3U3JA

Crystal structure of hsult1a1 bound to pap
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
287
structure length
287
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 95
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3jA00
2FGJA 1G3IA 3BBPA 4MYCA 3LBIA 4PPFA 2AKYA 2YVUA 2AXNA 4DT1B 4O2RA 5BW8A 2PJRA 1T0JB 1EFTA 4LHXA 4EIWA 2FSFA 1JB1A 2C78A 2XB4A 3LXRA 3V4FA 2YNMA 3CO5A 2VSOA 1W5TA 2B21A 2JDIA 4HAYA 2KE5A 4O0MA 1J2JA 1ESMA 2V55B 4KFRA 1TX4B 5E4FA 5FPYA 4BQSA 1ZCBA 2XSZA 1QHXA 3PENA 1N5KA 3TMKA 2VH5R 4NBSA 4MQBA 2GAAA 1GSIA 2IYVA 1XX6A 4LYHA 4GMXA 1Z29A 2VP0A 1R5OA 3LQQA 4RFVA 4C4PA 4BFWA 3OESA 5C46F 5C1BA 3EPKA 4C0QC 3THWA 3PJRA 3R9XA 3KB2A 2BKEA 2IS6A 4TQAA 5DYIA 2XXAB 3W9YA 1F3OA 2QM7A 2EFEB 1ZMXA 2F55A 1F2UB 1W4CA 2BC9A 4G0NA 4EKDA 3GLHA 3DO6A 1NIPA 2QMOA 2OE2A 3GJ4A 3TW8B 2ZIAA 2QAGC 3I5XA 4OI2A 4PX9A 3IIMA 5A5GA 2QQ0A 3GLIE 4JVLA 3ZDQA 4UJ3A 1IXRC 3AH8A 3SOPA 4FMCB 1T3LA 2D7DA 3VU9B 5TB5A 2A9KA 2YYZA 4XSGA 2ZUDA 3KQLA 1F6BA 5FR2A 1E2QA 1E0JA 3QOFA 2YOHA 1OYYA 4DSUA 3TGPA 1N5JA 1DO2A 1HE8B 2ONKA 4CDGA 1RIFA 4DCSA 4OQXA 2XB2A 4IOJA 5DI3B 3THYB 2ZS8A 4XWOA 2GHIA 1YVDA 3SQWA 2ZVQX 3LBNA 2BIFA 1GDDA 2CLCX 2QL6A 3RWOA 2OG2A 1TEXA 1NJFA 3EAQA 4GSYA 2HDNB 4Q1FA 5JCPA 2XGJA 2P2LA 3AVWA 4XIGS 1Z08A 2JLVA 1Z0KA 2N42A 2REOA 3C7KA 1KO5A 4OBEA 4C2TA 1IBRA 3ZVLA 3IPXA 1WBBA 2BWJA 1OPXA 1MO6A 3K8YA 4GNKA 1P60A 5C18A 3Q5EA 4HB0A 3LLMA 2XSZD 5H1YA 5K8TA 3CWZA 4PSKA 1Q1QA 4NU0A 1DVRA 2AD5A 4WIAA 1MKYA 2QSYA 2ZSDA 3ZYCA 3A58B 2IF2A 1EFCA 2GKSA 4D80A 4IVRA 4EPXA 3I1FA 1KKMA 2ZR7A 1O3YA 2MSCB 4NCKA 1AK2A 4Q19A 2ZR9A 1MT0A 3H86A 4P33A 2D2FA 4AIIA 4K46A 4QGGA 5JSZB 2ZSFA 4NP6A 3OE7D 1Q0UA 1UDXA 1A4RA 4D2IA 1N3BA 3AKCA 2W6ID 3T1QA 2BV3A 1G7CA 4JLNA 2Z0MA 2QNRA 4PHGA 4NYMR 3L82B 3LX8A 4TT3A 1M7BA 1VYVA 1G18A 2F7SA 4Q03A 4QG7A 1EWQA 2RGDA 1KIMA 1MABA 1FTSA 2XJ4A 3N2EA 4I1OA 3AGPA 3CX6A 1XPUA 5KNBA 3UKDA 3RABA 5J4HA 1E2HA 1OLOA 1W44A 2MMCA 4TSFD 4TYYA 2V1XA 3O8RA 1W48A 2CEAA 5KPJA 2GF9A 2W0MA 2O8EB 4L8GA 1I4DD 2JATA 3HR7A 421PA 4E5UA 1GAJA 4TLEA 3A6PC 4PZZA 1YR6A 1ZNWA 3B2EA 4ZDKA 1GNPA 2QT1A 1Q22A 2FSIA 2O8CA 1XPRA 1ETUA 3MWKA 5J4YA 5LB2A 2OAQ1 1U98A 4NKRA 1GWNA 1TUIA 1DAHA 4HLCA 2VHCA 1KSFX 1C1YA 2IC5A 1NMZA 3CRVA 4OHXA 1LY1A 2D62A 1KSGA 3RS5A 3ZVNA 1GILA 2CBZA 4E03A 2QQEA 1P9NA 2F9LA 4ZCLA 1E9RA 4YLGA 3ADCA 4LJYA 3MJHA 4XH9B 3OEEA 3T35A 3G5UA 2AWOA 1IJEA 5HCNA 4V0KA 1ZD9A 3VX4A 3U60B 1T9HA 1XXHB 1VCOA 2P6UA 4DLTA 1IM2A 1KI8A 3IEVA 3EA0A 5L3VA 1QBKC 2X1VA 3U44A 3B9QA 3MJRA 3BORA 4HB4A 2OILA 2A5JA 3AF0A 5F3WB 2GJ8A 1F2UA 2QTVB 4KBGA 1W47A 3PXGA 1AGRA 4Q66C 4YMVA 3H84A 1VMAA 3C41J 2DWOA 3Q8XB 4DCUA 4KFTA 2PLFA 1N6RA 2DFNA 2QT0A 2GETA 3W3ZB 1NN1A 1ELOA 4BRWA 3R9WA 1BO6A 1DBSA 5BQ5A 1WMSA 2REBA 3PEVA 2IA5A 2XX3A 4Q1EA 4Q9LA 2YKGA 1VCNA 2F1IA 2PMDA 2JASA 5FUVA 1HV8A 4DLVA 2IYRA 1ZAKA 1Q57A 1AN0A 1AS0A 2OEPA 2OHFA 2WMNB 5L3SB 3D7MA 1HT2E 3ZIAD 3S1AA 1RE0A 3WRYC 1Q20A 4FWTA 2PH1A 2HLDD 3D31A 3PUVA 3PR1A 2QG6A 2FSHA 3U7EB 1XJCA 2RGNC 3VX3A 4I1VA 3KUDA 3TK1A 1EFRD 3DZDA 1RC8A 1LB1B 1UBGA 1NIJA 1S2MA 1Q44A 4B2IA 3Q85A 4LJ6A 1QHNA 3B60A 4ZDJA 5KNDA 4TMTA 3QF7A 4HLUA 3B78A 2QE7D 1TU3A 2ZQ5A 1GNRA 3HR8A 2OAP1 4V0MA 3T15A 2YWGA 1Z47A 2GTPA 2WWGA 4CT5A 4A4DA 5L3QB 3BB1A 1GTVA 1A5TA 2PMKA 2C5LA 1WRBA 3FKSD 4NHOA 4CVNA 4L9WA 4D25A 3RANA 4JLDA 4Q7MB 2Q21A 4BRUA 4QRHA 1DOAA 2BBTA 3ZZTA 2FA9A 2WJGA 2VRWA 1XCMA 3IILA 2EYUA 4Q02A 5F2EA 3I73A 2PT5A 4CRWB 4ACAA 5KNCA 1VECA 2OLKA 3WP0A 1AQYA 3SJAA 4BZPA 4U7DA 2XITA 1I2MA 3O8DA 1NG9A 2P67A 3IQWA 4N3NA 3CBQA 2R6AA 4AG6A 5FTJA 1Z28A 1FMLA 1W2HA 4B3BA 1ZBDA 1EFRA 1CULC 2W83A 4JKIA 3TR0A 5H68A 3LO5A 2ODNA 2QBYA 3RC3A 1KI6B 4WXRA 2NPFA 4PAMA 4AKIA 2P5SA 2OESA 4DUGA 1W36C 4V03A 4DVGA 1JECA 2J5XA 2VTKA 2CLDX 3KQNA 1U99A 1COWA 3MRSA 3WP1B 1ODFA 2PX0A 4X8HA 1A1VA 2AWNA 4LHWA 4LRWA 1CTQA 2FF7A 3L43A 1N6NA 1KNQA 1LVGA 1T8TA 1E2DA 2QTFA 4HB2A 1UADA 3QNUA 4O25A 3CRMA 2ANBA 2ZRPA 4HEJA 2RH5A 2XTNA 1R7RA 4ON9A 4Q00A 3TH5A 1OJLA 5CJ2A 4DJTA 1E0SA 3GLGB 1CJMA 3OIWA 1M7GA 4OI1A 1CLUA 4LI0A 5UKDA 3ZGXA 4D6PA 2ZUBA 1KOFA 2QM8A 4URWR 3AF4A 4P4TA 1HH4A 1RYFA 4Q4JB 2ZRAA 2C95A 3AF2A 3P27A 5BN3A 3BH7A 4GZLA 3T5GA 4NPHA 3BB4A 4PQRA 1X6VA 5HKKD 2NMVA 4QXAA 3KL4A 5FOUA 1M2OB 2ZJ8A 5AUNB 3ZQ6A 1NBMA 1E2JA 2YOGA 3T34A 1ZM9A 3WNBA 3ASYA 2ZXUA 1VHTA 2QPAA 1OXTA 3E1SA 4MRNA 4XWAA 3LA6A 1OW3B 1RRFA 4KYUA 1DAFA 1KJZA 1U94A 5DO9A 2G0TA 2BMEA 3AF1A 3CNLA 3EG5A 4JL8A 5FBVB 4URUR 1UAAA 1N6KA 1QHYA 3AUXA 1PV4A 1Z6YA 4NDZA 1E1RA 1VG8A 1XTSA 2FDCA 1GKUB 4YMWA 1TQ6A 5DGXA 4DWJA 4RZXA 3GFPA 4FD2A 1ZC3A 4KI0A 2FFQA 4LJ4A 3R7WA 2QZ4A 2RGAA 5DE3A 3K1JA 2WWIA 2HF9A 3EIHA 5FPHA 4X8LA 3W6NA 2OFXA 1P4SA 3B7GA 4W9MC 2ZI5A 4QBFA 2HYIC 1A2KC 1E79A 3TJZA 3CNOA 3A1VA 5BWMA 2ZRIA 3QIAA 3TUJC 1E2MA 1KI3A 2FFHA 3Q7QA 5D3MB 1ZU5A 3QPUA 5FI1B 2A5GA 1DAEA 4PPQA 4DKXA 3LVRE 2VIIA 3W34A 4YC7A 4ZPXA 3H1TA 1X8LA 4LHYA 3VR6A 4DZZA 1GM5A 3KJEA 2QBYB 1X86B 4BLTA 1Y3AA 4MGYR 1QF9A 4MDFA 3THXB 5JCZA 4HUQA 3VQTA 3K9NA 1E3MA 5F98A 2A5YB 