3U3JA

Crystal structure of hsult1a1 bound to pap
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
287
structure length
287
Chain Sequence
b'SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
molecule tags Transferase
source organism Homo sapiens
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
total genus 95
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3jA00
2P6UA 2XNSA 4JLBA 4TMZA 1YRBA 3ZD7A 3C5HA 4EPWA 3K9GA 1KMHB 2WJGA 1X3SA 4FCTA 4Q4AA 3VAAA 2XJ4A 2PT5A 2W00A 2KI5A 3GLFA 2A3RA 1I4LD 2JIZA 2J0UA 5LD2C 1UBEA 3L82B 4PTLA 2JLUA 2J87A 4GL2A 3CX7A 2KSQA 1ELOA 2WJIA 2KE5A 4TTRA 2ORVA 1KGDA 2GILA 2C99A 3L2OB 1EFTA 4BEJA 1TQ4A 1IXSB 4FCVA 3PEYA 2Z83A 3QKTA 5JJIA 5EE0A 3ADCA 3BH6A 5EP1A 1GUAA 1DAEA 4PZLA 1X8LA 1M1YE 2UZ3A 1X6VA 2EQBA 2PBRA 1GSIA 1W0KD 1E1RD 1KKMA 2ZSFA 3VKWA 4MITA 4TMKA 2QQEA 5KSYA 2HXYA 2GETA 1H8HA 1MKYA 3ONWA 3DHWC 2D3WA 5FTLA 2Z0MA 1K5DA 3Q3JB 2IYXA 1G64A 2W0SA 4KO8A 2BIFA 3A58B 4JSTA 3PEWA 3T1VA 4DT1B 4TT3D 2GBLC 2VPPA 1EFRD 2WBLC 3KKPA 1UKZA 4XVQA 1LB1B 5JJKA 2FN4A 1ESNA 1OLOA 2ASEA 2B7CA 2B6HA 2NO7A 5EXTA 3EX7C 4F4CA 4LX0A 3IEUA 1OH7A 3UG6A 1Z5ZA 1BOFA 1W0KA 2ANBA 1W36D 1IN8A 3K9LA 4GP7A 4HDOB 3GPLA 1BO6A 3KX2A 2P3SA 4DEXA 1CKEA 1VCOA 2RGDA 4P33A 4JLNA 5FTNA 4QXAA 4Z8XA 3LW7A 5AJYA 3OFNA 4ERNA 1E2MA 2FF7A 4JKYA 1CXZA 4C0QC 4CT5A 4EUNA 1FX0A 3THOA 5J4LA 2Q6TA 5GVRA 2EFHB 3KB1A 4P4SB 1SVOA 2A5FA 4KVAA 1B23P 2IWRA 5JRZA 3THYA 1IAQA 4M1WA 4HAWA 2OCPA 4BFYA 5DH9A 3W3ZB 3L0SA 3U60B 3QF4B 1Q1EA 3SNHA 5KUTA 4D25A 1YJ5A 4OK6A 2ZI4A 3NXSA 1JXOA 2ZRIA 1OXTA 2VHUA 1GP2A 3BK7A 2ATXA 3A36A 5JMTA 3A1WA 1SQ5A 4C7OA 1SXJD 2QTVB 3PXGA 3H0KA 3HYRA 3LBNA 4HATA 4A9AA 4BFWA 1KI9A 2TMKA 4DBLC 1N0VC 1VKJA 3CONA 4IFEA 4A4DA 3Q9LA 4HLUA 1MO3A 4MGYR 2Q9BA 5EXPA 3B82A 1ZUHA 2HUPA 1G8GA 3B2EA 1W0JA 2IYLD 3EWSA 3FMOB 1XX6A 2Q3MA 3X1ZA 4D0GA 4D6PA 2FH5B 4M0LA 3EA0A 4JLVA 2R6FA 5FOSA 2I4IA 1NP6A 4IOLA 4PR0A 3GQBA 3D3QA 4MA4A 2FGKA 3QVUA 2BWJA 2IL1A 3ZQJA 1UKYA 4ZV4A 1FZQA 1EX6A 2F3RA 3U2QA 4M1MA 2IYRA 4Q9JA 1R5NA 4LUCA 3TVTA 4EPXA 1KK2A 4Q4JA 2QTHA 5E4FA 4OHZA 3ZIAD 1N6LA 2HF8A 2QNRA 1XTKA 4PZYA 3ASZA 2GJ9A 2C95A 3B13B 3FKQA 2ZI5A 3T5DA 4HYYA 4M22A 5GADl 1D2EA 3PEUA 1NVUQ 2QEQA 2G3YA 4ZKEA 3U61B 1CEEA 3A1TA 3FKSD 1U90A 3THXA 1D2NA 1SHKA 5EZ5A 1ZU5A 1KSGA 3LXRA 1G3QA 5CK4A 3R8FA 3K9NA 4EFMA 3BFXA 3NBFA 1OH5A 1MRSA 4DDUA 5JLJA 3CRMA 5M04A 1YKSA 4XVRA 2E1RA 3U7FB 4AKEA 3PUXA 2CE2X 4TSFA 2O8FB 1VG9B 1G19A 3BIFA 4RZUA 1H65A 3AEZA 3B1XA 3I8SA 3KQUA 3FDIA 5AK0A 3CRRA 2AWOA 1SKQA 4ZDKA 4B6EA 4W7SA 2I1QA 2QRNA 2J0SA 1NIJA 2VH5R 4RY2A 2HLDA 2V7QA 1VIAA 2AXPA 2DWOA 4NE2A 4A8JA 1QHXA 4N0DA 4LHYA 4RFSA 3RC3A 4JIMA 4DLWA 1RRPA 2CNWA 3OAAD 3QVVA 4D4MA 1ZNZA 4OHWA 4Q48A 5E7MA 2PX0A 4PANA 4Q4AB 3W90A 1AS2A 1U9IC 2G88A 4YDSA 1XB2A 5IRCD 5J4VA 5FBWB 4JBXA 4Q4JB 1W4RA 1CTQA 1XDBA 1NN3A 1BYIA 4FXPA 4JVNA 2NZ8A 2PLFA 3PEVA 1COWA 4WOPA 4I1OA 2ZPTX 1IJEA 5FL7D 4URWR 1S4QA 2IBMA 4F91B 5J4HA 1FW6A 3KXIA 3LV8A 2CLSA 4NL4H 3U3MA 1KK0A 1LS6A 5JHHB 4JKIA 4M1KA 4BZPA 1N25A 2PCJA 3CNLA 3DEFA 5EUMA 4B34A 1KIMA 2C2HA 2ZRLA 1AS3A 4AYXA 2OAP1 3ZS8A 3NEJA 2ZRMA 4DSOA 2GCPA 4UJ5A 5JEDA 1Q21A 1Z2AA 1KSJA 3OIUA 2GHIA 2HT6A 4B3XA 1AQYA 2IXFA 3KL4A 3DM5A 4Z1MD 1DAKA 4EFLA 4TL7A 2NMVA 3HU2A 3MJRA 5KDLA 3L0IB 1AJEA 3LWNA 3WHLA 3NC0C 1S1CA 1ZP6A 1XWIA 1W46A 2ERYA 4F4JA 3I62A 1OFIA 1FPMA 1ZM7A 3CR7A 1XTJA 2OEPA 5FUYA 3LY5A 4UJ3A 1Z06A 1Z6AA 4KHZA 4JJZA 3QI2A 3QSYA 4JL6A 1N6NA 5FPYA 3SOPA 4PAMA 4B76A 3GLIE 3AVXA 3K70D 1OE0A 1AZSC 2XB2A 1XD2B 2ZRBA 4A2WA 2QE7A 4TQ9A 3VQTA 3AVYA 4MYUA 3VKHA 2O0KA 5F2EA 4BZXA 4HSEA 4Q4LA 4EQ6B 5CB8A 2ZSDA 4GBMA 4JYBA 1J2JA 3AVQA 3SJCA 3WBKA 4LHVA 4A8JB 2KWIA 421PA 4D82A 4CEIB 1RRFA 2IT1A 4D0NA 3MGCA 5D3QA 3AKEA 4WW0A 2YWFA 3GJ7A 4DIDA 3T1TA 2DFTA 2CCGA 3IPXA 4RD1A 2DB3A 2Q9CA 4CEHB 1WBDA 4PC1A 2GZDA 3NHAA 4ZO4A 5K8UA 5KO2A 4PC2A 2C04A 5FI1B 2O52A 1FMLA 1G5TA 1NN1A 4Q1FA 4QBGB 3UG7A 2GXSA 4HLQB 1W7AA 4B71A 3H86A 4M1TA 1W5SA 4DHEA 5E3HA 4DLSA 2CJWA 3TH5A 5LPNA 1E2KA 2JDIA 1KI2A 2CE7A 1R10A 4HAZA 1G7TA 1WE2A 4P0TA 3QKRA 4HAVA 5JS8A 1OW3B 2BMDA 4ILEA 4ZDJA 2ZRJA 2O8FA 3BB1A 4QHTA 2OAQ1 3TLXA 1COWD 3IIJA 1XPOA 2CK3D 3QXJA 5KHOC 1XEXB 4LJ9A 3AVTA 4GFDA 2V1XA 2ZSAA 4B43A 3A6PC 2I3BA 3JVVA 2UKDA 5FL3A 2GTPA 2ZJYA 1WMSA 4DSUA 2A30A 1KYIA 3QQ5A 2DFNA 1QHGA 2JLWA 1LNZA 2WKPA 2H16A 4LWZA 1T3HA 1ZJ6A 4PHFA 2J7KA 1AN0A 4Y0VA 2EWWA 1DG3A 5CIQA 2QRZA 4AKIA 2ZAMA 2A5GA 2BHRA 1E1QD 2YWEA 2CL6X 1E9DA 4O3MA 3MWYW 1OYYA 3C5CA 3C15C 1KO7A 1ETUA 3CWQA 4NZYA 5KPJA 1BMFA 1E2JA 3O47A 5JEEA 1N5IA 5FTJA 1JR3E 4CIDA 5KSOA 4KBGA 5F98A 1NNEA 4FMDF 1KY2A 4LJYA 1AKYA 1JQJC 3ZYCA 3P1JA 1EXMA 2GCOA 221PA 2DR3A 4V0KA 3SHWA 2PJRA 2J5XA 1EFUA 2OZEA 3WYFA 2J3EA 2N42A 4TWZA 4PSAA 4QNMA 1DO0A 1W2GA 3T34A 4YXWD 4BQSA 4R2IA 2RGAA 3IBGA 3LW8A 2OFWA 4PQYA 4E09A 3RLFA 4QBFA 3V4RA 2EVWX 4ZDWA 2ZI6A 5AJXA 1N0WA 1SKYE 1UKVY 2JJ1D 2O0HA 5SZJA 3W5IA 1LY1A 3TUZC 1GNQA 4HUQB 1KI8A 1F2UB 1I2DA 4K46A 3T61A 1QVAA 2NQ2C 2AK2A 2Q3HA 2QP4A 3I3SR 3Q8XB 1Z3IX 3MLEA 4ZIRA 