3U3JA

Crystal structure of hsult1a1 bound to pap
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
287
structure length
287
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3jA00
5LPNA 1ZMXA 4RFSA 1W4AA 2R65A 3C7KA 2ONJA 2BBTA 3BB4A 4CGZA 2VBCA 1ZP6A 3IPYA 4CIDA 2R6GA 1QHHA 3B1YA 2XXAA 4XD7A 1L4YA 1Z08A 1R6BX 4IDPA 4O2LA 5AJXA 5FBWB 3ZVNA 4F4CA 2FMXA 2R62A 3CF6R 1E1QA 1GVNB 1LF5A 1E6CA 2HCJB 2VA8A 1G5PA 1U8YA 2BHRA 4R2HA 1RRFA 2YYZA 2V1XA 821PA 3KQLA 1Z07A 4OKSA 2ZYTX 1KDRA 3REFA 2BIFA 4RD1A 4Y0AA 1JJ7A 2IYLD 1M74A 2XNDD 3TW8B 3FB4A 621PA 4OHWA 2DFLA 4MRPA 3RS0A 5JHGB 3IO5A 2QP4A 2QMUA 2CCKA 2VSFA 2WKPA 2QRZA 1UKYA 4DDUA 2J0UA 1IY1A 3GFTA 3GLGA 4V0MA 5IK2D 5JEEA 2OXRA 5JLJA 2IYSA 1VHTA 2LKCA 4HAWA 1OV4A 3FMOB 1E2QA 2WJIA 4IFBA 4F91B 1WBDA 4JLBA 3LW8A 4Q4LA 2ZVQX 1UKZA 2PEYA 3U6BA 4JLKA 5CJ2A 3UG6A 2P65A 3VR6A 2XJ4A 4HB2A 5CJPA 3K0CA 1MABB 2ZROA 5FPSA 4AG6A 4I1VA 2JA1A 2QROA 3LY5A 2IEYA 5E7IA 1U99A 2R8RA 3NEJA 2QAJA 4BFTA 1HEIA 4M1YA 4BEBA 1ZINA 4JLDA 1JR3D 4Q7LA 4OQFA 4V0OA 3UMRA 3K8YA 1GOTA 3QKRB 5TXGA 2FH5B 3QG5A 1KSGA 3SBEA 2OFXA 1Q1EA 1ZUHA 3I5YA 1JQLB 2ORIA 4DLXA 2WV9A 1E32A 4IOMA 1XPUA 3ZS8A 5JZVA 5F9HA 3A37A 2CEAA 4QL3A 4HI0E 3U3KA 2JDIA 3B7GA 1EFRA 4TMVA 4AC9A 2VRWA 2BWJA 1U0HC 2AXNA 2G0TA 4IXNA 1E2LA 2D3WA 2REBA 3L0SA 4RSGA 3SQWA 4EFMA 1AGPA 1SXJE 2B92A 2PT7A 4Q48A 3ND8A 1XTKA 4QGFA 5DISB 1VYUA 5DN6D 1MO3A 3SYLA 5D3QA 2UKDA 2VPPA 1JB1A 3ZYCA 1TU4A 2ZYUX 1UFQA 5TARA 4G1UC 2H92A 4PC3A 1P4SA 3P27A 2JLZA 1S2MA 2HCBA 5GVSA 3BH7A 4MYUA 3VU9B 1DAMA 1DG1G 3KJHA 2ZIAA 3FKSA 4XVQA 3BFXA 3WNDA 2R6AA 1CR2A 4ZKDA 2O0JA 2VHUA 4BFSA 3THOA 1KI1A 4A8JB 5L3QB 1Z2CA 5AUNB 4QNMA 1KO4A 1ZM9A 1YKSA 2J7PD 2V4ZA 2WPDD 2G77B 3C8UA 4IEIA 1QG4A 4ZDWA 5FBVB 3T1VA 3QKUA 3CONA 1G17A 3C5HA 2IS4A 1DADA 1S3GA 1KMHB 4ZPXA 1YJ5A 2XSZA 4QG7A 1WF3A 4GOXA 5KPDA 5F3WB 2B21A 