;  2G4D B;  3NVY A;  4TV3 A;  3A9J A;  4BAX A;  1ZDX A;  4JQW C;  5BYS A;  1YN3 A;  3MTN B;  3VUY A;  3SFE B;  2K3U A;  1WI0 A;  3L08 A;  1VZ8 A;  1AYF A;  2D3B A;  2DWQ A;  4ARC A;  2Q5W D;  1V1P A;  4HJK A;  4J6I A;  1SEB D;  4UDU C;  2KD0 A;  3BVG A;  3HM3 A;  5E6N A;  1WGG A;  4FN2 A;  4M8N A;  1WMH A;  1PYW D;  3ETR A;  1KLG D;  2Y3A A;  2GBR A;  4KZ0 A;  4XZ4 A;  4XGA B;  2LZ6 A;  1YJJ A;  4MDK E;  3NVW A;  3AMZ A;  1EF5 A;  1ZDV A;  2O2V A;  2N9P C;  3B9J A;  1FNU A;  3AI5 A;  1WR6 E;  2LWP A;  5HI1 A;  4G3X B;  2WDV B;  4LNI A;  4W9G A;  3C0R B;  2N7J A;  1FXA A;  2HD5 B;  4AJW A;  1HZ6 A;  4KIK A;  1GB4 A;  3ONS A;  2R2Q A;  2GBN A;  2LGI A;  3NY5 A;  3DVG X;  4OZA A;  1SIJ A;  3RUL A;  1V6E A;  3DBH I;  4GIV A;  1WXQ A;  3H6N A;  2JRI B;  2K5P A;  4FUL A;  1PFD A;  3X0W A;  2BKF A;  2AX5 A;  1VZ6 A;  4Q2J A;  3APD A;  2DYB A;  2HTM E;  4IOI E;  1EU4 A;  3TBL D;  3GE3 C;  1KJT A;  1UBQ A;  1PGX A;  1Y56 A;  2L3Z A;  5D3D A;  5G5H A;  4MGZ E;  2D07 B;  3AE3 B;  2NCN A;  5BMG A;  3Q3F A;  2HDE A;  1QKZ A;  2C7N B;  3NZS A;  3Q8C A;  1AWD A;  2WXN A;  1JQ4 A;  4AOF A;  1D5M C;  2YLM A;  1B9R A;  2K1F A;  4O1N A;  4B9K A;  2LEK A;  2AYO B;  1ZW7 A;  3A4R A;  1UGJ A;  5GMV A;  1UUP A;  1P98 A;  1RRB A;  2QIL A;  5BMI A;  2FUH B;  4JL9 A;  1C4P A;  2KJR A;  4XWW A;  3VDZ A;  3Q8E A;  3Q69 A;  5IOI A;  2C7M B;  3HVD A;  1RFA A;  2KMC A;  5E6J A;  5HFY A;  3TEZ A;  3EHV A;  1YD8 U;  4L2Y A;  1HA5 A;  3MC8 A;  3RNB C;  1WR1 A;  3N3K B;  3IAM 1;  2BYT A;  4DXG A;  1Y8R C;  3GB1 A;  4P7I A;  2KK8 A;  3HVZ A;  2WXK A;  4XWT A;  2KKC A;  3NG0 A;  3L16 A;  4BZA A;  1WH3 A;  3KLS X;  1WYW B;  4KV2 A;  4K81 A;  2KFJ A;  3W5U B;  2J0M A;  3NUH B;  1F2R I;  1QZE A;  4EFO A;  2G9H D;  2D3C A;  1HEZ E;  2IDY A;  2C9W B;  4L23 A;  1LQB A;  3MJ5 A;  4IM3 A;  3VR8 B;  1AW7 A;  2LI5 A;  4A6Q A;  4IWP A;  1V9J A;  4NQL B;  4HRS A;  1ZGU B;  2PLP A;  3KWV A;  5JZE B;  2NPT B;  2MHJ A;  2BYE A;  2LRW A;  1PGB A;  2KC2 A;  1WE7 A;  3TMP B;  1QT9 A;  4GN1 A;  2E6X A;  4GDK B;  4ZRK A;  1MI0 A;  1DYQ A;  1E8X A;  3AV8 A;  5JXV A;  3UI3 A;  3P1M A;  1JRO A;  4C7Z A;  2K8H A;  3DBS A;  3VH4 B;  3AED B;  4PS7 A;  2IO3 B;  1D6E C;  1QIL A;  1YIW A;  4XC2 A;  2L76 A;  1YJI A;  1GC7 A;  1L7Y A;  1XT9 B;  3OJ3 A;  3TEY A;  2L0T A;  4RF1 A;  1UGM A;  1GJZ A;  2QEJ C;  1WGK A;  3ZQ4 A;  2MJD A;  4HVB A;  3QIJ A;  2L7R A;  3R2I A;  2LGX A;  3U52 E;  2V9H A;  4DXA B;  1SE9 A;  4ZYS A;  3BK2 A;  1WXA A;  3B1L X;  1PQS A;  2KJH B;  2FCS A;  3VUX A;  3QAQ A;  2KWU B;  3W1S A;  4K7U A;  1J7A A;  5H8Y E;  1ET6 A;  1F52 A;  3Q8F A;  3LDZ E;  5EE0 A;  2KVR A;  5CHF A;  2WNM A;  4US9 A;  1C77 A;  1LFD A;  1CZP A;  3ZGZ A;  3AEF