3U30A

Crystal structure of a linear-specific ubiquitin fab bound to linear ubiquitin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
SHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering and structural characterization of a linear polyubiquitin-specific antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords linear di-ubiquitin
total genus 42
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u30A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u30A01
1E7UA 1R4NI 3R3MA 4KDIC 4MGZE 4WAAA 2KX3A 3HK0A 2C60A 3QC8B 3ZRFA 4FHJA 4B9KA 2MBBB 1Q5WB 3VXWA 2O6VA 3PRZA 4TUUA 3DQVA 3DBRI 3S2AA 2EKEC 2DYBA 3PGEA 3VQIA 2NR2A 3AU5A 4M8MA 5IAAC 4WWNA 2AL6A 1YD8U 2LASA 3QCAA 1WYWB 4W9EA 4XC2A 1V86A 2C7HA 2FAZA 4GN1A 2BPSA 2KMAA 4ZRJA 2L0FA 2G45B 2OOBB 4GOCA 1L7YA 2N1VA 2W9NA 2NS5A 1P3QU 2FIFA 4GMVA 2KWUB 3X0WA 1LXDA 3WAOA 3NY5A 1LQBA 5TR5A 4KV2A 3A9JB 3NOBA 3QHTA 3ZVVA 3QK0A 4KZ0A 1TBEA 1EF5A 4RM9A 2C5LC 2NBVB 3OJ4B 3TCAA 1YX5B 3PRPB 2KKCA 3VH3B 3APDA 4DHZE 2D07B 1WMHA 2KWVB 4NAWB 4NJ6A 2ZNVB 4XZ4A 3UQBA 2DYOA 3EC8A 3AXCA 4LCDE 1AARA 5KHOA 2MBEA 4HCNB 5L95C 2N7EA 2C7NB 2KFKB 3ZNGC 5CHFA 5J17A 3LJ3A 4BKGA 2KMCA 3H7PA 4K81A 3AU4A 4RM8A 5GMVA 3BY4B 2FUHB 4LDTB 4A20A 3GZNI 4K7UA 3QARA 3DVNU 3VUXA 2M1MA 3WALA 3ONSA 2YLMA 4M0WB 5KHQA 2GBJA 3H7PB 1FXTB 1WXVA 3VUWA 4EZKA 3APCA 4FA6A 1WF9A 4HXDA 2O6VD 4LJPB 2LWPA 3WAMA 1S3SG 2NBWB 4BKTA 4W9CA 2L76A 1NBFC 2DZJA 3H1UA 5L83A 2K8BA 2KJHB 2PEAA 2KLGA 2D11A 1M94A 2BYEA 2PPHA 5FR6A 2D3GA 2N9EB 5DPRA 4GSWA 2LXCA 3UQAA 4JQWC 3ZO5B 3R66C 1MG8A 3DBLI 2WX1A 4K7SA 4AJWA 1J19A 3A9JA 2PJHA 1WXSA 2KXJA 3UINB 3KW5B 4HDOA 2L8JA 4X57B 1UD7A 2KDBA 3KUDB 4KDLB 4TQ1A 1GNUA 2JXXA 3A9KB 2MSED 4G50A 2C9WB 2JVCA 2WWZA 2WX0A 5HKHA 4AUQC 2K8CA 3L13A 5D6JB 3TIXA 4FJZA 2NPTA 5AEKB 2K8HA 2MX2A 3KVFB 4HPMB 4NPNA 2JPHA 3EFUA 1V5TA 1I42A 1GC7A 1K8RB 2KD0A 5AZFA 1WXMA 2JUOA 3NZSA 1WGHA 3P2BA 3SDLC 1S1QB 3T8MA 3CSTA 3M62B 3L08A 4AWJA 3KUCB 4DDID 2FNJB 1WGYA 2DZKA 2RGFA 4MSMB 2GBNA 1P0RA 4KIKA 4PS8A 4BVUC 2KK8A 4MGYE 3QAQA 2LVPA 4W9GA 1R4MI 2L0TA 3TJPA 3PLVA 4B95A 2AL3A 2D2QA 1KJTA 4GDLA 4OVUA 2IBIB 1RFAA 2IO2B 2MQJA 1BT0A 2L7RA 1C1YB 2L3ZA 3ZLZA 2MP2B 2NCNA 3V6EB 3QWZB 4W9HA 1E7VA 2IZVB 2KX0A 3QA8A 4E71A 4ANUA 1I35A 4AOFA 4URKA 3CSFA 3N3KB 4F7ZA 3ZNHB 5E6OA 3A1QB 2AEHA 1WGDA 3W1SA 3CMMB 4HPLB 4W9KA 2QHOA 1P98A 2KTRA 2C7MB 1E8XA 2O2VA 1WM2A 4W9IA 4MEMA 5DPSA 4FBJB 3RCZA 1ZW7A 1RAXA 4GIVA 1UBQA 4DDGD 5E6PA 1TGZB 2CKHB 4A3PA 3RD2A 2KQ7A 1ISNA 5E6NA 5CHVC 3EHVA 3QIJA 4WJQA 1WH3A 1X1MA 4HDQA 3SU8X 3ALBA 5J2RA 1SGHA 4BBNC 3RT3B 4KSKC 2DX5B 2KJ6A 1SE9A 2LRUA 2FCNA 2EMTA 1V81A 3MJWA 3V61A 1GUAB 3PPAA 4WJPA 3BINA 3HM6X 5G2NA 2LJ5A 3ZDTA 1UBIA 4MM3A 2KLCA 2OJRA 4GDLB 2IY1B 1EO6A 2XEWA 4IWPA 2KANA 5DCNA 3SHQA 3ZNID 1WXAA 3DOWA 3NHEB 4ICVA 4HLEA 1JRUA 1YX6B 2KDFB 3IVFA 4WWPA 1GJZA 5CX3A 4WJOA 4GXBA 3ZDMC 1WFYA 4P7IA 5D2MB 3K9PB 3ZRCA 4HVBA 3D32A 3MTNB 4EUTA 3OJ3A 2Y5BB 5IA7A 4WQOB 3APFA 4F8CB 3U30A 4KZCA 2GBKA 1WRDB 4JLCA 4FADA 2N9PC 2RPQA 2J0JA 2BGFA 2YVCA 4LJOB 2MWSB 3DVGX 3RZWC 2IYDB 3QJZA 3B08A 3VTWA 4JL9A 4MJSB 2K6DB 2FIDA 4OVVA 2PE9A 4IG7B 3UF8A 2ZNVC 2ZVNA 2ZJDA 3PREA 3VH4B 3JYUA 3NZUA 3PT2B 3VAWA 2M8SA 4F1SA 3ZUNA 1TZ1A 3VDZA 3N30A 1P1AA 4CYEA 3QQ8B 4MELA 3W1YA 2DENB 3ZTDA 4KIKB 1WM3A 1YQBA 3K9OB 1WJUA 4FHKA 2KOXA 4I6PA 2AYOB 2ZCBA 4G3XB 1L2NA 4G11A 2DHZA 3ML9A 3UGBB 2G3QB 2JZZA 1J8CA 1WZ0A 1RLFA 2DZMA 4PS7A 4TKNA 3UIPB 1WGGA 2J7QB 1UELA 3N32A 2B3AA 3B0AA 1E5WA 3O65B 3A33B 4BOZB 5AZGA 4B6WA 4LDTD 2KC1A 4BKSD 4IUMB 2KVRA 3KUZA 2BKFA 2NPTB 1UGMA 3X23A 4DHJD 3L54A 5AZHA 2GBRA 2KO3A 2BWES 3W1SC 2XBBC 4TQ0A 1WMHB 3A4RA 2PE6B 4EFOA 1V9JA 2CR5A 4IWQA 3H6NA 4KSLC 1WJNA 4W9FA 4DWFA 3V6CB 5LLIA 1WR6E 4PYUA 3WIMA 2ZZPB 2L05A 3DBSA 3M3JA 1EF1A 3KH0A 1TTNA 2DZIA 3CF6E 3IHPC 3M63B 3HIZA 1D3ZA 4FJVB 1V2YA 4ASWC 2MBQA 4CO7A 5JHBA 4MJSA 1WGRA 2Z0EB 3M95A 1CMXB 4WWOA 2IY0B 5CHWA 3R7RA 3ZNZB 2LRWA 3PZDA 2KQSA 5C23A 4GDKB 3QX1A 2R2QA 2GBMA 3Q3JA 5DPTA 1IYFA 1H4RA 2BWFA 2BYFA 2Z59B 3AI5A 2EMSA 2DAJA 2JY6A 3VFKA 1UZXB 2KTFA 1KLVA 1QZEA 1OGWA 1VCBA 3SD5A 3HHMA 1OQYA 2DAFA 2KZRA 3DPDA 2FCSA 1T0YA 4W9LA 3RYTA 1E8WA 5LXIB 2JRHA 1E8YA 2MLBA 4E3CA 5D7GA 2JT4B 3L0WB 2M4NA 1KM7A 2UYZB 3DDCB 3PS6A 3I3TB 2K25A 1SIFA 2KN5A 3JSVA 4IM3A 5LXHA 2I1JA 2K6QA 2Z0DB 1V6EA 3ENEA 2JRIB 3RZFA 1IP9A 1ZKHA 1WI0A 4MSQB 2LGXA 5JZEB 2KC2A 2M0XA 3ZTCA 2CS4A 3KYCD 4EOYA 4IM2A 2N4FA 2RR9A 3JSVB 2HE7A 1P9DU 4HWIB 3WA0A 1E90A 2ZCCA 3Q3FA 4GB9A 3JVZX 3PVLA 1WE7A 2CU1A 2HD5B 4GGQA 2M17A 1Z5SB 2HJ8A 2N1WA 3R7QA 2V4LA 2A5UA 2MCNB 3C0RB 2IO0B 3ZW3A 1V5OA 3VVWB 4AJYB 2I1KA 4BKSA 1WE6A 1WZ3A 3ML8A 2J0MA 4II2B 4MH0E 3PHWB 1Z2MA 2NVUI 4IW0A 4DHZB 1PQSA 3LDZE 4CHKA 2K1FA 2MRPA 4JGHB 4PS3A 2O6VB 3VTUA 3ZKJC 1C3TA 2CHXA 3IFWB 4NQKE 1ZGUB 2KTRB 1V49A 4FULA 2MBOA 3NS8A 3IG3A 2UWQA 4GDKA 2D10A 2XK5A 1XD3B 4DBGA 3T9LA 2LVOA 2VRRB 1A5RA 1Y8RC 4I6NB 3OAWA 3UIOB 1WX7A 2V1YA 4FLHA 4ZRKA 2KFKA 4FN2A 1IPGA 3DVGY 1J0GA 2LZ6A 2LGYA 1GG3A 4I6LB 2J0KA 4E74A 1XT9B 3HM3A 4ZYNA 1NI2A 2KWCA 2LVQA 3H9DA 4K1RB 2RSUA 4ZRIA 2KNBA 3DCGA 4ICUA 1XQQA 3WANA 2A4ZA 1YJ1A 2CHWA 3PHXB 4PYZA 4KVGB 2R2OA 4BOSC 2MA9B 1RRBA 2ZEQA 3DBHI 4DHJB 3EECA 5JHAA 5D94A 4IWOA 3A4SC 3U8ZA 4HJKA 1OEYJ 2KJRA 2KFJA 3PLUA 2AWTA 1WX8A 3OLMD 2NBUA 3ZIMA 1E8ZA 2BF8B 4W9DA 2LGDA 1WX9A 3ECIA 1LFDA 2O2VB 1F9JA 3KYDD 4DXAB 3L16A 1Q0WB 1NDDA 5C1ZA 3V62A 1OEYA 1WIAA 4HCPB 4EKUA 2KDEB 1EUVB 1U4AA 2MBHA 3PRMB 1KOTA 1UH6A 3U7DA 2GMIC 2KHWB 2V3SA 4K7WA 2MP2A 1YIWA 1HE8A 2JZ3B 3RULA 2G4DB 3VHTC 2HTHA 2IO3B 3A1QA 3H7SA 4J6IA 1V80A 2ZVOA 4GU2A 4IM0A 1WJ6A 4NAWA 2ZPYA 4HK2A 3RUIB 4N9F4 1H8CA 3GOEA 2LXAA 4M8NA 3PV1A 3VUYA 3PTFC 4IC7B 4AP4C 4NQLB 3PSEB 3VTVA 4NNJB 2N7DA 4EZJA 4MGKE 3AULA 2IO1B 2FCMA 3TL5A 5CTRC 4RMAA 4BBNF 3TMPB 4EEWA 3V60A 1G6JA 2BKRB 2RD0A 4DK5A 4BFRA 2BYVE 4WJNA 4G0NB 3WAPA 2CHZA 3JW0X 3L17A 2LI5A 3DVNV 2G4SA 3A9KA 1GC6A 4ANVA 5DPWA 2LUEA 5G55A 2WYQA 5BO4B 2MW5A 2GOWA 2ASQA 3IBEA 2N9XA 4EZLA 2LD9A 1Q1OA 2L00B 2K39A 2WDTB 4XX5A 5J18A 3L10B 5JH5C 1WR1A 1VD2A 4ANWA 1WY8A 2JWZA 2REXA 4NJ7A 1LM8B 2DYMA 4MGIE 4W9JA 2JF5A 2FCQA 3TBLD 2ZPNA 3MHSD 1OTRB 1WJ4A 4ANXA 4ZDVA 4NY0A 4MDKE 4FJYA 5EDSA 4II3B 4JIOU 2KDIA 4TV3A 4YL8A 4A3OA 3B1LX 2XK5B
chains in the Genus database with same CATH superfamily