2FSGA 1Z2CA 4BASA 1CKEA 2IF0A 2JGNA 4UJ5A 1KMHB 2Q9CA 1NY5A 5E95A 3TIFA 4A6PA 5JFGA 1XZPA 2CVHA 1GKYA 3QE0A 2RKOA 1IY2A 4LK2A 4W7SA 5IK2A 2FMXA 5JS8A 1E2LA 4EQ6A 3R9IA 2DBYA 1G5PA 4LYJA 2HCBA 2YWHA 4KFSA 5HKKA 5FR1A 4Q4JA 5FL3A 1BOFA 1UKEA 4HAWA 1EGAA 4Y0AA 3GEIA 1NI3A 2FPLA 4MDEA 2BOVA 1FQKA 3CRW1 1U0LA 3RS7A 2IHYA 1Q1BA 4CEJB 4YONB 1YRAA 2UZIR 3IEUA 2JJ1D 5KHOC 4Q21A 1M6NA 3SEAA 1US8B 3EX7C 1XB2A 3O8CA 4RKEA 1J7KA 2NO1A 4QL3A 3SN6A 4ASUA 3HPRA 3U4QA 1LV7A 3KKQA 5FOSA 4H9GA 2BKUA 3H4MA 1NN5A 1YR9A 3NWJA 1VCMA 3N70A 5J4KA 3PITA 2V54A 4KITB 1P7CA 2MSEB 1TPZA 4L4UA 3L8YA 2ZYUX 3AVTA 3PEWA 4MRPA 5EXPA 1NMYA 2CJWA 4ZDIA 4H1VA 3CRRA 4F38A 3W5IA 4JBWA 4PHFA 2OBLA 3OF5A 4R2IA 1E9CA 4YMSA 1P2UA 2AL7A 1JQJC 2F43A 2WWWA 3QKSA 3M6AA 5EXSA 4EPVA 2DFTA 2ZS7A 5FUWA 2P0EA 2WJJA 3K0CC 4NCNA 2J87A 5JZVA 4HAVA 2R9VA 5FL7D 2O5VA 2QE7A 2KI5A 2WM9B 3B82A 4W5HA 3V00A 3QG5A 4OL0A 5CB6A 2WOJA 1WBDA 2WPDA 4IDQA 3FPAA 3MG9A 1EFHA 1T3SA 2FH5B 2GBLA 3TUZC 3BFVA 2Q3HA 4WZAE 1FUKA 4Q1CA 5BYJA 4LGMA 4TN1A 3KZ1E 2L0XA 2JJ8A 4QBHA 4BLSA 1RRPA 1G8PA 1KJYA 1YQTA 2G0NA 2VA8A 2Z6VA 3QXCA 3K70D 2OO7A 1W4AA 5FBLB 4GPTA 5ANRB 1Z06A 1JR6A 4PHHA 1TADA 5FOVA 2ZUCA 3U7GA 2D7CA 4IEIA 2QAGA 3K70B 1R8QA 3VKWA 1R5BA 2X2EA 1UDWA 1U0JA 4RFSB 1YE8A 4UNSA 1JALA 4ASUD 5AUOB 1QHIA 4Q4HB 4WW0A 4ERNA 1W2GA 3W6PA 3SDZA 1XEFA 4LJ8A 4PTLA 2G1KA 4CYMA 4JVNA 4M9XA 5SZIA 2GDJA 3KJGA 4F92B 2NO6A 5B2ZA 3BJIC 4XJXA 2ZRJA 2ZI9A 2ZTSA 3QBVA 1L4YA 2QEQA 2ZVPX 1YZLA 4QM6A 1R0YA 4ACBA 4DCVA 2ZM5A 3NTUA 3CIOA 4LCBA 4BZXA 2RGBA 4TQUS 3KQKA 1P2SA 4PC7A 4HZIA 2HYDA 3AP3A 3CPJB 4HDCA 4RZUA 4ZIRB 1E2FA 2OFWA 3NDBB 3BIFA 1OH7A 1DADA 1G8GA 3UXMA 3KTAB 4TMWA 2FG5A 3BE4A 1JAIA 3RS4A 5P21A 5JECA 3K0FB 1ESNA 1OF1A 1YZUA 3I62A 3B13B 3NDPA 3FYHA 4LBYA 4O3MA 4NL4H 1UEJA 5DH9A 3U3MA 3UMFA 4MKIA 5G41A 2IWRA 2I4IA 4MUBA 1FQJA 2IT1A 4UNQA 5SZHB 1LFDB 4MKFA 2BBSA 4FWIB 3PQCA 3SHWA 2CJWB 4FCVA 3HYRA 3C16C 3BRWD 2GNOA 4RD3A 5HCIA 1ZRHA 4F7WA 5CIQA 1KAOA 2RB4A 2V6JA 4CEIA 1PVOA 4TTPA 1W36D 4HYYA 1D9XA 4KSBA 2OT3B 2AFIE 4ZI3A 2BMFA 4YDHB 2A2ZA 5CDFA 3TW4A 1FMJA 3A36A 4XD7D 1VYUA 1NVXQ 2C9CA 2QSZA 4PFSA 4K8OA 4C3ZA 2B8TA 2ATVA 4A0GA 5HZKA 1W5SA 3GJ6A 4MYUA 4JLJA 3EZ9A 4TMVA 3GJXC 1OFTA 1DAKA 4URZR 4WVFA 4A92A 4JJKA 1E32A 1KI1A 1UBFA 3GLIA 3KQUA 4TL8A 1U2RA 2GVDC 1JXMA 4PSVA 3SYLA 1KY3A 3VFDA 3ICEA 1KMQA 1L2TA 1G3UA 5KUTA 2AKAB 3QBTA 3A1UA 2QUZA 3RSOA 4C0KA 1OE0A 3T1TA 2CL0X 3MUFA 2J0QA 1W4RA 3ZVMA 1H8HD 2GCNA 4XSHA 4QC2A 5SZKB 2ZJ5A 3SHFA 5E7MA 5A4JA 2YWEA 2AXPA 2F43B 3QKSB 3V4RA 1LF0A 4IFEA 5EXTA 4JIMA 2ORWA 3NH6A 5C4GB 1N6OA 1AKYA 1DS6A 1DELA 2PJZA 3LLUA 1W0KD 3CPHA 4C0AC 4KO8A 4KODA 1M1YE 2C2HA 2FZ4A 1MO4A 1TF2A 2HT6A 1NLZA 5J4VA 1WDTA 1CF4A 2RGEA 2JIZA 4NYIQ 1Z6XA 1LS6A 4RD6A 5E7JA 2WSSD 2NPIA 1WB9A 3FMPB 3W8NA 1SXJB 2VP4A 2B8WA 3EZ2A 3MMPA 2GEVA 2ZE5A 4UXIA 1OSNA 2VL7A 2ZSAA 4YXWD 4IJMA 2VQSA 2XZPA 1W7AA 1UKZA 1WQ1R 4DHEA 8OHMA 2IYUA 1TL7C 3CONA 4MYTA 3WNCA 1GVNB 3BXZA 1CRQA 3LWNA 5J40A 4DXAA 3DPUA 2W2TA 3J81k 1ZU4A 1P9RA 4LSGA 1IN7A 1ZCAA 4BFVA 4Z1MD 2R6GA 1DO0A 1GUAA 1LW7A 1R2QA 2PZGA 1XMSA 2X8AA 4AURA 1AGPA 3P4XA 4PPGA 1HY3A 2VF8A 1A82A 2BCJQ 2JIZD 1OH6A 1JEEA 4BFZA 2IYZA 3EZ6A 4Q48A 3VR4A 2Q9AA 2QU8A 1BIFA 2V4ZA 4G5SA 3NC1C 5CM8B 4OI0A 2FE4A 4G5OA 4Q9KA 2J0VA 2ZETA 521PA 3S1AB 1XD8A 1E9BA 3QUSA 4MITA 5CIWA 5BN5A 2C8VA 5JHGB 1S3GA 5AJYA 4PZYA 3U6BA 4IDNA 221PA 4A1FA 3HDTA 2IYTA 3FFAA 3GFOA 5BN4A 5K8UA 3QSYA 2VF7A 3NVAA 1SGWA 1S0UA 3JVUA 2EYQA 2WJHA 3RRMA 4I1UA 3U3JA 1JR3E 1RJ9A 2IUSA 2Z4RA 1E1QA 1OFIA 2Z43A 4ZI2A 3SFZA 3B1ZA 1U90A 3HU1A 1Q1ZA 5L3RA 1OFUX 1XMVA 3LV8A 1ZM7A 3FHCB 1JR3D 2ATXA 3A8TA 2ZRGA 4TMXA 5HR5A 2UZ3A 5DHAA 5JLJA 3KFVA 3AVQA 1K5DA 2CCJA 2V9PA 2UKDA 4Q1BA 1TF7A 3DVLA 3GLGA 3WYGA 4AY2A 3SZRA 1QHHA 2XOKA 2HXSA 4NYJQ 3W8RA 4PHTA 4R9UC 3W5JA 2O0HA 1W0JD 3GQBA 4OQFA 3TSWA 2V3CC 2O8DB 1EX6A 2ZR0A 1A7JA 1YZTA 1IQPA 4A2WA 1OIWA 1FFHA 1XF9A 4FMCF 2WTUA 4DSOA 3MLEA 3L0SA 1CIPA 2ZI7A 3D8BA 4G5GA 4KJZA 4KLNA 4OYHA 2EFHB 1IOZA 1KK2A 2JLXA 5JRJA 3AVPA 1DE0A 4LC1A 1N25A 2VHTA 2E1RA 3QXXA 2H57A 1S9HA 1GNQA 4LJAA 3HU2A 3F0TA 1IXZA 3F5FA 1FP6A 1G9XA 5EE3A 2OM2A 4HAXA 5JEEA 3UWKA 2FGKA 3ZIAA 1OKKD 2VP6A 1C9KA 3SR0A 2CCGA 2ODEA 4A82A 1TQ4A 4P4SA 2RAPA 1NSTA 2GCOB 1LS1A 4A2PA 1ANKA 1DG1G 1KDTA 1YZNA 2WBLC 3EZ7A 3U6KA 4NCJA 4M0LA 3HWSA 1U9IC 2GRJA 1T0HB 3VNVA 1S1MA 2NO9A 3NIBA 4ARZA 5EJEA 2REXB 3W6OA 2W6JA 3ZD6A 3NBYC 2ZSEA 2XNSA 3K09A 2GXSA 3FMFA 1E9AA 3B1WA 4WOPA 3MCAA 4PZLA 4M1OA 4RCYA 5JRZA 3OE7A 3K0AB 3HJNA 1ZIOA 4B3XA 1F60A 1ZYUA 5B64A 4G01B 3KXKA 4Q7JB 1E2NA 3K09C 1W49A 1CU1A 2I1QA 1WCV1 5HPYB 4S2EA 4S35A 1IN8A 5JHHB 4GL2A 2JLUA 1OKKA 3QKUA 4TTQA 4QHTA 1NP6A 1BH2A 1H8ED 3VAAA 1EK0A 5E3HA 4NH0A 3KKOA 4POAA 2ONJA 3LY5A 2RGXA 1R4AA 2OV2A 2YZ2A 4P4UA 3K0SA 5CLQA 2JLWA 4XD7A 1Z6TA 2WHXA 2E9SA 4PO8A 1NN3A 1E94E 2CNWD 3NC0C 1GIAA 3G0HA 1KK0A 5DHFA 4GP6A 1OXVA 2R62A 2GVZC 1IN6A 4M1TA 1KI2A 1CJTC 3BFKA 2IX3A 1OFHA 2EFGA 3A4LA 1B23P 1VIYA 5K8LA 3QG1A 2IYSA 2UVQA 1W0JA 5GJWC 3UATA 