2GJSA 4Q7JB 1P6XA 1GKIA 3IDQA 4QG7A 3UMFA 2IEYA 2ZR7A 3I5YA 2Z4RA 3QIAA 3BH0A 3FWYA 4F92B 4GP6A 5C4GB 1OH6A 3P32A 3E70C 3T35A 1YZUA 3U6KA 1E9AA 2AL7A 2GF9A 4OHYA 4B2IA 1WXQA 4KU4A 2VF7A 3GFTA 3GJ8A 3WBJA 5HR5A 2GAOA 1NMZA 1WP9A 4PHHA 5CDFA 2O8BA 3A4MA 1P3JA 1IN6A 1NKTA 4RZXA 2RH5A 1J7KA 4KLNA 2GRJA 1NVWQ 2GEDA 4C30A 1GIAA 2N1BA 2XNDD 1DPFA 1RVDA 3DMNA 4KSCA 3SJBA 5FR1A 1Z63A 5FI0B 1JB1A 1OYWA 2F6RA 4G5SA 1CR0A 1P4SA 2W2TA 3SYLA 1DVRA 1UJ2A 5BQ5A 4UKDA 2UVQA 2A5YB 3WP0A 2YJTD 2L0XA 1II8A 2O8EA 3VFDA 4LSGA 3QXHA 4HZUA 3B6EA 4BLTA 3I61A 1E2EA 2SHKA 5JJLA 1JALA 2CXXA 2VP0A 5K8TA 1W49A 2IYQA 3PUYA 4WVFA 1NBME 4PZZA 2ODWA 4XH9B 2VP9A 5TV2A 3PUWA 3ICEA 2AD1A 4PSVA 2VSXA 4OI4A 2RGBA 1D9ZA 1UBGA 1UEJA 2WWXA 3K9HA 3Q7PA 4YLGA 5BW8A 5L3QA 3RWOA 3M1IA 4ZPXA 2YOGA 3BFKA 3IO5A 2XB4A 4RKFA 4UXJA 1G3RA 2ZYWX 1TTTA 1G4AE 3S1AB 3QY0A 1G17A 3TSZA 4P31A 4Q01A 3K09A 4G3XA 3AKYA 4IDPA 3OIYA 3SFZA 3OEEA 3AKCA 3QKUA 3KQNA 2ZE7A 1HTWA 3EZFA 3M0EA 1QBKC 1HT2E 4AI6A 3LD9A 3UXMA 1E9SA 1RRGA 3R9IA 1XJ0A 3TGPA 1R5BA 3GD7A 3CH5A 2WICA 1E79D 2ZJAA 1I4DD 2QL6A 3REFA 5EZ6B 2FSGA 1YR6A 3U3OA 2HYIC 1C1YA 4V02A 3Q72A 3VR1A 2BMJA 3QXSA 2ZR9A 5HZHA 2IYYA 3B60A 4GZLA 4IDOA 3R7WA 3AM1A 2G0NA 3LVQE 2JDID 1ZCAA 2J59A 3M4YA 5EP4A 4UQOA 5IHPA 3WNCA 1G6HA 4LBWA 1RKBA 5BN4A 5EJEA 1XJQA 2ZSBA 3O8BA 3MMPA 3RRYA 4KAXA 3RS3A 4TYPA 3TW8B 5FBQB 2R6GA 1IM2A 4TL8A 4DCUA 3ZD6A 1GM5A 1N5KA 4LBVA 5JS7A 4TT3A 1GAJA 4KV9A 1P9WA 4NBSA 4C0AC 2O8DA 3GJ4A 1XD8A 3VHLB 3GJ6A 2Y8EA 4V0OA 1U94A 4WXPA 4BWYA 2ZYVX 5L3RA 1TQ6A 2QM7A 2GAAA 3CH4B 3IGFA 5TXGA 4MDFA 1QHHA 4EAQA 1CRQA 1ZC3A 1KNQA 4M9XA 1RFLA 3TE6A 1EESA 1VYTA 2HXSA 3AGQA 3NH6A 2F55A 4BGDA 5JZVA 3T15A 2FMXA 2REOA 3B8HA 1N6OA 1UEIA 4X8HA 5CK5A 2ZRKA 3ZVMA 1D5CA 1P62B 1NLYA 1W4CA 3KZ1E 4MKFA 1G41A 1MO4A 2PEYA 3AP2A 1NG9A 1OKKD 1U0HC 5CDFE 4DIEA 5AUPB 2QENA 4CEJB 3KQKA 1U2RA 1ZNYA 4BLPA 3F0TA 2H18A 3Q5DA 2QMHA 5FPHA 4HAUA 5FOVA 3ZJYA 2IYVA 1ZRHA 2ZRAA 4A15A 1L2TA 1ZM9A 4F93B 3HPRA 2JIZD 3S1AA 4AKHA 4Q21A 4K81B 2W6ID 5EE3A 5G53C 2IXGA 1KI4A 2RGEA 1ZCBA 1U8ZA 3LBIA 1YZGA 3LQQA 2QPOA 2XOKD 2Z5FA 2J0VA 3BS4A 4IRUB 2HV8A 1BS1A 1HURA 4TYWA 3I32A 1X8JA 2CVFA 1KO1A 1G5PA 3EAQA 3U4QB 1ZD8A 1IY0A 2DBYA 2GCNA 2QY9A 2ECKA 1QZXA 1N0UA 1DO2A 4IVPA 4OHXA 4UNSA 1AM4D 1ANKA 1G18A 1CU1A 4KI0A 1AZTA 4M53A 4A92A 4F4IA 2WAYA 3W5JA 2FJUA 3WYAA 3IIMA 1KDOA 3VMFA 3P26A 4NYMR 4RZ2A 4LC0A 1DAHA 2WPDA 2X19A 3ZVRA 1D9XA 1HA3A 2YVUA 3KFXA 4NYJQ 3U5ZB 2CHQA 2KJQA 4WBSA 1CLUA 1PUIA 2UZIR 2PEZA 4IXNA 3UIEA 1GNRA 2C98A 4Q7MB 1YU9A 4EPVA 1HUQA 5DSZA 1XPRA 2ZRDA 1EFCA 3NHBA 5FOXA 3BAFA 3QXXA 1XCMA 3AP3A 4IDQA 2IS6A 3LFUA 4URVR 4TTPA 2GVDC 2MMCA 3KTAA 4NYIQ 3BBPA 5G40A 4YQFA 3AV0B 3LVRE 1HQYE 2OSBA 4Q47A 2WKRA 1FL9A 5FOWA 4A2PA 1KAGA 4TL6A 5HTKA 3W6NA 4IOKA 1GNPA 1IBRA 4BUJA 1YR7A 2R6CA 3H2YA 1E2NA 4DKXA 2B8TA 4GDFA 2D74A 2H92A 3U4QA 1E9RA 2VP4A 5FUXA 2BMEA 5L3SA 2YHSA 1QG2A 4V0LA 2FX3A 4N3NA 1QHIA 2VHQA 5IK2A 4I1UA 2WPDD 3QKRB 1KY3A 2IC5A 1P9NA 621PA 4P4UA 2RAPA 1D6JA 4D4LA 1IN4A 4LGMA 1OFUX 2MMGA 3C14C 2X2EA 1W5TA 2QQ0A 1Z83A 3NVAA 4DB2A 4PHGA 4YONB 4QGFA 2AFHE 4W9MC 2ZJOA 2LCFA 1Z22A 1G3MA 1LF0A 1KMHA 2DFLA 3RS5A 1OIWA 2OG2A 2C9CA 4U00A 1TU3A 1T5IA 4JT4A 4KODA 1FUKA 1NMXA 4TQUS 4U7DA 4RFSB 1VCNA 2DPXA 3DZDA 2XEXA 3UPUA 1DAMA 2VHJA 1W0JD 1E0JA 3JZAA 5DE3A 2QT0A 4IEIA 1OFHA 1XEWY 3W8RA 2PLRA 2NOAA 4C9BA 5H68A 3SDZA 3LRPA 1D8TA 3CKLA 1A4RA 1Z29A 2XSZA 1YQTA 2XTMA 4FMDB 3EPLA 3RDPA 3U6BA 4DRZA 4URUR 5C1BA 1U8AA 2F43B 3JVUA 1KJYA 5JHGB 2IW3A 5CJ2A 4L5BA 1VPLA 1Q1BA 3B7GA 2R65A 4GRAA 3FB4A 3AQ4A 4XSHA 3EZ7A 4LJ7A 3FOZA 1R4AA 1M8PA 4IHQA 2BBTA 4P4SA 5KPDA 4AG5A 1G1MA 2ZS8A 3KUDA 1ZMXA 5JSZB 1EGAA 2X77A 1SVKA 4NU0A 4W5WA 2QI9C 4PC3A 4BFXA 4LV5B 4CT4B 1XTQA 3R8CA 3ADBA 1N6KA 3BH7A 1G7RA 4JLKA 4PAOA 3CO5A 4QBIA 3NTUA 2ZIAA 5AR1A 4UNRA 1F2TB 4HAXA 4OI1A 1QHNA 3B85A 5DI9A 4BPBA 4KFUA 4AK9A 3U3RA 1SVMA 2FFBA 2PT7A 3EIHA 4YMVA 2WSSA 4G1UC 4ZCLA 3K0FB 1ONBA 3T06B 3ZLJA 2FOLA 4OQFA 2F9MA 4I99A 4I1SA 1OIVA 1NMYA 3AKDA 3QNUA 1NVXQ 3EIEA 1RRCA 3B9PA 1ZM2A 2BBOA 3FVQA 2G1KA 3BFVA 4EJSC 5FBRB 1N5LA 4AY2A 1E69A 5P21A 2PL3A 3RANA 2FA9A 5L8VA 4YMSA 1P9RA 3T1QA 1TNDA 3UWKA 3GP8A 1E1QA 2OCYC 4NKRA 5CYPA 5H1YA 3RSOA 4HAYA 3GLIB 1WB9A 2FFAA 3K0EA 1YVDA 3X1DA 1I4TD 721PA 5G3YA 4OKSA 4FI3C 2VLIA 3J81k 1OJLA 1LFDB 2C9OA 2RCNA 4IJMA 2HEIA 1EK0A 1X86B 4NYMQ 4PXAA 5DISB 2PZGA 3RRMA 4QHSA 1KOFA 3CF2A 3X1WA 8OHMA 2IA5A 5D3MA 1MOZA 1SVSA 4MKHA 4AD8A 1LTQA 5L3VA 2OE2A 1A7JA 4TLAA 4Q19A 4C2UA 4C7OB 4LHXA 3QEOA 2FZ4A 1Q12A 3PFIA 2JCSA 2YV5A 3K09C 1E4YA 2VHCA 1IOZA 4JYCA 2CK3A 3KDSE 2ZE5A 3FKSA 4KITB 1CIPA 1F60A 1XTSA 4DDWA 2GXAA 3U7HB 1HH4A 4MUAA 4B47A 2H17A 4IDNA 1BIFA 4DEYA 5EE1A 3CRQA 4GNKA 3IIKA 2QSZA 4GSYA 4J0QA 3OEED 5DIFA 2IHBA 5SZKB 4OK5A 1M7GA 2YWHA 3RABA 2QMUA 1ZYUA 1CRPA 4KFTA 3MWJA 1YHNA 4BECA 3IBYA 2QTFA 2IF0A 1RE0A 1W4AA 2C9YA 4QKQA 1ZW6A 1P72A 3PVSA 3TIFA 1HQCA 121PA 3PUVA 5BXQC 2GJ8A 1BMFD 3EW9A 3QG1A 2ZJ5A 2C5LA 4MYHA 4A6XA 2BKEA 1R0XA 2QAGC 4ESHA 1BKDR 4WXRA 4RCYA 2GDJA 5FTKA 