B;  5DCN A;  3ZXR A;  2ZCB A;  1IPG A;  2JWU A;  1FNV A;  2JSV X;  2KZR A;  2REX A;  4HDO A;  4BVU C;  2D11 A;  4US8 A;  4EE2 A;  1TBE A;  2WQY B;  4PYZ A;  3I5J C;  4DHZ E;  2UU7 A;  3PZ8 A;  3WAP A;  1J19 A;  2PE6 B;  1JRP A;  3O65 B;  5E6P A;  3OG5 A;  4QAY A;  1FNW A;  3RZF A;  2MBQ A;  2V0G A;  2KFK B;  4C4V A;  2UYZ B;  1JWS D;  3Q2A C;  1T0Y A;  2HTH A;  3NJT A;  1H8C A;  2KAJ A;  1ZXH A;  4OVZ A;  2GB1 A;  2VZK B;  3DBL I;  2N9L A;  1UWM A;  3CMM B;  2NPT A;  4DBG A;  4TMA B;  1SE3 A;  1TGZ B;  4DXF A;  4EZJ A;  4TUU A;  4GDK A;  4NNJ B;  2BQQ A;  3SFD B;  2V3N A;  2KAC A;  4FA6 A;  2EKE C;  3BVZ A;  2MP2 B;  4LNK A;  1Q1O A;  2CU3 A;  2WXJ A;  5AZG A;  2KLG A;  1FM0 D;  2LFI A;  3ALB A;  4FHK A;  1QOA A;  4BKT A;  3NRZ A;  3HIZ A;  3MC9 A;  2D2Q A;  1XLO A;  2N7D A;  4JIO U;  1VJK A;  4BFR A;  3M95 A;  4LJP B;  2KAN A;  2YEP B;  2ASQ A;  2K0P A;  3IBE A;  4P6V F;  2Z59 B;  3TL5 A;  1N63 A;  1I35 A;  2LMC A;  3HRD D;  1SBB B;  4WJP A;  2BF8 B;  1I4X A;  4B0E A;  2ZVO A;  3TUO A;  1H4R A;  4D2K A;  1E8Y A;  4WWO A;  1D5Z C;  5JH5 C;  1HTQ A;  2LGD A;  2PIA A;  1Q5W B;  1OGW A;  3NZ3 A;  1STE A;  4WUR A;  4C00 A;  2BS4 B;  3BII D;  2ICI A;  5AZF A;  1X1M A;  1F1H A;  1TKG A;  2C60 A;  5FKA C;  1WYG A;  2K8C A;  1TS2 A;  1V81 A;  1P1A A;  4KGR A;  3ZNI D;  2Y5B B;  2N4F A;  1E8W A;  2L05 A;  3RD2 A;  4DHZ B;  3GE8 C;  3APC A;  4G11 A;  2M19 A;  1WXS A;  1BUI C;  4CO7 A;  2WXI A;  2DEN B;  3Q8B A;  3DBR B;  5C2T B;  2GMI C;  3V60 A;  3GZN I;  2DZM A;  4RCO A;  3ZTC A;  2AEH A;  4MEL A;  2LUM A;  1NI2 A;  3DVN V;  4ANV A;  2KFK A;  2DAJ A;  4EOY A;  1E10 A;  4RGT A;  2JXX A;  3HM6 X;  4KGT A;  1V5T A;  4C7Y A;  1UH6 A;  4REZ A;  3H7S A;  4WJN A;  3L0W B;  1KTK A;  2V4L A;  2VH1 A;  5EDS A;  1JAL A;  1XLQ A;  1TZ1 A;  3QJZ A;  1L0V B;  3KQ4 A;  4PK1 A;  4AWJ A;  4A20 A;  1F0Z A;  2X38 A;  2MP2 A;  2SEB D;  4KGS A;  2MA9 B;  4M02 A;  3FAH A;  2WXO A;  1FXI A;  2RSU A;  4PT5 A;  4YT0 B;  2GRI A;  4RF0 A;  3EA6 A;  2HJ1 A;  4NJ7 A;  2RDH A;  5EE1 A;  1SJH D;  1FFV A;  3CIR B;  3EEC A;  1V97 A;  2ZW0 A;  3U8Z A;  2LVO A;  2QMT A;  2IY1 B;  1HXY D;  4TSS A;  5DPT A;  1M4V A;  3AU4 A;  4A9A A;  1VRA B;  2PVO D;  3AE6 B;  4OVV A;  5D3I B;  3W1S C;  1E7U A;  1KRH A;  3BZD B;  2MJE A;  3ZJV A;  1TIF A;  1J8C A;  1WIA A;  3VTV A;  1CMX B;  1A5R A;  4HCN B;  3ML9 A;  3EGR A;  4ASW C;  5TSS A;  1YX6 B;  4YSY B;  5KHO A;  3RCZ A;  5E6O A;  1TZO A;  3I63 C;  3N1Y C;  2KMM A;  3PPA A;  4HKQ A;  1HTO A;  3VRA B;  2GBJ A;  3PRM B;  4RM8 A;  1E8Z A;  4X57 B;  4ANX A;  2FE8 A;  2MH7 A;  4BKS D;  1WRI A;  1RM6 C;  2PVG C;  3P4R B;  3L10 B;  4MSM B;  2GLS A;  4YWG G;  3IHP C;  3M63 B;  4LCD E;  2JY6 A;  1I4R