2Y5CA 4B9KA 4FHJA 2MBBB 3VXWA 4N58A 3ZQ4A 3DQVA 2YEPB 2EKEC 1D5XC 3PGEA 4LK0M 3VQIA 4ZOHC 5IAAC 2DBYA 2AL6A 4W9EA 1V86A 2SEBD 4YTMB 2J42A 1C9FA 3DBRB 3SFDB 1PGAA 3B2GA 3OG5A 5TR5A 4KV2A 1XCTL 2WXJA 3QK0A 1VZ7A 4C4VB 2KKCA 3GP7A 1YN4A 2KWVB 1WMHA 1SE4A 1QOBA 4NJ6A 4OW0A 1T0RC 1MG4A 2EKIA 5KHOA 2MBEA 1PGXA 5GXGB 3LJ3A 4BKGA 2KMCA 3AU4A 4RM8A 1UUPA 1NEKB 4A20A 3FILB 4PT5A 3U7ZA 3VUXA 2DLBA 2YLMA 4M0WB 5KHQA 2GBJA 3H7PB 1WXVA 3APCA 4HXDA 2O6VD 2RDBC 1CQVA 4W9CA 5L83A 2KLGA 2LHDA 3NVWA 2LXCA 2OEDA 3P4RB 1I4GA 3DBLI 1HQRD 4K7SA 4AJWA 1V1PA 3A9JA 2PJHA 1NI3A 3P4QB 2Y5PA 1UD7A 3DHGC 3KUDB 3EFCA 3HVZA 4TSSA 2Y3AA 1UWXA 2WX0A 5HKHA 3L13A 1Q10A 5D6JB 5J2RA 2NPTA 3KVFB 2K8HA 4HPMB 1I7HA 2D5GA 5H8YE 3URYA 1GC7A 3MFGA 1JWUD 3H8HA 5AZFA 1TS2A 3T8MA 3R8BA 4KGRA 4A90A 3FC4A 2BBCA 2RGFA 3RPFC 1SE3A 2LVPA 3IT6B 4XDCA 3TJPA 1MPEA 4RH6A 2D2QA 1PUTA 2MQJA 1XLOA 1K51A 2QSDA 1JWAD 1E7VA 2IZVB 3QA8A 4RF1A 3A1QB 4OZCA 4HPLB 4W9KA 1EWYC 2CJNA 4MEMA 2HTME 3U52E 4A3PA 1F1HA 2JZPA 1YJIA 1IBXA 4WJQA 1L5PA 1MI0A 3ALBA 3HUIA 3AB5A 4KSKC 3N20C 1FD6A 3MC9A 2EMTA 2W3RA 3GE3C 1V8CA 1E10A 3NRZA 2LJ5A 4N6EB 1UBIA 4MM3A 5FR3A 5G5HA 2MJDA 4LTUA 2V4IB 2WXMA 3AMZA 2KVZA 3I5JC 4ICVA 3NHEB 3SR6A 3IVFA 5CX3A 4WJOA 1L0YB 2IDYA 2G9HD 1L4DB 1FO4A 3OJ3A 4WQOB 3RNAC 4KZCA 2D3BA 4M0WA 2N9PC 3NG0A 2J0JA 3B08A 3VTWA 4MJSB 3ETRA 4HJGE 4HROA 1JWBD 4F1SA 2RPVA 3N30A 4M01A 1C4PA 3W1YA 1YQBA 4BZAA 3MC8A 1VDVA 3Q8CA 4RCOA 2AYOB 1KH0A 1L2NA 3KQ4A 4MT5A 3ZJTA 4TKNA 1UELA 2K22A 3B0AA 1E5WA 3O65B 3A33B 3TEYA 4B6WA 1FFUA 2BKFA 1P7EA 3X23A 4DHJD 2KACA 3L54A 2LGSA 5AZHA 2GBRA 5MPOA 3W1SC 2WXIA 1ZP0B 4IWQA 1WJNA 4W9FA 4DWFA 1B1ZA 2TSSA 2WLBA 4WH4A 2E3TA 3AE5B 3CF6E 3IHPC 1D3ZA 4LNFA 3ZNZB 1WGRA 5FK9C 3R7RA 1BMLC 1CMXB 4WWOA 5BMGA 3NS1A 3BYYB 3Q14C 2FBWB 2KQSA 5C23A 1N6ZA 4GDKB 5I4DA 1IYFA 3EA6A 2Z59B 2DAJA 2JY6A 3HHMA 1FRRA 2KZRA 2JRHA 2MLBA 3PS6A 2I2YA 3DDCB 3I3TB 3JSVA 1SIFA 2BVCA 2I1JA 2JRIB 1IP9A 4P16A 2KC2A 2M0XA 3TEZA 2CS4A 2WDQB 2RR9A 4IKGA 3WA0A 1E90A 1FMAD 3Q3FA 2INNE 2HJ8A 2V4LA 2A5UA 1SSNA 3C0RB 4KGTA 1OFFA 3OWEB 3ML8A 3KWVA 3PHWB 2BB5A 2NVUI 1E7PB 1C3TA 1GJZA 2WU2B 2CHXA 1N63A 3E9SA 4FULA 2INDC 1V97A 3ZYYX 1A5RA 4KKIA 1WX7A 2V1YA 4FLHA 1TS3A 2WP9B 1VR9A 4E74A 2J0KA 4ZYNA 1I4PA 4S0RA 2KNBA 1KF6B 1JROA 2OHFA 2NMQA 1ZDXA 4DHJB 5D94A 3A4SC 3Q3MC 3U8ZA 2WXHA 2R61A 2WQYB 3OLMD 1SJED 3ZIMA 1E8ZA 4W9DA 3ECIA 2O2VB 1F9JA 3KYDD 4KX6B 3AN1A 4HCPB 3PRMB 3I57A 1KOTA 2WXKA 4MACA 1TS5A 3J9CA 2MJEA 2G1EA 2L1AA 3PV1A 3VUYA 3VTVA 4NNJB 3AULA 1HTQA 3DHIC 4M02A 3DBLB 1EU3A 2BKRB 2BYVE 2J4XA 1AW7A 4A8XC 4FXCA 3L17A 2WNMA 4ANVA 4DXFA 2PKOA 5G55A 5BO4B 3IBEA 2MW5A 4EZLA 5AUKA 1C4CA 4XX5A 1WR1A 4NJ7A 2DYMA 5BYRA 3MHSD 4ANXA 1JW9D 4NY0A 4FJYA 4JIOU 1J7CA 2MH7A 3NVYA 2M0AA 3PZ8A 1R4NI 3R3MA 2KX3A 4R3DA 4EE2A 2WXOA 2O6VA 3S2AA 2QC8A 2AQ1B 2NR2A 3AU5A 4WWNA 2JX5A 1YD8U 1XLPA 4XE0A 4ZRJA 4GN1A 2C7HA 2BPSA 2G45B 1LGRA 4ITKA 1JCKB 2NS5A 1P3QU 2N9LA 4GMVA 1C76A 4KZ0A 3TCAA 3PRPB 3VH3B 3SFEB 4DHZE 3CIRB 3T3OA 4WWMA 3T3NA 2ZNVB 3EC8A 2W82A 4IDIA 4LCDE 1AARA 5L95C 2N7EA 2C7NB 4JX1C 2QMTA 3ZNGC 5CHFA 3N9YC 5J17A 4QAYA 3BY4B 2FUHB 3C19A 2M1MA 4S17A 5HFYA 1FXTB 3VUWA 4FA6A 1WF9A 2LWPA 2NBWB 3H1UA 2WXFA 2PEAA 5E6JA 3ZGZA 4P6VF 1WGKA 1RFKA 1FXAA 2WX1A 3UINB 3KW5B 2KDBA 4TQ1A 2LHEA 3TEXA 3U2SC 2BS4B 3RNEC 5IKCM 2JSVX 3EFUA 3Q3NC 1SIJA 1K8RB 5HI1A 2PIAA 5BYQA 2JUOA 1MVKA 1S1QB 4N59A 3FAHA 3KUCB 2I38A 1WGYA 1K53A 2L32A 4BVUC 4KIKA 3AH7A 3BZDB 3QAQA 1KLUD 2WHIA 3BYTB 2XNAC 2IJ0A 4OVUA 1RFAA 1BT0A 1C1YB 1I4HA 2MP2B 4W9HA 2AQ3B 1C78A 1I35A 3Q3OC 4AOFA 3CSFA 1KLGD 3I9V1 1FXIA 2KTRA 3UI3A 2C7MB 1WM2A 1F52A 4FBJB 5HG2A 3RI7C 3W5VB 1MFWA 1ZXHA 3RD2A 3RNGC 1AN8A 3EHVA 1WH3A 4ACFA 2INCC 3RT3B 3AE3B 2DX5B 2LRUA 1SE9A 2FCNA 3NVVA 1AWDA 3V61A 1GUAB 4WJPA 4LNKA 1WYGA 2L52A 2KLCA 2OJRA 5HHDG 1EO6A 2XEWA 1V1OA 3DOWA 4JPSA 4HKZE 4HLEA 4P7IA 5D2MB 3K9PB 3ZRCA 4IOIE 1QT9A 2M56B 2Y5BB 5IA7A 4C56C 3U30A 2GBKA 1WRDB 4JLCA 1T0SC 2RPQA 2MWSB 3QJZA 3TEWA 4C7ZA 3Q69A 1ROEA 3RN9C 5AUIA 2FIDA 4IG7B 3UF8A 2ZJDA 3VH4B 3JYUA 2PTLA 3AV8A 3NZUA 3NZ3A 3VAWA 1TZ1A 3IAM1 1NYQA 3QQ8B 3V3XA 4MELA 2DENB 3ZTDA 4KIKB 1WM3A 2KOXA 3PO0A 2W54A 3NUHB 1TS4A 2DHZA 3FILA 3UGBB 1WZ0A 1XF5L 4RGOS 3V05A 1WGGA 1BXTA 5AZGA 4BKSD 4IUMB 1QOGA 2ICIA 2KO3A 5G5GA 2XBBC 1WMHB 1V9JA 3H6NA 4P1CC 5JXVA 1SE2A 1J7BA 5LLIA 4PYUA 3M3JA 1T3QA 1EF1A 1KRHA 2DZIA 3P42A 4K3BA 1V2YA 5JHBA 4MJSA 2RDHA 1B9RA 1L6UA 5BYSA 3QX1A 1H4RA 2BYFA 3AI5A 3VFKA 1UZXB 1KLVA 1VCBA 2GB1A 1UNSA 1OQYA 2DAFA 5FKAC 2K0PA 1FM0D 2BB6A 1DYQA 1ZOYB 2JT4B 2M4NA 1KM7A 2UYZB 4IM3A 2J52A 2Z0DB 1ZKHA 5JZEB 3ZTCA 3AE7B 4NZLB 5IO9A 4US8A 2N4FA 4ZYSA 1P9DU 2GLSA 4HWIB 1C77A 3JVZX 2CU1A 4GGQA 3AEDB 2MCNB 2IO0B 3ZW3A 2I1KA 4D2KA 4BKSA 4MH0E 4II2B 3BK2A 4DHZB 1XO3A 1PQSA 3B2FA 4JGHB 4PS3A 3ZKJC 3Q6BA 3IFWB 4NQKE 1ZGUB 4KGSA 2MBOA 2ZW1A 1UGJA 2UWQA 2XN9C 2D10A 2XK5A 1MHXA 1XD3B 3T9LA 2LVOA 1VJKA 1HZ6A 4ZRKA 3AEFB 3TUOA 1IPGA 2LZ6A 2LGYA 4I6LB 1XT9B 2KWCA 2INPE 4GLSC 3AEEB 2ON8A 1YJ1A 4KVGB 3BIID 3IAS1 3EECA 4IWOA 4HJKA 1HTOA 2KFJA 3PLUA 3B9JA 1SJHD 1WX8A 2FUG1 2LGDA 1NDDA 4B0MA 1OEYA 2KDEB 1EUVB 2MBHA 4USAA 2WXRA 4JWSC 2IGDA 4P1BC 2V3SA 4HEA1 3AE8B 1PYWD 3A1QA 2ZVOA 4IM0A 4HK2A 4N9F4 3RNBC 4C4VA 1TT5B 1H8CA 3GOEA 1YQ4B 1F77A 3LYYA 2X38A 3PTFC 4IC7B 1V1PB 4EZJA 4MGKE 5CTRC 4RMAA 3V60A 1G6JA 4DK5A 4UDUC 4BFRA 2QDFA 2CHZA 1JALA 2LI5A 3AEBB 2G4SA 5DPWA 1F2RC 1GOZA 2GOWA 2LD9A 5JH5C 2JWZA 2MJ3A 3HRDD 3L4PA 4MGIE 2WXPA 3BWUD 3TBLD 1K50A 1YN3A 1WJ4A 4ZRPA 4ZDVA 5EDSA 4II3B 4TV3A 4TMAB 3B1LX 1VZ8A 2KWDA 1E7UA 4KDIC 2ZW0A 4WAAA 2IGGA 3QC8B 1DGJA 2JWUA 3GB1A 1Q5WB 3VR8B 3PRZA 4TUUA 2HDEA 4ARIA 2BYTA 3Q8EA 3QCAA 1WYWB 4XC2A 2OOBB 3BK1A 1PDXA 4ZHPA 1L7YA 2W9NA 3AECB 2FIFA 2KWUB 4HRSA 1LXDA 4YWGG 3NY5A 1LQBA 1RYJA 3ZVVA 1I4XA 1KFYB 4RM9A 2BS2B 2NBVB 3ABVB 1YX5B 2WXLA 2LUMA 3APDA 4NAWB 1JRPA 2DYOA 3AXCA 4LLGM 3H7PA 2KMMA 2KDMA 4LDTB 3GZNI 4K7UA 3DVNU 3WALA 1HZ5A 1QOFA 1ZDVA 2K3UA 1D4BA 4KKJA 1HEZE 4LJPB 3WAMA 1S3SG 1TKGA 2IPKD 1NBFC 1FCLA 2K8BA 2KJHB 4PK1A 2BYEA 2PPHA 5FR6A 5DPRA 4RF0A 3UQAA 3ZO5B 3R66C 4OZBA 1GPXA 1UWMA 1J19A 1WXSA 4HDOA 4X57B 2UU7A 1GNUA 4WAFA 4G50A 4AUQC 2K8CA 5AEKB 5TSSA 3TIXA 2QCZA 3AE6B 2BQQA 1V5TA 1I42A 1XLNA 2KN4A 1WXMA 1WGHA 3M62B 2GI9A 4AWJA 2WDRB 1QKZA 1P0RA 1TY0A 4PS8A 4NAMA 4W9GA 1QOAA 2L0TA 3DWGC 3PLVA 1E0ZA 1BUIC 4B95A 2AL3A 4OHJA 1YJJA 1KJTA 1TIFA 2JYTA 3LXFA 4GDLA 2IBIB 2L7RA 3QWZB 2Q5WD 3N1XC 2KX0A 4E71A 4ANUA 3DHHC 1L0XB 4URKA 3N3KB 2NTSA 4F7ZA 2AEHA 1GB1A 5IOIA 3CMMB 2VZKB 3ZJVA 1E8XA 3GS2A 1RAXA 5E6PA 1TGZB 2B76B 2KQ7A 1D6EC 1NENB 3QIJA 4YTNB 1X1MA 4HDQA 3SU8X 4BBNC 2KJ6A 1V81A 1XEEA 3PPAA 5G2NA 3ZDTA 1Y56A 4CQNA 4LNOA 1UF0A 4GDLB 5D3IB 2WGSA 3SHQA 3WCQA 2KANA 5DCNA 1ET9A 2PLPA 1WXAA 1JRUA 2KDFB 4WWPA 3ZJUA 4C7YA 4GXBA 3ZDMC 2QILA 4HVBA 2VZKD 4EUTA 2LGIA 3CWIA 1ZE3D 1E6EB 3AEAB 2BGFA 2YVCA 3RZWC 1A70A 3AEGB 2IGHA 2PE9A 3GZNB 2ACZB 2ZNVC 4LNNA 2ZVNA 3I63C 3PREA 1FPYA 4OVZA 2M8SA 3ZUNA 1J7AA 1P1AA 1ET6A 1LO5D 4CYEA 4YSXB 3AM9A 4LNIA 3K9OB 4FHKA 4I6PA 3AE9B 2ZCBA 4G3XB 1R4MB 3BVZA 3ML9A 1J8CA 3UIPB 2J7QB 2B3AA 4BOZB 2KC1A 2KVRA 3KUZA 2NPTB 3MC0B 2BWES 2OJWA 3U4EG 3A4RA 2AX5A 2PE6B 4EFOA 3V6CB 3WIMA 1WR6E 3Q2AC 2L05A 3W2DA 3AE4B 1I4RA 2J53A 4YSYB 3AE1B 2N7JA 3M63B 4L2YA 1KTKA 2MBQA 4CO7A 2Z0EB 1WXQA 1SF0A 2IY0B 3PZDA 4B0EA 5DPTA 3Q3JA 4JWUC 2BWFA 2WDVB 1QZEA 1OGWA 4L23A 3SD5A 4C00A 1DOYA 2FCSA 1T0YA 3RYTA 5LXIB 1E8WA 4A9AA 4RGNA 1E8YA 2V3PA 1TY2A 1EWCA 2K25A 1P7FA 5LXHA 2VH2A 2K6QA 1V6EA 2LJIA 1N5WA 1WI0A 4US9A 3KYCD 1JWMD 4EOYA 4IM2A 2KYWA 4O1NA 3JSVB 2HE7A 4A55A 3Q8FA 2HD5B 1Z5SB 1VRAB 1D5MC 4AJYB 4NJCA 1WE6A 2J0MA 3O13A 3NVZA 1Z2MA 3LDZE 4CHKA 2K1FA 3VTUA 2O6VB 3IG3A 3DWMA 4GDKA 4RNAA 4RGMA 1EM7A 4MM3B 2VRRB 1Y8RC 1L6VA 3OAWA 3UIOB 5EE1A 2BS3B 1T6BX 2WXNA 1J0GA 1GG3A 1EU4A 3MHZA 2Z8LA 3HM3A 3H9DA 1NI2A 1TKEA 2LVQA 1N5XA 2RSUA 2LFIA 4ZRIA 4ICUA 1XQQA 3PHXB 4PYZA 5EE9A 4BOSC 4DQOC 2MA9B 3DBHI 2CU3A 2ZEQA 3RFZB 2KJRA 2LEKA 3RMKC 2VH1A 2DWQA 4XDDA 