5KDDA 2ZS7A 2WWIA 2OBLA 3KUCA 1CBUA 3FMPB 1P2VA 1DARA 1Y63A 3VU9B 1G3IA 4LJ5A 1NL3A 4W5HA 3GLGA 1JR3A 1VG8A 3AGPA 4U5XA 2WZQA 2GESA 2EWVA 5BYJA 4JBWA 2IXEA 3MAAC 2JJ8A 4DLXA 4DDTA 1DAFA 4MKIA 2XZOA 1OHHA 3OF5A 5SZHB 3DL0A 3CPHA 4S2EA 5C46F 4EIWA 4GMDA 5K8IA 1RW4A 2EFGA 3KJHA 3B1YA 3I1FA 3DO6A 1DAGA 1JAHA 3MWKA 4QFMA 2G9NA 2C78A 2ZJZA 5B30A 1C9KA 1SXJC 4PO9A 3BXZA 4QJ5A 1TMKA 4N1AA 2YKGA 1S9DA 3QF4A 4FMCF 3E1SA 2J46A 1RYFA 1XTRA 3CNNA 4E07A 5G41A 4EPRA 1AK2A 3ND8A 4DSNA 4JLMA 2F7SA 1H8HD 1J8MF 1MABB 2V9PA 3NKVA 3JZMA 2D2EA 3VR2A 2JGNA 3F8TA 1ZIPA 2LKDA 3BGWA 2F43A 2GNOA 1PUJA 2ZETA 5AUQA 5C2JB 2VIIA 2O8DB 1YRAA 3A8TA 2RMKA 2ZTSA 3QKSA 1DADA 3ADDA 4ZIRB 4RD4A 3TAHA 5DN6A 2RGCA 1P7CA 2P2LA 2A5JA 5FPTA 4G5OA 4UXHA 4RVCA 2ZE6A 1UM8A 4CW7A 3K70B 3B78A 3SJZA 1K5GA 2V6JA 4PX9A 4KJZA 3MSXA 3GMTA 1XD9A 2B8WA 3PUZA 2QG6A 3SN6A 4OQNA 2W58A 4KFSA 1TF5A 3K0CC 4PAQA 1ZINA 4ZCIA 4TMVA 1II0A 2JLSA 3EG5A 1GRQA 2YZ2A 3GLHA 3WHKA 5ELXA 5AUNB 1XU4A 3TSOA 4Q4HA 4ON9A 3A1SA 2QPTA 4A0GA 4M8NE 2PMKA 3THWB 3SYNA 4Y0AA 2NO0A 3CRVA 4B48A 3TQCA 4ACBA 4Z54A 4Q1AA 4A1FA 3VU9A 3BC1A 5K8LA 2O8CB 1CP2A 4M1YA 4JJKA 1K8RA 4LY6A 3VR6A 1SXJB 3L8ZA 1T0JB 1S96A 2CBZA 1LVGA 3EPHA 1Z2CA 3RHFA 2WHXA 1GL7A 1MV5A 2V8OA 2IEZA 1NBMA 4LBYA 2CLCX 4QGAA 1K6MA 3CF6R 4HLCA 1NRJB 4B3GA 2ZVPX 4DUGA 5LDDC 4OI2A 2OBNA 4GT1A 2V1UA 2ZS9A 4RD2A 4ACAA 4IDHA 2ZQ5A 5KYKA 3GLFB 1D2MA 4LCBA 3QE0A 3EZ6A 3B1WA 3FHCB 1R6BX 3LDAA 4JS0A 1KDPA 3AUXA 3DPUA 4MUBA 5FPKA 1II8B 2F3TA 4DB4A 2IS4A 2O8EB 2IUSA 1N3BA 1Q1QA 3AVUA 2D06A 3QENA 4GPTA 3VNUA 1WQ1R 3FPAA 1T9HA 1JR6A 1UF9A 3UWOA 2P6RA 1U81A 3EZ2A 2IHYA 3KKMA 2JLXA 4EJSB 2W6IA 2OXRA 2Q21A 1C4OA 5HKKA 1XBTA 3A4NA 1F5NA 2WOOA 3VX4A 4BFZA 1T8TA 4YMUA 3RC8A 1FUUA 2XNDA 4Q00A 1S0UA 1WA5A 3HPQA 1NG1A 4OQMA 3QBVA 3CF0A 2O8CA 2CEAA 1NI3A 1G16A 4PSKA 4WA7A 3WNDA 2AKAB 2D62A 1JAIA 3QPUA 4QGGA 3SQXA 2DWQA 4MRPA 3G82C 2IF2A 1P5ZB 1A1VA 3U3KA 4MYCA 2P5SA 1EG7A 5DHAA 3SJAA 1TX4B 4ZI3A 4KFRA 1FOEB 2IUTA 3RS7A 3W34A 4KBFA 1AQUA 1TAGA 1E98A 1MO6A 1R0ZA 2DCUA 3SI7A 4DLZA 5CITA 1E9EA 3V9PA 4G0NA 4HDQB 2ZRPA 1F2UA 5EXSA 3ZZTA 3M6AA 2AX4A 3R9WA 1XEXA 3BORA 3QOFA 3LLUA 1G20E 2NO9A 1JI0A 4BLQA 2OLKA 3EWAA 4A0RA 1O3YA 3QG5A 4QJ4A 5DI3A 2WWHA 1E79A 1OKKA 2FV8A 1Q3HA 1R2QA 2OXCA 2QT1A 2ZRCA 4NYIR 3AUYA 4OJQA 3T1OA 2J1LA 1E2IA 3C41J 5DYIA 3ZIAA 1FP7A 4URXR 4OHVA 1AS0A 4URZR 4CF7A 1G9XA 5TDHA 4DLVA 2ORIA 1KAOA 2R8RA 4ARZA 1JR3D 3EZ9A 3LBHA 4BRWA 1KI3A 4RSGA 4XD7D 4BLSA 1FTNA 4Q1EA 1QDEA 3X1YA 3GLHE 3FMIA 4XTRA 5J47A 1I2MA 3B9QA 3E5HA 5JECA 1IQPA 1NBMD 3LXXA 1T91A 1FMJA 3DOEA 1DTSA 1E32A 3PQCA 4AG6A 1E2FA 4LDJA 1L4UA 2VEDA 2CHVA 3IO3A 3MWLA 2ZANA 1SVWA 1XD2A 3IHWA 2ONJA 1JECA 2XTZA 1ZUIA 1Q1ZA 1US8B 3TW4A 2XITA 1GZSA 1XTIA 5TMPA 3IQWA 2WTUA 4E03A 1U9IA 3FHOA 4Q03A 5LB4A 4D80A 2JLRA 4I1VA 1NLFA 2QGZA 1E0AA 5B2ZA 1CR4A 3AVOA 2HJGA 2WVJA 1NKSA 1G8YA 4LRWA 4YMTA 5CLQA 2DWPA 1JNYA 5GVSA 1V43A 3HU1A 5F9FA 3BE4A 1XMSA 1NY5A 5AJZA 1KO4A 1E9FA 4RFVA 2ZEJA 5J4KA 4R9UC 1OT3A 4IKEA 2O8BB 1KHTA 1WBBA 2ZRGA 1GITA 1VCIA 4HB3A 2EFCB 1ZNXA 2WAXA 3FFAA 3ZGXA 2DFKB 3CRW1 1TU4A 3EC1A 4PC6A 4JVMA 4IVRA 4XD7A 1GL6A 3K0AA 1DBSA 2CNWD 3OAAA 1UDWA 3NH9A 4M9QA 5IDVA 3K0FA 1SKYB 4QBHA 1IHUA 2WKQA 4BRUA 2RHDA 5BN5A 4H1UA 4EPYA 4WAUA 1G3UA 2K5UA 4URYR 3AVPA 4HLDA 5CYOA 1NVVQ 3RAPR 4FCWA 5J40A 2QZ4A 3FE2A 3KTAB 5KNCA 4TLEA 4TZ6A 4MKGA 2OILA 1AA9A 2VP6A 2OV2A 1IY2A 3CLVA 1S9HA 1NY6A 2J7PA 5FPSA 1AKEA 1G4UR 3KFVA 3KKOA 3P4YA 5LBIA 4WZ6A 2CL7X 4AWXA 3SHFA 2P5TB 2VL7A 3SE0A 2X1VA 5SZIA 4UNPA 4AIIA 1A2KC 1KI6B 3LLMA 1RJ9B 2BDTA 2HCBA 1A5TA 2XX3A 2YOHA 3LQRA 4JLJA 4A0HA 3REGA 2JJ1A 1XMVA 4WZAE 4B33A 4TYQA 4PHTA 2V54A 3ZDQA 4B75A 2B7BA 1T0HB 3OE7D 4IXMA 3KQHA 2GCOB 2XXAB 5A5GA 4NMMA 3WMGA 5F9HA 2DHRA 2JA1A 2F1HA 4NP6A 1KSFX 2AFIE 4OYHA 5EP2A 2G1JA 3ZZUA 4TYYA 3THYB 2QA5A 3CR8A 4MGZR 2WIAA 2D7DA 4B6FA 4O2RA 2JJ2A 4RZ3A 5A0FA 1RZ3A 2CHGA 1E9CA 2HT1A 4FWTA 2VQSA 4MRVA 2JAQA 4BZQA 3IHLA 2KB0A 3W6OA 2VP2A 1TQDA 2QP3A 1SXJA 2HYDA 4H1VA 4LPSA 1YZNA 2KBFA 3T12A 2FU5C 4F38A 4QC2A 1VCMA 5HZKA 4B2PA 4BFSA 3HDTA 1E2DA 1V5WA 3CZPA 4PO8A 1FP6A 1R8QA 2OFXA 1LV7A 2R6DA 5FTMA 1B0UA 1Q22A 5FUVA 4DCNA 5AUOB 5KSZA 1XMIA 3PV0A 2QM8A 2XAUA 3EARA 2PMDA 1F48A 3GEEA 1PZNA 4U02A 1MT0A 1TUEA 4A0FA 2OFOA 1XXHA 4ITRC 1NN5A 2IX3A 4C3ZA 3RS2A 1L8QA 2ZITA 1HYQA 5KNBA 1Z0KA 2BMFA 2BM1A 2CLDX 4IFBA 3MG9A 4AKGA 4XWOA 3GJ3A 5JSZA 3I8XA 3UK6A 3PENA 4LYHA 4M1OA 3TUIC 1RIFA 4PC7A 4US2R 5AJWA 4RJLA 3KJEA 3KKQA 5FL7A 2FE4A 2BC9A 4JVSB 1G8HA 4NCNA 3GLGB 2OUKA 2ZI9A 3GFPA 2GBLA 1J8YF 4Z1MA 1TEVA 2AD5A 3NEYA 3SBEA 2IS1A 1KKLA 1W47A 1RJ9A 2NGRA 4A82A 1CULC 4NCHA 1N5JA 1KI6A 3TR5A 3FHTA 1Z6TA 1OFTA 1GL9B 3QJYA 3HYTA 5FR2A 1T6NA 1XEWX 2ZJ2A 3CX8A 4OBEA 4CEIA 4NCJA 2WMNB 5BWMA 1XRJA 1ZC4A 4B3BA 1WCV1 1XZPA 1FFHA 2ZRNA 4M4SA 4B35A 4QGHA 3QEJA 4JLOA 3SEAA 4C4PA 4JVLA 4ASUA 3CZQA 1M7HA 1T8UA 2C8VA 3AF2A 2Q3FA 3TNFA 1KJZA 3NBXX 3DZ8A 1NLZA 4HZUB 2ZU6A 1R0WA 2IUUA 4KSBA 5EXXA 1PVOA 3FTQA 1S2MA 4C0HA 3UANA 4PFSA 1US8A 2WMOB 4KLZA 3EC2A 4LHWA 