A;  1RAX A;  3Q6B A;  3AE4 B;  1LM8 B;  2M8S A;  2HJ8 A;  2MSE D;  5FR6 A;  4ANW A;  1NVI D;  2N9E B;  4B6W A;  3V62 A;  4A3P A;  2LGS A;  5J2R A;  2ZJD A;  4RMA A;  2QDF A;  4KKJ A;  1R4N I;  1MHX A;  3N32 A;  2OHF A;  2LHE A;  1FRD A;  4GMV A;  2MWS B;  2KWD A;  2Z8L A;  1IP9 A;  2BGF A;  4IKG A;  3ZNH B;  4KDI C;  2CR5 A;  1I4G A;  4R3D A;  1YOV B;  3AU5 A;  4LJO B;  1E6E B;  1QQR A;  5JHB A;  2JZZ A;  3DHH C;  3I3T B;  2K6Q A;  4RM9 A;  1DGJ A;  4RGM A;  3CSF A;  3R7Q A;  5HHD G;  2Y5P A;  1FO4 A;  4JE3 B;  2MJ3 A;  1IGD A;  3ECI A;  1MJD A;  2K39 A;  4WJQ A;  4BKS A;  1MG8 A;  2BT6 A;  4N6E B;  1P9D U;  1C1Y B;  1ET9 A;  4GU2 A;  5EE3 A;  1VLB A;  4P16 A;  2GBK A;  2DAF A;  2IZV B;  4YTN B;  1GB1 A;  2W3S A;  1OQR A;  2RDG A;  2ZZP B;  3P4P B;  1NEK B;  4HPM B;  3PZD A;  4FBJ B;  3ABV B;  4FHJ A;  3H1U A;  3HHM A;  1ESF A;  2WX0 A;  2NR2 A;  1TY2 A;  2DHZ A;  2BWE S;  1QOB A;  4OW0 A;  4IUM B;  1SB3 C;  1YJ1 A;  3DPD A;  2WXM A;  2ACZ B;  3P63 A;  1F77 A;  3PVL A;  4K3B A;  3VAW A;  1WGY A;  2V3P A;  2WU5 B;  3UQA A;  4MGK E;  2OED A;  1HZ5 A;  2XK5 A;  1BXT A;  3QK0 A;  2ZVN A;  2BW2 A;  1XQQ A;  2JT4 B;  4MT5 A;  3NOB A;  4W9H A;  1LXD A;  1WJN A;  2R61 A;  4ICV A;  1YQ4 B;  2PW9 A;  2FCN A;  3OLM D;  4IG7 B;  3PHX B;  2BPS A;  1IGC A;  2RMM A;  1AAR A;  1I4Q A;  2BB6 A;  3Q3N C;  5GXG B;  3DDC B;  3Q3J A;  2X8X X;  1L6V A;  4USA A;  2KX0 A;  3A4S C;  3MJW A;  2IGG A;  1OFF A;  1PGA A;  4JX1 C;  4WIP A;  3AM9 A;  3JVZ X;  1MHH E;  4IWO A;  3ZDM C;  1SXT A;  3KYD D;  3N9Y C;  3ZYY X;  4NPN A;  2ZW1 A;  3X23 A;  3QWZ B;  2IPK D;  3H9D A;  2AQ2 B;  1E9M A;  3T3O A;  5LXH A;  4XDD A;  2LHD A;  4A3O A;  2JUO A;  3DOW A;  2J53 A;  1ACC A;  1QF6 A;  4YTM B;  1YN5 A;  3DHI C;  1XEE A;  2WXR A;  3I9V 1;  4S0R A;  4W9L A;  4C4V B;  3RT3 B;  3QAR A;  1MG4 A;  2JYT A;  4MAC A;  4JPS A;  1E90 A;  1MVK A;  1FCC C;  2KDM A;  3EFC A;  3RFZ B;  4TKN A;  3T3N A;  1DOX A;  4OHJ A;  2PE9 A;  1QLB B;  2IND C;  4F7Z A;  2MW5 A;  3VTW A;  2LRU A;  3BIN A;  5MPO A;  2DYO A;  1YQ3 B;  1VCB A;  2C7H A;  2YVC A;  3PLV A;  3RZW C;  3W1Y A;  1GAQ B;  3SHQ A;  3N30 A;  1IYF A;  3PS6 A;  2LD9 A;  3DCG A;  4ZYN A;  2IYD B;  4K7W A;  4JGH B;  3ZLZ A;  2QHO A;  1RWS A;  2BS3 B;  4ZHO A;  1LO5 D;  2QSD A;  3JSV A;  3C19 A;  1KOT A;  1U4A A;  2FAZ A;  2J52 A;  3IT4 B;  3PV1 A;  1G6J A;  5CHW A;  1WJ4 A;  4B0M A;  2D3A A;  2IBI B;  1J7C A;  1T0R C;  4ARI A;  1E5W A;  5BMH A;  2BB5 A;  3AE1 B;  4IDI A;  3M62 B;  2WDR B;  3ML8 A;  1L0Y B;  2KXJ A;  3S2A A;  2KDB A;  4P1B C;  1DOY A;  2KQ4 X;  4XYC A;  3AEG B;  2EMT A;  2E3T A;  1YQB A;  3PLU A;  1WFY A;  3MFG A;  3UIN B;  3RNE C;  1T5X D;  2D10 A;  3KW5 B;  4WQM A;  2KYW