5C3JB 2KQ4X 4DXAB 3L16A 1Q0WB 5D3DA 1SBBB 1WIAA 1U4AA 1VLBA 1UH6A 3U7DA 2WXGA 1FFVA 2KHWB 2WS3B 4K7WA 2MP2A 5IN7A 2JZ3B 4K3CA 1DOIA 2G4DB 1TZOA 1R4NB 1RM6C 1ZPSA 4J6IA 1V80A 4NAWA 2X8XX 3RUIB 3RNCC 2MEKA 5C2TB 2LXAA 4M8NA 2LMCA 2GRIA 2KAJA 4NQLB 3PSEB 2CJOA 1L0VB 2IO1B 1D5ZC 3TL5A 4EEWA 3TMPB 1STEA 4WJNA 3WAPA 3JW0X 2YEPF 3DVNV 1GC6A 2D3CA 2N9XA 3MJ5A 1Q1OA 1QLBB 2L00B 3BVMA 3L10B 3P4PB 1FIQA 1WWTA 4W9JA 5H92C 2FCQA 2ZPNA 4WURA 1OTRB 3P63A 4MDKE 2W55A 4ARCA 2SAKA 4YL8A 1OQQA 2XK5B 4MGZE 3HK0A 2C60A 3ZRFA 1YOVB 3DBRI 2V0GA 4WIPA 2DYBA 4YT0B 4M8MA 1YN5A 1YQ3B 2PMVA 3R2IA 2LASA 2FAZA 2KMAA 2V9HA 2L0FA 3DBHB 2N0SB 4GOCA 2DNFA 2N1VA 3P1MA 3ZXRA 1N62A 3X0WA 3WAOA 3A9JB 3NOBA 1ENFA 3QHTA 2AQ2B 1TBEA 1EF5A 2C5LC 3OJ4B 3LB8C 4AS1A 2D07B 3HVDA 2M19A 4DXGA 4XZ4A 3UQBA 1NYRA 4WQMA 5BMHA 1K52A 4HCNB 1AYFA 2KFKB 4K81A 5GMVA 2K5PA 3QARA 2BW2A 3ONSA 3P4SB 1FNVA 3ZXVA 4HPPA 1IGCA 4EZKA 4H2AA 5IP4D 4BKTA 2L76A 2DZJA 3KWLA 2D11A 1M94A 2D3GA 2N9EB 4GSWA 2E6XA 2N9KA 4ZHOA 4JQWC 1MG8A 1HXYD 2KXJA 2RDGA 3BVGA 2L8JA 1T0QC 2H88B 5EE0A 1OQRA 4KDLB 2JXXA 3A9KB 2MSED 2C9WB 2JVCA 2WWZA 4L1BA 4FJZA 2MX2A 4NPNA 2RMMA 1XLQA 2JPHA 2D3AA 1TKYA 2KD0A 1I4QA 1CK1A 3NZSA 3P2BA 3SDLC 3CSTA 3N1ZC 3L08A 1FNUA 4DDID 2FNJB 2DZKA 2HJ1A 4MSMB 2GBNA 3GE8C 2KK8A 4MGYE 1R4MI 4RFBA 1TJEA 4Q2JA 1YNTE 2IO2B 4J3OD 3E56A 2L3ZA 3Q8AA 3ZLZA 2NCNA 3V6EB 4YSZB 3ZNHB 5E6OA 1WGDA 2JU6X 3W1SA 1M4VA 2QHOA 1P98A 2O2VA 4W9IA 5DPSA 3RCZA 1GB4A 1ZW7A 1T5XD 4GIVA 1UBQA 4DDGD 2CKHB 2EELA 1ISNA 5E6NA 3R2TA 5CHVC 4XGAB 3W9CB 1YMHE 1SGHA 3MJWA 4MH8A 3AE2B 3BINA 3HM6X 1C4AA 3EGRA 1JWSD 1L4ZB 2IY1B 5LNK1 4IWPA 1QQRA 3KLSX 1FRDA 4YXDB 3ZNID 1YX6B 1N60A 1HA5A 1WFYA 3VR9B 3IXSA 2JYEA 3D32A 3MP9A 3MTNB 2K9XA 3APFA 4F8CB 2QIEB 4FADA 4LJOB 3DVGX 2IYDB 4JL9A 1GAQB 1CJEA 4JE3B 2K6DB 4OVVA 3RNFC 3PT2B 1QILA 3VDZA 4YTPB 2BTEA 4XWWA 1WJUA 1RWSA 4XWTA 1IGDA 4G11A 2G3QB 2BT6A 2JZZA 4PS7A 1RLFA 2DZMA 3TSSA 3VRAB 3N32A 2WXQA 1WRIA 4LDTD 1UGMA 4AQ7A 5EE3A 4REZA 2PW9A 2FE8A 4TQ0A 2CR5A 5T8IA 4KSLC 1VZ6A 4C80A 2ZZPB 3DBSA 1TYGB 3KH0A 1TTNA 3HIZA 4FJVB 4ASWC 3M95A 3Q8BA 5CHWA 4ZRQA 2LRWA 2R2QA 2GBMA 2EMSA 2KTFA 1F2RI 1XCQL 1MJDA 3DPDA 4W9LA 4RGTA 1DOXA 1ZXIA 4E3CA 1FEHA 1SEBD 3L0WB 5D7GA 3PZ7A 2KN5A 1F0ZA 3W5UB 3ENEA 3RZFA 5BMIA 4MSQB 2LGXA 4HKQA 4A6QA 2ZCCA 4GB9A 3PVLA 2QEJC 1WE7A 2PVOD 2M17A 2N1WA 3R7QA 3N1YC 1ZUD2 1V5OA 3VVWB 1WZ3A 1C79A 4IW0A 1ESFA 3SEBA 2MRPA 2ONQA 1CZPA 2KTRB 1V49A 4XYCA 3NS8A 4DBGA 4I6NB 2H89B 2KFKA 4FN2A 3DVGY 1PFDA 3NJTA 4K1RB 2MHJA 3DCGA 3WANA 2A4ZA 2CHWA 3C8YA 2R2OA 1IBXB 3EUB2 1RRBA 2V3NA 5JHAA 2JQRB 1OEYJ 2AWTA 1ACCA 1SXTA 2NBUA 2BF8B 1WX9A 1LFDA 1R7SA 2W3SA 5C1ZA 3V62A 4EKUA 2GMIC 1SB3C 4OZAA 3VRBB 2L83A 1YIWA 1HE8A 3RULA 2WU5B 3VHTC 2HTHA 2QJLA 2IO3B 3H7SA 4GU2A 1WJ6A 1XXGA 2ZPYA 1FNWA 1FCCC 1JQ4A 2KT7A 3FKYA 2NTTA 1QF6A 3IT4B 4AP4C 2N7DA 4M00A 1MHHE 2FCMA 1PGBA 4BBNF 2RD0A 4G0NB 3A9KA 2LUEA 2WYQA 2JXTA 2ASQA 1NVID 2WDTB 2K39A 5J18A 1VD2A 4ANWA 1WY8A 2REXA 1LM8B 1E9MA 1N61A 2JF5A 4BAXA 1JMLA 1WSPA 1IUEA 2PVGC 2KDIA 4A3OA
chains in the Genus database with same CATH topology
1E7UA 1R4NI 3R3MA 4KDIC 4MGZE 4WAAA 2KX3A 3HK0A 2C60A 3QC8B 3ZRFA 4FHJA 4B9KA 2MBBB 1Q5WB 3VXWA 2O6VA 3PRZA 4TUUA 3DQVA 3DBRI 3S2AA 2EKEC 2DYBA 3PGEA 3VQIA 2NR2A 3AU5A 4M8MA 5IAAC 4WWNA 2AL6A 1YD8U 2LASA 3QCAA 1WYWB 4W9EA 4XC2A 1V86A 2C7HA 2FAZA 4GN1A 2BPSA 2KMAA 4ZRJA 2L0FA 2G45B 2OOBB 4GOCA 1L7YA 2N1VA 2W9NA 2NS5A 1P3QU 2FIFA 4GMVA 2KWUB 3X0WA 1LXDA 3WAOA 3NY5A 1LQBA 5TR5A 4KV2A 3A9JB 3NOBA 3QHTA 3ZVVA 3QK0A 4KZ0A 1TBEA 1EF5A 4RM9A 2C5LC 2NBVB 3OJ4B 3TCAA 1YX5B 3PRPB 2KKCA 3VH3B 3APDA 4DHZE 2D07B 1WMHA 2KWVB 4NAWB 4NJ6A 2ZNVB 4XZ4A 3UQBA 2DYOA 3EC8A 3AXCA 4LCDE 1AARA 5KHOA 2MBEA 4HCNB 5L95C 2N7EA 2C7NB 2KFKB 3ZNGC 5CHFA 5J17A 3LJ3A 4BKGA 2KMCA 3H7PA 4K81A 3AU4A 4RM8A 5GMVA 3BY4B 2FUHB 4LDTB 4A20A 3GZNI 4K7UA 3QARA 3DVNU 3VUXA 2M1MA 3WALA 3ONSA 2YLMA 4M0WB 5KHQA 2GBJA 3H7PB 1FXTB 1WXVA 3VUWA 4EZKA 3APCA 4FA6A 1WF9A 4HXDA 2O6VD 4LJPB 2LWPA 3WAMA 1S3SG 2NBWB 4BKTA 4W9CA 2L76A 1NBFC 2DZJA 3H1UA 5L83A 2K8BA 2KJHB 2PEAA 2KLGA 2D11A 1M94A 2BYEA 2PPHA 5FR6A 2D3GA 2N9EB 5DPRA 4GSWA 2LXCA 3UQAA 4JQWC 3ZO5B 3R66C 1MG8A 3DBLI 2WX1A 4K7SA 4AJWA 1J19A 3A9JA 2PJHA 1WXSA 2KXJA 3UINB 3KW5B 4HDOA 2L8JA 4X57B 1UD7A 2KDBA 3KUDB 4KDLB 4TQ1A 1GNUA 2JXXA 3A9KB 2MSED 4G50A 2C9WB 2JVCA 2WWZA 2WX0A 5HKHA 4AUQC 2K8CA 3L13A 5D6JB 3TIXA 4FJZA 2NPTA 5AEKB 2K8HA 2MX2A 3KVFB 4HPMB 4NPNA 2JPHA 3EFUA 1V5TA 1I42A 1GC7A 1K8RB 2KD0A 5AZFA 1WXMA 2JUOA 3NZSA 1WGHA 3P2BA 3SDLC 1S1QB 3T8MA 3CSTA 3M62B 3L08A 4AWJA 3KUCB 4DDID 2FNJB 1WGYA 2DZKA 2RGFA 4MSMB 2GBNA 1P0RA 4KIKA 4PS8A 4BVUC 2KK8A 4MGYE 3QAQA 2LVPA 4W9GA 1R4MI 2L0TA 3TJPA 3PLVA 4B95A 2AL3A 2D2QA 1KJTA 4GDLA 4OVUA 2IBIB 1RFAA 2IO2B 2MQJA 1BT0A 2L7RA 1C1YB 2L3ZA 3ZLZA 2MP2B 2NCNA 3V6EB 3QWZB 4W9HA 1E7VA 2IZVB 2KX0A 3QA8A 4E71A 4ANUA 1I35A 4AOFA 4URKA 3CSFA 3N3KB 4F7ZA 3ZNHB 5E6OA 3A1QB 2AEHA 1WGDA 3W1SA 3CMMB 4HPLB 4W9KA 2QHOA 1P98A 2KTRA 2C7MB 1E8XA 2O2VA 1WM2A 4W9IA 4MEMA 5DPSA 4FBJB 3RCZA 1ZW7A 1RAXA 4GIVA 1UBQA 4DDGD 5E6PA 1TGZB 2CKHB 4A3PA 3RD2A 2KQ7A 1ISNA 5E6NA 5CHVC 3EHVA 3QIJA 4WJQA 1WH3A 1X1MA 4HDQA 3SU8X 3ALBA 5J2RA 1SGHA 4BBNC 3RT3B 4KSKC 2DX5B 2KJ6A 1SE9A 2LRUA 2FCNA 2EMTA 1V81A 3MJWA 3V61A 1GUAB 3PPAA 4WJPA 3BINA 3HM6X 5G2NA 2LJ5A 3ZDTA 1UBIA 4MM3A 2KLCA 2OJRA 4GDLB 2IY1B 1EO6A 2XEWA 4IWPA 2KANA 5DCNA 3SHQA 3ZNID 1WXAA 3DOWA 3NHEB 4ICVA 4HLEA 1JRUA 1YX6B 2KDFB 3IVFA 4WWPA 1GJZA 5CX3A 4WJOA 4GXBA 3ZDMC 1WFYA 4P7IA 5D2MB 3K9PB 3ZRCA 4HVBA 3D32A 3MTNB 4EUTA 3OJ3A 2Y5BB 5IA7A 4WQOB 3APFA 4F8CB 3U30A 4KZCA 2GBKA 1WRDB 4JLCA 4FADA 2N9PC 2RPQA 2J0JA 2BGFA 2YVCA 4LJOB 2MWSB 3DVGX 3RZWC 2IYDB 3QJZA 3B08A 3VTWA 4JL9A 4MJSB 2K6DB 2FIDA 4OVVA 2PE9A 4IG7B 3UF8A 2ZNVC 2ZVNA 2ZJDA 3PREA 3VH4B 3JYUA 3NZUA 3PT2B 3VAWA 2M8SA 4F1SA 3ZUNA 1TZ1A 3VDZA 3N30A 1P1AA 4CYEA 3QQ8B 4MELA 3W1YA 2DENB 3ZTDA 4KIKB 1WM3A 1YQBA 3K9OB 1WJUA 4FHKA 2KOXA 4I6PA 2AYOB 2ZCBA 4G3XB 1L2NA 4G11A 2DHZA 3ML9A 3UGBB 2G3QB 2JZZA 1J8CA 1WZ0A 1RLFA 2DZMA 4PS7A 4TKNA 3UIPB 1WGGA 2J7QB 1UELA 3N32A 2B3AA 3B0AA 1E5WA 3O65B 3A33B 4BOZB 5AZGA 4B6WA 4LDTD 2KC1A 4BKSD 4IUMB 2KVRA 3KUZA 2BKFA 2NPTB 1UGMA 3X23A 4DHJD 3L54A 5AZHA 2GBRA 2KO3A 2BWES 3W1SC 2XBBC 4TQ0A 1WMHB 3A4RA 2PE6B 4EFOA 1V9JA 2CR5A 4IWQA 3H6NA 4KSLC 1WJNA 4W9FA 4DWFA 3V6CB 5LLIA 1WR6E 4PYUA 3WIMA 2ZZPB 2L05A 3DBSA 3M3JA 1EF1A 3KH0A 1TTNA 2DZIA 3CF6E 3IHPC 3M63B 3HIZA 1D3ZA 4FJVB 1V2YA 4ASWC 2MBQA 4CO7A 5JHBA 4MJSA 1WGRA 2Z0EB 3M95A 1CMXB 4WWOA 2IY0B 5CHWA 3R7RA 3ZNZB 2LRWA 3PZDA 2KQSA 5C23A 4GDKB 3QX1A 2R2QA 2GBMA 3Q3JA 5DPTA 1IYFA 1H4RA 2BWFA 2BYFA 2Z59B 3AI5A 2EMSA 2DAJA 2JY6A 3VFKA 1UZXB 2KTFA 1KLVA 1QZEA 1OGWA 1VCBA 3SD5A 3HHMA 1OQYA 2DAFA 2KZRA 3DPDA 2FCSA 1T0YA 4W9LA 3RYTA 1E8WA 5LXIB 2JRHA 1E8YA 2MLBA 4E3CA 5D7GA 2JT4B 3L0WB 2M4NA 1KM7A 2UYZB 3DDCB 3PS6A 3I3TB 2K25A 1SIFA 2KN5A 3JSVA 4IM3A 5LXHA 2I1JA 2K6QA 2Z0DB 1V6EA 3ENEA 2JRIB 3RZFA 1IP9A 1ZKHA 1WI0A 4MSQB 2LGXA 5JZEB 2KC2A 2M0XA 3ZTCA 2CS4A 3KYCD 4EOYA 4IM2A 2N4FA 2RR9A 3JSVB 2HE7A 1P9DU 4HWIB 3WA0A 1E90A 2ZCCA 3Q3FA 4GB9A 3JVZX 3PVLA 1WE7A 2CU1A 2HD5B 