4OK6A 5FPSA 2ORIA 4TWZA 3GFTA 3U7FB 1TF5A 2NOAA 1GP2A 4LBVA 3RLFA 2RHMA 2CL7X 2AX4A 1G3RA 2EWVA 2J45A 5EP4A 2J7PD 2VSXA 3F8TA 4LOAA 4CW7A 2ZRMA 3LX5A 4WBSA 3AV0B 2FU5C 4EJSA 1H8HA 3I32A 3CB4A 3LW8A 3VMFA 2O52A 1NNEA 2AD1A 1U8ZA 5FBRB 5EP3A 4HI0E 2C77A 2FOLA 3VNUA 4TLBA 2CL6X 1E99A 2NZ8A 2PEZA 4EJSC 3GLIB 2PZEA 2GJSA 2GZHA 3JVVA 4M53A 3ZS9A 3ONWA 4PC2A 1Q3TA 2J0UA 1KJWA 2BJWA 3GJ3A 2ZU0C 3PFIA 4HDQB 2GZDA 4BLRA 4RZ3A 4C2UA 3EWAA 3QPVA 2PCLA 4RKFA 3TUIC 3QY0A 2FPKA 3K70C 3ICQB 2OLJA 4IEEA 4OK3A 1W46A 4TLAA 1AZSC 2ZU6A 4XTRA 3TAHA 1Z83A 2W2VA 1SKQA 1SXJC 1TQ2A 1K5GA 3ZH9B 2ZRFA 1EESA 2JA1A 1SVSA 4G5QA 3IQXA 1QG2A 2FN4A 3R8FA 2ZYVX 2ODWA 2F3RA 2IUUA 3PCRB 3ZJYA 2GZAA 3ZZ0A 1VTKA 3FTQA 3ADKA 2DR3A 4O2LA 4MGKR 4US1R 2FV8A 3CH5A 3H0KA 5TDHA 1FPMA 4KU4A 1ZM4A 1JPNA 3CKLA 3GEHA 2C99A 2D2EA 1S96A 2A7QA 3H2YA 3OIYA 3OAAD 4Q9JA 3NH9A 5DSZA 4B6EA 3TBKA 3GLFA 1N2CE 2YHSA 4GZMA 4B3CA 3CLVA 2BCGY 4IKEA 1G64A 1NLFA 4E09A 1HEIA 1MO3A 2W2XA 1KI6A 1CBUA 2FFAA 2ZJAA 4XVUA 3OHMA 1S9DA 5EE9A 5G53C 2QPTA 2R6DA 4M1SA 1OB5A 1DAIA 1ZUHA 3KTAA 4DCNA 3FGNA 2CLSA 3B6EA 2C03A 4C7OB 3R8CA 3EZFA 2WWFA 4QBGB 4YQFA 3GJ7A 1ZNZA 1YZQA 3IO3A 3T1OA 4AC9A 1UKVY 4UNPA 4M8NE 2QORA 3L0OA 4OHWA 5TARA 2CDNA 3TVDA 4MGZR 3DL0A 2OXRA 1UM8A 2TMKA 4B6FA 1JEDA 3P20A 3MWLA 1P6XA 3RWMB 1AZTA 3NBXX 4UNRA 1G6OA 1XCPA 4LHVA 2B7CA 1SULA 3ASZA 3B8HA 4CGZA 2DPXA 2X2FA 2BBOA 3QVVA 5GVRA 2QRNA 2V6IA 3TLXA 1JNYA 4E07A 1JJVA 2R65A 3ZQJA 4EPWA 3PUWA 1M7HA 1PLJA 4GOKA 4P3YA 4KYIB 3VR2A 2YC4C 3P4YA 4R71A 1II8A 2X77A 4QNMA 4PC3A 3RHFA 4UXHA 2IXFA 3AVYA 2A5DA 5FTMA 1KDRA 3T61A 3WHLA 3EC1A 4Z51A 3X1XA 1XTRA 5L3QA 4TYQA 3O8BA 2ZAOA 1UF9A 1YZKA 2FEOA 3GLFE 1T4GA 2EFCB 4M1KA 5B57C 2ZREA 1NJGA 1J99A 1XDBA 2AK2A 2Z83A 3A4NA 3SS8A 5DIFA 3PV0A 4DDWA 5DLQC 1R5NA 2XTMA 3EIQA 5KDOA 2GXUA 2X19A 2KSQA 1QG4A 1NY6A 4NONA 3CPEA 4TMKA 3DHWC 2IK8A 2OUKA 3IO5A 2QENA 1T3HA 2NTYC 5DN6D 3SI7A 2QMHA 4D4MA 4WXPA 3SBDA 4CIDA 1ONBA 1VPLA 4JLBA 3I5YA 2WSSA 3MFYA 3RRNA 2J3EA 1OT3A 1BMFD 3IUYA 3CRQA 1MRNA 2ZI4A 4Z54A 5CB8A 3I8SA 1JQLB 1LF5A 4D81A 3K0FA 3D3QA 2B92A 4UXJA 2W00A 2ZS9A 3OFNA 4FN5A 2D06A 3RRYA 2ZJ2A 2NG1A 1AS3A 2FPMA 1HQCA 2WICA 1G20E 3GLFB 4II7A 1ZNYA 4ILEA 4LV5B 3ND8A 3LFUA 3AF3A 3KXLA 4PXAA 5AK0A 4QJ4A 5ELXA 3IPYA 2DB3A 2HT1A 2J9RA 3Q3JB 3IIJA 3SYKA 4C9BA 4PPNA 2Z5FA 5HE9A 1XTJA 2WV9A 3RSLA 1JXOA 4H1UA 4GI7A 2PCJA 4IXNA 3LVQE 5FTLA 1XEXB 2JJ2A 4PC6A 4X8OA 4LY6A 1P3JA 1KMHA 1XZQA 1IY1A 5IDVA 1II9A 1RYHA 4IXMA 5JJLA 5KDLA 4Q4AB 3TE6A 4C0HA 3TSOA 1BMFA 1Q3HA 4TZ6A 2IEYA 5C4MA 3OIVA 1TU4A 2ZE7A 1HURA 3PVSA 5FUXA 4HLDA 1CRPA 2PLRA 3U3RA 2GF0A 2WIBA 4RSGA 1ZD1A 4Y0VA 4AG5A 3OFND 4BEJA 4ZV4A 4KAXA 4PSAA 2J7PA 2EWWA 2HEIA 4ZKEA 4ABYA 621PA 1K8RA 5JBQA 2BBWA 2ZRBA 1TQDA 5D3QA 3CM0A 4PO1A 5LDDC 1QVAA 3FKSA 3VKGA 3THWB 821PA 2R8RA 1WXQA 1J8MF 1IHUA 1E6CA 3P32A 3QPWA 4Q1AA 4LYFA 3SE0A 2O8FB 3U5ZB 4W5WA 4U02A 1SVIA 4F4JA 2QTHA 3EPJA 1CEEA 2QRZA 3LQRA 3QXJA 2G3YA 3QKTA 3U44B 5AUQA 5AUPB 3AKEA 1P2TA 3DEFA 1BKDR 2KWIA 2EU8A 3X2SA 3NXSA 3BD9A 4JT4A 2CHVA 2HF8A 1NBME 2RMKA 2WOOA 3I72A 4BZQA 3W90A 2QP4A 3CZQA 5FTKA 4TL7A 1EFUA 4EJSB 4URXR 2H16A 4LHZA 4P32A 2Q9BA 1CR0A 1D6JA 1E69A 1OV4A 2Q6TA 4C0LA 4AKEA 5B30A 1Z2AA 1KO7A 3L2OB 2WJIA 5CK5A 4DLXA 4B35A 1L8QA 4L15A 5JWOA 1F2TB 1SXJA 4MUAA 4A15A 1QHHB 3SYNA 3NBZC 4JLMA 2ASEA 4EFLA 4QGFA 4HLQB 2VPPA 2NO7A 2F1JA 1CP2A 2AR7A 1N5LA 1Z8FA 1SHZA 5H70A 3AKDA 5G3YA 3TNFA 1FNNA 2ZJBA 3T12A 1UPTA 3QVUA 3CNNA 1NF3A 4YMTA 4C30A 1OXSC 1GL9B 2JJ2D 3WHKA 3BS4A 4FCTA 4HZUB 3KFXA 4F4IA 3B1XA 2JAQA 3ZZUA 4IRUB 1IY0A 4W5JA 4BLPA 4EPRA 2ZITA 3THYA 5FH9A 1US8A 5HE8A 4HZUA 3LBHA 5FBQB 3B9PA 2NQ2C 4BFYA 2H92A 3PUZA 5KYKA 1SQ5A 2P65A 4WZBE 2KBEA 4ZCIA 2ECKA 2D4HA 2OBMA 1HYQA 2GJAA 2LWIA 2O8BB 3DOFA 2W0SA 4HSEA 4TLDA 4JLOA 4A0RA 4JZKA 3V9PA 4E22A 1PLKA 4TZ0A 3K9GA 4HAUA 3CZPA 3PG5A 4GFDA 3VTKA 1XJQA 1E9EA 1I4LD 3UANA 3BC1A 5EZ5A 3UG7A 5L3SA 1RPZA 4EPYA 5AR1A 1SVKA 1UJ2A 5CJPA 1MR3F 4TMZA 1A2BA 1CR4A 2DFKB 4LBWA 2CE2X 5AJVB 5B58C 2XZOA 2IHBA 3AEZA 3HP1A 4AKHA 1GKIA 4D82A 1B0UA 4C7OA 2QGNA 5FBWB 4NE2A 2LKDA 4TYPA 1SXJE 1U81A 4ZDWA 3LW7A 2WZQA 5G3ZA 1Z07A 1K6MA 2YINC 1E9FA 5F9FA 2ZROA 2B7BA 1RFLA 1Z0FA 1GRNA 1Z22A 1Z0AA 4HUQB 2O0KA 3KUCA 3I8XA 1E9DA 1AIPA 5CK4A 3FMOB 4XVQA 5GJVC 3AP2A 5EZ6B 2GXAA 4Q7LA 5EUMA 4F91B 2OCAA 4Q01A 3T5DA 4A8JA 4N0EA 2WAYA 4GOXA 2R6FA 3D6TB 2OBNA 5FOWA 4LX0A 5BXQC 4DB2A 4TYWA 1G4UR 2QP3A 4I1SA 4QHYA 3RRZA 4QHSA 3WY9A 4A8JC 3NHAA 2MSDB 4M4SA 2Q3MA 4TL6A 4KVAA 3G82C 3ADBA 3K0AA 4UKDA 1Z6AA 2JCSA 4ZIRA 1Q21A 3FB4A 4TSFA 4EDHA 4CEJA 3IIKA 2VLIA 4A0FA 4Q9HA 3WMEA 1T6NA 3VHLB 4PQYA 1M8PA 3RS2A 2H18A 1MRSA 1S3SA 5GJBA 1KZ7B 3U61B 3REGA 1XTIA 3GEEA 1W36B 2H1LA 1H65A 2HJVA 3AVXA 5IK2D 4FI3C 4DDTA 2OCBA 2GEDA 4DLWA 1QZXA 4RVCA 2ERXA 2ZE6A 1AM4D 2AN9A 3LAWA 4GOJA 3CWQA 1G8HA 2OFOA 4RD1A 4BE7B 5F9HA 3TQCA 1FZQA 4FINA 2IW3A 1AKEA 5KOYA 1GL6A 1XBTA 1X1RA 2FFBA 5KSYA 1W1WA 4TT3D 4US2R 1G21E 4AD8A 3L0IB 4BECA 1KYIA 4OQNA 1P5ZB 1Z0JA 4DLSA 2XZLA 3Q72A 1G8FA 1RVDA 