A;  1FEH A;  1K8R B;  3TEW A;  2L83 A;  2XEW A;  3V6E B;  1VD2 A;  3A33 B;  1NYQ A;  3AEB B;  2DZI A;  2KVZ A;  4AUQ C;  4W9E A;  2PMV A;  2WXH A;  1SE4 A;  2RD0 A;  1RYJ A;  1PUT A;  4GDL A;  2NTT A;  2I2Y A;  1P7F A;  1K52 A;  3CWI A;  1C3T A;  4DQO C;  4IWQ A;  4BKG A;  4CYE A;  2DNF A;  3R66 C;  5G55 A;  1GPX A;  4HPL B;  1WM2 A;  3NZU A;  1P7E A;  4A90 A;  2L8J A;  1ZUD 2;  2MEK A;  2EMS A;  2H89 B;  3AEA B;  1HE8 A;  2QJL A;  1N61 A;  1VZ7 A;  2N9K A;  4ZDV A;  2FIF A;  5BYQ A;  1SE2 A;  1TJE A;  4WWP A;  2N7E A;  3L13 A;  2IGD A;  1K50 A;  3W2D A;  3H8H A;  4E3C A;  3TIX A;  4II2 B;  2NBU A;  4F1S A;  2EEL A;  2JPH A;  4FLH A;  5AUK A;  3R3M A;  4DK5 A;  1UEL A;  2JZ3 B;  4II3 B;  4RH6 A;  3R7R A;  1GNU A;  4WJO A;  3ZRC A;  3ZO5 B;  2EKI A;  4N58 A;  4N9F 4;  3URY A;  1CQV A;  1XF5 L;  2JU6 X;  1A70 A;  3DVN U;  4K1R B;  1WGR A;  2Z0E B;  2PTL A;  4M01 A;  1R4M B;  1KM7 A;  4GSW A;  3DWM A;  2KDE B;  4FJZ A;  3EUB 2;  2KQ7 A;  2DZK A;  2AL3 A;  4JWS C;  3P4S B;  2KO3 A;  3U30 A;  3ZNZ B;  5D94 A;  1FIQ A;  4ZRJ A;  4HWI B;  2L32 A;  3U4E G;  2J0J A;  4C56 C;  1EM7 A;  2FBW B;  3RUI B;  3A1Q B;  3PHW B;  3VH3 B;  4K7S A;  2KOX A;  2KN4 A;  4DDI D;  1QOG A;  4J3O D;  1P0R A;  4CHK A;  1Z5S B;  1TKY A;  4M00 A;  4M0W A;  3ZNG C;  4HXD A;  1NDD A;  2PEA A;  4HCP B;  4NJ6 A;  4EKU A;  4WAF A;  1L4Z B;  1OEY J;  2QCZ A;  1TY0 A;  1EWC A;  2RPQ A;  3LXF A;  1YN4 A;  4XE0 A;  3L54 A;  3UIO B;  2C5L C;  3RNC C;  2PJH A;  2WXQ A;  3UF8 A;  3CF6 E;  5C3J B;  1FMA D;  4HLE A;  1WXV A;  4N59 A;  3V6C B;  3QC8 B;  2WWZ A;  5DPS A;  1FXT B;  3ZTD A;  2K25 A;  4FXC A;  5LNK 1;  4YSZ B;  1UWX A;  1KH0 A;  2HE7 A;  2KDF B;  5D2M B;  3D32 A;  1TS4 A;  3W9C B;  3AUL A;  3PTF C;  3W5V B;  2ZEQ A;  2CHW A;  1I4P A;  1DOI A;  4EZK A;  1KLV A;  2CJN A;  3QCA A;  2LXC A;  1WSP A;  4IC7 B;  2WYQ A;  2NS5 A;  1C4A A;  3RI7 C;  3SU8 X;  2LVQ A;  4MH8 A;  1PDX A;  1JCK B;  4TQ0 A;  3UGB B;  1T3Q A;  3RNA C;  1K51 A;  1JWM D;  2KJ6 A;  3R2T A;  4NY0 A;  2ZNV B;  4DWF A;  4LK0 M;  1WE6 A;  1IBX B;  4WWM A;  5AZH A;  1WY8 A;  1ZP0 B;  2K8B A;  2O6V B;  2KTF A;  3FIL B;  3KYC D;  2V4I B;  2LJ5 A;  3SEB A;  2MQJ A;  1P3Q U;  1JRU A;  2OOB B;  3P2B A;  2AQ3 B;  4FAD A;  2XK5 B;  2BYF A;  4GLS C;  4GGQ A;  2OJW A;  2DBY A;  4AQ7 A;  3Q3O C;  2LGY A;  1L0X B;  1OTR B;  2L1A A;  2W54 A;  4KDL B;  4FJV B;  1JML A;  1TTN A;  5CHV C;  2JX5 A;  1XCQ L;  4PYU A;  4AS1 A;  3ZUN A;  3Q14 C;  3A1Q A;  3VHT C;  1M94 A;  1JWA D;  2MBO A;  3B0A A;  2V3S A;  2IGH A;  5H92 C;  2JQR B;  4IM0 A;  1R4N B;  3VQI A;  1WZ0 A;  1I7H A;  4H2A A;  1EF1 A;  5IO9 A;  5IN7 A;  2LJI A;  1YX5 B;  1D3Z A;  3RN9 C;  4RGN A;  1KLU D;  1UBI A;  2M56 