3VTKA 4B3CA 3SS8A 2BEKA 3W6PA 4B3FX 4PQFA 4KVGA 4RD0A 1DELA 3B1VA 1LS1A 4QRHA 5CIWA 3AH8A 4M9SA 1GFIA 1P60A 1W48A 2WOJA 4HB4A 4MRSA 3LA6A 3VR4A 2KBEA 3NBYC 4HLUC 3NBZC 4DCSA 1Q44A 1GTVA 3OHMA 1G6OA 2OT3B 2IWHA 5BYKA 5DN6D 2J0UB 1NSFA 1JEDA 1W1WA 2CDNA 1OSNA 3A4LA 1VMAA 3THWA 4JMPA 4AYTA 2QAGB 5C4MA 3SC3A 3C16C 5LB2A 1W2HA 3TVDA 2CCJA 4DCTA 5B64A 3K8YA 1R7RA 2VSOA 4IOJA 1UAAA 2MSDB 1P2UA 5EE5B 3TUJC 3GLFE 1VYUA 2VTKA 1MH1A 1W44A 1XEFA 1XZQA 4EPTA 2NPIA 4NDZA 4CDGA 1FNNA 3RSLA 2GZHA 5H70A 3KKNA 1E94E 2XZPA 2E87A 3PCRB 2CMKA 4TMTA 2VA8A 4TN1A 4LYAA 5L3SB 3NDPA 2CCKA 3E2IA 1TEXA 4Q7LA 4Q9LA 3NDBB 4JT2A 2ZI3A 3C4JA 4JLPA 2IK8A 2ZE8A 3U44B 4AURA 3AF4A 1QG4A 2GEVA 4G5QA 5KSPA 3N2EA 4CRWB 2MSEB 3CBQA 5KDOA 4M21A 1CJVC 1QHSA 2BKUA 2WJYA 3G5UA 2WWYA 2VBCA 5H8WA 1XFAA 4KCGA 1XP8A 4QJ3A 1KI7A 2AHOA 1GKYA 1LW7A 2JASA 4BLRA 4AYWA 2BJVA 3SU8A 1MRNA 4IW3B 1UBCA 1W36C 2C96A 1ZBDA 3H4MA 2W0MA 2OO7A 3UATA 4TQAA 2YINC 4DUGD 2WWWA 3K1JA 5ANRB 1FTSA 1S1MA 4PPQA 2AN9A 4US0R 1YR8A 2A78A 1GRNA 1KJWA 4XJXA 2FSHA 4G5GA 3GEHA 2WJJA 3F5FA 5GJVC 2LKCA 4GOXA 3RVBA 5A4JA 4C2TA 4M9ZA 2ZUDA 5AWFC 5GJBA 2FGJA 4HDCA 4HB2A 1ZM3A 1JQLB 1A82A 2ORWA 5DLQC 1GILA 4QM7A 5FBVB 2GK7A 4DWJA 2P65A 1CJMA 1XPUA 5EUQB 1E2HA 1Z0IA 4YMWA 2AWNA 2D4HA 3OESA 2YOFA 3SR0A 3WRYC 2C77A 2PCLA 2R6AA 4II7A 1PLJA 5TARA 2J41A 2NG1A 2FZLA 2PX3A 1JPJA 1M7BA 4LJ6A 3ZVNA 4MDEA 4ABYA 2QAGA 3I72A 2ZRFA 3H1TA 4LOAA 2GJAA 5B58C 1GVNB 3L0PA 2ODEA 4XIGS 3C7KA 3ND9A 3TJZA 1AGPA 1M34E 2H8KA 5FBLB 4A2QA 4B73A 1Y3AA 3BB3A 4JL5A 5HPYB 1IN7A 2ERXA 1P75A 1ESMA 2WWFA 1X1SA 2D2FA 2XJ9A 3DKVA 3OEHA 4IOMA 1Z07A 5FFMA 2DYKA 1G7SA 5E7IA 1RYHA 4V0NA 4NTZA 2QSYA 3OIVA 5TY0A 1ZM4A 5GJWC 3CW2A 4PPFA 4Q18A 5E7JA 3UMRA 2FG5A 3FGNA 4QL3A 4D4KA 1Z08A 1HV8A 2ZUCA 1GDDA 4BFVA 5CB6A 1AIPA 2BM0A 3BOSA 3RS4A 2G6BA 3W9YA 2GF0A 4Q5IA 2YC2C 3N70A 5L3QB 1IY1A 3D7MA 1VIYA 3BRWD 4QHYA 3V00A 3IKJA 3ZH9B 4L16A 4ZKDA 3Q5EA 5JRJA 1XCGB 3MFYA 4NCIA 4Q1CA 1IONA 1H8EA 1L4YA 2YNMA 3O8RA 1PJRA 2WJHA 1N6PA 4POAA 1XJCA 2GWHA 1P61B 5J4YA 1SZPA 4DXAA 3NG1A 2HCJB 3PITA 3OFND 2WV9A 1Z0JA 4Q4HB 2QMEA 5EE9A 1R8SA 2WJVA 521PA 5JI2E 1E99A 1E2PA 4P32A 2NO6A 1ODFA 4C0JA 1OPXA 2ANCA 2BVNA 3A37A 4LC1A 3IILA 5C18A 3K0SA 1WDTA 1KZ7B 2H57A 3X1XA 4QM6A 4R7ZA 2A7QA 3CX6A 1MR3F 1BYUA 1PLLA 4FMBB 3I5XA 4X8OA 3ZS9A 1NIPA 1EFHA 1CR2A 4HB0A 4H9GA 4TLBA 1BH2A 1JBKA 4FD2A 4DDVA 4LYFA 1YZLA 2FPLA 1Z47A 1UBFA 4UNQA 3DM9B 1OB5A 1KK3A 3K0AB 2P6NA 1N2CE 1E4VA 5D3MB 4NHOA 4MQBA 4BFTA 3B1ZA 2GJKA 4R71A 4M2LA 4UXIA 2ZJBA 1P73A 4FIDA 3BB4A 3I73A 1ZD9A 4O0MA 4V0MA 1MO5A 1IXZA 1P2TA 3P27A 1HE8B 4JL8A 2FDCA 2VSFA 2QPAA 3GFOA 4FMCB 5TB5A 3FYHA 1UFQA 4MH0R 4LPKA 2EW1A 1M74A 2ZYTX 2JLQA 2LWIA 3VHXA 4JBYA 4OQLA 2HDNB 5F3WB 3PJRA 2R2AA 2BBWA 2JATA 1Z6YA 5DNYB 4XWKA 4NCKA 2A5DA 4Z8YA 5CLLA 1KI1A 2F9LA 4OJKA 2W2XA 2ZREA 4XWAA 4C0LA 5HE9A 3KB2A 4WZBE 1RPZA 2REBA 3K0CA 3EASA 2XTNA 2XXAA 4GI7A 4P4TA 2OM2A 3AVWA 2ZI7A 4JZKA 4K8OA 1DEKA 1II9A 2GXUA 2FPKA 2H5EA 3L0OA 1T3SA 1TF2A 1PV4A 4R2HA 3V4FA 5DO9A 1IJFA 3PG5A 1E1RA 1Z8FA 2C03A 3NC1C 1TUIA 4FN5A 3T5GA 3U3JA 2ZJ8A 3ETLA 4TMXA 5DYGA 1P2SA 2V7QD 4Q9HA 4CZ2A 1SHZA 1E0KA 3WMEA 2VRWA 1O87A 1N6HA 4ZI2A 2EYUA 1PLKA 3WP1B 3N2IA 4L15A 4BLOA 5KOYA 2G83A 4V0ME 3SQWA 2ZSEA 2QUZA 3GLHB 3KJIA 3HU3A 4MRNA 3THXB 5DHFA 2R9VA 1Q0UA 3P20A 4RD3A 2P0EA 1T4GA 1FQKA 4XOIA 3MUFA 2OESA 4ZDIA 1E96A 4DLRA 1UDXA 2X2FA 3LAWA 4JLAA 5LD2B 1Q20A 3LX5A 3OE7A 3WYGA 4EKDA 2QGNA 3MJHA 3K70C 2FEMA 3FFBA 3ASYA 1JJVA 5UKDA 2XZLA 2EYQA 2W2VA 2FSFA 4ARZB 1KNXA 2FPMA 1UADA 2VYFA 1EX7A 3Q7QA 1AGRA 4PPGA 5E95A 2FWRA 4DLTA 3HWSA 4QNRA 4OI0A 5KNDA 3ZQ6A 1N6IA 2CL0X 4ESVA 3HJNA 1OIXA 5FOTA 1VECA 2H7VA 3DMDA 3CM0A 3UMSA 2CJWB 5CJPA 3EPJA 4RD6A 4PO1A 4L9WA 4GMXA 2FNAA 1ZVQA 5EQTA 4HUTA 3LX8A 6Q21A 2JLZA 3RNLA 4D0LB 1QF9A 3OEHD 4EDHA 4XVUA 3AP1A 4M1SA 3W8NA 4A36A 4L8GA 2BCJQ 4JLDA 4TLCA 4HUQA 3EIQA 4KXFB 4DSTA 3D8BA 3DVLA 2QORA 5JCPA 1U98A 1GKUB 2JLYA 3R7WB 2GVZC 4BFUA 1FNMA 1OHHD 1G8FA 4IVQA 3TAUA 2GK6A 1NN0A 1ZD1A 5JBQA 4RKEA 3KQLA 3ZVLA 3GEIA 3TK1A 2D7CA 4B32A 4XTCS 1U99A 4NPHA 1CJKC 1FX0B 1Q3TA 4BE7B 2NTYC 1G21E 1TL7C 2RGNA 4Q9KA 3RWMB 4Q7KA 1G7CA 3O8DA 2ZYUX 3MRSA 4Q02A 4D26A 2A2ZA 3HR7A 5JFGA 2ZXUA 4D81A 4HZIA 1RC8A 4R98A 2N46A 2ATVA 2YWGA 5EP3A 2WIBA 2F1RA 5IF9A 1H8ED 3Q85A 3HP1A 4F7WA 2DY1A 821PA 1EWQA 4G01B 4LBZA 1DOAA 2MSCB 1S8FA 1OXUA 4G5RA 4ASUD 2Z4SA 4DLYA 2J0QA 4WIAA 5IK2D 2BCGY 2PH1A 1E9BA 3VR3A 1CS4C 2IYUA 3L43A 1E2LA 1J99A 1JEEA 2RKOA 5FOUA 1ZU4A 1L7VC 2OHFA 5GJCA 4OQXA 2AK3A 4EQ6A 2B92A 1KDRA 3VR5A 1CJTC 4DVGA 3R9XA 1M6NA 4CEJA 1G5RA 1F6BA 4A6PA 2VF8A 3IPYA 1MABA 1OXSC 2QP9X 2ZROA 1NJGA 3PIRA 2W6JA 1SXJE 1F3OA 1SGWA 2XGJA 3EA5A 4CVNA 3LH5A 3L8YA 4TSFD 4B74A 1VG0B 4HI0E 3U44A 1E3MA 1DAIA 2IYWA 1KDTA 4Q1BA 4YDHB 3DOFA 2ZAOA 1DS6A 4MGIR 3TRFA 2ODBA 2JEOA 3BJIC 2AXNA 4B3DA 4KYIB 4ZCMA 1E2GA 3IEVA 1G8PA 2R62A 5FUWA 1EWRA 1UKEA 1XXHE 1TADA 1T5LA 5JWOA 2HJVA 2FSIA 1OB2A 3AF3A 1VHLA 3EXAA 3GJXC 1UPTA 3RYTC 2G0TA 5HCIA 3SFVA 2GXQA 4B44A 2Z43A 1XNJA 1R5OA 3QKSB 