4GGQA 2M17A 1Z5SB 2HJ8A 2N1WA 3R7QA 2V4LA 2A5UA 2MCNB 3C0RB 2IO0B 3ZW3A 1V5OA 3VVWB 4AJYB 2I1KA 4BKSA 1WE6A 1WZ3A 3ML8A 2J0MA 4II2B 4MH0E 3PHWB 1Z2MA 2NVUI 4IW0A 4DHZB 1PQSA 3LDZE 4CHKA 2K1FA 2MRPA 4JGHB 4PS3A 2O6VB 3VTUA 3ZKJC 1C3TA 2CHXA 3IFWB 4NQKE 1ZGUB 2KTRB 1V49A 4FULA 2MBOA 3NS8A 3IG3A 2UWQA 4GDKA 2D10A 2XK5A 1XD3B 4DBGA 3T9LA 2LVOA 2VRRB 1A5RA 1Y8RC 4I6NB 3OAWA 3UIOB 1WX7A 2V1YA 4FLHA 4ZRKA 2KFKA 4FN2A 1IPGA 3DVGY 1J0GA 2LZ6A 2LGYA 1GG3A 4I6LB 2J0KA 4E74A 1XT9B 3HM3A 4ZYNA 1NI2A 2KWCA 2LVQA 3H9DA 4K1RB 2RSUA 4ZRIA 2KNBA 3DCGA 4ICUA 1XQQA 3WANA 2A4ZA 1YJ1A 2CHWA 3PHXB 4PYZA 4KVGB 2R2OA 4BOSC 2MA9B 1RRBA 2ZEQA 3DBHI 4DHJB 3EECA 5JHAA 5D94A 4IWOA 3A4SC 3U8ZA 4HJKA 1OEYJ 2KJRA 2KFJA 3PLUA 2AWTA 1WX8A 3OLMD 2NBUA 3ZIMA 1E8ZA 2BF8B 4W9DA 2LGDA 1WX9A 3ECIA 1LFDA 2O2VB 1F9JA 3KYDD 4DXAB 3L16A 1Q0WB 1NDDA 5C1ZA 3V62A 1OEYA 1WIAA 4HCPB 4EKUA 2KDEB 1EUVB 1U4AA 2MBHA 3PRMB 1KOTA 1UH6A 3U7DA 2GMIC 2KHWB 2V3SA 4K7WA 2MP2A 1YIWA 1HE8A 2JZ3B 3RULA 2G4DB 3VHTC 2HTHA 2IO3B 3A1QA 3H7SA 4J6IA 1V80A 2ZVOA 4GU2A 4IM0A 1WJ6A 4NAWA 2ZPYA 4HK2A 3RUIB 4N9F4 1H8CA 3GOEA 2LXAA 4M8NA 3PV1A 3VUYA 3PTFC 4IC7B 4AP4C 4NQLB 3PSEB 3VTVA 4NNJB 2N7DA 4EZJA 4MGKE 3AULA 2IO1B 2FCMA 3TL5A 5CTRC 4RMAA 4BBNF 3TMPB 4EEWA 3V60A 1G6JA 2BKRB 2RD0A 4DK5A 4BFRA 2BYVE 4WJNA 4G0NB 3WAPA 2CHZA 3JW0X 3L17A 2LI5A 3DVNV 2G4SA 3A9KA 1GC6A 4ANVA 5DPWA 2LUEA 5G55A 2WYQA 5BO4B 2MW5A 2GOWA 2ASQA 3IBEA 2N9XA 4EZLA 2LD9A 1Q1OA 2L00B 2K39A 2WDTB 4XX5A 5J18A 3L10B 5JH5C 1WR1A 1VD2A 4ANWA 1WY8A 2JWZA 2REXA 4NJ7A 1LM8B 2DYMA 4MGIE 4W9JA 2JF5A 2FCQA 3TBLD 2ZPNA 3MHSD 1OTRB 1WJ4A 4ANXA 4ZDVA 4NY0A 4MDKE 4FJYA 5EDSA 4II3B 4JIOU 2KDIA 4TV3A 4YL8A 4A3OA 3B1LX 2XK5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7U A;  1R4N I;  3R3M A;  4KDI C;  4MGZ E;  4WAA A;  2KX3 A;  3HK0 A;  2C60 A;  3QC8 B;  3ZRF A;  4FHJ A;  4B9K A;  2MBB B;  1Q5W B;  3VXW A;  2O6V A;  3PRZ A;  4TUU A;  3DQV A;  3DBR I;  3S2A A;  2EKE C;  2DYB A;  3PGE A;  3VQI A;  2NR2 A;  3AU5 A;  4M8M A;  5IAA C;  4WWN A;  2AL6 A;  1YD8 U;  2LAS A;  3QCA A;  1WYW B;  4W9E A;  4XC2 A;  1V86 A;  2C7H A;  2FAZ A;  4GN1 A;  2BPS A;  2KMA A;  4ZRJ A;  2L0F A;  2G45 B;  2OOB B;  4GOC A;  1L7Y A;  2N1V A;  2W9N A;  2NS5 A;  1P3Q U;  2FIF A;  4GMV A;  2KWU B;  3X0W A;  1LXD A;  3WAO A;  3NY5 A;  1LQB A;  5TR5 A;  4KV2 A;  3A9J B;  3NOB A;  3QHT A;  3ZVV A;  3QK0 A;  4KZ0 A;  1TBE A;  1EF5 A;  4RM9 A;  2C5L C;  2NBV B;  3OJ4 B;  3TCA A;  1YX5 B;  3PRP B;  2KKC A;  3VH3 B;  3APD A;  4DHZ E;  2D07 B;  1WMH A;  2KWV B;  4NAW B;  4NJ6 A;  2ZNV B;  4XZ4 A;  3UQB A;  2DYO A;  3EC8 A;  3AXC A;  4LCD E;  1AAR A;  5KHO A;  2MBE A;  4HCN B;  5L95 C;  2N7E A;  2C7N B;  2KFK B;  3ZNG C;  5CHF A;  5J17 A;  3LJ3 A;  4BKG A;  2KMC A;  3H7P A;  4K81 A;  3AU4 A;  4RM8 A;  5GMV A;  3BY4 B;  2FUH B;  4LDT B;  4A20 A;  3GZN I;  4K7U A;  3QAR A;  3DVN U;  3VUX A;  2M1M A;  3WAL A;  3ONS A;  2YLM A;  4M0W B;  5KHQ A;  2GBJ A;  3H7P B;  1FXT B;  1WXV A;  3VUW A;  4EZK A;  3APC A;  4FA6 A;  1WF9 A;  4HXD A;  2O6V D;  4LJP B;  2LWP A;  3WAM A;  1S3S G;  2NBW B;  4BKT A;  4W9C A;  2L76 A;  1NBF C;  2DZJ A;  3H1U A;  5L83 A;  2K8B A;  2KJH B;  2PEA A;  2KLG A;  2D11 A;  1M94 A;  2BYE A;  2PPH A;  5FR6 A;  2D3G A;  2N9E B;  5DPR A;  4GSW A;  2LXC A;  3UQA A;  4JQW C;  3ZO5 B;  3R66 C;  1MG8 A;  3DBL I;  2WX1 A;  4K7S A;  4AJW A;  1J19 A;  3A9J A;  2PJH A;  1WXS A;  2KXJ A;  3UIN B;  3KW5 B;  4HDO A;  2L8J A;  4X57 B;  1UD7 A;  2KDB A;  3KUD B;  4KDL B;  4TQ1 A;  1GNU A;  2JXX A;  3A9K B;  2MSE D;  4G50 A;  2C9W B;  2JVC A;  2WWZ A;  2WX0 A;  5HKH A;  4AUQ C;  2K8C A;  3L13 A;  5D6J B;  3TIX A;  4FJZ A;  2NPT A;  5AEK B;  2K8H A;  2MX2 A;  3KVF B;  4HPM B;  4NPN A;  2JPH A;  3EFU A;  1V5T A;  1I42 A;  1GC7 A;  1K8R B;  2KD0 A;  5AZF A;  1WXM A;  2JUO A;  3NZS A;  1WGH A;  3P2B A;  3SDL C;  1S1Q B;  3T8M A;  3CST A;  3M62 B;  3L08 A;  4AWJ A;  3KUC B;  4DDI D;  2FNJ B;  1WGY A;  2DZK A;  2RGF A;  4MSM B;  2GBN A;  1P0R A;  4KIK A;  4PS8 A;  4BVU C;  2KK8 A;  4MGY E;  3QAQ A;  2LVP A;  4W9G A;  1R4M I;  2L0T A;  3TJP A;  3PLV A;  4B95 A;  2AL3 A;  2D2Q A;  1KJT A;  4GDL A;  4OVU A;  2IBI B;  1RFA A;  2IO2 B;  2MQJ A;  1BT0 A;  2L7R A;  1C1Y B;  2L3Z A;  3ZLZ A;  2MP2 B;  2NCN A;  3V6E B;  3QWZ B;  4W9H A;  1E7V A;  2IZV B;  2KX0 A;  3QA8 A;  4E71 A;  4ANU A;  1I35 A;  4AOF A;  4URK A;  3CSF A;  3N3K B;  4F7Z A;  3ZNH B;  5E6O A;  3A1Q B;  2AEH A;  1WGD A;  3W1S A;  3CMM B;  4HPL B;  4W9K A;  2QHO A;  1P98 A;  2KTR A;  2C7M B;  1E8X A;  2O2V A;  1WM2 A;  4W9I A;  4MEM A;  5DPS A;  4FBJ B;  3RCZ A;  1ZW7 A;  1RAX A;  4GIV A;  1UBQ A;  4DDG D;  5E6P A;  1TGZ B;  2CKH B;  4A3P A;  3RD2 A;  2KQ7 A;  1ISN A;  5E6N A;  5CHV C;  3EHV A;  3QIJ A;  4WJQ A;  1WH3 A;  1X1M A;  4HDQ A;  3SU8 X;  3ALB A;  5J2R A;  1SGH A;  4BBN C;  3RT3 B;  4KSK C;  2DX5 B;  2KJ6 A;  1SE9 A;  2LRU A;  2FCN A;  2EMT A;  1V81 A;  3MJW A;  3V61 A;  1GUA B;  3PPA A;  4WJP A;  3BIN A;  3HM6 X;  5G2N A;  2LJ5 A;  3ZDT A;  1UBI A;  4MM3 A;  2KLC A;  2OJR A;  4GDL B;  2IY1 B;  1EO6 A;  2XEW A;  4IWP A;  2KAN A;  5DCN A;  3SHQ A;  3ZNI D;  1WXA A;  3DOW A;  3NHE B;  4ICV A;  4HLE A;  1JRU A;  1YX6 B;  2KDF B;  3IVF A;  4WWP A;  1GJZ A;  5CX3 A;  4WJO A;  4GXB A;  3ZDM C;  1WFY A;  4P7I A;  5D2M B;  3K9P B;  3ZRC A;  4HVB A;  3D32 A;  3MTN B;  4EUT A;  3OJ3 A;  2Y5B B;  5IA7 A;  4WQO B;  3APF A;  4F8C B;  3U30 A;  4KZC A;  2GBK A;  1WRD B;  4JLC A;  4FAD A;  2N9P C;  2RPQ A;  2J0J A;  2BGF A;  2YVC A;  4LJO B;  2MWS B;  3DVG X;  3RZW C;  2IYD B;  3QJZ A;  3B08 A;  3VTW A;  4JL9 A;  4MJS B;  2K6D B;  2FID A;  4OVV A;  2PE9 A;  4IG7 B;  3UF8 A;  2ZNV C;  2ZVN A;  2ZJD A;  3PRE A;  3VH4 B;  3JYU A;  3NZU A;  3PT2 B;  3VAW A;  2M8S A;  4F1S A;  3ZUN A;  1TZ1 A;  3VDZ A;  3N30 A;  1P1A A;  4CYE A;  3QQ8 B;  4MEL A;  3W1Y A;  2DEN B;  3ZTD A;  4KIK B;  1WM3 A;  1YQB A;  3K9O B;  1WJU A;  4FHK A;  2KOX A;  4I6P A;  2AYO B;  2ZCB A;  4G3X B;  1L2N A;  4G11 A;  2DHZ A;  3ML9 A;  3UGB B;  2G3Q B;  2JZZ A;  1J8C A;  1WZ0 A;  1RLF A;  2DZM A;  4PS7 A;  4TKN A;  3UIP B;  1WGG A;  2J7Q B;  1UEL A;  3N32 A;  2B3A A;  3B0A A;  1E5W A;  3O65 B;  3A33 B;  4BOZ B;  5AZG A;  4B6W A;  4LDT D;  2KC1 A;  4BKS D;  4IUM B;  2KVR A;  3KUZ A;  2BKF A;  2NPT B;  1UGM A;  3X23 A;  4DHJ D;  3L54 A;  5AZH A;  2GBR A;  2KO3 A;  2BWE S;  3W1S C;  2XBB C;  4TQ0 A;  1WMH B;  3A4R A;  2PE6 B;  4EFO A;  1V9J A;  2CR5 A;  4IWQ A;  3H6N A;  4KSL C;  1WJN A;  4W9F A;  4DWF A;  3V6C B;  5LLI A;  1WR6 E;  4PYU A;  3WIM A;  2ZZP B;  2L05 A;  3DBS A;  3M3J A;  1EF1 A;  3KH0 A;  1TTN A;  2DZI A;  3CF6 E;  3IHP C;  3M63 B;  3HIZ A;  1D3Z A;  4FJV B;  1V2Y A;  4ASW C;  2MBQ A;  4CO7 A;  5JHB A;  4MJS A;  1WGR A;  2Z0E B;  3M95 A;  1CMX B;  4WWO A;  2IY0 B;  5CHW A;  3R7R A;  3ZNZ B;  2LRW A;  3PZD A;  2KQS A;  5C23 A;  4GDK B;  3QX1 A;  2R2Q A;  2GBM A;  3Q3J A;  5DPT A;  1IYF A;  1H4R A;  2BWF A;  2BYF A;  2Z59 B;  3AI5 A;  2EMS A;  2DAJ A;  2JY6 A;  3VFK A;  1UZX B;  2KTF A;  1KLV A;  1QZE A;  