B;  3IAS 1;  4KX6 B;  2O6V D;  3BYY B;  5J17 A;  1K53 A;  1IUE A;  2J7Q B;  4XDC A;  5TR5 A;  1KF6 B;  3V3X A;  1FCL A;  4HK2 A;  2N0S B;  1SSN A;  1UNS A;  4P1C C;  3RYT A;  5KHQ A;  3IFW B;  1J0G A;  5LLI A;  2XN9 C;  2W3R A;  3M3J A;  2I1K A;  2W9N A;  2D3G A;  3OWE B;  5AEK B;  4LLG M;  3K9P B;  3RNF C;  3TEX A;  2NBV B;  4W9I A;  2JXT A;  3GP7 A;  3T8M A;  2FCM A;  2JWZ A;  4NAW B;  3Q3M C;  3ZXV A;  3U7Z A;  4NJC A;  2WX1 A;  3DBH B;  2MX2 A;  4DHJ D;  3B2F A;  2MLB A;  4RGO S;  1WM3 A;  2N1W A;  3VVW B;  3JYU A;  3ZDT A;  3VFK A;  2KTR A;  4M8M A;  1NBF C;  4A8X C;  1JWB D;  3V61 A;  2RPV A;  3PRE A;  2KWC A;  1ROE A;  2M0A A;  4BBN F;  1IBX A;  2KMA A;  3DWG C;  4NQK E;  2KWV B;  3AB5 A;  1XLP A;  3KVF B;  2BKR B;  2O6V A;  3FIL A;  1EU3 A;  3PO0 A;  5IA7 A;  5D7G A;  4I6N B;  2Z0D B;  3P4Q B;  3JSV B;  4LNF A;  3NVV A;  5G2N A;  3DQV A;  2ZPN A;  4ZRQ A;  3PRP B;  3KUZ A;  4ANU A;  3E9S A;  2QIE B;  4YSX B;  5I4D A;  3BK1 A;  4JLC A;  2V1Y A;  3VR9 B;  1MFW A;  2IJ0 A;  2KN5 A;  3NHE B;  1CJE A;  3TCA A;  3FKY A;  2WLB A;  4I6L B;  5DPW A;  1VR9 A;  4MGI E;  3BVM A;  3U2S C;  5BO4 B;  2JF5 A;  4KKI A;  2L0F A;  3P42 A;  3LB8 C;  2SAK A;  3SDL C;  2BBC A;  2AL6 A;  2K22 A;  1BT0 A;  3A9K B;  1FD6 A;  1T6B X;  3U7D A;  1SGH A;  4K3C A;  1ZE3 D;  3EFU A;  4LTU A;  3MHS D;  4A55 A;  4KZC A;  2WDQ B;  3GOE A;  2KT7 A;  3MP9 A;  4MM3 B;  3VTU A;  4HEA 1;  1V80 A;  4GDL B;  1GC6 A;  3VXW A;  4ICU A;  2J42 A;  4MJS B;  2CJO A;  1L5P A;  3KUD B;  1TT5 B;  1WRD B;  2JZP A;  1L4D B;  3TSS A;  3WA0 A;  2KC1 A;  3AE8 B;  3VRB B;  1TS3 A;  2DYM A;  4NAW A;  2MCN B;  3AEE B;  2R2O A;  1V1O A;  1ZOY B;  1Q0W B;  3RNG C;  3QHT A;  1TS5 A;  5FK9 C;  1NEN B;  3LJ3 A;  4W9J A;  5T8I A;  2G1E A;  3IT6 B;  5C1Z A;  2GBM A;  2LUE A;  2NVU I;  2IY0 B;  5AUI A;  3BYT B;  3PRZ A;  3BY4 B;  4I6P A;  4G50 A;  2WS3 B;  4WWN A;  3SR6 A;  3QA8 A;  2XNA C;  1C4C A;  4EZL A;  5L83 A;  2CS4 A;  3PSE B;  3O13 A;  2BTE A;  3AE5 B;  3UQB A;  4YL8 A;  4W9D A;  1EWY C;  2BVC A;  4KSK C;  3WIM A;  2VRR B;  4LNN A;  2PKO A;  3R8B A;  4CQN A;  1E0Z A;  3NVZ A;  1WXM A;  1V2Y A;  4WAA A;  3IG3 A;  3HK0 A;  4GB9 A;  1T0Q C;  2K6D B;  2WHI A;  3ZIM A;  1AN8 A;  3ENE A;  2IO1 B;  1CK1 A;  1XXG A;  1N62 A;  2WGS A;  4C80 A;  4AJY B;  2WXF A;  1UD7 A; 
#chains in the Genus database with same CATH homology