1L8QA 4WZ6A 4QOSA 2F1JA 2BBSA 4EPVA 1SXJB 2ZRJA 3ZZUA 1JXMA 3L43A 3I73A 4BFUA 5J4KA 1E9FA 4NCNA 4LRWA 2RGNA 1M2OB 2C9OA 3B6EA 3AVWA 3AKYA 3SHWA 1E0KA 4GDFA 2FFQA 4FN5A 4Q47A 3CNNA 1NG1A 1KKMA 4RZ3A 4AYWA 4HAXA 2AN9A 4ITRC 3L0IB 4GI7A 5EE0A 4L9WA 4MRVA 2FSHA 5JSZA 5A4JA 1FUUA 3Q5DA 1NIPA 5G3ZA 3RANA 2QM8A 1KOFA 1E2KA 2OCBA 3AF4A 4QGHA 5FI0B 4E07A 1R0ZA 4LJ7A 3BERA 4N0EA 2QMHA 2QA5A 1QF9A 2BVNA 3Q5EA 3A4NA 4BZXA 2W0MA 5SZHB 1R7RA 4PHFA 3X1XA 1FMLA 3BD9A 1QRAA 2OHFA 2XJ9A 2ZJZA 4L5BA 4M9ZA 3WHKA 5EP4A 2J59A 3HJNA 4HAZA 1CU1A 2CL7X 3KKPA 4ZV4A 3EX7C 1GKIA 1U9IC 2WKRA 1DG3A 2EWWA 2XTNA 5CDFE 1T3SA 3EIQA 4GNKA 3G5UA 4M1KA 1KDPA 3P4YA 4FCWA 3TAHA 5FFMA 1KK3A 2EU8A 2GCNA 5CLQA 1J7KA 4IFEA 2QQ0A 3ONWA 2Q3FA 1RW4A 4D81A 2WJJA 1H8HD 4ASUD 4DBLC 4KJZA 3GLIE 3NVAA 4IKEA 2IYUA 3RABA 4H9GA 1OXVA 2FSIA 2Q3HA 2VL7A 3H2YA 2F55A 2ZJAA 1ZUNB 3NIBA 3A1SA 4K46A 4BLTA 1NRJB 4YDHB 5KDOA 1PV4A 2XTZA 1LW7A 4PZZA 1G3UA 4HDCA 4H1UA 3DVLA 4JZKA 4KCGA 1E2DA 1N6RA 1NMXA 3OFND 4D4MA 4OQNA 4LDJA 2FGKA 221PA 4MRNA 1GNPA 4JJKA 4A6XA 3OEED 3GJ0A 4ERNA 1OB5A 2ZQ5A 3AVPA 2X1VA 3BK7A 4A1FA 2BMEA 3T5GA 3HU1A 4M1MA 4JVSB 6Q21A 1XXHA 1JEEA 4MKFA 1KGDA 4MGYR 3M1IA 5CITA 1G5RA 1IN8A 2GJAA 2OFWA 2F1HA 2QY9A 3D31A 3FMPB 1AN0A 2J3EA 2GXSA 1GM5A 2J46A 4KAXA 4TL6A 1IN5A 1Z6TA 1W48A 3ETLA 2GZDA 4RCYA 3NC1C 2IS1A 4LHZA 2C8VA 4NHOA 4L4UA 3EPHA 3EC2A 5JI2E 3GLIB 1OT3A 5FPTA 1NSTA 1A82A 1QHIA 2HJGA 2J9RA 2QE7D 2F7SA 4PAMA 3REGA 3X2SA 4EPWA 2BOVA 1LS1A 1NN0A 5C1BA 1G291 1KI2A 3TVTA 2ONKA 2KWIA 4ESVA 3GJ6A 1EFCA 3MD0A 3A6PC 4CEHB 3EXAA 1IONA 4BRWA 3LQRA 5B2ZA 4A4DA 4WZBE 1UF9A 4EPXA 4W5HA 4AYXA 3AQ4A 4M1WA 4FMCB 4C7OB 1FUKA 4EDHA 1YZQA 3TLXA 4D26A 2ZI7A 2B7CA 1N6KA 1ZNWA 3U3OA 4US2R 5KSZA 1OLOA 4R9UC 4EPTA 1P75A 4Z1MD 1G16A 1UBFA 4PO9A 3OF5A 5CLLA 5BN4A 2GXUA 4HZUB 2KJQA 1ZAKA 3SU8A 4V0LA 3AEZA 4B3FX 3KQNA 4HATA 