1ZAKA 4O25A 1Q57A 1OXVA 1YZKA 3W3AA 4N0EA 2ZRHA 3LO5A 1W36B 2GKSA 3WY9A 2OLJA 2RHMA 4LV6A 3CPJB 5HE8A 3D31A 3FMFA 4PPNA 2OBMA 4C0SA 3CNOA 2ODNA 2WM9B 1X1RA 1CJUC 3I4LA 2J9RA 4BASA 3B5JA 1X8KA 3F3YA 3GLGE 1KSHA 3QF7A 1VDZA 4DT1A 2PJZA 1XXHB 1VHTA 3G0HA 1NF3A 1J90A 2I1VB 1NSTA 1SULA 1R0YA 2ZU0C 4LJ4A 4OL0A 4XSGA 3UKDA 1VYVA 2ZM5A 3WMFA 1M2OB 1QVRA 1JJ7A 4FINA 1IN5A 3AF1A 2XOKA 1U0JA 2IYZA 3P4XA 2VO1A 1W4BA 4LJ8A 3KXKA 4NYJR 3GJ5A 1A2BA 2WWGA 2OCAA 4CGZA 1HY3A 2EU8A 5HKKD 4JSYA 3RRNA 3CPEA 2JLVA 5B57C 2NPFA 4L4UA 3AB3A 1HE1C 3BWDD 3WNBA 1U0LA 1QHYA 2RGNC 2WSSD 1N6RA 1GWNA 2X8AA 3TSWA 3R20A 4LI0A 2OCBA 4LHZA 1GRRA 1YZQA 1Z0DA 2GZAA 3LNCA 2IYTA 3QPWA 1GOTA 1KMQA 5IT5A 4MRRA 3O8CA 5JI3E 4RCZA 5DGXA 1XF9A 3QXCA 1WRBA 1XMJA 2J7PD 5KU1A 1EFRA 2BEJA 3NWJA 2YYZA 1IXRC 4PQRA 1ZUNB 1G291 4TLDA 1U8YA 4DJTA 1QHHB 3D6TB 4MYTA 5CM9C 2GA8A 2HLDD 3CIOA 2Q0HA 2CVHA 2O5VA 2ZR0A 4B2LA 3A1VA 2EFDB 2W6JD 1OV4A 3RS0A 3SBDA 2GEUA 3VKGA 2FFHA 2Q9AA 3A1UA 2QBYB 1S3SA 3VNVA 3DKPA 3IUYA 1Z6XA 4EJSA 3ICQB 2BOVA 3CWZA 4TMWA 1WF3A 2J45A 2B21A 4IEEA 1E6CA 1TQ2A 3OIWA 2YC4C 4X8MA 1SVIA 4I4LA 4LJAA 2F1IA 3H84A 3TBKA 5JCZA 3MD0A 1OXXK 2QROA 5J5CA 2F1JA 1YE8A 2A9KA 2JJ2D 2WSMA 3ZZ0A 3ECCA 4OK3A 3TR0A 4Q9IA 1ZIOA 1JPNA 4TYNA 4KYUA 2IS2A 5AJVB 5TVKA 2VP5A 4HEJA 4D2IA 1VTKA 4C0KA 1Z28A 4MGKR 4Q66C 5KTYA 2NZJA 3TKLA 4LV8B 2VHTA 5FH9A 1T3LA 2W83A 2AKYA 3EPKA 4C0BA 2ZVQX 3OZXA 2PZFA 3CB4A 3TQFA 1Z0AA 3CUEF 3AF0A 1DG1G 4LZZA 1GG2A 3DDCA 3TMKA 2H1LA 2QMOA 3KJGA 1Z6GA 1CF4A 3K53A 2P67A 1J70A 4TZ0A 1TF7A 1YR9A 2ONKA 4TTQA 4DZZA 3PR1A 4A8JC 3WXMA 2IYSA 1CR1A 3N5CA 2EFEB 2V6IA 4GZMA 4S35A 1KTVA 1E2QA 1FQJA 2HF9A 4NH0A 5DI3B 5G3ZA 5HCNA 4GOKA 2RB4A 2QBYA 5BN3A 4X8LA 5JWHA 2PZEA 5CM8B 2E9SA 2FEOA 2XSZD 3U7EB 4Q1DA 3SZRA 1KO8A 4LYJA 1HEIA 2O0JA 4TL9A 4CEHA 2BBSA 2QE7D 3VX3A 4D4JA 3WRXC 3KXLA 4LK2A 3I92A 4E5UA 3QBTA 4P3YA 1S3GA 4CYMA 3BERA 1F2TA 4QOSA 4DC9A 1LF5A 1XCPA 1E0SA 1OF1A 2BV3A 3IQXA 1SVLA 4FW9A 3GLIA 2V55B 3X2SA 3AVVA 2QN6A 1HT1E 2BJWA 3GJ0A 4YC7A 2NO1A 1Z0FA 2V4ZA 2FFQA 1QRAA 1KZGB 4FWIB 4V03A 2R44A 1OH8A 3QUSA 2Z6VA 1NJFA 3ADKA 3RRZA 3MCAA 4GOJA 4DCVA 4AC9A 1KO5A 1YZTA 4O2LA 1VG1A 4L9SA 2ZUBA 3HR8A 4W5JA 3GCGA 3SYKA 2AR7A 1TPZA 4YXWA 1JXMA 2QU8A 2REXB 3NIBA 4E22A 5JWRA 4I81A 1DE0A 2V3CC 2QAJA 4EFNA 4UNNA 2RGGA 1ZNWA 4BEBA 4DLUA 4US1R 4Z51A 1KK1A 2RGXA 4NONA 1NVVR 3BD9A 3C8UA 2NIPA 3QPVA 2G77B 3U7GA
chains in the Genus database with same CATH superfamily
4DPLA 2VK1A 4TMZA 1SPXA 4YJKA 3ZD7A 5KJ6A 3OU2A 3K9GA 3T5CA 3FUUA 2EAUA 2WJGA 4Q4AA 1K4MA 2XGOA 2XJ4A 2PT5A 4DM7A 5FEUA 2W00A 2C88A 1ZJWA 1O58A 2OO5C 2IKQA 4YFVA 3I01M 4ZP1A 1RP7A 2PBZA 1A9SA 2A9VA 1LPNA 2A0WA 2G9ZA 2J0UA 3C3CA 3RODA 3L82B 4PTLA 3Q8LA 4GL2A 1BHQ1 1SVUA 3G0DA 1CERA 3LKVA 2BEVB 4Q05A 1NFFA 4Q3OA 4TTRA 2PTGA 3OTIA 5I7SA 3D6FA 2W11A 2C99A 2ZAYA 1XDGA 4TKUA 5BUCA 1UPXA 4EJ6A 2I80A 1QB7A 3BA6A 5KTRA 2C3PA 3PEYA 3C3JA 3QKTA 3W4KA 4UM9B 2X6QA 3F7NA 5JJIA 1C50A 1GUAA 1PS8A 1SZJG 2YW2A 1DAEA 3AFIA 1XPJA 1NUTA 2C7GA 4ZCSA 1EZ1A 3Q7RA 1AUVA 1H05A 5LM3A 2VXCA 3O6VA 3F5SA 2PBRA 1GSIA 1ST2A 1WVMA 3DB2A 3A7EA 3ISVA 4GLBA 3GOHA 3VKWA 4TMKA 2QQEA 4AO7A 3OEYA 4V38A 5BPFA 1XU7A 4BKMA 2OAEA 1Z35A 3PC6A 4FLFA 3RVSA 3CVWA 1E1CB 1Q0QA 1XOIA 4R40A 2Q6LA 3URKA 4AMUA 5BUQA 4IHJA 1KEWA 3DBRB 4KO8A 2P77A 4O4LB 3G02A 2OHVA 4JSTA 1E7RA 4G5YA 3T1VA 1K8ZB 4KQIA 5JQGF 2VDWA 2VK4A 3BX1A 3IX7A 1FLVA 2GRUA 4KOEC 4KR6A 1W1UA 4ZAZA 2XWJI 2WBLC 2YW9A 4CN9A 1VGRA 4JY7A 1VHQA 1UKZA 2CDCA 1V0JA 1LB1B 1Q17A 2ZR8A 2P35A 3GV0A 1U2GC 5F2OA 2XVZA 1LZKA 4F4CA 3NGXA 3IEUA 3UW1A 1N3YA 2PFSA 3UG6A 1N32B 5E2IA 4CM9D 4NZ9A 1ADJA 4J0IA 4GP7A 1N3IA 5CVVA 3QVTA 3K6SB 4P33A 4JLNA 1UT5A 5ALSA 5BWOA 1BU8A 5FTNA 4EHKA 1N8KA 3B6KA 3ABOB 3INGA 1D1SA 4KQCA 3HBFA 1E2MA 2FF7A 1U3FA 2VYND 3B9BA 3W5HA 4CT5A 1FX0A 4NMLA 4E08A 2A5FA 4RA9A 3UICA 5IH7A 1B8VA 3AL3A 5E6RA 2JGLA 4YRAA 3PNBA 5K0BA 1V7CA 1XKLA 2BFPA 4HAWA 4M1WA 4DW8A 4W5RA 3ZDAA 1XQVA 4NICA 1QRRA 3M33A 3E53A 3KVVA 1S8NA 1W5FA 5JFTA 3W3ZB 1Z6QA 2Z58A 4WOKA 5AT1A 3SNHA 4D25A 1VLQA 3KEGA 5AD1A 4OK6A 1JHZA 1Q0SA 5KWVA 1R4MA 1RRMA 1QYXA 2QN8A 1IRXA 2R87A 1OXTA 5DBHX 1NVFA 4KE8A 2QJRA 1EM8A 2XY4A 1D6NA 5JMTA 3L6OO 5TPWA 1JAYA 1SQ5A 3M83A 1SXJD 3EAGA 2M2IA 3P9YA 5EWJA 4W5QA 3WSVA 1AXEA 5BV0A 2V5UA 4HATA 3MJEA 3TOVA 4BFWA 1IYZA 4YP1A 2SNIE 1FSZA 4DBLC 4YRKA 1YUBA 4AQ7A 2O3RA 3O21A 1GPAA 3Q9LA 2P5YA 4HLUA 3F6PA 1I6LA 4Z4CA 4B8ZA 3B2EA 1AOXA 3EWSA 1OBOA 1H6BA 2Q3MA 4D6PA 1ACMA 4ZRMA 4JLVA 5FOSA 2Q5EA 5G4KB 3PQ7A 4WERA 4RSMA 3GQBA 3D3QA 3HNPA 3MBKA 2P9EA 3QVUA 5T4HA 3ZQJA 1Y8ZA 1FZQA 5DBOA 1LSSA 1EX6A 4IIXA 1JKXA 3PX3A 3FWPA 1KK2A 1XZNA 2GFHA 2KS6A 4DEVA 5LP6C 4EWLA 1FJXA 3HCCA 4G4JA 2HF8A 2VJLA 3U4GA 1C9NA 4YROA 4YACA 4ZZ0A 4DLBA 2O14A 3JPYA 3BWYA 3FKQA 2FPUA 4D6XA 3T5AA 4R0MA 3INYA 1Q6YA 2XCUA 4M22A 1XZEA 3DF9A 3VBEA 3TL2A 1K3FA 1U7WA 1WHTA 3HDVA 1YJ8A 2C2MA 4P84A 1RP1A 2M9MA 3LOQA 1KYQA 1JEYB 1FNSA 3P2EA 4E2XA 2UXBB 3SR4A 4OU5A 5JQGB 3VHRA 3F6CA 1D2NA 2XZDA 1G3QA 4G85A 2NTNA 5LQDA 1R6UA 3UWDA 2G8LA 