1OGW A;  1VCB A;  3SD5 A;  3HHM A;  1OQY A;  2DAF A;  2KZR A;  3DPD A;  2FCS A;  1T0Y A;  4W9L A;  3RYT A;  1E8W A;  5LXI B;  2JRH A;  1E8Y A;  2MLB A;  4E3C A;  5D7G A;  2JT4 B;  3L0W B;  2M4N A;  1KM7 A;  2UYZ B;  3DDC B;  3PS6 A;  3I3T B;  2K25 A;  1SIF A;  2KN5 A;  3JSV A;  4IM3 A;  5LXH A;  2I1J A;  2K6Q A;  2Z0D B;  1V6E A;  3ENE A;  2JRI B;  3RZF A;  1IP9 A;  1ZKH A;  1WI0 A;  4MSQ B;  2LGX A;  5JZE B;  2KC2 A;  2M0X A;  3ZTC A;  2CS4 A;  3KYC D;  4EOY A;  4IM2 A;  2N4F A;  2RR9 A;  3JSV B;  2HE7 A;  1P9D U;  4HWI B;  3WA0 A;  1E90 A;  2ZCC A;  3Q3F A;  4GB9 A;  3JVZ X;  3PVL A;  1WE7 A;  2CU1 A;  2HD5 B;  4GGQ A;  2M17 A;  1Z5S B;  2HJ8 A;  2N1W A;  3R7Q A;  2V4L A;  2A5U A;  2MCN B;  3C0R B;  2IO0 B;  3ZW3 A;  1V5O A;  3VVW B;  4AJY B;  2I1K A;  4BKS A;  1WE6 A;  1WZ3 A;  3ML8 A;  2J0M A;  4II2 B;  4MH0 E;  3PHW B;  1Z2M A;  2NVU I;  4IW0 A;  4DHZ B;  1PQS A;  3LDZ E;  4CHK A;  2K1F A;  2MRP A;  4JGH B;  4PS3 A;  2O6V B;  3VTU A;  3ZKJ C;  1C3T A;  2CHX A;  3IFW B;  4NQK E;  1ZGU B;  2KTR B;  1V49 A;  4FUL A;  2MBO A;  3NS8 A;  3IG3 A;  2UWQ A;  4GDK A;  2D10 A;  2XK5 A;  1XD3 B;  4DBG A;  3T9L A;  2LVO A;  2VRR B;  1A5R A;  1Y8R C;  4I6N B;  3OAW A;  3UIO B;  1WX7 A;  2V1Y A;  4FLH A;  4ZRK A;  2KFK A;  4FN2 A;  1IPG A;  3DVG Y;  1J0G A;  2LZ6 A;  2LGY A;  1GG3 A;  4I6L B;  2J0K A;  4E74 A;  1XT9 B;  3HM3 A;  4ZYN A;  1NI2 A;  2KWC A;  2LVQ A;  3H9D A;  4K1R B;  2RSU A;  4ZRI A;  2KNB A;  3DCG A;  4ICU A;  1XQQ A;  3WAN A;  2A4Z A;  1YJ1 A;  2CHW A;  3PHX B;  4PYZ A;  4KVG B;  2R2O A;  4BOS C;  2MA9 B;  1RRB A;  2ZEQ A;  3DBH I;  4DHJ B;  3EEC A;  5JHA A;  5D94 A;  4IWO A;  3A4S C;  3U8Z A;  4HJK A;  1OEY J;  2KJR A;  2KFJ A;  3PLU A;  2AWT A;  1WX8 A;  3OLM D;  2NBU A;  3ZIM A;  1E8Z A;  2BF8 B;  4W9D A;  2LGD A;  1WX9 A;  3ECI A;  1LFD A;  2O2V B;  1F9J A;  3KYD D;  4DXA B;  3L16 A;  1Q0W B;  1NDD A;  5C1Z A;  3V62 A;  1OEY A;  1WIA A;  4HCP B;  4EKU A;  2KDE B;  1EUV B;  1U4A A;  2MBH A;  3PRM B;  1KOT A;  1UH6 A;  3U7D A;  2GMI C;  2KHW B;  2V3S A;  4K7W A;  2MP2 A;  1YIW A;  1HE8 A;  2JZ3 B;  3RUL A;  2G4D B;  3VHT C;  2HTH A;  2IO3 B;  3A1Q A;  3H7S A;  4J6I A;  1V80 A;  2ZVO A;  4GU2 A;  4IM0 A;  1WJ6 A;  4NAW A;  2ZPY A;  4HK2 A;  3RUI B;  4N9F 4;  1H8C A;  3GOE A;  2LXA A;  4M8N A;  3PV1 A;  3VUY A;  3PTF C;  4IC7 B;  4AP4 C;  4NQL B;  3PSE B;  3VTV A;  4NNJ B;  2N7D A;  4EZJ A;  4MGK E;  3AUL A;  2IO1 B;  2FCM A;  3TL5 A;  5CTR C;  4RMA A;  4BBN F;  3TMP B;  4EEW A;  3V60 A;  1G6J A;  2BKR B;  2RD0 A;  4DK5 A;  4BFR A;  2BYV E;  4WJN A;  4G0N B;  3WAP A;  2CHZ A;  3JW0 X;  3L17 A;  2LI5 A;  3DVN V;  2G4S A;  3A9K A;  1GC6 A;  4ANV A;  5DPW A;  2LUE A;  5G55 A;  2WYQ A;  5BO4 B;  2MW5 A;  2GOW A;  2ASQ A;  3IBE A;  2N9X A;  4EZL A;  2LD9 A;  1Q1O A;  2L00 B;  2K39 A;  2WDT B;  4XX5 A;  5J18 A;  3L10 B;  5JH5 C;  1WR1 A;  1VD2 A;  4ANW A;  1WY8 A;  2JWZ A;  2REX A;  4NJ7 A;  1LM8 B;  2DYM A;  4MGI E;  4W9J A;  2JF5 A;  2FCQ A;  3TBL D;  2ZPN A;  3MHS D;  1OTR B;  1WJ4 A;  4ANX A;  4ZDV A;  4NY0 A;  4MDK E;  4FJY A;  5EDS A;  4II3 B;  4JIO U;  2KDI A;  4TV3 A;  4YL8 A;  4A3O A;  3B1L X;  2XK5 B; 
#chains in the Genus database with same CATH topology
 2Y5C A;  4B9K A;  4FHJ A;  2MBB B;  3VXW A;  4N58 A;  3ZQ4 A;  3DQV A;  2YEP B;  2EKE C;  1D5X C;  3PGE A;  4LK0 M;  3VQI A;  4ZOH C;  5IAA C;  2DBY A;  2AL6 A;  4W9E A;  1V86 A;  2SEB D;  4YTM B;  2J42 A;  1C9F A;  3DBR B;  3SFD B;  1PGA A;  3B2G A;  3OG5 A;  5TR5 A;  4KV2 A;  1XCT L;  2WXJ A;  3QK0 A;  1VZ7 A;  4C4V B;  2KKC A;  3GP7 A;  1YN4 A;  2KWV B;  1WMH A;  1SE4 A;  1QOB A;  4NJ6 A;  4OW0 A;  1T0R C;  1MG4 A;  2EKI A;  5KHO A;  2MBE A;  1PGX A;  5GXG B;  3LJ3 A;  4BKG A;  2KMC A;  3AU4 A;  4RM8 A;  1UUP A;  1NEK B;  4A20 A;  3FIL B;  4PT5 A;  3U7Z A;  3VUX A;  2DLB A;  2YLM A;  4M0W B;  5KHQ A;  2GBJ A;  3H7P B;  1WXV A;  3APC A;  4HXD A;  2O6V D;  2RDB C;  1CQV A;  4W9C A;  5L83 A;  2KLG A;  2LHD A;  3NVW A;  2LXC A;  2OED A;  3P4R B;  1I4G A;  3DBL I;  1HQR D;  4K7S A;  4AJW A;  1V1P A;  3A9J A;  2PJH A;  1NI3 A;  3P4Q B;  2Y5P A;  1UD7 A;  3DHG C;  3KUD B;  3EFC A;  3HVZ A;  4TSS A;  2Y3A A;  1UWX A;  2WX0 A;  5HKH A;  3L13 A;  1Q10 A;  5D6J B;  5J2R A;  2NPT A;  3KVF B;  2K8H A;  4HPM B;  1I7H A;  2D5G A;  5H8Y E;  3URY A;  1GC7 A;  3MFG A;  1JWU D;  3H8H A;  5AZF A;  1TS2 A;  3T8M A;  3R8B A;  4KGR A;  4A90 A;  3FC4 A;  2BBC A;  2RGF A;  3RPF C;  1SE3 A;  2LVP A;  3IT6 B;  4XDC A;  3TJP A;  1MPE A;  4RH6 A;  2D2Q A;  1PUT A;  2MQJ A;  1XLO A;  1K51 A;  2QSD A;  1JWA D;  1E7V A;  2IZV B;  3QA8 A;  4RF1 A;  3A1Q B;  4OZC A;  4HPL B;  4W9K A;  1EWY C;  2CJN A;  4MEM A;  2HTM E;  3U52 E;  4A3P A;  1F1H A;  2JZP A;  1YJI A;  1IBX A;  4WJQ A;  1L5P A;  1MI0 A;  3ALB A;  3HUI A;  3AB5 A;  4KSK C;  3N20 C;  1FD6 A;  3MC9 A;  2EMT A;  2W3R A;  3GE3 C;  1V8C A;  1E10 A;  3NRZ A;  2LJ5 A;  4N6E B;  1UBI A;  4MM3 A;  5FR3 A;  5G5H A;  2MJD A;  4LTU A;  2V4I B;  2WXM A;  3AMZ A;  2KVZ A;  3I5J C;  4ICV A;  3NHE B;  3SR6 A;  3IVF A;  5CX3 A;  4WJO A;  1L0Y B;  2IDY A;  2G9H D;  1L4D B;  1FO4 A;  3OJ3 A;  4WQO B;  3RNA C;  4KZC A;  2D3B A;  4M0W A;  2N9P C;  3NG0 A;  2J0J A;  3B08 A;  3VTW A;  4MJS B;  3ETR A;  4HJG E;  4HRO A;  1JWB D;  4F1S A;  2RPV A;  3N30 A;  4M01 A;  1C4P A;  3W1Y A;  1YQB A;  4BZA A;  3MC8 A;  1VDV A;  3Q8C A;  4RCO A;  2AYO B;  1KH0 A;  1L2N A;  3KQ4 A;  4MT5 A;  3ZJT A;  4TKN A;  1UEL A;  2K22 A;  3B0A A;  1E5W A;  3O65 B;  3A33 B;  3TEY A;  4B6W A;  1FFU A;  2BKF A;  1P7E A;  3X23 A;  4DHJ D;  2KAC A;  3L54 A;  2LGS A;  5AZH A;  2GBR A;  5MPO A;  3W1S C;  2WXI A;  1ZP0 B;  4IWQ A;  1WJN A;  4W9F A;  4DWF A;  1B1Z A;  2TSS A;  2WLB A;  4WH4 A;  2E3T A;  3AE5 B;  3CF6 E;  3IHP C;  1D3Z A;  4LNF A;  3ZNZ B;  1WGR A;  5FK9 C;  3R7R A;  1BML C;  1CMX B;  4WWO A;  5BMG A;  3NS1 A;  3BYY B;  3Q14 C;  2FBW B;  2KQS A;  5C23 A;  1N6Z A;  4GDK B;  5I4D A;  1IYF A;  3EA6 A;  2Z59 B;  2DAJ A;  2JY6 A;  3HHM A;  1FRR A;  2KZR A;  2JRH A;  2MLB A;  3PS6 A;  2I2Y A;  3DDC B;  3I3T B;  3JSV A;  1SIF A;  2BVC A;  2I1J A;  2JRI B;  1IP9 A;  4P16 A;  2KC2 A;  2M0X A;  3TEZ A;  2CS4 A;  2WDQ B;  2RR9 A;  4IKG A;  3WA0 A;  1E90 A;  1FMA D;  3Q3F A;  2INN E;  2HJ8 A;  2V4L A;  2A5U A;  1SSN A;  3C0R B;  4KGT A;  1OFF A;  3OWE B;  3ML8 A;  3KWV A;  3PHW B;  2BB5 A;  2NVU I;  1E7P B;  1C3T A;  1GJZ A;  2WU2 B;  2CHX A;  1N63 A;  3E9S A;  4FUL A;  2IND C;  1V97 A;  3ZYY X;  1A5R A;  4KKI A;  1WX7 A;  2V1Y A;  4FLH A;  1TS3 A;  2WP9 B;  1VR9 A;  4E74 A;  2J0K A;  4ZYN A;  1I4P A;  4S0R A;  2KNB A;  1KF6 B;  1JRO A;  2OHF A;  2NMQ A;  1ZDX A;  4DHJ B;  5D94 A;  3A4S C;  3Q3M C;  3U8Z A;  2WXH A;  2R61 A;  2WQY B;  3OLM D;  1SJE D;  3ZIM A;  1E8Z A;  4W9D A;  3ECI A;  2O2V B;  1F9J A;  3KYD D;  4KX6 B;  3AN1 A;  4HCP B;  3PRM B;  3I57 A;  1KOT A;  2WXK A;  4MAC A;  1TS5 A;  3J9C A;  2MJE A;  2G1E A;  2L1A A;  3PV1 A;  3VUY A;  3VTV A;  4NNJ B;  3AUL A;  1HTQ A;  3DHI C;  4M02 A;  3DBL B;  1EU3 A;  2BKR B;  2BYV