5HCNA 4TTPA 5FPYA 4DCVA 3V4RA 2AX4A 1SQ5A 1E2IA 1HYQA 4P4TA 3UMFA 2ANCA 1W47A 3TRFA 2J0QA 5JEDA 3C16C 4PAQA 1KDTA 5CM9C 2KBFA 1G7RA 2YVUA 2IS2A 3P1JA 1XFAA 1X8KA 3SJCA 2OILA 2A5JA 4AWXA 2ZS9A 2GRJA 1XEWX 1IXZA 1D2NA 4HLQB 1NP6A 3A4MA 2HEIA 2LWIA 5B58C 2WKQA 4KFSA 2IBMA 4P31A 4R2IA 1QVAA 4D4JA 3DMNA 4YONB 5EXTA 4LYAA 2UVQA 2DFNA 3F0TA 4PSKA 3D8BA 3CWZA 3I5XA 1YZGA 2H17A 2VQSA 4MYTA 3BJIC 3FTQA 5ANRB 5AUQA 4Q4JB 3EC1A 2NPIA 3HP1A 5HKKD 4FD2A 2IUTA 5EQTA 1N5LA 5KHOC 2J87A 2QMEA 4TLAA 3LNCA 1OH5A 3IBGA 1XEFA 2OAQ1 1B0UA 1E4YA 4FWIB 3R9WA 4KV9A 2QRNA 4FMBB 1NN1A 1E0SA 3MWJA 3UPUA 2FV8A 2PCJA 2VF7A 1LFDB 4RD4A 5C4GB 2Q9AA 3N2IA 1XMVA 1WQ1R 2VP5A 3WYFA 2WSSD 4DEYA 5EUQB 4Q9LA 3FHCB 1XEXB 2R6DA 4Q19A 3IQWA 2OESA 1R5NA 3SJBA 1E2GA 2BEJA 3NKVA 4LI0A 2RGAA 4TN1A 2NGRA 3KKOA 3K9HA 2VHCA 5E7JA 2QAGA 4RD2A 5LD2B 4FXPA 4JKYA 2D62A 1W7AA 1Z0AA 2BC9A 4Q4HA 3A36A 4Z8YA 4LJ5A 4PAOA 4RVCA 2V9PA 5D3MB 1FX0B 3M4YA 4M1OA 4PR0A 2CNWD 4YDSA 2Z5FA 2CDNA 4RZUA 4BZQA 1E99A 2MSCB 5JI3E 3VU9A 1UAAA 1TEXA 4QBHA 2UZ3A 5LB2A 1U98A 4JL8A 3DL0A 4P4SB 3WMEA 5JHHB 1LS6A 2PEZA 5H1YA 4ZKEA 3SZRA 1GL7A 1OXSC 4O25A 1F48A 3PENA 3P20A 5EZ5A 5C2JB 1BO6A 1E2FA 1RZ3A 1VCIA 1NLYA 4C0BA 4DWJA 4XTCS 2FPMA 4LC1A 1GKUB 4HLUC 3NG1A 4IVRA 3O47A 1KMHA 4IOJA 3BB3A 3RRYA 4FMDB 4XWAA 1ZC3A 5JECA 2AHOA 2QM7A 1SXJA 5TV2A 1C1YA 2H1LA 2JLSA 4MKIA 2ZSEA 4KFUA 3P32A 3K09C 3PG5A 3TSOA 3U5ZB 1SULA 4EQ6A 1EWQA 4B33A 1JJVA 4KU4A 2GBLA 2O8FB 3NHBA 1JI0A 421PA 4YMTA 1JQJC 1WBBA 1W0KD 4FMCF 2GJKA 5H8WA 4DVGA 2Z4SA 3PUWA 3P26A 2V6JA 1SVMA 1VCNA 3Q8XB 4WBSA 3UG7A 2NMVA 2LKDA 4DDTA 4M1TA 4D82A 3B1XA 4Z54A 1OH7A 3SNHA 1KI4A 4GMDA 4II7A 1KI3A 4NTZA 4W7SA 1E1RD 1XD8A 4C3ZA 4TYYA 1CLUA 4Q00A 3AB3A 3SDZA 2V6IA 2Z43A 1TUIA 3OHMA 1XX6A 3PEUA 4LHVA 3C15C 3B60A 3WMGA 2P0EA 3R8FA 1GWNA 3H1TA 4NBSA 2DBYA 4MRRA 3BE4A 4TSFA 1RRPA 4HUQA 