3BFXA 3V7NA 1XWFA 2NXWA 1MRSA 4RHFA 4BQIA 3AR7A 4H4EA 1RI4A 4P4NA 1YD7A 2ZYRA 3AETB 3KT6A 4XDYA 4XVRA 3GAFA 5EIBD 3RJTA 5M04A 1AO0A 4AKEA 3C7DB 1PW5A 1VG9B 4F8EA 4RZUA 1MGOA 1L5KA 1Z13A 3B52X 4BVEA 1LTKA 1SXIA 4EZBA 4AZ0B 3SC2B 1QC5A 2CXQA 4B6EA 4W7SA 4FU0A 2R751 1NIJA 5L6MB 1R00A 2FW7A 1RRVA 2AOWA 2HLDA 1I8TA 2CMFA 2DWOA 2V7QA 3LF1A 3PP8A 4NE2A 5MN6A 4A8JA 1QHXA 3RC3A 2Z8ZA 3B6MA 1RRPA 3NV7A 2QK4A 4ZA2A 3AERA 3VDMA 3DBHA 2PX0A 1ZS9A 3TIGA 3IMCA 1JLLA 3FZYA 4GHWA 1AS2A 1NNLA 3NBKA 4ZQHA 1XB2A 1K4KA 4D79A 5LUBA 5J4VA 4JBXA 1ID8A 1UBJS 2NN3C 4XGRA 1E3EA 1XDBA 3H5TA 2HO5A 5BQXA 1BYIA 1PX0A 1Q3KA 1QFXA 2RBEA 2QRMA 3NB0A 3Q88A 3PD7A 2NZ8A 2PLFA 3WHIA 2J67A 4DZTA 1PK7A 2ZSIA 4WOPA 4FOTA 4V3BA 1H6AA 4GRDA 4GR5A 2H4ZA 5JMPA 4F91B 1VE6A 2IBMA 3CBGA 1Z2PX 1T1JA 1PQPA 2VLBA 3IERA 4Z9BA 4CMEC 4CCSA 2QY6A 1P2DA 3DO5A 3LV8A 4QOEA 3U3MA 1KK0A 3PFKA 4DR3B 4RHEA 3LHKA 4KAAA 3Q6NA 4R5MA 4PLHA 1Z5GA 4XR4A 2E55A 3CNLA 3DEFA 4B34A 2CUZA 1KIMA 4WLEA 3Q8WA 4IQ8A 3RD5A 2IH4A 4HH0A 4J3JA 4ZVSA 1DKPA 3GF4A 1HORA 5JS6A 1UMCB 3F4KA 4U6SA 4GM0A 1Q21A 5AXBA 4EUKA 2DECA 5BVHB 5JEDA 5K0ZA 2X0KA 3KTDA 2HCRA 1RPAA 4ND8A 1NBIA 1ZG3A 3KL4A 3NHFA 3I0NA 4UTZA 5AW7A 1G9TA 3L0YA 3HU2A 1OZAA 4UVDA 5FB3A 3S70A 3VYVA 5KVCA 3L0IB 4EY5A 4YYEA 4RVHA 5HFNA 4IGFA 1DWPA 2C84A 3AW9A 3ETCA 1S1CA 1SD1A 5CVJA 1XWIA 2PLNA 1OFIA 2WSLA 2EL7A 3EQ7A 3OTOB 1SKBA 2VJOA 1CY7A 2FWPA 4MAMA 2O7QA 2BZGA 1FEZA 2CD7A 2HA0A 3LY5A 4N49A 3K72B 1H1TA 2Z9BA 4HDNA 3A0UA 4WDQA 5DP2A 5CP8A 1PNOA 1Z6AA 3ORSA 1CUGA 2C4TA 2JH9A 2E5FA 4JJZA 1JX6A 4KHZA 4YV7A 5MF6A 3QSYA 3EVNA 3KSRA 3I6ZA 4IZ6A 1DJPA 4L6IA 2XXAA 1PNVA 5KQSA 2R4UA 2CKDA 2Z5VA 1XD2B 1YIOA 3RJMA 1E1NA 3WTCA 4X92A 1N1GA 2DSNA 3LP8A 2FUCA 2XUDA 4R9RA 4K6HA 2OO5A 1UQUA 1LNQA 2EWMA 3EUFA 4FZ3A 2PLWA 3ORHA 2OUIA 2F3SA 1L7XA 1SJ9A 3EH1A 4LHVA 1EUYA 4DTIA 5EEHA 4A8JB 5AVJA 2KWIA 2OTCA 2PRKA 2Q5JA 3EF3A 4FZ5A 2OXIA 2IT1A 2AOUA 3PI7A 4TMYA 2CW5A 2VS1A 4WW0A 1EFVA 1X3LA 2YWFA 4G1MB 1MF7A 3I2IA 4KAFA 4MJXA 2DHCA 3ZU4A 1WBDA 1SQ6A 4Z4FA 4J7UA 4CETA 4B4UA 2GZDA 3NHAA 4X1OA 2VDOB 5K8UA 1YJAA 4ENVA 4PC2A 2C04A 3OQ6A 3JYQA 3OPQA 1FMLA 1G5TA 3A9SA 1DIBA 2A86A 3QWAA 4HX5A 2YWBA 4PXYA 4Y0NA 1P8AA 3DOIA 3R5KA 3EG9B 4DLAA 4S05A 3OZDA 4M1TA 2GKGA 4QUKA 1LFAA 3EBLA 1X7YA 4DLSA 3D5TA 1E2KA 3OPMA 3AO0B 1R10A 3ISJA 2B8EA 2FFRA 3AY0A 2PH5A 2O6HA 1G7TA 3HJRA 1WE2A 3EDCA 1VBNA 4N5NA 1Y6FA 5H59A 4HAVA 5KNDH 5I7RA 3F5QA 3PL5A 1OW3B 2BMDA 5CLHA 5LDGA 4EJMA 4FILA 4E0BA 1EXVA 3KAPA 4YMHA 2J48A 3BB1A 2WJWA 3MTGA 3PHLA 4NY1A 5AOAA 3TLXA 2O8FA 4F5YA 5CVTA 4J6EA 2OK7A 1EM6A 2CK3D 1ZVMA 2F1KA 3QRWA 3QXJA 3V55A 1SR8A 1T0IA 4G1CA 5SY4A 2ZSAA 4G07A 1J33A 3WLQA 5AHKA 4OH7A 3RF6A 1K0FA 5A9RA 2I3BA 3OQIB 4JHXA 1NHWA 2ZUVA 3LM8A 4JDPA 4BVHA 1KWKA 2ZJYA 2XI4A 4ENPA 4YRLA 1Z5OA 1EUQA 3RS8A 4ARSA 2QXTA 4MR8B 3F7MA 4Z9XA 3ROQA 1JXAA 2PMBA 4JUAA 4U7TB 2JLWA 3FYSA 3M6WA 1RAGA 1LNZA 4LWZA 3H97A 2Z04A 4H7IA 2WM8A 3LSTA 1CWUA 1T3HA 4IQ0A 4JB3A 4Y0VA 2G7ZA 1DG3A 5DLPA 1KOJA 1UZNA 1O5IA 2YWXA 2ZAMA 3GIDA 3ANSA 4M0MA 2ZRQA 2B8JA 4GAEA 2IU4A 4QATA 3SXUA 4CTJA 4QDUA 1XALA 3F67A 3H6HA 1T0BA 3C15C 3BDIA 1ETUA 1PT6A 1E7MA 3CWQA 1IEQA 2G76A 1E6EA 4DJDC 1DC6A 2BCEA 3UV7A 2PUTA 1BMFA 1E2JA 2YHUA 1FTWA 3FNHA 4DGQA 5A62A 5JEEA 1N5IA 2WIJA 3HO6A 5A0TA 4MK4A 1UJCA 5BY2A 3MJSA 2XGMA 3VKUA 4DR5B 5F98A 4RC9A 4DANA 2XWQA 3C3YA 1NNEA 5C80A 3L0BA 4FMDF 1VL2A 2Y1CA 4EA6A 4CKCB 3ZE8A 1EXMA 2Y6VA 1XHLA 4V0KA 5KYXA 3JQ9A 5TVGA 4R0NA 4YDRA 3NW9A 3OE1A 2J3EA 4TWZA 1DO0A 1W2GA 3Q3GE 3U7QA 2I2AA 5EESA 1R16A 4BQSA 5A4MS 4Q82A 1ILEA 3OZUA 4V1CA 1D07A 2XUGA 1VC2A 1J20A 1UJMA 4EHFA 1ZK1A 3CZCA 3RLFA 4Y3UA 1LQ2A 3V4RA 3KOYA 3D6HA 5AJXA 2IV7A 3RK0A 3T9BA 1E3DA 5L7TA 1C0PA 2O0HA 1XRLA 3AOEC 2HWUA 3TUZC 1UK9A 2CXHA 3OZWA 2FLVA 4RTQA 3E4CA 1SA0A 1Y8QB 4U1RA 3GLUA 5KWEA 2V3VA 1T9GR 3GEDA 2QP4A 4X41A 3EHEA 1HDIA 5JH7F 5H81A 1QGDA 1Y1PA 3BCUA 3GFGA 1MB3A 3I9V6 5C8DA 2GJSA 4YRDA 3GRVA 5A4IS 3IDQA 1OWOA 1QK4A 2ZR7A 3IQIX 3NI2A 3CKMA 4LZLA 2UVPB 4UQPA 3T35A 4FOOA 3OSUA 1QH8B 2PJDA 1E9AA 2D4AA 2RG7A 3FRHA 1JSZA 3KE8A 2VF7A 1EH5A 1QTNA 2Z09A 1SK8A 4QUDA 2W2KB 1GGHA 4DV6B 3A4MA 2YHIB 4HLNA 4MW2A 1IN6A 3EBPA 3H17A 2E1PA 2BMVA 4MWBA 2DPLA 2IYEA 4GVPA 1T2NA 1IWPB 2V0GA 1GQQA 4UMDA 1SZDA 4C30A 1B2LA 4KP7A 5HGXA 3ZIUA 4EY7A 1JG3A 1L7NA 3DMNA 3LUCA 3MBIA 4PLPA 4KSCA 5I8ZA 1Z63A 1AH2A 3VKVA 1JB1A 5IANA 2HLPA 3SYLA 2OMEA 1ZK4A 2J85A 3QLJA 1UJ2A 2XUOA 2ALJA 3AV3A 4F8JA 2DR0A 1GPWB 1Y82A 1QIMA 1RNLA 4DUYB 1K0UA 2L0XA 1NBEA 3FGZA 1ONPA 1E59A 1EHCA 1DQNA 1QLWA 3UWMA 4FGZA 2SHKA 1TEHA 5AKXA 5IULC 3WSWA 1NM5C 3AI2A 2RAUA 1W49A 4P34A 3RNOA 5K0GA 4WVFA 1Y4ZA 2DUWA 3IT1A 5F35A 3VJKA 3FPSA 3V2IA 2ECOA 2ODWA 1FA9A 4H6PA 5FIUA 2OWDA 1DKRA 4BFLA 1MX9A 5AI8A 4EY3A 4PSVA 1K2VN 3KJZA 3D43A 1L5GB 4GWLA 4HF7A 4EMSA 3AHEA 4MARA 3QX8A 5EJGA 1BXRB 1IXKA 4ZPXA 3AEUB 3BFKA 1AQ6A 4UXJA 1R9GA 3HH8A 4D56A 1QMGA 5KINB 4E3WA 1TTTA 4MWEA 1OR8A 2WW8A 3EGEA 2JEYA 1EUCA 5DNUA 1OI2A 4OXKA 3KZNA 4KUGA 5EYPA 1A9OA 3E3LA 2B2CA 1QBKC 2CFCA 2P4SA 2I4RA 3LD9A 4HNHA 