E;  2J4X A;  1AW7 A;  4A8X C;  4FXC A;  3L17 A;  2WNM A;  4ANV A;  4DXF A;  2PKO A;  5G55 A;  5BO4 B;  3IBE A;  2MW5 A;  4EZL A;  5AUK A;  1C4C A;  4XX5 A;  1WR1 A;  4NJ7 A;  2DYM A;  5BYR A;  3MHS D;  4ANX A;  1JW9 D;  4NY0 A;  4FJY A;  4JIO U;  1J7C A;  2MH7 A;  3NVY A;  2M0A A;  3PZ8 A;  1R4N I;  3R3M A;  2KX3 A;  4R3D A;  4EE2 A;  2WXO A;  2O6V A;  3S2A A;  2QC8 A;  2AQ1 B;  2NR2 A;  3AU5 A;  4WWN A;  2JX5 A;  1YD8 U;  1XLP A;  4XE0 A;  4ZRJ A;  4GN1 A;  2C7H A;  2BPS A;  2G45 B;  1LGR A;  4ITK A;  1JCK B;  2NS5 A;  1P3Q U;  2N9L A;  4GMV A;  1C76 A;  4KZ0 A;  3TCA A;  3PRP B;  3VH3 B;  3SFE B;  4DHZ E;  3CIR B;  3T3O A;  4WWM A;  3T3N A;  2ZNV B;  3EC8 A;  2W82 A;  4IDI A;  4LCD E;  1AAR A;  5L95 C;  2N7E A;  2C7N B;  4JX1 C;  2QMT A;  3ZNG C;  5CHF A;  3N9Y C;  5J17 A;  4QAY A;  3BY4 B;  2FUH B;  3C19 A;  2M1M A;  4S17 A;  5HFY A;  1FXT B;  3VUW A;  4FA6 A;  1WF9 A;  2LWP A;  2NBW B;  3H1U A;  2WXF A;  2PEA A;  5E6J A;  3ZGZ A;  4P6V F;  1WGK A;  1RFK A;  1FXA A;  2WX1 A;  3UIN B;  3KW5 B;  2KDB A;  4TQ1 A;  2LHE A;  3TEX A;  3U2S C;  2BS4 B;  3RNE C;  5IKC M;  2JSV X;  3EFU A;  3Q3N C;  1SIJ A;  1K8R B;  5HI1 A;  2PIA A;  5BYQ A;  2JUO A;  1MVK A;  1S1Q B;  4N59 A;  3FAH A;  3KUC B;  2I38 A;  1WGY A;  1K53 A;  2L32 A;  4BVU C;  4KIK A;  3AH7 A;  3BZD B;  3QAQ A;  1KLU D;  2WHI A;  3BYT B;  2XNA C;  2IJ0 A;  4OVU A;  1RFA A;  1BT0 A;  1C1Y B;  1I4H A;  2MP2 B;  4W9H A;  2AQ3 B;  1C78 A;  1I35 A;  3Q3O C;  4AOF A;  3CSF A;  1KLG D;  3I9V 1;  1FXI A;  2KTR A;  3UI3 A;  2C7M B;  1WM2 A;  1F52 A;  4FBJ B;  5HG2 A;  3RI7 C;  3W5V B;  1MFW A;  1ZXH A;  3RD2 A;  3RNG C;  1AN8 A;  3EHV A;  1WH3 A;  4ACF A;  2INC C;  3RT3 B;  3AE3 B;  2DX5 B;  2LRU A;  1SE9 A;  2FCN A;  3NVV A;  1AWD A;  3V61 A;  1GUA B;  4WJP A;  4LNK A;  1WYG A;  2L52 A;  2KLC A;  2OJR A;  5HHD G;  1EO6 A;  2XEW A;  1V1O A;  3DOW A;  4JPS A;  4HKZ E;  4HLE A;  4P7I A;  5D2M B;  3K9P B;  3ZRC A;  4IOI E;  1QT9 A;  2M56 B;  2Y5B B;  5IA7 A;  4C56 C;  3U30 A;  2GBK A;  1WRD B;  4JLC A;  1T0S C;  2RPQ A;  2MWS B;  3QJZ A;  3TEW A;  4C7Z A;  3Q69 A;  1ROE A;  3RN9 C;  5AUI A;  2FID A;  4IG7 B;  3UF8 A;  2ZJD A;  3VH4 B;  3JYU A;  2PTL A;  3AV8 A;  3NZU A;  3NZ3 A;  3VAW A;  1TZ1 A;  3IAM 1;  1NYQ A;  3QQ8 B;  3V3X A;  4MEL A;  2DEN B;  3ZTD A;  4KIK B;  1WM3 A;  2KOX A;  3PO0 A;  2W54 A;  3NUH B;  1TS4 A;  2DHZ A;  3FIL A;  3UGB B;  1WZ0 A;  1XF5 L;  4RGO S;  3V05 A;  1WGG A;  1BXT A;  5AZG A;  4BKS D;  4IUM B;  1QOG A;  2ICI A;  2KO3 A;  5G5G A;  2XBB C;  1WMH B;  1V9J A;  3H6N A;  4P1C C;  5JXV A;  1SE2 A;  1J7B A;  5LLI A;  4PYU A;  3M3J A;  1T3Q A;  1EF1 A;  1KRH A;  2DZI A;  3P42 A;  4K3B A;  1V2Y A;  5JHB A;  4MJS A;  2RDH A;  1B9R A;  1L6U A;  5BYS A;  3QX1 A;  1H4R A;  2BYF A;  3AI5 A;  3VFK A;  1UZX B;  1KLV A;  1VCB A;  2GB1 A;  1UNS A;  1OQY A;  2DAF A;  5FKA C;  2K0P A;  1FM0 D;  2BB6 A;  1DYQ A;  1ZOY B;  2JT4 B;  2M4N A;  1KM7 A;  2UYZ B;  4IM3 A;  2J52 A;  2Z0D B;  1ZKH A;  5JZE B;  3ZTC A;  3AE7 B;  4NZL B;  5IO9 A;  4US8 A;  2N4F A;  4ZYS A;  1P9D U;  2GLS A;  4HWI B;  1C77 A;  3JVZ X;  2CU1 A;  4GGQ A;  3AED B;  2MCN B;  2IO0 B;  3ZW3 A;  2I1K A;  4D2K A;  4BKS A;  4MH0 E;  4II2 B;  3BK2 A;  4DHZ B;  1XO3 A;  1PQS A;  3B2F A;  4JGH B;  4PS3 A;  3ZKJ C;  3Q6B A;  3IFW B;  4NQK E;  1ZGU B;  4KGS A;  2MBO A;  2ZW1 A;  1UGJ A;  2UWQ A;  2XN9 C;  2D10 A;  2XK5 A;  1MHX A;  1XD3 B;  3T9L A;  2LVO A;  1VJK A;  1HZ6 A;  4ZRK A;  3AEF B;  3TUO A;  1IPG A;  2LZ6 A;  2LGY A;  4I6L B;  1XT9 B;  2KWC A;  2INP E;  4GLS C;  3AEE B;  2ON8 A;  1YJ1 A;  4KVG B;  3BII D;  3IAS 1;  3EEC A;  4IWO A;  4HJK A;  1HTO A;  2KFJ A;  3PLU A;  3B9J A;  1SJH D;  1WX8 A;  2FUG 1;  2LGD A;  1NDD A;  4B0M A;  1OEY A;  2KDE B;  1EUV B;  2MBH A;  4USA A;  2WXR A;  4JWS C;  2IGD A;  4P1B C;  2V3S A;  4HEA 1;  3AE8 B;  1PYW D;  3A1Q A;  2ZVO A;  4IM0 A;  4HK2 A;  4N9F 4;  3RNB C;  4C4V A;  1TT5 B;  1H8C A;  3GOE A;  1YQ4 B;  1F77 A;  3LYY A;  2X38 A;  3PTF C;  4IC7 B;  1V1P B;  4EZJ A;  4MGK E;  5CTR C;  4RMA A;  3V60 A;  1G6J A;  4DK5 A;  4UDU C;  4BFR A;  2QDF A;  2CHZ A;  1JAL A;  2LI5 A;  3AEB B;  2G4S A;  5DPW A;  1F2R C;  1GOZ A;  2GOW A;  2LD9 A;  5JH5 C;  2JWZ A;  2MJ3 A;  3HRD D;  3L4P A;  4MGI E;  2WXP A;  3BWU D;  3TBL D;  1K50 A;  1YN3 A;  1WJ4 A;  4ZRP A;  4ZDV A;  5EDS A;  4II3 B;  4TV3 A;  4TMA B;  3B1L X;  1VZ8 A;  2KWD A;  1E7U A;  4KDI C;  2ZW0 A;  4WAA A;  2IGG A;  3QC8 B;  1DGJ A;  2JWU A;  3GB1 A;  1Q5W B;  3VR8 B;  3PRZ A;  4TUU A;  2HDE A;  4ARI A;  2BYT A;  3Q8E A;  3QCA A;  1WYW B;  4XC2 A;  2OOB B;  3BK1 A;  1PDX A;  4ZHP A;  1L7Y A;  2W9N A;  3AEC B;  2FIF A;  2KWU B;  4HRS A;  1LXD A;  4YWG G;  3NY5 A;  1LQB A;  1RYJ A;  3ZVV A;  1I4X A;  1KFY B;  4RM9 A;  2BS2 B;  2NBV B;  3ABV B;  1YX5 B;  2WXL A;  2LUM A;  3APD A;  4NAW B;  1JRP A;  2DYO A;  3AXC A;  4LLG M;  3H7P A;  2KMM A;  2KDM A;  4LDT B;  3GZN I;  4K7U A;  3DVN U;  3WAL A;  1HZ5 A;  1QOF A;  1ZDV A;  2K3U A;  1D4B A;  4KKJ A;  1HEZ E;  4LJP B;  3WAM A;  1S3S G;  1TKG A;  2IPK D;  1NBF C;  1FCL A;  2K8B A;  2KJH B;  4PK1 A;  2BYE A;  2PPH A;  5FR6 A;  5DPR A;  4RF0 A;  3UQA A;  3ZO5 B;  3R66 C;  4OZB A;  1GPX A;  1UWM A;  1J19 A;  1WXS A;  4HDO A;  4X57 B;  2UU7 A;  1GNU A;  4WAF A;  4G50 A;  4AUQ C;  2K8C A;  5AEK B;  5TSS A;  3TIX A;  2QCZ A;  3AE6 B;  2BQQ A;  1V5T A;  1I42 A;  1XLN A;  2KN4 A;  1WXM A;  1WGH A;  3M62 B;  2GI9 A;  4AWJ A;  2WDR B;  1QKZ A;  1P0R A;  1TY0 A;  4PS8 A;  4NAM A;  4W9G A;  1QOA A;  2L0T A;  3DWG C;  3PLV A;  1E0Z A;  1BUI C;  4B95 A;  2AL3 A;  4OHJ A;  1YJJ A;  1KJT A;  1TIF A;  2JYT A;  3LXF A;  4GDL A;  2IBI B;  2L7R A;  3QWZ B;  2Q5W D;  3N1X C;  2KX0 A;  4E71 A;  4ANU A;  3DHH C;  1L0X B;  4URK A;  3N3K B;  2NTS A;  4F7Z A;  2AEH A;  1GB1 A;  5IOI A;  3CMM B;  2VZK B;  3ZJV A;  1E8X A;  3GS2 A;  1RAX A;  5E6P A;  1TGZ B;  2B76 B;  2KQ7 A;  1D6E C;  1NEN B;  3QIJ A;  4YTN B;  1X1M A;  4HDQ A;  3SU8 X;  4BBN C;  2KJ6 A;  1V81 A;  1XEE A;  3PPA A;  5G2N A;  3ZDT A;  1Y56 A;  4CQN A;  4LNO A;  1UF0 A;  4GDL B;  5D3I B;  2WGS A;  3SHQ A;  3WCQ A;  2KAN A;  5DCN A;  1ET9 A;  2PLP A;  1WXA A;  1JRU A;  2KDF B;  4WWP A;  3ZJU A;  4C7Y A;  4GXB A;  3ZDM C;  2QIL A;  4HVB A;  2VZK D;  4EUT A;  2LGI A;  3CWI A;  1ZE3 D;  1E6E B;  3AEA B;  2BGF A;  2YVC A;  3RZW C;  1A70 A;  3AEG B;  2IGH A;  2PE9 A;  3GZN B;  2ACZ B;  2ZNV C;  4LNN A;  2ZVN A;  3I63 C;  3PRE A;  1FPY A;  4OVZ A;  2M8S A;  3ZUN A;  1J7A A;  1P1A A;  1ET6 A;  1LO5 D;  4CYE A;  4YSX B;  3AM9 A;  4LNI A;  3K9O B;  4FHK A;  4I6P A;  3AE9 B;  2ZCB A;  4G3X B;  1R4M B;  3BVZ A;  3ML9 A;  1J8C A;  3UIP B;  2J7Q B;  2B3A A;  4BOZ B;  2KC1 A;  2KVR A;  3KUZ A;  2NPT B;  3MC0 B;  2BWE S;  2OJW A;  3U4E G;  3A4R A;  2AX5 A;  2PE6 B;  4EFO A;  3V6C B;  3WIM A;  1WR6 E;  3Q2A C;  2L05 A;  3W2D A;  3AE4 B;  1I4R A;  2J53 A;  4YSY B;  3AE1 B;  2N7J A;  3M63 B;  4L2Y A;  1KTK A;  2MBQ A;  4CO7 A;  2Z0E B;  1WXQ A;  1SF0 A;  2IY0 B;  3PZD A;  4B0E A;  5DPT A;  3Q3J A;  4JWU