4N1AA 3QI2A 1Z0DA 2IYXA 3MGCA 4B74A 4JLAA 4EAQA 4Q1DA 4NYJR 5TVKA 1VHLA 1E4YA 2XEXA 4OJQA 5FTNA 4BFTA 4K81B 1F2TA 3MSXA 3RNLA 2J7KA 5J5CA 2F9MA 4RD0A 1SVLA 5LPNA 5D3MA 1G19A 4OKSA 4C0BA 3GLGE 1XCGB 2R44A 4GMDA 2IWHA 3DKPA 3OEED 4U5XA 4ZKDA 1Z63A 1N5IA 1E98A 2QA5A 2QAJA 3OZXA 4XOIA 4J0QA 1ZVQA 3B1YA 4OHYA 5IF9A 1R0WA 1SZPA 1ZM3A 3CR7A 2C96A 1OIVA 1DAGA 1KI9A 3DM9B 1GRRA 1QDEA 4DEXA 1HE1C 4HATA 2HCJB 2J46A 4BFSA 2PT7A 1VDZA 2BHRA 4L5BA 1UBEA 1Z5ZA 5IRCD 1R6BX 3DOEA 5A0FA 2HXYA 3R7WB 4ESVA 3P26A 3QEOA 5KSOA 2CHGA 3DMNA 3A1SA 1VG9B 2O8FA 1KGDA 2O8EA 2YWFA 3U7HB 5IHPA 4KSCA 3PEYA 4Z8XA 2JLYA 4XTCS 4M9ZA 4IHQA 2G6BA 4ZCMA 4WAUA 4JLKA 2XTZA 3AQ4A 2QI9C 1N6HA 4M9SA 1E0AA 1OB2A 2R2AA 1UFQA 1FW6A 721PA 2B6HA 3KXIA 2EW1A 4UNNA 3U3OA 4URVR 5JMTA 3T06B 5FFMA 4LBZA 1I2DA 5FOTA 5LD2B 4KBFA 1XEWY 1NKSA 1HQYE 4YXWA 1PZNA 2WWHA 2IUTA 1E2KA 2N46A 4URYR 1T91A 3HYTA 1TUEA 3F3YA 4ZO4A 5IT5A 2Z4SA 1WE2A 2IS4A 2IS1A 2VYFA 1MOZA 2FX3A 1E1QD 4MGIR 3KKMA 3WXMA 3KKPA 4BFUA 4B75A 3RC8A 5CM9C 1AS2A 4EUNA 2BMJA 1FX0B 1N6PA 2JEOA 3PEUA 3AM1A 3N5CA 1XJ0A 1CR1A 2A5FA 4NMMA 3NEYA 4QJ5A 3X1DA 3ZS8A 5CITA 4LDJA 1P75A 1SXJD 4RD4A 1V5WA 5JJIA 2WMOB 1XD2A 3Q9LA 4LV8B 3TRFA 4L16A 2NZJA 3FMIA 3I4LA 3MAAC 4ESHA 2XXAA 3EASA 4LWZA 5AJWA 3QQ5A 5LB4A 4FMDB 2XOKD 4V0NA 1EX7A 3QKRB 4BGDA 3IGFA 4MA4A 1XPOA 2ZJOA 3GD7A 3JZMA 1G6HA 1D5CA 2C04A 2WSMA 2YV5A 4DLUA 2BVNA 4B33A 3WBKA 4M1MA 4B43A 4JYBA 4EFMA 1S8FA 1WA5A 2NIPA 2ZRLA 4QFMA 1SKYE 2XAUA 4YMUA 2O0JA 3CH4B 2H8KA 1RW4A 3UMSA 2ZRDA 2ZRKA 1U0HC 2BEKA 2DHRA 3FHOA 4NCIA 3E70C 5GADl 5JWHA 2VP9A 2WVJA 1KSJA 3FDIA 1M74A 2GILA 2VSFA 2XJ9A 2CMKA 4MYHA 4KV9A 4XWKA 1X3SA 3R20A 3ADDA 1MH1A 3EXAA 1RKBA 4AKGA 1PUIA 5EP1A 1EXMA 3K9LA 2WKPA 2VHUA 4PAOA 2G9NA 3EPHA 3DMDA 3THOA 1S4QA 2OCPA 4JVMA 2ORVA 2ZSBA 4IVPA 4YDSA 3L0PA 1GRQA 1D2EA 1XNJA 1YZGA 2CE7A 2IEZA 5CDFE 1JAHA 1RJ9B 5KSPA 3ND9A 4JKYA 4QNRA 5JS7A 1QRAA 2KB0A 2K5UA 4PO9A 4LC0A 1W4BA 4I99A 2BM1A 4RJLA 1QHSA 3AP1A 4KVGA 2IYWA 2JLZA 2ZYWX 1DG3A 1E9SA 1VIAA 4XVRA 2ZAMA 4NYIR 4DDUA 2WIAA 2IXGA 1W0KA 4N0DA 2WKRA 1Q12A 3CF2A 3LH5A 4JBXA 1ZNXA 4LV6A 3A37A 2DY1A 3NG1A 1G8YA 2HJGA 5CYOA 2FNAA 2WJYA 3KJHA 2ZI3A 3HPQA 4M1WA 3M1IA 4UQOA 4HUTA 1N0UA 1MABB 1XMJA 4AI6A 4DCTA 1OH8A 2ZI6A 1PJRA 3FE2A 3IBGA 5M04A 2FJUA 1XD2B 1V43A 4A8JB 1E0KA 3SBEA 4I4LA 4B76A 1EG7A 1P61B 2CXXA 4M1YA 4PR0A 4AWXA 2GEUA 2GK7A 2OCYC 2JLQA 5AWFC 1AA9A 5EE0A 1E4VA 4B2LA 4B71A 5KU1A 3EWSA 4IVQA 2A30A 1OXXK 3C14C 3GLHE 3SJCA 3LRPA 1MV5A 1UEIA 2CVFA 3RAPR 3RVBA 4BLQA 2QMUA 4IW3B 1MO5A 2D3WA 2PBRA 4DEYA 2QPOA 1ZIPA 1VYTA 4R98A 3A1TA 3KB1A 4OQLA 2PX3A 3X1ZA 5KPDA 2GWHA 2W58A 3KQHA 4B2PA 2WJVA 1O87A 1U9IA 3ZD7A 3KJIA 4CT4B 3VHXA 2ZRHA 3KDSE 1NSFA 2PL3A 3FHTA 2O8CB 2VP5A 4QGAA 1KDPA 3DDCA 4BEBA 4IDHA 1ZM2A 3FKQA 4C0SA 1KHTA 4QJ3A 2V8OA 3C5CA 5JWRA 2KJQA 4LJ5A 5JEDA 4IDOA 3K53A 2CNWA 4IOMA 1VKJA 3UK6A 3DM5A 1JPJA 3B85A 4NYMQ 4LJ7A 4DRZA 3BOSA 1ZC4A 4LPSA 1JJ7A 2C9YA 3QF4B 1GITA 3SFVA 3BFXA 2DWQA 1XEXA 1YR8A 3N2IA 2Y8EA 3OIUA 4Z8YA 1PUJA 2J59A 4TL9A 2O8BA 1NG1A 1XU4A 2VP2A 2OZEA 1E2IA 1FOEB 4JLVA 4DUGD 1IN5A 3SNHA 2C98A 4DIDA 1N6IA 3AVUA 4FMBB 4RCZA 3RS3A 5AJZA 3C4JA 2OXCA 3BH6A 4MKHA 2IYLD 2QP9X 1CJUC 1VCIA 1QHGA 1J8YF 3CR8A 2FEMA 4QBIA 4B3FX 4R2HA 3AKYA 2E87A 4KCGA 3VR1A 3AB3A 3UWOA 1VG0B 2O8DA 5CYPA 4V02A 5KO2A 1NRJB 4OI4A 3SJBA 4D4JA 3E5HA 3HU3A 2G88A 1T8UA 1G5TA 1AJEA 5EE1A 3TR5A 4DC9A 2A3RA 1VG1A 4LUCA 2SHKA 1NN0A 4JL6A 4M22A 4BLOA 2CCKA 4OK5A 1LNZA 3OAAA 2KBFA 2DCUA 2QN6A 2AFHE 3OEHA 3CUEF 1R8SA 5EE5B 1RRCA 5TXGA 2W6JD 2NO0A 3VR3A 1NVUQ 1F48A 3WYFA 2ZEJA 1ZUNB 1OYWA 3L8ZA 2GCPA 2HUPA 2WPDD 3U3KA 5DNYB 2GK6A 2ZYTX 4Q47A 1J70A 1OXUA 1CS4C 3JZAA 5GJCA 2PEYA 3CF0A 4G3XA 4NCHA 2GJKA 5AJXA 4LYAA 1R0XA 5TMPA 4F93B 4B48A 4LJ9A 4A9AA 3GP8A 3NHBA 3Q5DA 5CLLA 4AK9A 3FFBA 1NVVQ 3P1JA 1KNXA 1E96A 2ZRNA 4D0GA 5H8WA 1ZP6A 3UG6A 2QROA 3B5JA 1TNDA 1TTTA 3GJ0A 4KFUA 4HAZA 4P31A 2QY9A 5KTYA 2QGZA 4F4CA 3IHLA 4D0LB 3WMGA 2Q0HA 1R10A 1TMKA 4JYCA 2VBCA 4JMPA 1X8KA 4R7ZA 3AUYA 3TQFA 3OEHD 4D26A 2ZPTX 3LDAA 3PUXA 1BYUA 1KAGA 1LTQA 2QAGB 3IKJA 2V7QA 1CJVC 1QVRA 1T5LA 4Q4HA 5TV2A 4DB4A 5JJKA 1N6LA 1CJKC 3UIEA 3QENA 4B34A 4QGHA 1IXSB 1ZD8A 1FL9A 3BK7A 2V1UA 2RCNA 1KDOA 2P3SA 4DDVA 2LCFA 2QMEA 2ZE8A 2P6NA 4Q5IA 4MH0R 1G41A 3TAUA 1G7SA 4RFSA 5K8IA 4AYXA 1RRGA 3EC2A 121PA 2EFDB 4P4SB 1DTSA 4I81A 4PANA 2G77B 4US0R 3WMFA 1KK1A 4NTZA 3ETLA 2IS2A 4BPBA 3Q7PA 4NZYA 3CF6R 1I4TD 2HLDA 4DIEA 1P72A 1RZ3A 1SVMA 3QXHA 3EA5A 4IDPA 4CEIB 2J1LA 1E2EA 2MMGA 3BGWA 4MRVA 4L9SA 1UKYA 4BWYA 2CK3D 3REFA 3SU8A 4X8MA 3RDPA 1COWD 3NBFA 3RS0A 1P9WA 4IOLA 4B32A 4DSNA 1YR7A 4RD2A 4A6XA 4QKQA 2GESA 1E2PA 2BEJA 1E79D 1YJ5A 1EWRA 1BYIA 4HDOB 5FOXA 6Q21A 3C5HA 3K0CA 3MWJA 1DARA 2XNDD 1NKTA 1XTQA 2GA8A 1DAMA 1GL7A 3PUYA 2BMDA 4B3DA 5TY0A 1DEKA 2JJ1A 4C0JA 1II8B 2IYQA 3WNDA 3I3SR 5FUYA 4CEHA 1YRBA 4FCWA 4A36A 3U2QA 2GBLC 4GP7A 3UMRA 3SC3A 4FIDA 1S1CA 1XFAA 1N0VC 4PC1A 4RY2A 5DN6A 3C15C 1GOTA 5EQTA 4ARZB 4HLUC 2LKCA 4KLZA 5DYGA 4B3GA 1IN4A 3EW9A 