4QVGA 4M1QA 2MCFA 1BGWA 1UXOA 4O5AA 3U49A 2J5BA 3GD7A 5IJ0B 1OFVA 2NO5A 1L3IA 3R23A 5DYTA 3TNYA 4C7VA 2R7MA 3EOZA 3OZGA 5INTA 1E79D 3KSZO 4YAEA 1C30A 4UTVA 1YR6A 1J42A 2I5PO 4GR4A 5ALGA 2X7XA 1C1YA 4DIOA 1YJXA 2HYIC 4NESA 1KVQA 2FSSA 3VR1A 2P9QA 3BK1A 4CFSA 4GYKA 5HZHA 2IYYA 4PCLA 4I3FA 4IDOA 4LE1A 5KTSA 1GZ6A 3AM1A 5JH7B 2YR0A 1C0EA 4FDLA 4Q3KA 5IHPA 1X7WA 2NT4A 3T1NA 4KXMA 2X1MA 1EDBA 1X7HA 3O1JC 1RKBA 3ETEA 3TD6A 1AURA 3DQZA 1XJQA 3OWOA 1VE9A 2BGWA 1SMKA 3RRYA 1UAYA 4REOA 5JQWA 2X6TA 4TKUB 1EE1A 3CA8A 2POCA 5HRCA 1IM2A 3WYBA 4DCUA 2FX5A 3WJAA 4LBVA 2RHOA 4RWEA 1QGOA 3B5EA 5HA5A 2IOHA 3O9MA 1UDAA 1GAJA 1M2EA 4KV9A 4NBSA 2O8DA 3EF0A 3VHLB 3GJ6A 1GLNA 2Y8EA 3ZWWA 2NSDA 5HWSA 1Z4NA 5JYEA 2G8NA 3JRNA 3TLBA 3T9DA 4D3XA 1FZTA 1NXXA 1BAPA 1KMNA 3CH4B 5TXGA 3DZBA 1CRQA 1EP3B 1ZC3A 2MYTA 5JIBA 1EVIA 4RYLA 1KNQA 1PJCA 5AW2A 3AGQA 5LZ7A 4MDHA 3SHTA 2MIIA 4BP3A 1PZMA 1TO6A 1YAHA 2FMXA 2PYZA 2REOA 2EW2A 1UEIA 3B8HA 3EVFA 3ES9A 3HFGA 3O1IC 4FHDA 1D5CA 3RK4A 1P62B 4RK1A 3I6MA 5JPIA 3TTTA 3HVJA 5C3UA 2D0IA 4MKFA 1U3GA 3AP2A 2IY9A 5D87A 1DBQA 3PPIA 4G41A 5CDFE 1Z82A 2AG5A 1QCCA 2QENA 3DZGA 3ZQ4A 4DIEA 3KQKA 3GH3A 3NHKA 3EF1A 1FE8A 4GGMX 4P1ZA 4Y2GA 3CUYA 3X0DA 1XQ6A 2C4WA 2DTDA 2F8TA 2IYVA 3AERB 2FRDA 2FN7A 4IHKA 4PRLA 1ZM9A 3FPJA 4KGVA 1ZLXA 1H0SA 2JIZD 4Q4DA 2K2WA 3B53X 1FXWF 4O8ZA 4R7GA 5EE3A 3H9UA 3DKRA 1UMCA 1CUZA 2FVXA 5BN4B 3CCCA 2PWZA 1U8ZA 4P3XA 1YZGA 3E22A 1UMKA 1Z75A 3SZOA 2NNLD 2HQSA 3HCDA 2Z5FA 4FR0A 4UEQA 1F8YA 5C34B 5CB4B 4EX6A 2HV8A 1HURA 2ZWIA 1MEOA 4OFXA 4RZIA 4WASA 2VDPB 5IN4A 1JZSA 1NYQA 1IY0A 2GCNA 5JASA 3ZWQA 3K4PA 2FX2A 3LKZA 3C7AA 4PINA 2YVAA 3A2LA 4IDBA 4B6OA 4F4HA 5GONA 1CU1A 1CVLA 1Y3DE 4KI0A 4M53A 4YCAA 1RM0A 3UMJA 1A4XA 3M6IA 1NF8A 1U0GA 1QCZA 3OQPA 2WA1A 1KDOA 1R37A 1CC1S 3QLUA 4I55A 4I5DA 1JEAA 4UEJA 2PV0A 4XAQA 4RZ2A 2ASVA 2J6IA 2AEEA 1DAHA 3N2ZB 4I55F 1KQNA 4G0OA 4CKYA 2RFLA 2BE7A 3WO0A 4WBSA 5LA6B 5JNUA 4D97A 2I6TA 4D4MA 3UIEA 4GVLA 1AKVA 3IP5A 3LHIA 1SHJA 5CFPA 1YU9A 3KM0A 4L6AA 3VR6D 4EPVA 1HUQA 1O95A 2QF7A 2FUKA 1WOMA 4AS1A 5BUSA 1EFCA 2CV0A 2B9EA 1KEKA 3BAFA 2B4KA 1XCMA 2P2ZA 4IDQA 2D8MA 3L7IA 3V5NA 2DJIA 3NAZA 4EA7A 3TKYA 5AI9A 1WETA 4J16C 1ESDA 3QUQA 1J8QA 3ROPA 5G40A 3AV0B 3LVRE 3BE5A 2OSBA 2LNDA 4JAVC 4YJ2A 3FTPA 4JYAB 4B7XA 1TKBA 4NFSA 4UD6A 3ESAA 2XZTA 1LI4A 1GNPA 6CHYA 1YR7A 1V8ZA 2R6CA 3B12A 1G8KA 3WICA 4DLPA 4F11A 5B2FA 4J0EA 4DKXA 4GDFA 3PF9A 2EEZA 2WU0A 3PHCA 4DCOA 1Y5MA 1Q7TA 3BK2A 3PXCX 3RC7A 3WHPA 2O1EA 4UVIA 1TQ8A 4QZVA 3U4QA 1TM1E 2VP4A 3OHSX 1ZISA 2BMEA 4L5JA 3A4TA 2OL4A 5FP0A 1H0RA 1P0PA 4OYYA 3BPSA 2L42A 4JI0B 3PXBA 3QVOA 1E3WB 2DLNA 1P7VA 3QKRB 1L8XA 2IC5A 5IVDA 4O5OA 2RAPA 3RBXA 1SUIA 3VR0A 4D4LA 1Z4IA 1NPYA 1FNCA 4LGMA 4GS5A 3FOAA 1NDHA 4C14A 2YHIA 3NVAA 3SX2A 1W5TA 2QQ0A 3TB4A 4A8HA 3Q8KA 2WIFA 2AMVA 3UGKA 5EHZA 1VMIA 4FOSA 4OH1A 4PHGA 1BVRA 3KFLA 1W85A 4ISCA 4R54A 4YONB 2DFVA 2X0EA 5CDYA 2ZJOA 3P0RA 2PDAA 1G3MA 2FSVA 3DV0B 3HNRA 4RA6A 2CJXA 4Z99A 1EE2A 1OIWA 1RYZA 2OG2A 2XQVA 1C7ZA 2IU0A 5IJWA 4HR7A 4CLDA 1ND6A 2HTFA 1CDOA 3AEQA 4N8EA 2YNMD 5FADA 2NVUB 3DZDA 2VHYA 3IUSA 1DAMA 1NVEA 1W0JD 3C7TA 4MB2A 3W9BA 4QLAA 1C41A 3K9QO 2PKQP 5DE3A 1T5DX 2AW3A 1DRVA 3KYJB 1CDEA 1OFHA 3MTJA 4IEIA 3P9IA 4J9UE 3W8RA 4F6RB 2ADMA 5EGNA 1JFSA 2JBAB 5BYAA 1J5EB 1GD1O 1KRWA 3PK0A 1YF3A 1Z29A 2XTMA 4FKBA 1L4FA 2CLIB 1VKHA 2H2AA 3DUWA 2YN2A 3E9RA 3ME5A 3COPA 4URUR 5C1BA 3RVPA 4L8WB 3ZHCA 3QTLA 2L82A 3LVFO 2Y77A 4MUFA 5IKEA 1JIQA 4WBNA 5DMXA 2G36A 1G42A 1MPXA 1CZLA 3RUIA 4UPEA 3QELA 4D92A 2F4VB 4LJ7A 3G0BA 5COBA 1FLAA 1CDZA 1M8PA 1ZUWA 3DLCA 5ITWA 3RBZA 3NNSA 1AA6A 1HEYA 2Q07A 2H2HA 4AMVA 1TTHA 4YI3A 3MGGA 5CCDA 1QGED 1A8SA 4CKCA 1MHPA 2C83A 4W5WA 1GCOA 4BO6A 3O4RA 5G0TA 3ZLUA 1DO8A 1VPVA 3CU5A 2O2CA 4IIHA 1Z7WA 1JSCA 1BCRA 3OM9A 4U2EA 5ER6A 3A6DA 4BFXA 4WZZA 4E11A 2H54A 3BULA 1LPOA 3BH7A 4JLKA 4PAOA 4QBIA 3ONEA 1AF4A 2H6EA 5AR1A 1F2TB 4OQZA 1ORVA 1HNXB 2L17A 4HAXA 7ADHA 2FXVA 1QHNA 3B85A 2Q6KA 5DI9A 3V8QA 4BPBA 5ICEA 4KFUA 5AW3A 1S02A 2PT9A 4II2A 2Y1FA 3EVTA 1X77A 2FN9A 4QSHA 4YJGA 4CL2A 3ZLJA 2FOLA 2PUAA 3ZDRA 4FDMA 1P17A 2WU1A 4I99A 1EGMB 5EXEA 1HR0B 1OIVA 1UPCA 4OG2A 3CRNA 1DXHA 1JHYA 4KQWA 4OB6A 4QQNA 1IWBB 2I7TA 5HUJA 4DV0B 1MJGM 3FVQA 5FBRB 5CFLA 1KOGA 3BTOA 3RANA 1XL0A 3QA3E 4YMSA 1P9RA 3K0BA 4ARVA 2B8NA 1CT9A 2ODAA 1XVIA 3T1QA 3VR5D 3GP8A 2WB4A 3O74A 3V4PB 1MB0A 3FLAA 5H1YA 4BNHA 2I9KA 2BFCB 1IDN1 3F7TA 4HAYA 4CU2A 1SRQA 3GLIB 1V41E 4INOA 3X1DA 1M8JA 2Z3WA 3LG2A 1T8RA 1LJLA 1JYSA 2I4TA 2OBYA 4OKIA 2ZJ7A 4JCCA 4TWJA 1D4FA 3RHZA 1LZLA 2R0QC 4BZZA 3K31A 4V0RA 2XEDA 4F21A 2ZZKA 3EZLA 3L8CA 2RCNA 4BNJA 3TSYA 2VYCA 4IEFB 1GT91 5CFQA 4DR1B 1RKUA 1KOFA 3BMCA 2Q27A 3KAKA 4KQHA 4KUEA 1VE1A 1E6LA 2IA5A 1UPUA 3DOUA 3DDHA 3QU4A 2DPMA 3RYFA 3TI7A 1U5BA 3ZWNA 4C7OB 4LHXA 4PU0A 3M8KA 4HP8A 3SGLA 4JYCA 1LA2A 3F3MA 4IVNA 3K30A 4BGIA 5CFZA 3KDSE 2YZKA 2ZE5A 4KITB 3BHJA 4KI7A 4DXHA 2F00A 4DDWA 1RMYA 4DR4B 1HH4A 4MUAA 1EJ0A 4DEYA 1OJ7A 1BIFA 2X14A 1RDFA 5BP7A 2BI7A 2G7MC 4C4RA 3HABA 1SU4A 3A3KA 4FGJA 