3OAAA 4V02A 4EIWA 1R0YA 4AG5A 2ORVA 3DZDA 2F9MA 3BC1A 3B1ZA 1IAQA 4Y0VA 4MGZR 2QZ4A 2IHBA 1IN4A 1QHYA 3SI7A 4OI1A 4NP6A 2ODNA 3TR5A 4BLPA 4BUJA 3TNFA 4RJLA 4TL7A 3VNVA 3CUEF 3K0AA 1QHXA 1OXUA 1G7SA 3WP1B 1X1SA 2VYFA 2YWGA 2WWXA 1WP9A 4B6FA 2KBEA 1CXZA 2ZI3A 5SZIA 2LCFA 5GJWC 4BASA 3SC3A 1KJZA 3R20A 1G8HA 2PCLA 1YR7A 3MCAA 3R9IA 1FTSA 1PZNA 1W36B 2QNRA 4CW7A 1CP2A 2R2AA 3EZ7A 5JFGA 1YR9A 2W2VA 1Z22A 4G0NA 4C9BA 1D9ZA 4W5JA 3EIEA 4LPKA 1II0A 2ZSBA 1U0LA 2GA8A 2Z4RA 2GAOA 2FX3A 1MR3F 1NN3A 1FW6A 3PJRA 2P5SA 1ZU5A 1GDDA 2C9YA 3R7WB 3BBPA 3R9XA 3RRMA 3RWOA 5J4HA 5CK4A 2JIZD 4C0LA 3NDBB 2QEQA 2GAAA 2W2TA 1P9WA 1Q12A 2EVWX 2ZYWX 3GJ7A 5CDFA 1GITA 1R10A 3L8YA 4W9MC 2BDTA 3QKSB 3K0EA 1ZW6A 3U4QB 2IUUA 4FWTA 4XIGS 4KODA 2CXXA 3MWKA 3GLHA 1Z8FA 2B7BA 4LHXA 5SZJA 3K9NA 2W6IA 4IW3B 3V00A 4KVGA 2O8EA 1VG0B 1EGAA 2JLQA 5DYGA 1OH6A 3T1OA 3GLIA 2C98A 3KJIA 3TR0A 2WOOA 3AVXA 5GVRA 1R8SA 4AKEA 2ZVPX 1W46A 5BW8A 1E2HA 4F7WA 3S1AB 1QVRA 1D9XA 1U81A 2C95A 2Q3MA 3EZ2A 4TWZA 2IT1A 4C4PA 3EPJA 4GOKA 3ZQ6A 4B44A 4CEHA 3VKWA 1E96A 2GEUA 3TKLA 5B64A 5H68A 3DDCA 4DEXA 5K8UA 1R4AA 3MRSA 3VHXA 2WJYA 2HXSA 4OQXA 5FL7A 2QBYB 1FZQA 4JMPA 1Z6XA 4KYIB 5A5GA 1PUJA 2ERYA 4GP6A 3CPEA 2CVHA 3GLFB 1XMIA 5FOSA 3V9PA 4FMDF 1EFTA 2WWWA 3UKDA 4JT2A 4ABYA 2AL7A 2ERXA 4HZUA 2OV2A 4I4LA 5DI3B 1ZVQA 2AFHE 1JR6A 3FFBA 2RHMA 4A0RA 2I1VB 2FU5C 2ZYVX 4WOPA 4Q1EA 4LV6A 1ZD8A 1KI9A 4QRHA 1O3YA 1IJFA 1MO4A 1OKKD 2IYXA 2WOJA 3WMFA 1NVUQ 1WE2A 2ZRPA 3RS4A 1ZCAA 2ZJ8A 4ESHA 1GL9B 2FFAA 3U61B 1W2GA 2E9SA 2OXCA 4MUBA 5CM8B 1N6LA 5GADl 1CR1A 2PZFA 3BRWD 2G88A 1SVOA 3CRVA 3KUCA 1FP7A 3L82B 2J45A 3CLVA 4LHYA 5FBRB 4ARZA 2RGBA 1Z0JA 2Z83A 3AF1A 4KFRA 1TQ6A 4DCUA 1ESNA 2QPOA 2C03A 4HAVA 1FQJA 4LJAA 1GKYA 2IYQA 2OBNA 2VIIA 3SHFA 4DZZA 1E9BA 1FTNA 1RIFA 2RAPA 2YZ2A 2HLDD 3E2IA 4ZI2A 2WBLC 2ZXUA 3ZLJA 5AJYA 3X1DA 1YZKA 4YXWD 