1IJFA 1Z3IX 2I3BA 1XD9A 1XMIA 1SVOA 1X8JA 1G7TA 2GXQA 3K0EA 4CZ2A 3GPLA 2J41A 5G40A 5L8VA 2A78A 3EIEA 2C9OA 2V7QD 4LZZA 1G7RA 5LD2C 1XWIA 2IL1A 3BERA 4EQ6B 4FMDF 1L4UA 1ZJ6A 1KKLA 2ODBA 2DYKA 4DSTA 4WZ6A 3VU9A 1HA3A 1D9ZA 1WF3A 1E1RD 1HTWA 1G5RA 3M4YA 4PQFA 3THXA 4WA7A 1IAQA 4P0TA 1D8TA 3KX2A 1OHHA 2WWXA 2BM0A 4MRRA 4DLYA 3IHWA 1KI7A 2P6RA 1SVWA 4TLCA 1G4AE 1CR2A 1G16A 2JLSA 1G3QA 4QOSA 1JI0A 1NLYA 4OHZA 3X1YA 2WWYA 1G291 1XP8A 1WP9A 2ZJYA 2BJVA 1GG2A 4Q18A 3W3AA 1SKYB 1FP7A 4AYTA 4JJZA 4D0NA 2Q3FA 2AHOA 2VHQA 2FWRA 4OJKA 3EARA 3BB3A 1FTNA 4QM7A 2EVWX 3BH0A 3MD0A 3GJ8A 1GZSA 1YKSA 3SJZA 3SQXA 4LPKA 4V0ME 1KI4A 2GJ9A 2PZFA 4M2LA 4D4KA 4FXPA 3VKHA 4GBMA 1D2NA 2F3TA 4GRAA 4JSYA 1BS1A 2P5TB 4Z1MA 3FOZA 2XNDA 1P2VA 1Z6GA 3A4MA 5FI0B 1OH5A 3M0EA 2G1JA 2ZANA 3WBJA 3MWYW 1KY2A 1HUQA 4A0HA 2VEDA 4B44A 2H5EA 3TVTA 2RGGA 4JVSB 3QEJA 5HZHA 3LNCA 3E2IA 5LBIA 2J0UB 1F5NA 2RHDA 3EPLA 5BYKA 4OHVA 3T1VA 5DI3A 1FX0A 1II0A 3C8UA 5DISB 1NMXA 2IYYA 1G3MA 1OHHD 3NEJA 5KSZA 4TQ9A 1FNMA 1PLLA 2WKQA 5J47A 4JT2A 2ZRCA 5C2JB 4DT1A 1G17A 2G83A 4Q4LA 3FWYA 4RZ2A 4V0LA 2F1RA 3CW2A 2J0SA 5SZJA 2D74A 3DKVA 2N1BA 2OSBA 3IDQA 2IXEA 3AGQA 3ZVRA 1U8YA 4G5RA 3X1WA 4Q4AA 4JL5A 1ZINA 3CX8A 5FPKA 4IFBA 3LXXA 1FUUA 2F1HA 4U00A 1HT1E 2EQBA 1KO8A 2FZLA 2I1VB 3AVOA 4DLZA 1G1MA 2WAXA 1N0WA 1Q1EA 4G1UC 1ZW6A 2NGRA 1L7VC 3PIRA 1XRJA 1J90A 1SHKA 2W6IA 1UBCA 3QXSA 3GJ5A 4A2QA 4GDFA 4TYNA 3WYAA 1ZUIA 1CXZA 1KO4A 1U8AA 5JSZA 1XXHA 2H7VA 3NKVA 1DPFA 4IOKA 5HTKA 3TSZA 3QJYA 1NVVR 3VR5A 5J4LA 2JDID 1XXHE 1Y63A 2R6CA 1TEVA 1NVWQ 4PAQA 5KDDA 3U4QB 4JLPA 4JBYA 3IBYA 5EUQB 1KZGB 3QKRA 4CEHB 2RGCA 4OQMA 1M34E 2IBMA 1TAGA 2DWPA 3DZ8A 1IONA 3WRXC 4BFXA 1T5IA 1JBKA 1OIXA 4GT1A 3I61A 1E2GA 4HB3A 4TTRA 3AVVA 2YJTD 4MKGA 5JI3E 3TKLA 2CHQA 3FVQA 1YU9A 3ECCA 3K9HA 1P73A 4KHZA 1KSHA 4Q9IA 4B73A 4EPTA 4CF7A 4DBLC 1KTVA 2H17A 2VHJA 4V0OA 1JR3A 2BDTA 2ERYA 2ZJZA 4KXFB 3LD9A 2GAOA 1XTKA 4B47A 1YHNA 2JLRA 3UPUA 2YC2C 4EFNA 2CK3A 4D4LA 3QF4A 3O47A 5EP2A 4MRSA 4JS0A 1XEWX 1D2MA 2GCOA 1NBMD 2ANCA 1KK3A 1AQUA 4Q7KA 2VO1A 3GMTA 5DI9A 1GFIA 4DLRA 3B1VA 1X1SA 5GVSA 2DFLA 5FPTA 1P62B 1KO1A 3GCGA 3BAFA 4ITRC 5JI2E 1Z0IA 3A1WA 3BWDD 1R0ZA 1NL3A 5EXXA 2YOFA 3GLHB 3I92A 5E7IA 3ZLJA 2F6RA 2HV8A 2RGNA 4M21A 3KKNA 3CX7A 4JSTA 4AYWA 1C4OA 4FW9A 4M9QA 2AK3A 5FL7A 1H8EA 3RYTC 4BUJA
chains in the Genus database with same CATH superfamily
1M5TA 1VL2A 2C0CA 4DT1B 2PUAA 5H82A 1XP5A 3KSRA 4LXYA 4XR4A 2QVLA 2N47A 5HVNA 2PJRA 1NBEA 4I14A 1BCSB 3PNMA 5AK4A 4NPCA 4C4YA 1WDLA 3OWOA 3LXRA 4EIWA 2VTBB 2YNMA 4EARA 4KHPB 1QAOA 1DFHA 1UJNA 1Y1TA 1M66A 2VSOA 1W5TA 5KWSA 5DSXA 3FXAA 4BJ6A 5JD4A 1R74A 1XHLA 4XB6B 1FF9A 4HQLA 4OD0A 1DU4A 1TX4B 1Z2PX 3KJFA 3MRVA 1KVQA 3GMIA 3PBKA 1XU9A 4RF5A 1M6WA 1EVLA 1XZFA 1QHXA 1ZCBA 2XSZA 3PENA 4UBNA 4XLTA 5DHQA 3VR4D 1N5KA 2VH5R 1LWNA 1XRRA 1YUNA 2YN2A 4H7PA 4NBSA 4R0VA 3SXPA 2PKRA 3PYXA 3WLHA 5HGXA 5KCZA 1HE2A 4W9NC 2GX6A 1Q3KA 3GFRA 4Q15A 5ARDA 1UWKA 5C1BA 3PJRA 2QTTA 3BRWA 3EPKA 1H5QA 2HC9A 3TF5A 2W2OA 3Q7RA 3R9XA 3A32A 3QM1A 4HGRA 4HWRA 1Y9EA 2IS6A 4B8WA 4TQAA 1XXLA 4O63O 1P2FA 3W9YA 3ISVA 1ZMXA 2F55A 1Y82A 1W4CA 4G0NA 4WZZA 5EFOA 3GLHA 1Z5GA 2I5PO 1R50A 3FPEA 2I2DA 2QMOA 2YR0A 2GK3A 4KXXA 4BFCA 3A31A 4BLVA 5H59A 3NPMA 7REQA 3QVGB 4IJ6A 3I5XA 3F6SA 4JELA 4OI2A 2ZSUA 4L74A 1D7OA 4MB0A 5G02A 4YFVA 1SR8A 4WACA 1PDVA 1C1HA 2II6A 3GLIE 3KJZA 1WUTA 2H00A 2H1FA 4X20A 3SOPA 2HJWA 3WZ2A 4H08A 3GR6A 4QTXA 1V35A 1IZ7A 2QM0A 1AKMA 3HMQA 3IPLA 4QFBA 2ZB4A 3NLLA 3I5MA 5T6MA 2ZTVA 4DVGA 2UAGA 3P7MA 5IXYA 5LQCA 4XSGA 4ER6A 2Z58A 2JIRA 2CXHA 3HBNA 2CDRA 4DR7B 2FQQA 1F0NA 1ECLA 3BIJA 1DO2A 3RVNA 1GKKA 4HNAA 4CDGA 5AIAA 4Z4CA 2X0KA 4OQXA 4O2BF 4XAQA 3E58A 1ESEA 1J2UA 1QG6A 1R4MA 3BQ9A 1JHYA 2CUNA 5IN5A 5TQ0A 4YRMA 4XWTA 4TKMA 1GDDA 3MBKA 2X9NA 4WY5A 3ZKAA 1MVOA 5HDBB 3RWOA 3EOZA 2ZZKA 2QLTA 4KKXB 1T1IA 1E1YA 3ZXXA 4D8VA 8ADHA 2HW8A 1T15A 3ZY2A 4W5OA 1Z0KA 3WGNA 4IDCA 4XYEA 5F52A 1P74A 3OQ1A 2XCRB 1IBRA 2IU3A 3I04M 1MJFA 1DZ3A 3IPXA 5KYGA 5LKRA 1OPXA 1Y9JA 5AVKA 5AFSA 2ZXEA 2P40A 1L4KA 3RUEA 1TK2A 1SJ9A 1ZGAA 2YXDA 3ER6A 4K03A 4YEDA 4HWTA 2Y3IA 2EHJA 4AMBA 4DYDA 1LJUA 2GS9A 1MPXA 3C74A 4IV5A 5CLHA 4ALNA 4GLFA 5L7WA 3HJCA 4EW1A 4CLOB 4KAFA 5H1YA 1E4EA 5K8TA 4LRUA 1MKYA 3ZXIA 4ITUA 2CT8A 2YMMA 4LI3X 2GKSA 1R6UA 3MTGA 4HN2A 5H3HA 1QLJA 4IINA 4NZMA 1WQ3A 3ZDYB 1UCFA 1T4CB 2AN5A 2WUFA 4OJNA 1AK2A 4Q19A 4D74A 1MJGA 3R6LA 1MT0A 3H86A 4HPJB 5IW8A 3A6FA 1HI9A 1F20A 4K46A 1N2IA 2I2XB 5FP0A 3IE2A 4EHDA 1BFKA 1CR6A 3LECA 2L19A 3S2IA 3ZHTA 5BNZA 5K4GA 2O3JA 1N1MA 1Q0UA 1UDXA 4O0LA 1QUFA 4NRDA 1H1TA 4TTTS 2I7TA 1N3BA 1QMGA 1N2XA 1RLMA 2LXNA 2XWBF 3CEHA 4BLUA 5E4JA 3IE1A 3UV6A 2BV3A 1G7CA 4JLNA 2Z0MA 3G85A 4PSDA 2Z95A 3DBHA 3V2IA 3IUEA 4UM5A 2BY4A 2J3LA 4X0EA 3WC4A 1CX9B 1JMYA 1WOYA 3N7UA 1C3EA 1MABA 5JXWA 1FTSA 1JG4A 5HK9A 4YGYA 3D6JA 3IDOA 4I1OA 1V6SA 2FB9A 3AGPA 3NHKA 4WKNA 4AMGA 5KNBA 4AF8A 3RABA 1E2HA 4WN9B 1OLOA 2MMCA 2OHIA 4TSFD 3RYCA 2CEAA 5CA1A 4PLPA 2R7AA 5LQSA 3EDMA 2O8EB 4ZEWA 