5EE1A 4ZK2A 1ZFNA 3USZA 4K05A 1L9XA 1QR6A 2AOUB 1QFYA 3EYAA 1P3DA 1PFQA 4LECA 5JD4A 2IHBA 3D0KA 4FKMA 1MRZA 1H42A 4K86A 3MGKA 2DWCA 3HLTA 4L4SA 4MW7A 3U40A 1G8SA 4NXNB 3N0RA 1ONOA 4LY9A 1EVQA 1NI4A 3RJ9A 5FUMA 1YHNA 5IAGA 2XLCA 5KHAA 1DMRA 2QTFA 5LD2B 4JZYA 3M5DA 3WADA 1RE0A 1W4AA 1YQ9A 1P72A 1FIUA 3IOYA 1U3CA 3WVNA 1JKMA 3C4VA 4L78A 3T95A 3PRKE 3SYRA 4L2IB 4S04A 3EW9A 3QG1A 1B73A 3IOEA 3ESXA 1O0SA 2X3UA 4QE3A 2FFJA 3U13A 4D5GA 4A6XA 2BKEA 3VDXA 2QAGC 5BOSA 1BKDR 2RC6A 4HWGA 1V1MA 2A1UA 3EXHB 2V65A 1POWA 5KDDA 4LFBB 1DAPA 1DFIA 4Z0PA 2EGGA 1DG9A 2WWIA 3HGQA 4KN9S 4YQZA 3U1BA 4PBTA 3C3PA 5B1DA 1CBUA 2EX1A 2IIVA 3FMPB 3I09A 1AQIA 3T9CA 5JATA 3VU9B 1P1IA 2PS1A 3JATB 1OX5A 3ODGA 1NL3A 3QFHA 4LJ5A 1USGA 4PNZA 4RF4A 3WZLA 5IAJA 2QS9A 1H2XA 1JR3A 1J9ZA 1DC8A 2X4DA 2WZQA 2GESA 2EWVA 2ET6A 3DOHA 2ERCA 3GG9A 2IXEA 2ZCVA 1N7HA 3LUBA 4GRIA 3V3TA 4MV5A 3N58A 3MAAC 5JISA 1DAFA 3P8ZA 3AWIA 1PCXA 4MKIA 4NULA 2XZOA 4KLAA 3BYZA 5SZHB 3VU3A 5JBNA 3IT3A 4ZT4A 1FU7A 2WJ4A 4GMDA 3RIYA 3TJMA 4DYVA 3CGGA 1Q0HA 3EFOB 3DO6A 5DCLA 2IU6A 1DAGA 1UP6A 3MWKA 3JX9A 3OJCA 5T8KC 2PRIA 4COKA 1MU0A 1XXLA 2GPAA 4BP8A 4YPOA 2O5CA 5JLAA 3UMVA 1MAUA 3AEKB 1JE1A 5F23A 2H0QA 2J9YB 3KLMX 4U2KA 3UAZA 1Z2OX 4A8PA 2QD4A 1IHYA 3QF4A 3ZHUA 1I7DA 1MB9A 4PZEA 1M34B 3ZN2A 1XTRA 2WQZA 1WCWA 3ORQA 5G41A 1BE0A 1P4JA 1AK2A 1IXYA 3H18A 3OCWA 3NOXA 3OLVA 2Q1TA 2F7SA 3FBTA 1H8HD 1J8MF 3NKVA 5JCXA 4ZTUB 2D2EA 2D2XA 1ND5A 3FUCA 3STYA 1NW6A 2IPXA 3C3KA 1I3OA 5FA6A 5F7XA 5F4BA 4ALJA 1P1FA 4N54A 5DHSA 3NDRA 5C2JB 1MV8A 2AG1A 3I9JA 4FS8A 3A8TA 2WEKA 1ZI9A 3L4SO 3MRTA 3OJXA 4WESB 1R6XA 2GN8A 3WBBA 2C7QA 3SR3A 5AW5A 2RGCA 1KMIY 3ANLA 2A5JA 5FPTA 3V1KA 3AUAA 5DYYA 4YT8A 3CZ9A 3DEAA 3LNTA 3S27A 2JH3A 3B78A 3SJZA 1SQGA 2YCLA 2V6JA 3RFVA 4NZMA 4KJZA 1SCAA 3GMTA 1XD9A 2QG6A 1KQPA 4MS1B 2AZXA 4BB6A 2X8WA 2I6GA 2D1TA 4KFSA 1Q2XA 3OC0A 4ER6A 1TF5A 4I5FA 3ID6C 3ABIA 1ZINA 4D0RA 1II0A 2JLSA 2B69A 2DU8A 2VXYA 5CAEB 1B93A 2BF4A 4DA6A 1SB8A 1WX1A 2CLOB 1YB6A 4QPCA 3PJFA 4BO5A 2C5SA 1WMDA 3DTNA 3TSOA 5IDQA 5LWHA 4QPDA 3IAXA 4M8NE 3THWB 1BVUA 1P19A 3WQHA 2BM9A 3FDZA 2IRWA 3PPYA 1UT8A 1BKSB 3V34A 4S1OA 1WD7A 5IPFA 3AL2A 3VGPA 4EITA 4LY6A 3VR6A 1SXJB 3L8ZA 1YNSA 4IDGA 5M34A 1D0IA 4UU0A 2QE6A 8GPBA 2HW8A 3EPHA 4O4IF 1NRXA 2G63A 3MQ2A 3U4AA 2WHEA 3FJOA 2BFBB 2Y0PA 1YVRA 4KQXA 2WHXA 3KOZA 5ALKA 1MV5A 2JGDB 1NE7A 1HG0A 3HBJA 4MWDA 3FHJA 4QGAA 4X3OA 1K6MA 1SCQA 3IVCA 3D02A 5KKAA 3D6MA 4B3GA 1ID1A 1JV2B 3R3YA 4NABA 1Z0ZA 2ZB8A 1RSZA 4U7WA 1FDWA 4GT1A 1JWLA 2C1EA 3OQVA 3ZEIA 4RDCA 3GLFB 4F4FA 4LCBA 2LR0A 2X6RA 1ZMRA 4G4GA 4FDUA 4JS0A 4IF6A 1YGYA 4DB4A 2IS4A 4NLLA 1YONA 2ZYGA 1RYEA 2IXTA 1BJRE 2D06A 4FD3A 3RVKA 4B3SB 2PS3A 3VNUA 1R5JA 3UKOA 2HLNA 4CIAA 3T7AA 2IE0A 3AK4A 1LC3A 3LC7O 1UF9A 3UWOA 2P6RA 1OI7A 5K1ZA 5HKBA 1JDTA 3KKMA 4R01A 3CNBA 1K97A 5B12A 4PLGA 4TTAA 1MC1A 3O4GA 3PD0A 5F51A 2V7WA 5CA1A 3ST7A 3OX2A 1XBTA 1PZGA 3K8OE 5EJ8A 3ANNA 4F4UA 2VR1A 2H7XA 3R7BA 3TQHA 1DBVO 2HPZA 3EDYA 3RC8A 2XNDA 1GAXA 3USES 4RKRA 2XF2A 1UJBA 3HPQA 3TLKA 1E60A 1NG1A 1I80A 1THGA 3PBKA 4MWTA 1Y8AA 3ND7A 4R3UC 2WJAA 3H5RA 4JP8A 4PSKA 3IP3A 1AMUA 3HVHA 3LQ2A 5ETJA 3SQXA 4RHYA 1IBCA 4MRPA 3R0VA 2WM2A 3OBIA 1PJQA 2GQ0A 3QWHA 4M83A 2PO7A 5TQ0B 1POXA 1UANA 2P5SA 1C29B 1J1IA 1EG7A 3OJ0A 2WWVD 4ZI3A 1RWKA 2XR1A 3AHIA 4MVCA 5CH5A 4WCFC 5BW6B 2ATIA 1N5RA 3IJRA 2CUNA 4KVFA 2H1RA 1TAGA 1R0ZA 3GXBA 3G2MA 2AFIB 2J6BA 5CITA 3EZYA 4PIMA 4GLOA 4PBSA 4HDQB 4X91A 5DDIP 1SA0B 2JVKA 4FQ5A 5EXSA 3M6AA 4W9RA 4DN6A 2AX4A 2ID8A 5BQFA 4CQMB 4LOHA 2BI4A 2FJ0A 3GLRA 2PVSA 4DLNA 3HMQA 2OPHA 3RV4A 4ZQFA 2HSJA 1UXGA 1CEYA 3DA8A 2B0JA 4LXQA 4AZTA 1Q2UA 5ITZA 4QUAA 1P5RA 2XNJA 3QG5A 1BZYA 4ROSA 4FB4A 1IU9A 1JJBA 1OKKA 6REQB 1Q3HA 2JI9A 1R2QA 2QT1A 1N9ZA 3T1OA 3AUYA 2J1LA 1E2IA 4H7PA 5LYYA 3L4KA 3KQVA 4IF4A 4OHVA 4CF7A 4X44A 1G9XA 3AUTA 1FSSA 3CF4G 3ZOKA 4RIHA 2CXRA 4ARZA 1JR3D 2UV8A 1RYMA 2PMWB 1VQ1A 2OLEA 1Z2EA 3UAYA 4BLSA 3NTLA 5EJ4A 1RQGA 3QWIA 1U9JA 4FC6A 3X1YA 5J47A 2FQ1A 3RFFA 1YS7A 4FFWA 2PKQO 3OMLA 1V16A 1NBMD 1I3KA 1NR7A 2IOYA 1NVMB 1DTSA 1E32A 3PQCA 2H65A 4AG6A 2OD7A 3C0KA 3MS7A 4OOEA 2D2VA 3I64A 1L4UA 4RW0A 2JFWA 5K3SA 2VEDA 1ORIA 2CHVA 3IO3A 5G0SA 3MWLA 4RJIA 5F73A 3WKCA 3R9KA 5LMUB 1MA0A 2ZANA 3MTEA 4H0CA 4I9GA 2XTZA 4KYTA 4UAJA 2WTUA 1US8B 1Q7CA 2XITA 4WWHA 4E03A 1U9IA 5CX1B 4F12A 4D3ZA 2GR9A 3AHFA 4WFIA 2JLRA 4LG1A 2QGZA 1V2GA 3AVOA 3VZBA 4GUDA 3SS9X 2YL2A 3D81A 1QSGA 4AL4A 4DQDA 4YMTA 2EJBA 4DILA 3D4BA 2DWPA 1JNYA 1IB0A 3ADPA 3G13A 3FOCA 1C9DB 5CNMA 3VA7A 3HU1A 1SB9A 4RVGA 2JGEA 4HNAA 4E5SA 5IEJA 1LK0A 2N3ZA 1E9FA 3OZVA 4V0QA 5GIOE 4XASA 2BP7A 2FAXA 1X94A 2GYYA 5EJ5A 5FCDA 1OT3A 5C4IA 2IZ7A 2IHKA 3S7ZA 4RNCA 1EVJA 2ENUA 1DXOA 3FNRA 4P4GA 4ZYZA 4F3KA 3HL4A 4NV3A 4HB3A 2EFCB 3CPSA 3DJYA 2WAXA 1SOVA 3FFAA 1X9GA 2XCQA 3L1IA 3QVKA 1HETA 1WULS 4NFYA 4EB0A 1LI5A 4RTLA 2HIMA 3LC2O 4IVRA 3TSCA 3VU8A 3IYLW 2HBQA 2REQA 4P5EA 5DTJA 4XUDA 2ZM6B 3CSDA 2FWIA 2VF4X 4OP2A 1I01A 2XNHA 2RHDA 4IXDA 4Z9FA 5BN5A 3NASA 3AB7A 4IMIB 4FUTA 3OLYA 3FA2A<