1BYIA 2CK3A 4MH0R 3CKLA 2RGEA 2ZJYA 4MYHA 1T0HB 3FMFA 3KJGA 1S0UA 1N5JA 1WRBA 2XZLA 1QHGA 1AZSC 1J2JA 1TEVA 3TSWA 1CRPA 2IYVA 2BCGY 4GRAA 1Q1BA 2EFDB 3RS3A 2CBZA 1JNYA 5AK0A 1UM8A 4PSAA 4F93B 2N46A 5CYPA 2DFKB 2DHRA 1IN6A 1XEXA 3W5JA 2A5FA 4AKGA 1K6MA 5FUVA 5C18A 5FTKA 4A36A 1QG2A 1S1CA 4PSVA 5DIFA 2JASA 1QHNA 1TF7A 1W49A 2IS6A 1ZIOA 3NWJA 4EAQA 2ZRMA 1F60A 3OEHD 1SVSA 1NLFA 3LBNA 2XAUA 1DELA 1TQ2A 4FW9A 3VR3A 1XJCA 1FP6A 1YHNA 2MSDB 3ZD7A 1FX0A 2N1BA 5BYJA 5L3RA 2YC2C 1I4LD 2P3SA 4PZLA 3QF4A 3ZS9A 2DWOA 4CEJB 2RGXA 1NMZA 2OM2A 3ZVLA 1X86B 2DCUA 1W36D 3AP3A 4TQAA 1T3HA 2FN4A 4OHZA 5IF9A 1FFHA 2JCSA 4JYBA 5C46F 4M22A 2XEXA 4HZIA 4URYR 2F1IA 3SFZA 4B3BA 2V8OA 2C78A 4BWYA 2WAYA 4NE2A 4NYJQ 4DT1B 1DARA 4Q1AA 3U44B 4PPQA 5EP1A 1D6JA 3D3QA 4NCKA 1W36C 3A1VA 3BH6A 3K70D 3RS7A 1N5IA 4LY6A 1RYFA 2O0KA 1E9SA 5FI1B 4H1VA 1W44A 5HZKA 1TUEA 5B57C 2WJHA 3K70C 4EJSB 4OQMA 2NO0A 3PUYA 3MAAC 4B3XA 3HYTA 2D06A 2QSYA 4E5UA 4BRUA 1HURA 1FQKA 1NJGA 5GJVC 3RC8A 3UATA 3C5CA 3KXIA 2F6RA 3CZQA 3I4LA 1Z63A 1OB2A 4Z51A 4QXAA 3SJAA 721PA 4ZIRB 1DO2A 4PC2A 3WBJA 1U0JA 2WZQA 3W8NA 3OIVA 3VX3A 4UNRA 1X8JA 1Q1QA 1GUAA 2YINC 1Q1ZA 4DLWA 5K8TA 2J41A 2Z6VA 3TQFA 3ASYA 2OZEA 3IEVA 2F1RA 5EZ6B 5KYKA 2XGJA 1YZLA 2O8BB 1VMAA 2OG2A 4OK6A 3RSOA 2XNDA 4BZPA 4BECA 1UBEA 2R6CA 2Q9BA 4AY2A 2PJZA 3LAWA 2XOKD 4M2LA 5DE3A 4B48A 2IXEA 2G83A 4NYIQ 4AK9A 1AM4D 1UJ2A 2CL6X 2Y8EA 3AF2A 1XD2A 2GCPA 4JS0A 4I1UA 2ECKA 5IK2A 2GJ8A 3B78A 1XWIA 1Z6YA 3ICEA 3A1TA 1F2UA 4TYQA 2IWRA 3KQHA 2BEKA 3BGWA 4B47A 3THXB 4L8GA 4URXR 1E2PA 4Q9KA 2ZREA 3UXMA 2ZE5A 2WWHA 4O0MA 3BXZA 4C0AC 1W4RA 2VHQA 1GSIA 1WDTA 3EZ9A 5KUTA 2IWHA 5B30A 2MMGA 1JR3A 3CH4B 1TMKA 3EA0A 2F3RA 4M8NE 2KB0A 1S3SA 2RHDA 3B2EA 1Z3IX 2QQEA 4LYFA 4L15A 5EJEA 1RVDA 2BM1A 1T5LA 1X3SA 1NIJA 2VLIA 3VFDA 4DCNA 4Q4AB 2ZSFA 4HDQB 3ZQJA 4TLDA 4M53A 3LH5A 2ZRHA 