 4W9C A;  3RUI B;  3A1Q B;  4ANX A;  4BKS D;  4XX5 A;  2FUH B;  3PHW B;  5C23 A;  3VH3 B;  4K7S A;  2KOX A;  4JL9 A;  2KJR A;  3L10 B;  4MSM B;  3IHP C;  2DX5 B;  4DDI D;  3M63 B;  4LCD E;  1P0R A;  3VDZ A;  2JY6 A;  3A9K A;  1RAX A;  4M0W B;  4CHK A;  1Z5S B;  2C7M B;  1RFA A;  2KMC A;  1LM8 B;  2FCQ A;  2HJ8 A;  2LAS A;  2M8S A;  2MSE D;  4HXD A;  5FR6 A;  1NDD A;  2N9E B;  3TJP A;  3ZNG C;  4B6W A;  2PEA A;  4PS3 A;  4MSQ B;  4HCP B;  3EHV A;  4NJ6 A;  3V62 A;  4EKU A;  4A3P A;  1YD8 U;  5J2R A;  1OEY J;  1WGH A;  4MM3 A;  2ZJD A;  2RPQ A;  4RMA A;  1GUA B;  1R4N I;  3L54 A;  2C5L C;  3UIO B;  2CHZ A;  3N32 A;  1WR1 A;  2PJH A;  3UF8 A;  3N3K B;  3CF6 E;  4MJS A;  4GMV A;  2MWS B;  1Y8R C;  2CHX A;  5DPR A;  4HLE A;  1WXV A;  1IP9 A;  4P7I A;  2N1V A;  2KK8 A;  3V6C B;  3KUC B;  1V49 A;  2BGF A;  1WX8 A;  1FXT B;  2WWZ A;  3QC8 B;  1V5O A;  2KKC A;  5DPS A;  3L16 A;  2K25 A;  3ZTD A;  2N9X A;  3ZNH B;  4KDI C;  2CR5 A;  1WH3 A;  1WYW B;  4KV2 A;  3AU5 A;  4K81 A;  2HE7 A;  2KFJ A;  2KDF B;  4LJO B;  3D32 A;  5D2M B;  5JHB A;  2ZNV C;  2JZZ A;  4DDG D;  2KDI A;  3I3T B;  2J0M A;  4EUT A;  2K6Q A;  3AUL A;  4RM9 A;  1F9J A;  3PTF C;  2ZCC A;  2ZEQ A;  2CHW A;  1QZE A;  4EFO A;  3CSF A;  2C9W B;  3R7Q A;  1SIF A;  4EZK A;  1KLV A;  1LQB A;  4IM3 A;  3QCA A;  2LXC A;  2LI5 A;  4W9F A;  4IWP A;  1V9J A;  3ECI A;  2K39 A;  4WJQ A;  4EEW A;  4NQL B;  4BKS A;  5LXI B;  2MBE A;  4IC7 B;  2WYQ A;  1ZGU B;  1MG8 A;  2NS5 A;  5JZE B;  1P9D U;  2NPT B;  4PS8 A;  1C1Y B;  2LVQ A;  4GU2 A;  3SU8 X;  2BYE A;  2LRW A;  4TQ0 A;  2KC2 A;  1WE7 A;  3TMP B;  3UGB B;  4GN1 A;  2GBK A;  2DAF A;  2IZV B;  4GDK B;  4ZRK A;  1WX7 A;  2KJ6 A;  2XBB C;  1E8X A;  4NY0 A;  2ZNV B;  4G0N B;  4DWF A;  2ZZP B;  4HPM B;  1WE6 A;  3JW0 X;  3PZD A;  4FBJ B;  2JRH A;  3QX1 A;  3L17 A;  4FHJ A;  2NBW B;  3H1U A;  2K8H A;  3HHM A;  5AZH A;  3DBS A;  2WX0 A;  2NR2 A;  3KH0 A;  1WY8 A;  2DHZ A;  3VH4 B;  2BWE S;  1I42 A;  1E7V A;  4PS7 A;  2IO3 B;  2FID A;  2K8B A;  2O6V B;  2KTF A;  3KYC D;  4IUM B;  2J0K A;  2OJR A;  2LJ5 A;  1YIW A;  3IVF A;  2MQJ A;  3K9O B;  1P3Q U;  3DVG Y;  1YJ1 A;  4XC2 A;  3DPD A;  3H7P B;  1JRU A;  4F8C B;  2L76 A;  3PVL A;  2OOB B;  3VAW A;  1WGY A;  2RR9 A;  1GC7 A;  1L7Y A;  3AXC A;  3OJ4 B;  3P2B A;  2G4S A;  4FAD A;  1XT9 B;  2XK5 B;  4MGK E;  3UQA A;  2BYF A;  3CST A;  3OJ3 A;  4GGQ A;  2L0T A;  2XK5 A;  3QK0 A;  2I1J A;  3WAN A;  1UGM A;  2ZVN A;  1GJZ A;  4E74 A;  2LGY A;  1XQQ A;  1S3S G;  2JT4 B;  4HVB A;  4MGY E;  3QIJ A;  1OTR B;  2L7R A;  1ISN A;  2LGX A;  3NOB A;  4LDT B;  4W9H A;  5CTR C;  1LXD A;  4KDL B;  4MH0 E;  4DXA B;  4FJV B;  4B95 A;  1TTN A;  1WJN A;  1WX9 A;  4ICV A;  1SE9 A;  5CHV C;  2FCN A;  2LVP A;  3OLM D;  3PHX B;  4IG7 B;  1WXA A;  2BPS A;  3B1L X;  1AAR A;  1PQS A;  2KJH B;  4PYU A;  3ZUN A;  2FCS A;  3A1Q A;  1M94 A;  3VHT C;  2MBO A;  3B0A A;  3DDC B;  3VUX A;  2V3S A;  3Q3J A;  3QAQ A;  2KWU B;  3W1S A;  2KX0 A;  3A4S C;  3MJW A;  4IM0 A;  1S1Q B;  4K7U A;  3VQI A;  1WZ0 A;  3ZKJ C;  