4AJEA 1ZUD1 2QXUA 3G0GA 2YWXA 1K4MA 2GLXA 1B1CA 1XDDA 4ALJA 2XLCA 4FKMA 1R0KA 4PZZA 3BQNB 3SOZA 1GNPA 2QT1A 4UHHA 1C7IA 2QRUA 4PVDA 3AEQB 2YASA 4Q3DA 1NW8A 1GZDA 3BGDA 3LQ4A 2OAQ1 5LB2A 4ZGGA 1GWNA 2BM9A 3FYCA 3AR7A 3BSFA 5ALIA 4BP1A 4LMAA 1X7XA 3LE8A 1CZKA 2QX6A 3NBUA 4JI6B 2Q5FA 3KVNA 1I1HA 5JSFA 1NMZA 3RS5A 3B6ZA 2D62A 5GIOE 2CBZA 3F4KA 1V39A 3HJTA 4GXRA 1JH8A 3O73A 5IKOA 3W06A 4E03A 2F9LA 1E9RA 4YLGA 3ADCA 2BEWA 3I9KA 3A9SA 3PVCA 4GECA 2JARA 4N54A 3O75A 2FP3A 5C1PA 4H4CA 2JI6A 4QDTA 3MB5A 3ON5A 5AOCA 1ZD9A 3WADA 3U60B 2UXBB 3H2GA 3HZZA 2W70A 1JLMA 1FU7A 1VCOA 1IM2A 3BWMA 7REQB 5E2AA 1T9AA 1P5HA 3IEVA 1PJ2A 3EA0A 5KREA 2IEBA 3D8SA 3EGOA 3U44A 4BE9A 3B9QA 3MJRA 3ZXUB 3RYHA 3BORA 3O2JA 4GKKB 4G26A 3PWZA 2BGMA 2A5JA 2Z8YA 3AF0A 1UXJA 1F2UA 1TO6A 4KBGA 4GKVA 4OMUA 3DMGA 4RE6A 1K1EA 4MW9A 8ATCA 1TXGA 3J80A 3RJMA 5BVHA 3H84A 5ILGA 2PLFA 3DOHA 5GPBA 3LP6A 1VPWA 1MB0A 3T7IA 2DFNA 2QT0A 3KK0A 3HXLA 3LL7A 4I3HA 1Y4DE 2MR6A 1IK4A 1P4HA 4UARA 4G1EB 1HGXA 2WJPA 2NU7B 1D5WA 2PZAA 4YCNA 4Q9LA 4AQ7A 2E1PA 2C1ZA 2IA5A 3O7WA 3VRHA 5IKXA 2XZDA 3GH1A 1HV8A 3OBIA 2LPMA 3LM8A 4ML3A 1Q57A 3UPTA 1QP7A 1AN0A 1FRVA 1D03A 1WY5A 2AOTA 3O3NB 2OHFA 4K28A 4QWWA 4QZVA 4TTAA 5L3SB 3D7MA 3HBFA 3IERA 5CFNA 5I3CA 5I8PA 3WRYC 1U7XA 1Q20A 2W6MA 1WS6A 4FWTA 3D31A 2Q6IA 3AM5A 3U7EB 2FSHA 2AEEA 4XCXA 2RGNC 4L0QA 4E4TA 3ESBA 4FYMA 1A9XA 4ZI5A 3N8GA 1ESDA 3TX2A 4BO0A 3UN1A 1VSQA 2RC5A 1JEYB 1WW8A 4YP6A 4OMCA 3UMCA 4QT0A 5JDCA 1HYHA 1NIJA 1S2MA 3WV4A 1NGSA 4J2TA 1KBZA 2D2XA 1QHNA 3B60A 4QX6A 1UOEA 1C41A 2ZUTA 4JU9A 3KLMX 4HLUA 5DXFA 3K30A 5J59A 2QE7D 3EH2A 3HR8A 1NC3A 2ZQ5A 4ME6A 4XKJA 2H8GA 4V0MA 2DPMA 1HTTA 1JJAA 1MX3A 2EEPA 1C1DB 2GTPA 4ID3A 4LWQA 1NI4B 3FKSD 4UUOA 4A4DA 5L3QB 3MCZA 5KNLA 2O2XA 4NHOA 4GX2A 3RANA 1FDVA 2GYWA 3KT0A 4NFSA 4QRHA 4QJIA 3UV3A 1SCIA 1GD1O 3P2KA 3TTVA 1MW8X 3J7AC 2Z3VA 2WJGA 2VRWA 3ESXA 5LJLA 5F2EA 2X40A 3U1TA 1BXGA 3UXYA 2POCA 1CUVA 1VECA 4U7DA 4MVJG 5CTJA 2IV7A 2XITA 3QI7A 1NG9A 2P67A 3CBQA 5F73A 2RHCA 4BBZA 5DBGA 1UBUS 3NNNA 5ALZA 1SG9A 3BJRA 4Q34A 1W2HA 2VH2A 4F0JA 3P8ZA 1EFRA 1CULC 2YV1A 2X5KO 4JKIA 1YQQA 1W5BA 3K1TA 4QELA 3I2IA 3LO5A 4YJKA 4B7ZA 2ODNA 1SHTX 2ZPUA 4CM1A 2QBYA 3FBGA 1KI6B 3D6UA 4WXRA 4Y1EA 2B3DA 2MJLA 3MWGA 3R74A 3T3NA 1M0EA 1PQ4A 2WM3A 3VNBA 4QTYA 3VO9A 3G8AA 2WQZA 3BMQB 2QK4A 3B3AA 3KVYA 4V03A 5B53A 4CL8A 4NPAA 1SOWA 2J5XA 1U28A 3CA8A 3FVVA 3VR2D 4U7GA 3DHEA 4D98A 3KQNA 3MRSA 4H17A 3U4MA 1C4WA 1A9QA 1C9DB 3DGEC 3IXMA 3T8YA 5AVZA 3DZFA 4RTNA 1MGOA 3FETA 3ONVA 1AK9A 3Q10A 1C7ZA 2F9FA 1LVGA 2FK8A 1H6AA 4P4NA 2C42A 3P2YA 5ALVA 5L40A 2HPVA 2VYNA 4I5FA 3P2JA 1E3EA 1QE0A 2PTHA 3HN7A 2JGEA 4AWBA 3WGJA 2XTNA 4NMXB 5BR8B 3K9WA 1ZISA 4KTVE 3QUCA 3CEPB 2AEJA 5CJ2A 1BE1A 1BW9A 3FYDA 4YS6A 3GLGB 3D8HA 3RYIB 4CKCB 2AJBA 4P3XA 4LDPA 1JH9A 5INTA 1H1DA 2E37A 1EUCB 2ZUBA 4URWR 3UT0A 4Q6BA 4ZAGA 3ML1A 5ALFA 3IAEA 4FDVA 1GTZA 3UJPA 5G0TA 4R68A 1DMSA 3W3AD 2C95A 1JWAB 1QJ4A 4YIKA 4GZLA 4M87A 4PZUA 4WUTA 2I7DA 4PQRA 3UMJA 2C3YA 3KKEA 4O5OA 4WK4B 2EP7A 2R85A 1IWPB 2ZJ8A 1CQJB 1NBMA 2DT5A 3LSTA 3N8IA 5D86A 1GUFA 1W35A 3T34A 3KPJA 3UA4A 3E1SA 4XWAA 1N75A 2O7NA 3I39X 4LF6B 4LRTB 3DOOA 3V7UA 4LE0A 3SR3A 3GRYA 2G0TA 2BMEA 1F2VA 4AO7A 4RIIA 2VHXA 3AUXA 3D7NA 1NBHA 4BGUA 2FZGA 1QTRA 1DHRA 4HJRA 3OLCX 2XUHA 2FDCA 5EIBD 4PLHA 2APJA 5HFAA 1FFWA 2B5OA 3ONFA 2WJWA 5HBRA 4DWJA 4TWRA 3PX7A 2IOFK 1WHSA 1CJSA 3AL2A 3EZLA 1ZC3A 2FZ5A 2FFQA 3G1WA 5E9JA 1IG3A 4RCVA 3R7WA 4OFBA 4OHKA 3KJXA 2W2LA 1A5AB 4FT2A 2PVPA 3EIHA 4RS3A 2QHXA 5FPHA 4FP9A 3ULKA 2QRVB 3CLKA 3PNYA 5HQJA 1P4SA 2H31A 5I7RA 4RENA 5AJHA 3VJLA 2WTNA 4W9MC 3A06A 1OBFO 1K6IA 3OOYA 1E79A 1Y8RB 4HX2A 1EGMB 2DFPA 1J0EA 2AC7A 1O5IA 5BWMA 2B69A 1PFGA 1PJBA 2OO3A 2VKTA 1OX6A 2ZRIA 3UHFA 4B6QA 3EYAA 4QARA 1I7LA 3ESQA 1JQEA 3G8CA 4F3NA 4H7HA 2QD3A 4S1WA 4JN6B 5JJBA 1HZZA 2BFDA 2GEKA 4MJ7A 1G5IA 3OZGA 1ST2A 2NW6A 2H1RA 2X15A 4N47A 1BS2A 1V4BA 1K8ZB 1FNSA 1S7GA 1UQUA 2P35A 4HLNA 1IWOA 4LHYA 4ZPXA 3WQRA 4WY2A 1AU9A 3G2LA 2EBFX 1CP3A 4MP8A 2ZQYA 2HL6A 4Z7JA 1AGYA 3E3NA 2VDPB 1Y42X 4RMGA 4GI2A 4O2AB 1NAHA 3U4QA 4QPCA 1GARA 1U11A 5KHAA 1HK7A 4H7KA 4E32A 1FFSA 3AM4A 4HUQA 4KUGA 5M29A 2BFAA 1H2EA 4ZOQI 1GHTA 1Z2CA 1NU6A 1QANA 3NBAA 2JGNA 3DZBA 3G68A 2YZMA 3HUEA 1KMHB 2V03A 1ULBA 2BTQB 4LRYA 3NGMA 4GKAA 5E95A 3P0RA 4YHBA 1LNSA 4E5PA 5AK5A 4YIHA 1ORDA 1IY2A 3ODGA 3OLQA 2FMXA 5IM4A 1ZR2A 1F0PA 1K6JA 5FRDA 5C1DA 1SH7A 4KFSA 1B14A 3ZBUA 3DPSA 2DP4E 3JWEA 5DHPA 4EJMA 2OBXA 1A76A 2XVAA 3KB6A 1W6RA 4LTDA 3WYCA 5D1HA 1EGAA 3ZD9A 1E8DA 3DZCA 1P0IA 3EZGA 3GEIA 3G9TA 5HF9A 2FPLA 5D1NA 1FTWA 4QEZA 4RK0A 3C2QA 2J3KA 3LGSA 5G0SA 2G70A 1JQ3A 4D5GA 3G23A 4NENA 3LIPA 4R8KA 1FQKA 2FLWA 3U5TA 3FOCA 4YREA 1SK9A 1JFRA 2JLBA 3EHDA 2JGMA 4J2HA 3KL2A 3R6WA 4ZT7A 1M6NA 5GQSA 3T3EA 4EX7A 3SEAA 3EX7C 1XRLA 1BROA 5EY5B 2MDTA 4KR7A 3F78A 4RKEA 3S0JA 3ISJA 2PWPA 2R79A 2B2NA 4X93A 1I8TA 4EITA 3LOQA 1A7UA 3ELUA 3MMZA 1HYBA 2XRFA 2QGFA 3NVMB 3OSUA 4QL3A 4AT1A 4ASUA 2PZKA 5TT1A 1RACA 4K9MA 5FOSA 4YJHA 3PPXA 4CKWA 