2PL3A 1AKYA 1EG7A 1NJFA 1S1MA 2K5UA 3IILA 4MKGA 4JL6A 4LV8B 3U7GA 3THYA 3IPXA 5EXPA 1J99A 2G1KA 5TDHA 3RWMB 5FTLA 4LK2A 1H65A 3KZ1E 1MO5A 5L3SB 5AJZA 4DUGD 3QKSA 3K0SA 2FGJA 2IF0A 3U4QA 3FMIA 1C9KA 4JLVA 1WA5A 3QY0A 1R8QA 1PLKA 5DN6A 1YR8A 4V0NA 3VTKA 5E3HA 5KPJA 1XTRA 1XNJA 3Q7QA 2WTUA 5JWOA 3GJ3A 2XB2A 1ZD9A 3ADBA 1OH8A 3BFKA 2IYTA 3K9LA 2ASEA 5EP3A 3AKEA 4ZCLA 1XEWY 2YHSA 3W3ZB 1A4RA 3IKJA 3TUIC 2KSQA 1VIAA 3CPHA 3Q3JB 4C2UA 2EFCB 1G8YA 4R7ZA 4BLQA 2ZRAA 1G8GA 2GCOB 5J47A 2NZJA 5J5CA 1AQUA 1VKJA 2VEDA 3A1UA 4QNRA 4TMWA 4AYTA 2FPLA 2XB4A 4D0GA 5FBQB 5IT5A 3LRPA 4NH0A 1E9DA 4PC6A 4PO8A 2ZAMA 4JLAA 2DFTA 1QBKC 1SVLA 2J7PA 5FR1A 2WPDA 1E3MA 1CF4A 2EW1A 4UKDA 2ZR0A 4DSTA 2ZRIA 5C4MA 1G3IA 4HLDA 4DLUA 4BEJA 1ZNXA 2ZJ2A 3W5IA 1P5ZB 1KAOA 1NVXQ 3ASZA 3ZH9B 1TADA 4BLSA 4UNSA 1N6OA 2VP4A 2RCNA 3LDAA 2O8CB 4A82A 4A0GA 4G5SA 1DAFA 4IVQA 2GJSA 1OFTA 4K81B 3CF2A 4E03A 4GSYA 1Q57A 1US8A 1M1YE 2H5EA 2UZIR 2B8TA 4JLOA 3AGQA 1J90A 4V0KA 3FE2A 1GP2A 4DB4A 5KO2A 1EFHA 2PX3A 2ZRFA 3PUZA 1YE8A 2R44A 1GRRA 1HA3A 4BFXA 2VSXA 3CX7A 3KTAA 4AKIA 2JJ2D 1ZYUA 2ZRGA 1II8B 1O87A 2NZ8A 4NPHA 3GD7A 4B43A 3UWKA 1YZTA 3DPUA 4Q03A 1E69A 3AKCA 1D2MA 3K0FA 1UDWA 3I61A 1BS1A 2ZRLA 1YRBA 2YJTD 1E94E 5FOUA 1F2TA 2NO7A 4DKXA 5FR2A 3IEUA 4CEIA 1XMJA 2D7CA 3TK1A 2GF0A 4BFWA 2F43B 1VDZA 4OJKA 3B9PA 4CF7A 2GNOA 1Q3HA 1RRGA 3IHLA 2QMOA 2FEOA 3JVVA 4UQOA 5J4YA 1JPJA 1NBMD 1Z06A 2BMFA 1ZRHA 2O52A 3IGFA 4EJSC 1BYUA 2YKGA 2QU8A 2GZAA 1G1MA 1U94A 3X1WA 4LZZA 2XNSA 3CRW1 4FINA 3WNCA 2NO9A 4AURA 5DI9A 1P9NA 5JCPA 2R6FA 4PPFA 4Q1FA 1FMJA 3TSZA 1XBTA 2NIPA 2GXQA 2PMKA 2ZEJA 4YQFA 1Q22A 1H8HA 2WJVA 3CB4A 4ASUA 2NOAA 4NYJR 1CR0A 1M6NA 1I4TD 4TLCA 3KKNA 1DAKA 4MRSA 1NKSA 1YQTA 4PX9A 1MO6A 2CJWB 2QG6A 3IUYA 3VR1A 4XSGA 4B2IA 1XTQA 3OFNA 4C0JA 1P72A 2QAGC 2RB4A 2NO6A 2AD1A 1E79D 2W58A 1DEKA 2C5LA 4LJ6A 2WMOB 4B2LA 