3OAW A;  3JVZ X;  4IM2 A;  4IWO A;  1EF1 A;  1OEY A;  1R4M I;  3ZDM C;  3KYD D;  1YX5 B;  3LDZ E;  1D3Z A;  4GXB A;  2KVR A;  4NPN A;  5CHF A;  1UBI A;  3WAM A;  1LFD A;  3X23 A;  4BOS C;  4HDQ A;  5DCN A;  2MBB B;  3PGE A;  2ZCB A;  3QWZ B;  1IPG A;  2O6V D;  5J17 A;  3H9D A;  2AWT A;  2KLC A;  2KZR A;  2REX A;  2J7Q B;  3A9J B;  4HDO A;  4BVU C;  5TR5 A;  1WGD A;  2KQS A;  2D11 A;  2IO2 B;  5CX3 A;  5LXH A;  1WZ3 A;  1EUV B;  2UWQ A;  3NS8 A;  1TBE A;  4KVG B;  4A3O A;  2JUO A;  2CU1 A;  4PYZ A;  4W9K A;  4HK2 A;  4DHZ E;  2BYV E;  3DOW A;  3RYT A;  4BOZ B;  3WAP A;  5KHQ A;  3IFW B;  1J19 A;  2PE6 B;  1J0G A;  5LLI A;  2KX3 A;  2BWF A;  2B3A A;  3M3J A;  3O65 B;  2I1K A;  5E6P A;  2W9N A;  2D3G A;  4W9L A;  3ZVV A;  3RZF A;  3RT3 B;  2MBQ A;  3QAR A;  2G45 B;  2M17 A;  5AEK B;  2KFK B;  3EC8 A;  1E90 A;  3K9P B;  4LDT D;  5J18 A;  2ZPY A;  2UYZ B;  1Z2M A;  2NBV B;  4W9I A;  1T0Y A;  2HTH A;  4TQ1 A;  4TKN A;  1H8C A;  3T8M A;  2FCM A;  3DBR I;  1WMH B;  2JWZ A;  4NAW B;  2M0X A;  3UIP B;  3APF A;  3WAO A;  2L00 B;  2LXA A;  2PE9 A;  4GOC A;  1WJU A;  4OVU A;  2WX1 A;  2MX2 A;  1UZX B;  3DBL I;  4FJY A;  5JHA A;  4DHJ D;  2MLB A;  2NPT A;  3CMM B;  1WM3 A;  1WJ6 A;  2N1W A;  2KNB A;  4DBG A;  4F7Z A;  1EO6 A;  1TGZ B;  4EZJ A;  2MW5 A;  3VTW A;  2KTR B;  3PT2 B;  2LRU A;  3JYU A;  4TUU A;  2O2V B;  2WDT B;  3BIN A;  3VFK A;  2DYO A;  4GDK A;  4NNJ B;  3ZDT A;  2KTR A;  4M8M A;  1VCB A;  2C7H A;  2YVC A;  1NBF C;  2EKE C;  3PLV A;  3RZW C;  3W1Y A;  4FA6 A;  2MP2 B;  1L2N A;  3V61 A;  1Q1O A;  2CKH B;  3PRE A;  2KWC A;  3SHQ A;  3N30 A;  5IAA C;  1IYF A;  3PS6 A;  4BBN F;  2LD9 A;  2KMA A;  5AZG A;  2KLG A;  3DCG A;  4NQK E;  3VVW B;  4ZRI A;  4IW0 A;  3ZW3 A;  2KWV B;  4KIK B;  3ALB A;  4ZYN A;  4FHK A;  2IYD B;  3KVF B;  2BKR B;  2O6V A;  3QQ8 B;  4K7W A;  4MEM A;  2MBH A;  4BKT A;  3HIZ A;  5IA7 A;  2IO0 B;  4JGH B;  3ZLZ A;  5D7G A;  4I6N B;  2D2Q A;  2Z0D B;  2N7D A;  3H7P A;  4JIO U;  2QHO A;  3JSV B;  4BFR A;  5G2N A;  3M95 A;  3DQV A;  1V86 A;  3JSV A;  4E71 A;  2ZPN A;  1KOT A;  1U4A A;  4LJP B;  2FAZ A;  3SD5 A;  2KAN A;  2ASQ A;  3IBE A;  3PRP B;  4ANW A;  2G3Q B;  3ZRF A;  3KUZ A;  4ANU A;  3PV1 A;  1G6J A;  5CHW A;  2DZJ A;  2M1M A;  2Z59 B;  3TL5 A;  1WJ4 A;  2PPH A;  1OQY A;  4WQO B;  1I35 A;  1GG3 A;  2V1Y A;  4JLC A;  3VUW A;  2RGF A;  2IBI B;  5D6J B;  2FNJ B;  4WJP A;  2BF8 B;  4BBN C;  4URK A;  1E5W A;  4KSL C;  2ZVO A;  1H4R A;  2KN5 A;  1E8Y A;  2A4Z A;  2KHW B;  3NHE B;  4WWO A;  3M62 B;  5JH5 C;  3TCA A;  3ML8 A;  2KXJ A;  2LGD A;  3S2A A;  1Q5W B;  2GOW A;  5L95 C;  2KDB A;  1OGW A;  4DHJ B;  1RLF A;  1ZKH A;  4I6L B;  5HKH A;  5DPW A;  3WAL A;  2EMT A;  2JVC A;  