4H9GA 2BKUA 4Q3EA 4HMQA 5KYWA 4EVRA 5FLXA 5A5FA 4RNCA 1KDYA 1GFWA 1YQWA 1BGXT 5GIPE 4GZ3A 3TD6A 1Y7PA 5FYQA 3GU3A 5T64A 2I6TA 4WFQA 2JH3A 1JFVA 4MCIA 3CXUA 5BYAA 4NIMA 1EFPB 3WGTA 5GGYA 3NM5A 4PYMA 1NMYA 5EXPA 1ZQ1A 5KWEA 3DCJA 5CDYA 3KR9A 4H1VA 2CDAA 2X4LA 2A1UB 4REQB 4AVYA 2AG5A 3W5IA 3DR5A 3HKDA 1F9EA 2ZYHA 4JBWA 1DTEA 1FC0A 4QFDA 4X60A 5AW1A 2VRCD 4C4TA 2E5WA 4YMSA 1FLVA 1P2UA 5T8KC 2AL7A 3VH2A 2F43A 2DCMA 1TVKA 4J7AA 5FUWA 2P0EA 3RVJA 3V4OA 3L7OA 3X44A 3O91A 3OZUA 4HAVA 1QH8B 3DHNA 4JY7A 1X1EA 1DFGA 2QT9A 3B82A 1SUCA 3BICA 3FCUB 3P9XA 4KMRA 3BQMB 4PNHA 4Q7EA 4R81A 4QG3A 3EZNA 4F2PA 3JATA 2GPAA 2FH5B 1G8JA 4I3GA 3RU3A 5BYJA 3TUZC 5LXTF 4J1TC 3U13A 2ZTLA 4MWTA 3A0RB 4LQDA 1YF3A 2FR0A 1WX1A 1WUYA 2DJ5A 2CYBA 2JJ8A 1KJYA 4BLSA 1PR2A 3KR0A 4OREX 3TFOA 4R9NA 5IKMA 4BBPA 3HV0A 3FDZB 2DWUA 5FBLB 5I9IA 1BVYF 4K6KA 3EZXA 1VCHA 3KPVA 1EM8B 2YXBA 1T2CA 1TM5E 1P1CA 3B51X 2AR0A 4XSVA 2WQ6A 2QAGA 3FGPA 1R8QA 2A33A 4OKNA 4QGBA 2LUOA 1UDWA 2R751 3GEPA 3O82A 4FGWA 5K3BA 1JALA 2ETXA 2XH8A 2XNJA 1PYGA 4ASUD 4LECA 2CJXA 3PLRA 4BNJA 1NM5C 3F2VA 1W2GA 3IP5A 3R4CA 3V8BA 4B6JA 1TA9A 2CKMA 2O05A 4EMTA 1A7KA 4XM1A 5M34A 4LJ8A 4M1ZA 1M1YA 2ZUUA 4B45A 3CKYA 3VZSA 2CMHA 4UFOA 4WKPA 4M9XA 1RRKA 4ZQGA 2AI2A 2PSHA 3K9BA 2DUJA 4U2GA 1T5OA 2G80A 5B2ZA 3FM9A 1FNCA 3BJIC 1F5SA 1QV6A 3O95A 1RXEA 4MWBA 3V46A 1LBEA 3QBVA 4U2KA 1P3Y1 3FCSB 1YZLA 4ACBA 3UMYA 2AR9A 2ZM5A 3GBVA 1XZ8A 1YCHA 3OUZA 2DE0X 3I2FA 1RM5A 4F3KA 4EF6A 5JD5A 3P9YA 2XHEA 1FTYA 2O7VA 3FR8A 4MGHA 3KQKA 3GARA 1ZKMA 4ZIRB 3CPJB 2UUCB 4D0RA 1AKQA 5IYZF 4O2AA 1K92A 3BIFA 1CRZA 3QWAA 1PGNA 4UBLA 3KTAB 1NBIA 3GRKA 2Z04A 3O1JC 5P21A 2DHQA 2EXXA 2VQFB 2GEFA 3VC2A 9LDBA 1OF1A 2O2IA 2W2PA 3UNXA 1L8XA 1ZIYA 3NDPA 1DUSA 1VJ1A 4E70A 5LVAA 2WJ6A 1FDOA 4XVHA 1NTOA 4F4FA 1FTQA 4M99A 4C6TB 3LT0A 4YAOA 5G41A 3WGYA 2I4IA 5SZHB 4LW8A 3TZ6A 1EK1A 3R7DA 3OFSA 3NETA 3IDFA 1IJKA 3RE1A 4ZYUA 3R75A 1I80A 3C16C 4RD3A 2EG5A 4F7WA 3RTBA 2A59A 4PLFA 4W7HA 5HCUA 1GV1A 5AI6A 5MFZA 2W2MA 4QTZA 1M33A 4CNQA 1W36D 4HYYA 4ZVQA 4NJOA 4ZI3A 1EVIA 1X1AA 4FR0A 3DQPA 1GG8A 3ASUA 3TW4A 4TUYA 3H97A 3A36A 5IARA 3SD7A 4FFOA 1VYUA 3SF8B 1SXQA 1AC5A 1CUXA 2XUOA 4LZJA 3AF5A 2QSZA 3Q0IA 3TNYA 1EXDA 1SHJA 3VUFA 4A0GA 3HMKA 4MYUA 1XNGA 5GOTA 3OPVA 4JLJA 3GJXC 1DAKA 4MIEA 5EWJA 1ZSNA 3C87A 4B79A 2J3HA 2BMWA 3K7EA 4M3NA 3GLIA 4O2BB 1CETA 4FT4A 1XZAA 2YWJA 4TL8A 1U2RA 3FIUA 4YJHB 3TIXB 3UB2A 4CKWB 3TTYA 1JXMA 4I1RA 3ABRB 4QXOA 5LSAA 4OB7A 4MRMA 1EVYA 3EOAI 5F12A 3WWEA 5CBKA 2A14A 3FNBA 1GG9A 2BYTA 1L2TA 1ULZA 1XZEA 3IMEA 1PWEA 1ULUA 5AM3A 3R7FA 3M33A 3DZIA 4C0KA 1XRPA 3W8EA 1W4RA 3WKEA 3BXGA 1Z62A 5JAUA 2WMDA 4H1TA 4RWEA 5J5VA 1T5BA 4M1EA 2WTAA 4WT7A 5DNVA 2ZJ5A 2IYNA 3PC7A 3SHFA 3C8ZA 1SZJG 1H85A 1NP3A 2AB0A 2QN7A 2OV1A 3ITKA 3L1JA 4L5JA 2EOAA 2YWEA 4QFCA 1VM6A 2AXPA 4PZ0A 3RVOA 3D7SA 3GO4A 4ED9A 2F43B 2L18A 3PHGA 4IFEA 2ORWA 3MTQA 2VJMB 4V38A 1CQWA 5AW3A 1YULA 2VHVA 4FNGA 1N6OA 3R6TA 3TS1A 3IUPA 1VOTA 1ZY2A 4BB9A 3UGKA 5KNCD 4KGVA 3LLUA 3CPHA 3FZEA 5DTIA 1PEKE 2QYSA 2QKYA 4MMYB 2F17A 1WZEA 1UBMS 4IZIA 1VRVA 2OCLA 3RK1A 3PPVA 4L85A 3M1AA 3K5HA 5BQOA 3KYCB 4OHBA 1CF4A 1KRWA 1MU0A 2JIZA 1R27A 2RGEA 1LS6A 4RD6A 2NPIA 1T9BA 4TZKA 2WKSA 4IQ0A 5TNXA 2OVBA 1SXJB 2B78A 2P6PA 3LXMA 1FNDA 3PXAA 3MMPA 5EIHA 2GEVA 3EIOA 3R5KA 3WB2A 2JGDA 5T67A 5C31A 3RBXA 4DNPA 2OCIA 3BD7A 4IJMA 5KNBH 1WMFA 2XDYA 3GDHA 3ZPXA 2IZOA 4EY3A 3TAXA 2RHLA 3BMNB 3K1AA 1TCCA 4WVLA 1YHYA 1YDMA 2FQYA 3TLAA 4DHEA 3HU5A 2CNNA 3CONA 4MYTA 1WMAA 1CRQA 2X8BA 1HTBA 5J40A 4G0XA 3D0OA 1WUHS 4DDHA 3BRCA 4E46A 3LY9A 3GJYA 2EP8A 4UW9A 3R6DA 4LSGA 4DQLA 1IN7A 4FHEA 4HC4A 4Z1MD 5JYBA 5K8VA 1EA7A 1R2QA 5T7BA 3I9FA 3G2OA 1R0LA 5BV1A 2WM8A 3BWXA 3NIWA 1ADBA 3TRDA 3DE2X 1HY3A 3HB7A 1H0SA 1BXGB 5IAKA 2D1RA 1OH6A 1QU3A 4TKLA 2BKXA 1VKNA 2KQUA 2WWVD 2E6KA 4IJQA 4Q48A 2HPZA 1K98A 1YRYE 1BIFA 2BEUA 2OMEA 2V4ZA 3IMKA 3IX7A 1ZGJA 4Q9KA 1GGHA 2J0VA 1MMFB 1XD8A 3M4NA 3P97A 5CIWA 1B1AA 1NVTA 5BUZA 5IZCA 2OHOA 2Z5GA 1ODLA 2C8VA 2V58A 5DWVA 3ROQA 3S6JA 3B7WA 1FDIA 4PZYA 3A2KA 4EKEA 1DQZA 3DVRX 1E20A 4HVLA 4KX3A 5KX5B 1A69A 5EJFA 7AT1A 2I4OA 4ZC8A 4K9NA 221PA 1OI3A 4RH1A 1WB6A 1ISMA 2EKPA 3KVRA 3OA2A 4Y6RA 4WL0A 1ZO8A 5BN4A 5K8UA 3JVUA 2W4QA 1J97A 2EYQA 4I1UA 3AOEC 3FNEA 1RJ9A 5J2TF 3OZCA 3PD7A 3I52A 1JDBB 2ID8A 5LQDA 2VT6A 3TNJA 3B1ZA 4MW0A 1CRWG 1A1SA 1Q1ZA 5H80A 4BNWA 4AY5A 5BURA 1OFUX 1F4LA 2B4AA 2FAXA 3FHCB 4UAUA 4MUKA 2E2WA 3NUQA 3TB6A 3VPDA 2FPPB 2AOUA 1OPRA 1Y6JA 3E7WA 1CHNA 3KFVA 1YJBA 2FKAA 1R8XA 3E9QA 4YBZA 2V9PA 3EBLA 4IUYA 2UKDA 3S2UA 5B36A 4RULA 2C4TA 3U3DA 1ZFNA 5DHSA 3GLGA 2YHUA 4ZOLB 4ZU6X 2BUBA 4IDDA 3V48A 3L4JA 1T5DX 1XQ9A 2JIBA 2NVWA 2XQVA 3W8RA 3DFUA 1KYTA 1QH1B 3V33A 4R3WA 2PDAA 2O0HA 4RA6B 2VR1A 3EGXA 3PSHA 2WU4A 5LZ5A 1SUAA 4MS3B 3G88A 2O8DB 2ZR0A 4ZTUB 3VAYA 3G7NA 5EJ6A 5JXIA 1XF9A 4V24A 1N1DA 1A5ZA 1PK9A 4DSOA 3MLEA 2NQ8A 4U7TB 3L0SA 3MK31 5ICSA 1DPGA 1DJQA 2LD4A 2QNIA 3ITEA 1CIPA 2WHPA 4G5GA 4KJZA 1ZI8A 4KLNA 4AX8A 1W581 5CLGA 5ITWA 1PFYA 2RBGA 1NT4A 