4EPYA 1EX7A 1DS6A 1G8PA 2D74A 3OEEA 5EXSA 3KQUA 4C0HA 3WYGA 5DYIA 2Q6TA 4NZYA 3RLFA 4M1SA 2A3RA 1MABA 1IJEA 3QXCA 3UMSA 3T1TA 3AVVA 1NVVQ 1T0JB 3C41J 3EZ6A 4XSHA 3TUJC 3GMTA 2JLWA 3W6NA 121PA 1G64A 2X77A 1IHUA 3D7MA 2ZSDA 5FTMA 3ND9A 4DC9A 2JEOA 2GJ9A 2WVJA 5TVKA 1CJUC 1T91A 1P2VA 3P4XA 2YWEA 3QKRA 5P21A 3DO6A 3U44A 3QBTA 2GHIA 1Q21A 2RGCA 1N25A 1OXXK 3RYTC 3QXXA 4HUTA 4A2QA 1M7BA 3TVDA 1P60A 1E9RA 1SVKA 2QE7A 5CIWA 1XJQA 3MLEA 4Q66C 3CNOA 2CLSA 4KSBA 1KSJA 4OHVA 2CL0X 2X19A 3WXMA 3DM5A 2ATXA 2X8AA 1OYWA 4OL0A 1BOFA 3PV0A 3EIHA 3DZ8A 4NYIR 3HR8A 2G3YA 4IEEA 1KZGB 2BCJQ 1UDXA 2Q21A 3LWNA 2O5VA 2W6JD 5CYOA 1QHHB 2EFHB 4TT3D 3I72A 1JEDA 3Q7PA 5GJBA 1HQCA 1N5KA 4B2PA 4E22A 2D2FA 4IOLA 4IRUB 1TAGA 4C0QC 4DLZA 1TTTA 2MMCA 1DVRA 4BFYA 1BIFA 1U8ZA 2ZJ5A 3AKDA 2ZR9A 3AF3A 2GEDA 4Z1MA 4A0HA 2ZRKA 2IYYA 4G5RA 1YU9A 4GP7A 1XF9A 3TE6A 4IDOA 2FG5A 4JKIA 4WXPA 4XVUA 1KDOA 2CE7A 3B5JA 4A9AA 5J4LA 4GOJA 2YC4C 3U7EB 1V5WA 1IM2A 1QZXA 4A8JA 5L3QA 5EXXA 5AUPB 2BM0A 4U7DA 2DWQA 3QPVA 4LV5B 3VAAA 3G0HA 1PUIA 4MUAA 4EPRA 1XDBA 2QI9C 5G53C 5JJLA 2J0UB 2EYUA 3GLGB 3PQCA 3R8CA 1MKYA 4TYWA 2E87A 1WXQA 1KO8A 2AK3A 4QJ5A 1CEEA 4AIIA 2ODBA 3PITA 1ODFA 3F3YA 1Q0UA 3OE7D 2ZJBA 3QXHA 2QTVB 4QGAA 4EFNA 2FZ4A 2GF9A 5DLQC 1COWD 3E70C 3WNBA 1PLLA 4GZMA 1YZUA 2IEZA 1LNZA 1YZNA 2GWHA 2ZU6A 2YOGA 3LX8A 1TQDA 3PR1A 1ETUA 4A15A 4DLYA 4JLNA 1KO7A 3LW7A 3W34A 3N5CA 4DLVA 2WICA 2IYRA 2QTHA 2PZGA 1R2QA 3QENA 3W3AA 4LBYA 1U90A 4WIAA 1GG2A 1NN5A 1OE0A 2BJWA 4QHYA 5E7MA 2FEMA 1LTQA 5HKKA 3GJ4A 5G41A 4B74A 5JCZA 2OAP1 1KIMA 2CE2X 3AM1A 2ZS8A 1VYVA 2CMKA 2ZE6A 1JAIA 1G6OA 4IHQA 4P32A 2HT6A 1X6VA 1ZNYA 4DJTA 2XZOA 3Q72A 4PQRA 2V54A 1QDEA 2D7DA 1E2MA 3UANA 4LPSA 2ZUDA 1RPZA 2WSSA 3IDQA 2QSZA 3OIYA 1S9DA 2ZM5A 2YOFA 1I2MA 2QTFA 2JATA 4WAUA 1A2BA 1RJ9B 2IUSA 3CX8A 5CK5A 1N0VC 5DGXA 2HYIC 5E4FA 4MITA 2W00A 