4AP4 C;  3B08 A;  4MGI E;  1YQB A;  5AZF A;  1X1M A;  3PLU A;  1WFY A;  1WF9 A;  2MRP A;  5BO4 B;  3UIN B;  2JF5 A;  2C60 A;  2L0F A;  2D10 A;  3KW5 B;  2A5U A;  3SDL C;  2K8C A;  2M4N A;  2AL6 A;  1K8R B;  1V81 A;  1BT0 A;  1P1A A;  1XD3 B;  2XEW A;  3A9K B;  3V6E B;  1VD2 A;  3T9L A;  3ZNI D;  2Y5B B;  1SGH A;  3U7D A;  3A33 B;  3EFU A;  2N4F A;  2DZI A;  3MHS D;  1E8W A;  4KZC A;  2G4D B;  2L05 A;  3RD2 A;  4DHZ B;  3GOE A;  4TV3 A;  4AUQ C;  3A9J A;  4W9E A;  4JQW C;  3APC A;  3MTN B;  4G11 A;  3VTU A;  3VUY A;  1WXS A;  1V80 A;  2RD0 A;  1GC6 A;  4GDL B;  3VXW A;  1WI0 A;  4CO7 A;  2DEN B;  3L08 A;  4GDL A;  4ICU A;  4MJS B;  3V60 A;  2GMI C;  3GZN I;  4HJK A;  2DZM A;  3ZTC A;  3KUD B;  2AEH A;  4J6I A;  1C3T A;  4MEL A;  4IWQ A;  4BKG A;  4CYE A;  1WRD B;  2KD0 A;  3R66 C;  1NI2 A;  5G55 A;  4HPL B;  3DVN V;  3WA0 A;  1WM2 A;  4ANV A;  2KC1 A;  2KFK A;  2DAJ A;  3NZU A;  4EOY A;  3HM3 A;  2JXX A;  5E6N A;  2DYM A;  3HM6 X;  2L8J A;  1V5T A;  1WGG A;  4FN2 A;  4M8N A;  1WMH A;  4NAW A;  2MCN B;  1UH6 A;  2GBR A;  4KZ0 A;  2EMS A;  2R2O A;  3H7S A;  4WJN A;  4XZ4 A;  3L0W B;  2V4L A;  1HE8 A;  1Q0W B;  5EDS A;  3QJZ A;  1TZ1 A;  3QHT A;  2LZ6 A;  4ZDV A;  2FIF A;  3LJ3 A;  4MDK E;  4W9J A;  1EF5 A;  2O2V A;  5C1Z A;  2N9P C;  4A20 A;  4WWP A;  4AWJ A;  2GBM A;  2LUE A;  1WR6 E;  3AI5 A;  2NVU I;  2LWP A;  2N7E A;  2IY0 B;  2MP2 A;  3L13 A;  4G3X B;  4W9G A;  3C0R B;  2MA9 B;  3PRZ A;  3BY4 B;  4I6P A;  2HD5 B;  2RSU A;  4G50 A;  4AJW A;  4WWN A;  4E3C A;  3TIX A;  3QA8 A;  4KIK A;  4II2 B;  3ONS A;  2R2Q A;  2GBN A;  3NY5 A;  2NBU A;  4F1S A;  2JPH A;  4EZL A;  4NJ7 A;  4FLH A;  5L83 A;  3DVG X;  3R3M A;  3RUL A;  1V6E A;  3DBH I;  4GIV A;  4DK5 A;  1UEL A;  2JZ3 B;  4II3 B;  3H6N A;  3EEC A;  2CS4 A;  2JRI B;  3PSE B;  3R7R A;  1GNU A;  3U8Z A;  2LVO A;  3UQB A;  4FUL A;  3X0W A;  2BKF A;  2IY1 B;  4YL8 A;  4W9D A;  5DPT A;  4WJO A;  3ZRC A;  3ZO5 B;  3AU4 A;  3APD A;  2DYB A;  4KSK C;  3WIM A;  4N9F 4;  2VRR B;  3TBL D;  1KJT A;  4OVV A;  1UBQ A;  3W1S C;  1E7U A;  2L3Z A;  3DVN U;  4K1R B;  1WGR A;  2Z0E B;  4MGZ E;  2D07 B;  1J8C A;  2NCN A;  1WXM A;  1WIA A;  3Q3F A;  3VTV A;  1CMX B;  1A5R A;  1KM7 A;  4GSW A;  1V2Y A;  4HCN B;  4WAA A;  2C7N B;  3IG3 A;  3ML9 A;  3NZS A;  4ASW C;  1YX6 B;  3HK0 A;  4GB9 A;  2KDE B;  4FJZ A;  2K6D B;  5KHO A;  3RCZ A;  4AOF A;  2KQ7 A;  2YLM A;  2DZK A;  2AL3 A;  2K1F A;  5E6O A;  3ZIM A;  4B9K A;  2KO3 A;  2AYO B;  1ZW7 A;  3ENE A;  2IO1 B;  3U30 A;  3ZNZ B;  3A4R A;  5D94 A;  3PPA A;  4ZRJ A;  5GMV A;  4HWI B;  1P98 A;  1RRB A;  2GBJ A;  3PRM B;  4RM8 A;  4AJY B;  1E8Z A;  1UD7 A;  4X57 B;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...