5HX7A 2XF2A 4OLAA 4PYJA 5IT0A 4JJGA 1IBSA 1S9HA 1GNQA 2C84A 4LCJA 2BL4A 2FPIA 1U1GA 1G9XA 2IEGA 3UWKA 3ZIAA 2VP6A 1N1GA 2PWYA 5BW4A 2ODEA 4A82A 4DA0A 4P4SA 4OHUA 4GOND 1LS1A 1L5NA 4L28A 2P9QA 4EG3A 4LX8A 2VPQA 1UT6A 1ENPA 4V0RA 4EA6A 3RU7A 1TDJA 2QTNA 3O5AA 4MTLA 2BGJA 1R00A 2Y27A 4OHFA 3NIBA 2GT1A 3EXHC 2WI8A 3I9V1 4TXMA 3ZD6A 1XLTC 2X0JA 4HP8A 3DEKA 3STUA 3NBYC 3DDWA 2JHAA 1DEHA 1T24A 5FX2A 4KW7A 1QQ6A 2QVBA 2VYVA 3RROA 2GXSA 1E9AA 2A94A 3RS9A 5KQGA 4DA4A 1T4CA 1ZN9A 4BEWA 5JANA 2O7RA 5IVIA 2AOTB 3RF6A 2R25B 3JVEA 4BIMA 5FO1A 3I23A 4CM8A 1NWCA 1ZH2A 1ZIOA 2PH5A 3ZDAA 1F0YA 3IPCA 1QOPB 3K09C 4GLOA 4KJXA 1OX5A 3EIFA 4JI0B 2YVAA 3KLBA 2WJZB 3OFJA 4ZT3A 4P7KA 4CV0A 4GOMD 4S2EA 1IN8A 1X8XA 4GL2A 1X94A 3UAZA 1XZIA 3JQ9A 3OCZA 2WHPB 5NULA 3VDMA 1M34A 4QHTA 1G5QA 2JANA 1VPDA 4TROA 4NH0A 3GIWA 1XZLA 3L7DA 3LY5A 1NXWA 2RGXA 2OV2A 3HABA 4NMHA 4I5GA 3LFHA 4E5VA 4DSAA 5LU8A 4XD7A 4EG0A 3K0SA 5JBIA 5AVRA 2AN1A 1NRIA 3AG5A 5EUCA 4EOGA 3LHFA 2ZUWA 4PO8A 1EZ1A 1NN3A 4MOWA 3F7MA 2CNWD 5MFPA 1CDEA 1CQIA 3EMVA 3MWFA 1KK0A 2QZSA 1YZYA 4MQEB 3Q3EA 3V5NA 3KM0A 4YCSA 4W5QA 4BQPA 2O0LA 1DKQA 1SK8A 1XSEA 2LIPA 2ST1A 5DEOA 2TYSB 4J90A 4MAMA 2DPLA 3RPEA 1J1ZA 3H13A 4GQBA 5I8WA 2Q50A 5FHRA 5GJWC 1RJGA 1BD3A 3PC6A 4G4IA 1D2RA 4IQ8A 1OLSB 4ANFA 1BHJA 1KFCB 1P1JA 1JIXA 1BE0A 1ZJZA 3GFTA 4TWZA 5D00A 3IOCA 2NVUB 2O2EA 3WK8A 2X23A 3B89A 4CCYA 2RHMA 1VHJA 2NXEA 3FTFA 4CW7A 2ZRMA 3N0XA 5IM4F 1LLDA 3BE6A 3ZWCA 1HO3A 4EJSA 4CJXA 1H8HA 3I32A 1YSCA 1GPH1 3PUKA 4H2DA 2AD1A 3KXDA 4DM3A 2GCGA 1TAUA 1B8OA 5FBRB 5JFTA 3NIFB 4HI0E 4DZRA 1S3IA 1ZLYA 2C0PA 3VNUA 4KP7A 3VVBA 2G7ZA 1ZL0A 3FSJX 3KV3O 4I5DA 3TVYA 1GXSB 2GJSA 4M53A 5BQXA 1E1CB 2JG3A 2Z2XA 1WNTA 2J0UA 2BJWA 3GJ3A 1KEUA 1X7DA 3T7JA 2NP7A 1ISPA 2RONA 2YYYA 4G2TA 2HDWA 3KETA 3UMVA 3OO0A 3BMXA 4DC1A 1FW8A 5IVKA 3EWAA 3QPVA 2A1TR 2PCLA 3KALA 3F7TA 2FPKA 1I3KA 1UBRS 4H3HB 4GPZA 2Q7DA 4CCAA 4QGSA 3ICQB 4IEEA 1NW5A 3LUFA 1W46A 2NV6A 4IHKA 1AZSC 2TMYA 4CQLB 2XTJA 4HFJA 2QRQA 1I3LA 2B9VA 5FT9A 3T94A 2CUTA 4GQAA 4YRNA 3HHEA 3E7XA 5TJHA 2XBUA 3ZH9B 1LI4A 1TQ2A 1YS2X 3D6NB 3PGVA 4W1RA 1I7QB 5E2IA 4G1MB 3ANMA 1SVSA 3JQRA 2W2NA 3E9CA 2G36A 5LYJB 1QO7A 1LCIA 4H1HA 3LDHA 4Z0NA 1JFTA 1MJNA 2ODWA 4DM4A 1QV9A 3B53X 4QPJC 3W6ZA 4X1OA 5CH8A 3PCRB 4BOYA 4JQOA 1TMOA 3ZJYA 4DR5B 1VTKA 1SB8A 2H08A 2OP1A 1PJCA 3FTQA 1OWMA 3EEIA 3O92A 3OU7A 4G0ZA 4MGKR 4O2LA 3GH3A 4US1R 3W2FA 1FPMA 1EXNA 3BXPA 5AI4A 1OLUB 3GYGA 4V2UA 3PQ3A 3PX2A 1Y37A 5C5EA 3O8NA 1AUQA 3KAQA 5B7PA 4B3CA 4X6UA 2QMQA 1R1DA 1ZCZA 4EUEA 2O5EA 4QRIA 1MC8A 1RYYA 2Y1WA 3HA3A 4DLNA 4JLSA 4ZODA 4M1SA 1DAIA 2Q5LA 2ECFA 2RKWA 2C92A 2CFOA 4EF5A 4I8IA 1B15A 1IHDA 2VJOA 1E5TA 1CUGA 2RHHA 2HA2A 1ZD5A 3RHSA 5CA0B 3A7DA 2CXTA 2OPBA 4C7OB 4QU5A 1IRXA 1RPAA 2ROQA 3VKUA 2WWFA 4R01A 3KOXA 1H0KA 4YYEA 2V3WA 2OHXA 4UCXA 1OT5A 1PSDA 1Y5MA 2OAEA 2QORA 2VJMA 4LZWA 1Q1NA 5TARA 3TVDA 2IZ0A 4MGZR 3DL0A 4OHRA 1QK5A 1JEDA 1WBJB 3P20A 4LZLA 2JGFA 1T2DA 3EDCA 2YN4A 4HV4A 2O59A 5U4XA 4UNRA 4DTIA 7ABPA 2YFKA 1G6OA 3LK7A 4PS0A 4TV8B 3VGJA 1PWYE 5DM70 4S1VA 3ZQUA 1U7UA 4EB3A 4YA6A 1J42A 2DPXA 2FSUA 2OV3A 2Y92A 1K3TA 3CZCA 3HL0A 3QVVA 3SZLA 1X9HA 3HXTA 4RJKA 3WQBA 5BSFA 1UDAA 3COJA 5KJFA 1PUXA 1JLKA 3CJTA 5LQUA 1VHWA 3D2AA 4QTTB 3I1IA 4GOKA 2G8LA 5AIBA 3GWZA 1B16A 1XCLA 2KW5A 3TO5A 4RLQA 1II8A 4B8ZA 2X77A 4PC3A 5FTMA 2GKOA 4BKPA 6PFKA 5KVSA 4QYWA 1YA4A 4NULA 3JZFA 2XXJA 3HDVA 2CNOA 3MBIA 1KF0A 9ABPA 1XTRA 4PRLA 1Q0QA 2P27A 4IH1A 1NE2A 1CUBA 1DKLA 4Y30A 2ZAOA 2WT8A 2FEOA 3D1JA 3H99A 3WB9A 4BTEA 3GT3A 4IG9A 5B57C 3R0XA 2A9RA 3WSTA 3Q8WA 3R9KA 1CUCA 4WESA 1VMDA 2QLFA 3PV0A 4RVGA 3UMMA 4ZEMA 5DLQC 5DGCA 3STYA 3ZHBA 2WHRA 3GVIA 2QXYA 2XTMA 2VTVA 2WV7A 4AF6A 3H4VA 2ZBGA 1S2IA 3R0ZA 3ASVA 4FKBA 4QIHA 4TMKA 3WWYA 2NACA 2IK8A 2OUKA 4ZAWA 3G0DA 5JZBA 1QIDA 2QX8A 4HN9A 2QTGA 1KORA 4TV8A 4NWIA 4CIDA 1KEEA 5HOEA 1MEEA 3K6KA 1KS2A 3O74A 3WL3A 5ERYA 4JLBA 3QHPA 3QYAA 5LZ7A 2C8KA 4Y6GB 1BHSA 2WSSA 4G81A 4EGSA 4C1BA 1KERA 4R2LA 4Z54A 5DTRA 3I8SA 4MCJA 4YRAA 3SC6A 1WQ4A 4U8HA 3D3QA 1E5XA 4H3KB 1R6AA 4NFHA 5EGNA 1IU9A 3LCMA 1XJ5A 4DARA 5EPUA 2I71A 5HUJA 3OFNA 4BO4A 5D5HA 1TMYA 2X6TA 3F6RA 4NENB 4WFJA 3RRYA 1LPBB 3G3EA 3V6MA 3RFVA 3CYFA 1HQCA 2WICA 1C8KA 1DRVA 1G20E 3LGXA 4K9DA 4WFKA 4ILEA 1K9VF 4YP7A 1W9MA 2PQ0A 2DB3A 3KXLA 5AK0A 1H6DA 4P5PA 5ELXA 4JXZA 2VXOA 4OMDA 4JYMA 2PR2A 1U2GC 1Q16A 1I3NA 5DPMA 5ESWA 3JQ9C 2Z5FA 3NOVA 5HE9A 1XTJA 2WV9A 1BEUB 3E3MA 4B17A 4YX9A 2HWUA 3MTIA 5CXQA 2PCJA 3VSAA 3AZOA 3ANXA 3FUVA 3N5KA 5K0GA 4CWAA 1G21B 1P3JA 4NU6A 1QG0A 3WJAA 4I19A 3OMLA 4IXMA 5KDLA 1NQTA 3BFJA 1SEVA 3L4BC 4V0SA 1P2GA 4UVDA 1MIOA 1PNRA 3NYIA 3UKJA 2WU1A 3LQKA 2DC1A 2E6UX 2IYPA 4RJ2A 3WFZA 2HJSA 2ZAGA 3UJAA 2Q5IA 2MINB 2H1OA 1WV1A 1K75A 1X39A 1OUMA 2ODPA 4PSAA 2TMGA 4JYPA 3REQA 2Z2YA 1D1SA 4E88A 1T2VA 3N9IA 1K8RA 5JBQA 3E9NA 1IHXA 4NK4A 3IESA 5TPZD 1QVAA 5LDDC 1A8HA 5COBA 3NALA 3P32A 1XVIA 3QPWA 1L4MA 4AJ1A 2H5LA 5AMXA 1U0TA 3AMVA 4BMDA 1ZQ9A 4W5WA 3U5ZB 1H2FA 3ZBQA 4U02A 4F4JA 5I3ZA 1QGUB 3KSZO