C;  2BWF A;  2WDV B;  1QZE A;  1OGW A;  4L23 A;  3SD5 A;  4C00 A;  1DOY A;  2FCS A;  1T0Y A;  3RYT A;  5LXI B;  1E8W A;  4A9A A;  4RGN A;  1E8Y A;  2V3P A;  1TY2 A;  1EWC A;  2K25 A;  1P7F A;  5LXH A;  2VH2 A;  2K6Q A;  1V6E A;  2LJI A;  1N5W A;  1WI0 A;  4US9 A;  3KYC D;  1JWM D;  4EOY A;  4IM2 A;  2KYW A;  4O1N A;  3JSV B;  2HE7 A;  4A55 A;  3Q8F A;  2HD5 B;  1Z5S B;  1VRA B;  1D5M C;  4AJY B;  4NJC A;  1WE6 A;  2J0M A;  3O13 A;  3NVZ A;  1Z2M A;  3LDZ E;  4CHK A;  2K1F A;  3VTU A;  2O6V B;  3IG3 A;  3DWM A;  4GDK A;  4RNA A;  4RGM A;  1EM7 A;  4MM3 B;  2VRR B;  1Y8R C;  1L6V A;  3OAW A;  3UIO B;  5EE1 A;  2BS3 B;  1T6B X;  2WXN A;  1J0G A;  1GG3 A;  1EU4 A;  3MHZ A;  2Z8L A;  3HM3 A;  3H9D A;  1NI2 A;  1TKE A;  2LVQ A;  1N5X A;  2RSU A;  2LFI A;  4ZRI A;  4ICU A;  1XQQ A;  3PHX B;  4PYZ A;  5EE9 A;  4BOS C;  4DQO C;  2MA9 B;  3DBH I;  2CU3 A;  2ZEQ A;  3RFZ B;  2KJR A;  2LEK A;  3RMK C;  2VH1 A;  2DWQ A;  4XDD A;  5C3J B;  2KQ4 X;  4DXA B;  3L16 A;  1Q0W B;  5D3D A;  1SBB B;  1WIA A;  1U4A A;  1VLB A;  1UH6 A;  3U7D A;  2WXG A;  1FFV A;  2KHW B;  2WS3 B;  4K7W A;  2MP2 A;  5IN7 A;  2JZ3 B;  4K3C A;  1DOI A;  2G4D B;  1TZO A;  1R4N B;  1RM6 C;  1ZPS A;  4J6I A;  1V80 A;  4NAW A;  2X8X X;  3RUI B;  3RNC C;  2MEK A;  5C2T B;  2LXA A;  4M8N A;  2LMC A;  2GRI A;  2KAJ A;  4NQL B;  3PSE B;  2CJO A;  1L0V B;  2IO1 B;  1D5Z C;  3TL5 A;  4EEW A;  3TMP B;  1STE A;  4WJN A;  3WAP A;  3JW0 X;  2YEP F;  3DVN V;  1GC6 A;  2D3C A;  2N9X A;  3MJ5 A;  1Q1O A;  1QLB B;  2L00 B;  3BVM A;  3L10 B;  3P4P B;  1FIQ A;  1WWT A;  4W9J A;  5H92 C;  2FCQ A;  2ZPN A;  4WUR A;  1OTR B;  3P63 A;  4MDK E;  2W55 A;  4ARC A;  2SAK A;  4YL8 A;  1OQQ A;  2XK5 B;  4MGZ E;  3HK0 A;  2C60 A;  3ZRF A;  1YOV B;  3DBR I;  2V0G A;  4WIP A;  2DYB A;  4YT0 B;  4M8M A;  1YN5 A;  1YQ3 B;  2PMV A;  3R2I A;  2LAS A;  2FAZ A;  2KMA A;  2V9H A;  2L0F A;  3DBH B;  2N0S B;  4GOC A;  2DNF A;  2N1V A;  3P1M A;  3ZXR A;  1N62 A;  3X0W A;  3WAO A;  3A9J B;  3NOB A;  1ENF A;  3QHT A;  2AQ2 B;  1TBE A;  1EF5 A;  2C5L C;  3OJ4 B;  3LB8 C;  4AS1 A;  2D07 B;  3HVD A;  2M19 A;  4DXG A;  4XZ4 A;  3UQB A;  1NYR A;  4WQM A;  5BMH A;  1K52 A;  4HCN B;  1AYF A;  2KFK B;  4K81 A;  5GMV A;  2K5P A;  3QAR A;  2BW2 A;  3ONS A;  3P4S B;  1FNV A;  3ZXV A;  4HPP A;  1IGC A;  4EZK A;  4H2A A;  5IP4 D;  4BKT A;  2L76 A;  2DZJ A;  3KWL A;  2D11 A;  1M94 A;  2D3G A;  2N9E B;  4GSW A;  2E6X A;  2N9K A;  4ZHO A;  4JQW C;  1MG8 A;  1HXY D;  2KXJ A;  2RDG A;  3BVG A;  2L8J A;  1T0Q C;  2H88 B;  5EE0 A;  1OQR A;  4KDL B;  2JXX A;  3A9K B;  2MSE D;  2C9W B;  2JVC A;  2WWZ A;  4L1B A;  4FJZ A;  2MX2 A;  4NPN A;  2RMM A;  1XLQ A;  2JPH A;  2D3A A;  1TKY A;  2KD0 A;  1I4Q A;  1CK1 A;  3NZS A;  3P2B A;  3SDL C;  3CST A;  3N1Z C;  3L08 A;  1FNU A;  4DDI D;  2FNJ B;  2DZK A;  2HJ1 A;  4MSM B;  2GBN A;  3GE8 C;  2KK8 A;  4MGY E;  1R4M I;  4RFB A;  1TJE A;  4Q2J A;  1YNT E;  2IO2 B;  4J3O D;  3E56 A;  2L3Z A;  3Q8A A;  3ZLZ A;  2NCN A;  3V6E B;  4YSZ B;  3ZNH B;  5E6O A;  1WGD A;  2JU6 X;  3W1S A;  1M4V A;  2QHO A;  1P98 A;  2O2V A;  4W9I A;  5DPS A;  3RCZ A;  1GB4 A;  1ZW7 A;  1T5X D;  4GIV A;  1UBQ A;  4DDG D;  2CKH B;  2EEL A;  1ISN A;  5E6N A;  3R2T A;  5CHV C;  4XGA B;  3W9C B;  1YMH E;  1SGH A;  3MJW A;  4MH8 A;  3AE2 B;  3BIN A;  3HM6 X;  1C4A A;  3EGR A;  1JWS D;  1L4Z B;  2IY1 B;  5LNK 1;  4IWP A;  1QQR A;  3KLS X;  1FRD A;  4YXD B;  3ZNI D;  1YX6 B;  1N60 A;  1HA5 A;  1WFY A;  3VR9 B;  3IXS A;  2JYE A;  3D32 A;  3MP9 A;  3MTN B;  2K9X A;  3APF A;  4F8C B;  2QIE B;  4FAD A;  4LJO B;  3DVG X;  2IYD B;  4JL9 A;  1GAQ B;  1CJE A;  4JE3 B;  2K6D B;  4OVV A;  3RNF C;  3PT2 B;  1QIL A;  3VDZ A;  4YTP B;  2BTE A;  4XWW A;  1WJU A;  1RWS A;  4XWT A;  1IGD A;  4G11 A;  2G3Q B;  2BT6 A;  2JZZ A;  4PS7 A;  1RLF A;  2DZM A;  3TSS A;  3VRA B;  3N32 A;  2WXQ A;  1WRI A;  4LDT D;  1UGM A;  4AQ7 A;  5EE3 A;  4REZ A;  2PW9 A;  2FE8 A;  4TQ0 A;  2CR5 A;  5T8I A;  4KSL C;  1VZ6 A;  4C80 A;  2ZZP B;  3DBS A;  1TYG B;  3KH0 A;  1TTN A;  3HIZ A;  4FJV B;  4ASW C;  3M95 A;  3Q8B A;  5CHW A;  4ZRQ A;  2LRW A;  2R2Q A;  2GBM A;  2EMS A;  2KTF A;  1F2R I;  1XCQ L;  1MJD A;  3DPD A;  4W9L A;  4RGT A;  1DOX A;  1ZXI A;  4E3C A;  1FEH A;  1SEB D;  3L0W B;  5D7G A;  3PZ7 A;  2KN5 A;  1F0Z A;  3W5U B;  3ENE A;  3RZF A;  5BMI A;  4MSQ B;  2LGX A;  4HKQ A;  4A6Q A;  2ZCC A;  4GB9 A;  3PVL A;  2QEJ C;  1WE7 A;  2PVO D;  2M17 A;  2N1W A;  3R7Q A;  3N1Y C;  1ZUD 2;  1V5O A;  3VVW B;  1WZ3 A;  1C79 A;  4IW0 A;  1ESF A;  3SEB A;  2MRP A;  2ONQ A;  1CZP A;  2KTR B;  1V49 A;  4XYC A;  3NS8 A;  4DBG A;  4I6N B;  2H89 B;  2KFK A;  4FN2 A;  3DVG Y;  1PFD A;  3NJT A;  4K1R B;  2MHJ A;  3DCG A;  3WAN A;  2A4Z A;  2CHW A;  3C8Y A;  2R2O A;  1IBX B;  3EUB 2;  1RRB A;  2V3N A;  5JHA A;  2JQR B;  1OEY J;  2AWT A;  1ACC A;  1SXT A;  2NBU A;  2BF8 B;  1WX9 A;  1LFD A;  1R7S A;  2W3S A;  5C1Z A;  3V62 A;  4EKU A;  2GMI C;  1SB3 C;  4OZA A;  3VRB B;  2L83 A;  1YIW A;  1HE8 A;  3RUL A;  2WU5 B;  3VHT C;  2HTH A;  2QJL A;  2IO3 B;  3H7S A;  4GU2 A;  1WJ6 A;  1XXG A;  2ZPY A;  1FNW A;  1FCC C;  1JQ4 A;  2KT7 A;  3FKY A;  2NTT A;  1QF6 A;  3IT4 B;  4AP4 C;  2N7D A;  4M00 A;  1MHH E;  2FCM A;  1PGB A;  4BBN F;  2RD0 A;  4G0N B;  3A9K A;  2LUE A;  2WYQ A;  2JXT A;  2ASQ A;  1NVI D;  2WDT B;  2K39 A;  5J18 A;  1VD2 A;  4ANW A;  1WY8 A;  2REX A;  1LM8 B;  1E9M A;  1N61 A;  2JF5 A;  4BAX A;  1JML A;  1WSP A;  1IUE A;  2PVG C;  2KDI A;  4A3O A; 
#chains in the Genus database with same CATH homology
 1E7U A;  1R4N I;  3R3M A;  4KDI C;  4MGZ E;  4WAA A;  2KX3 A;  3HK0 A;  2C60 A;  3QC8 B;  3ZRF A;  4FHJ A;  4B9K A;  2MBB B;  1Q5W B;  3VXW A;  2O6V A;  3PRZ A;  4TUU A;  3DQV A;  3DBR I;  3S2A A;  2EKE C;  2DYB A;  3PGE A;  3VQI A;  2NR2 A;  3AU5 A;  4M8M A;  5IAA C;  4WWN A;  2AL6 A;  1YD8 U;  2LAS A;  3QCA A;  1WYW B;  4W9E A;  4XC2 A;  1V86 A;  2C7H A;  2FAZ A;  4GN1 A;  2BPS A;  2KMA A;  4ZRJ A;  2L0F A;  2G45 B;  2OOB B;  4GOC A;  1L7Y A;  2N1V A;  2W9N A;  2NS5 A;  1P3Q U;  2FIF A;  4GMV A;  2KWU B;  3X0W A;  1LXD A;  3WAO A;  3NY5 A;  1LQB A;  5TR5 A;  4KV2 A;  3A9J B;  3NOB A;  3QHT A;  3ZVV A;  3QK0 A;  4KZ0 A;  1TBE A;  1EF5 A;  4RM9 A;  2C5L C;  2NBV B;  3OJ4 B;  3TCA A;  1YX5 B;  3PRP B;  2KKC A;  3VH3 B;  3APD A;  4DHZ E;  2D07 B;  1WMH A;  2KWV B;  4NAW B;  4NJ6 A;  2ZNV B;  4XZ4 A;  3UQB A;  2DYO A;  3EC8 A;  3AXC A;  4LCD E;  1AAR A;  5KHO A;  2MBE A;  4HCN B;  5L95 C;  2N7E A;  2C7N B;  2KFK B;  3ZNG C;  5CHF A;  5J17 A;  3LJ3 A;  4BKG A;  2KMC A;  3H7P A;  4K81 A;  3AU4 A;  4RM8 A;  5GMV A;  3BY4 B;  2FUH B;  4LDT B;  4A20 A;  3GZN I;  4K7U A;  3QAR A;  3DVN U;  3VUX A;  2M1M A;  3WAL A;  3ONS A;  2YLM A;  4M0W B;  5KHQ A;  2GBJ A;  3H7P B;  1FXT B;  1WXV A;  3VUW A;  4EZK A;  3APC A;  4FA6 A;  1WF9 A;  4HXD A;  2O6V D;  4LJP B;  2LWP A;  3WAM A;  1S3S G;  2NBW B;  4BKT A;  4W9C A;  2L76 A;  1NBF C;  2DZJ A;  3H1U A;  5L83 A;  2K8B A;  2KJH B;  2PEA A;  2KLG A;  2D11 A;  1M94 A;  2BYE A;  2PPH A;  5FR6 A;  2D3G A;  2N9E B;  5DPR A;  4GSW A;  2LXC A;  3UQA A;  4JQW C;  3ZO5 B;  3R66 C;  1MG8 A;  3DBL I;  2WX1 A;  4K7S A;  4AJW A;  1J19 A;  3A9J A;  2PJH A;  1WXS A;  2KXJ A;  3UIN B;  3KW5 B;  4HDO A;  2L8J A;  4X57 B;  1UD7 A;  2KDB A;  3KUD B;  4KDL B;  4TQ1 A;  1GNU A;  2JXX A;  3A9K B;  2MSE D;  4G50 A;  2C9W B;  2JVC A;  2WWZ A;  2WX0 A;  5HKH A;  4AUQ C;  2K8C A;  3L13 A;  5D6J B;  3TIX A;  4FJZ A;  2NPT A;  5AEK B;  2K8H A;  2MX2 A;  3KVF B;  4HPM B;  4NPN A;  2JPH A;  3EFU A;  1V5T A;  1I42 A;  1GC7 A;  1K8R B;  2KD0 A;  5AZF A;  1WXM A;  2JUO A;  3NZS A;  1WGH A;  3P2B A;  3SDL C;  1S1Q B;  3T8M A;  3CST A;  3M62 B;  3L08 A;  4AWJ A;  3KUC B;  4DDI D;  2FNJ B;  1WGY A;  2DZK A;  2RGF A;  4MSM B;  2GBN A;  1P0R A;  4KIK A;  4PS8 A;  4BVU C;  2KK8 A;  4MGY E;  3QAQ A;  2LVP A;  4W9G A;  1R4M I;  2L0T A;  3TJP A;  3PLV A;  4B95 A;  2AL3 A;  2D2Q A;  1KJT A;  4GDL A;  4OVU A;  2IBI B;  1RFA A;  2IO2 B;  2MQJ A;  1BT0 A;  2L7R A;  1C1Y B;  2L3Z A;  3ZLZ A;  2MP2 B;  2NCN A;  3V6E B;  3QWZ B;  4W9H A;  1E7V A;  2IZV B;  2KX0 A;  3QA8 A;  4E71 A;  4ANU A;  1I35 A;  4AOF A;  4URK A;  3CSF A;  3N3K B;  4F7Z A;  3ZNH B;  5E6O A;  3A1Q B;  2AEH A;  1WGD A;  3W1S A;  3CMM B;  4HPL B;  4W9K A;  2QHO A;  1P98 A;  2KTR A;  2C7M B;  1E8X A;  2O2V A;  1WM2 A;  4W9I A;  4MEM A;  5DPS A;  4FBJ B;  3RCZ A;  1ZW7 A;  1RAX A;  4GIV A;  1UBQ A;  4DDG D;  5E6P A;  1TGZ B;  2CKH B;  4A3P A;  3RD2 A;  2KQ7 A;  1ISN A;  5E6N A;  5CHV C;  3EHV A;  3QIJ A;  4WJQ A;  1WH3 A;  1X1M A;  4HDQ A;  3SU8 X;  3ALB A;  5J2R A;  1SGH A;  4BBN C;  3RT3 B;  4KSK C;  2DX5 B;  2KJ6 A;  1SE9 A;  2LRU A;  2FCN A;  2EMT A;  1V81 A;  3MJW A;  3V61 A;  1GUA B;  3PPA A;  4WJP A;  3BIN A;  3HM6 X;  5G2N A;  2LJ5 A;  3ZDT A;  1UBI A;  4MM3 A;  2KLC A;  2OJR A;  4GDL B;  2IY1 B;  1EO6 A;  2XEW A;  4IWP A;  2KAN A;  5DCN A;  3SHQ A;  3ZNI D;  1WXA A;  3DOW A;  3NHE B;  4ICV A;  4HLE A;  1JRU A;  1YX6 B;  2KDF B;  3IVF A;  4WWP A;  1GJZ A;  5CX3 A;  4WJO A;  4GXB A;  3ZDM C;  1WFY A;  4P7I A;  5D2M B;  3K9P B;  3ZRC A;  4HVB A;  3D32 A;  3MTN B;  4EUT A;  3OJ3 A;  2Y5B B;  5IA7 A;  4WQO B;  3APF A;  4F8C B;  3U30 A;  4KZC A;  2GBK A;  1WRD B;  4JLC A;  4FAD A;  2N9P C;  2RPQ A;  2J0J A;  2BGF A;  2YVC A;  4LJO B;  2MWS B;  3DVG X;  3RZW C;  2IYD B;  3QJZ A;  3B08 A;  3VTW A;  4JL9 A;  4MJS B;  2K6D B;  2FID A;  4OVV A;  2PE9 A;  4IG7 B;  3UF8 A;  2ZNV C;  2ZVN A;  2ZJD A;  3PRE A;  3VH4 B;  3JYU A;  3NZU A;  3PT2 B;  3VAW A;  2M8S A;  4F1S A;  3ZUN A;  1TZ1 A;  3VDZ A;  3N30 A;  1P1A A;  4CYE A;  3QQ8 B;  4MEL A;  3W1Y A;  2DEN B;  3ZTD A;  4KIK B;  1WM3 A;  1YQB A;  3K9O B;  1WJU A;  4FHK A;  2KOX A;  4I6P A;  2AYO B;  2ZCB A;  4G3X B;  1L2N A;  4G11 A;  2DHZ A;  3ML9 A;  3UGB B;  2G3Q B;  2JZZ A;  1J8C A;  1WZ0 A;  1RLF A;  2DZM A;  4PS7 A;  4TKN A;  3UIP B;  1WGG A;  2J7Q B;  1UEL A;  3N32 A;  2B3A A;  3B0A A;  1E5W A;  3O65 B;  3A33 B;  4BOZ B;  5AZG A;  4B6W A;  4LDT D;  2KC1 A;  4BKS D;  4IUM B;  2KVR A;  3KUZ A;  2BKF A;  2NPT B;  1UGM A;  3X23 A;  4DHJ D;  3L54 A;  5AZH A;  2GBR A;  2KO3 A;  2BWE S;  3W1S C;  2XBB C;  4TQ0 A;  1WMH B;  3A4R A;  2PE6 B;  4EFO A;  1V9J A;  2CR5 A;  4IWQ A;  3H6N A;  4KSL C;  1WJN A;  4W9F A;  4DWF A;  3V6C B;  5LLI A;  1WR6 E;  4PYU A;  3WIM A;  2ZZP B;  2L05 A;  3DBS A;  3M3J A;  1EF1 A;  3KH0 A;  1TTN A;  2DZI A;  3CF6 E;  3IHP C;  3M63 B;  3HIZ A;  1D3Z A;  4FJV B;  1V2Y A;  4ASW C;  2MBQ A;  4CO7 A;  5JHB A;  4MJS A;  1WGR A;  2Z0E B;  3M95 A;  1CMX B;  4WWO A;  2IY0 B;  5CHW A;  3R7R A;  3ZNZ B;  2LRW A;  3PZD A;  2KQS A;  5C23 A;  4GDK B;  3QX1 A;  2R2Q A;  2GBM A;  3Q3J A;  5DPT A;  1IYF A;  1H4R A;  2BWF A;  2BYF A;  2Z59 B;  3AI5 A;  2EMS A;  2DAJ A;  2JY6 A;  3VFK A;  1UZX B;  2KTF A;  1KLV A;  1QZE A;  1OGW A;  1VCB A;  3SD5 A;  3HHM A;  1OQY A;  2DAF A;  2KZR A;  3DPD A;  2FCS A;  1T0Y A;  4W9L A;  3RYT A;  1E8W A;  5LXI B;  2JRH A;  1E8Y A;  2MLB A;  4E3C A;  5D7G A;  2JT4 B;  3L0W B;  2M4N A;  1KM7 A;  2UYZ B;  3DDC B;  3PS6 A;  3I3T B;  2K25 A;  1SIF A;  2KN5 A;  3JSV A;  4IM3 A;  5LXH A;  2I1J A;  2K6Q A;  2Z0D B;  1V6E A;  3ENE A;  2JRI B;  3RZF A;  1IP9 A;  1ZKH A;  1WI0 A;  4MSQ B;  2LGX A;  5JZE B;  2KC2 A;  2M0X A;  3ZTC A;  2CS4 A;  3KYC D;  4EOY A;  4IM2 A;  2N4F A;  2RR9 A;  3JSV B;  2HE7 A;  1P9D U;  4HWI B;  3WA0 A;  1E90 A;  2ZCC A;  3Q3F A;  4GB9 A;  3JVZ X;  3PVL A;  1WE7 A;  2CU1 A;  2HD5 B;  4GGQ A;  2M17 A;  1Z5S B;  2HJ8 A;  2N1W A;  3R7Q A;  2V4L A;  2A5U A;  2MCN B;  3C0R B;  2IO0 B;  3ZW3 A;  1V5O A;  3VVW B;  4AJY B;  2I1K A;  4BKS A;  1WE6 A;  1WZ3 A;  3ML8 A;  2J0M A;  4II2 B;  4MH0 E;  3PHW B;  1Z2M A;  2NVU I;  4IW0 A;  4DHZ B;  1PQS A;  3LDZ E;  4CHK A;  2K1F A;  2MRP A;  4JGH B;  4PS3 A;  2O6V B;  3VTU A;  3ZKJ C;  1C3T A;  2CHX A;  3IFW B;  4NQK E;  1ZGU B;  2KTR B;  1V49 A;  4FUL A;  2MBO A;  3NS8 A;  3IG3 A;  2UWQ A;  4GDK A;  2D10 A;  2XK5 A;  1XD3 B;  4DBG A;  3T9L A;  2LVO A;  2VRR B;  1A5R A;  1Y8R C;  4I6N B;  3OAW A;  3UIO B;  1WX7 A;  2V1Y A;  4FLH A;  4ZRK A;  2KFK A;  4FN2 A;  1IPG A;  3DVG Y;  1J0G A;  2LZ6 A;  2LGY A;  1GG3 A;  4I6L B;  2J0K A;  4E74 A;  1XT9 B;  3HM3 A;  4ZYN A;  1NI2 A;  2KWC A;  2LVQ A;  3H9D A;  4K1R B;  2RSU A;  4ZRI A;  2KNB A;  3DCG A;  4ICU A;  1XQQ A;  3WAN A;  2A4Z A;  1YJ1 A;  2CHW A;  3PHX B;  4PYZ A;  4KVG B;  2R2O A;  4BOS C;  2MA9 B;  1RRB A;  2ZEQ A;  3DBH I;  4DHJ B;  3EEC A;  5JHA A;  5D94 A;  4IWO A;  3A4S C;  3U8Z A;  4HJK A;  1OEY J;  2KJR A;  2KFJ A;  3PLU A;  2AWT A;  1WX8 A;  3OLM D;  2NBU A;  3ZIM A;  1E8Z A;  2BF8 B;  4W9D A;  2LGD A;  1WX9 A;  3ECI A;  1LFD A;  2O2V B;  1F9J A;  3KYD D;  4DXA B;  3L16 A;  1Q0W B;  1NDD A;  5C1Z A;  3V62 A;  1OEY A;  1WIA A;  4HCP B;  4EKU A;  2KDE B;  1EUV B;  1U4A A;  2MBH A;  3PRM B;  1KOT A;  1UH6 A;  3U7D A;  2GMI C;  2KHW B;  2V3S A;  4K7W A;  2MP2 A;  1YIW A;  1HE8 A;  2JZ3 B;  3RUL A;  2G4D B;  3VHT C;  2HTH A;  2IO3 B;  3A1Q A;  3H7S A;  4J6I A;  1V80 A;  2ZVO A;  4GU2 A;  4IM0 A;  1WJ6 A;  4NAW A;  2ZPY A;  4HK2 A;  3RUI B;  4N9F 4;  1H8C A;  3GOE A;  2LXA A;  4M8N A;  3PV1 A;  3VUY A;  3PTF C;  4IC7 B;  4AP4 C;  4NQL B;  3PSE B;  3VTV A;  4NNJ B;  2N7D A;  4EZJ A;  4MGK E;  3AUL A;  2IO1 B;  2FCM A;  3TL5 A;  5CTR C;  4RMA A;  4BBN F;  3TMP B;  4EEW A;  3V60 A;  1G6J A;  2BKR B;  2RD0 A;  4DK5 A;  4BFR A;  2BYV E;  4WJN A;  4G0N B;  3WAP A;  2CHZ A;  3JW0 X;  3L17 A;  2LI5 A;  3DVN V;  2G4S A;  3A9K A;  1GC6 A;  4ANV A;  5DPW A;  2LUE A;  5G55 A;  2WYQ A;  5BO4 B;  2MW5 A;  2GOW A;  2ASQ A;  3IBE A;  2N9X A;  4EZL A;  2LD9 A;  1Q1O A;  2L00 B;  2K39 A;  2WDT B;  4XX5 A;  5J18 A;  3L10 B;  5JH5 C;  1WR1 A;  1VD2 A;  4ANW A;  1WY8 A;  2JWZ A;  2REX A;  4NJ7 A;  1LM8 B;  2DYM A;  4MGI E;  4W9J A;  2JF5 A;  2FCQ A;  3TBL D;  2ZPN A;  3MHS D;  1OTR B;  1WJ4 A;  4ANX A;  4ZDV A;  4NY0 A;  4MDK E;  4FJY A;  5EDS A;  4II3 B;  4JIO U;  2KDI A;  4TV3 A;  4YL8 A;  4A3O A;  3B1L X;  2XK5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...