4OBEA 4MGIR 4TT3A 1A2KC 3QSYA 4CZ2A 4AKHA 1M34E 1EESA 1LY1A 1OIWA 4RZXA 2G6BA 1Z0IA 3TGPA 1BH2A 1MT0A 4Q02A 4N1AA 1T8TA 2VHTA 2X2EA 2FJUA 2CNWA 4IDNA 4LC0A 5EUMA 3BAFA 3U7FB 5LBIA 1CJKC 1BMFD 5FTNA 1OJLA 5EP2A 1OIXA 1ZU4A 2WWFA 3CWQA 2G9NA 3VR2A 2CCGA 3PFIA 1WCV1 2L0XA 4CT4B 2OT3B 5E95A 4HLUA 4LJ4A 4LOAA 3TH5A 1XU4A 1KI6B 1CS4C 1A1VA 2H7VA 1Z6GA 1XJ0A 1KSFX 1KMQA 1H8ED 2ZS7A 1AKEA 5G3YA 1BKDR 4DXAA 4UJ3A 1G3QA 4TLBA 5F98A 3SOPA 3IO3A 2JGNA 3NC0C 1Q20A 3F8TA 1M7GA 3AH8A 2ZE7A 2F3TA 3MUFA 3ZVRA 4LYJA 2OLJA 2O8DB 2QPTA 3QQ5A 4Q21A 1F5NA 3K09A 4M21A 4A6PA 3K70B 3D6TB 1KJYA 5SZKB 3L0OA 1CJMA 2V7QD 5KNDA 3GLFE 5FPKA 1RE0A 1IN7A 2O0HA 1AJEA 5F2EA 2ZRCA 1E2EA 4NONA 2NTYC 1I4DD 1OHHD 4EKDA 5JS8A 1TQ4A 1E9CA 4XJXA 2JJ1D 1CULC 4D4KA 1UEIA 3G82C 4S35A 3SJZA 5JSZB 3MJHA 1AS0A 1W0KA 4N0DA 2FNAA 2XZPA 1XTSA 3HYRA 3NBXX 5HCIA 4URVR 2RMKA 2GKSA 4DCTA 1W0JD 3SQXA 1P2UA 2PBRA 2WSMA 4CYMA 2QP9X 3MG9A 5J40A 3ZIAD 1NVWQ 1QHSA 3QOFA 4PPGA 1YR6A 1NG9A 5JWRA 2CLCX 4JYCA 2G1JA 3H0KA 4D6PA 1E1RA 2ZRBA 4DLRA 5BYKA 1G41A 3AVQA 3VR4A 4U5XA 4WVFA 1K5GA 2C9CA 4XD7D 4C7OA 3BS4A 1R0WA 4I81A 3X1ZA 1HQYE 4UNQA 4TMKA 5FBLB 1E1QD 3I3SR 3CM0A 1UEJA 3RHFA 1I2DA 2AR7A 4B73A 5KDDA 1KNXA 1NVVR 4HB0A 3MFYA 1Y63A 4DLSA 5DSZA 4GT1A 1J8YF 3SFVA 3HWSA 1LV7A 3N70A 5G40A 2I3BA 2IYZA 3F5FA 4KXFB 3W6OA 3PEWA 2PH1A 1AZTA 4KVAA 4CRWB 2GDJA 1DAIA 3DEFA 3EARA 2IYWA 5DHAA 5DH9A 4MKHA 4D80A 4XWOA 1R5OA 2CLDX 1TPZA 4JIMA 3C14C 2OE2A 1P73A 1TL7C 3FOZA 1ZM2A 4YMSA 3E5HA 2NPFA 1RRCA 2HV8A 1SHKA 3RS5A 1XZPA 1G8FA 2QP3A 4O2RA 4URZR 4DSUA 4TTQA 4D0LB 4HDOB 1EX6A 1R0XA 4OJQA 1CJTC 1GNQA 4LUCA 4Q1BA 4O3MA 2ODWA 1VPLA 1HT1E 1OFIA 2JIZA 2V55B 3T61A 3X1YA 5F9FA 1W5TA 2ZANA 1Y3AA 2AK2A 4PTLA 5EE1A 1X1RA 1ZM4A 4PQYA 1XCMA 4LJYA 4HAUA 4MDEA 1T4GA 2ATVA 3K0CC 2PMDA 4RCZA 4QJ3A 3VMFA 1W4BA 1HE1C 2H57A 4I99A 1DOAA 1RYHA 1GAJA 4LSGA 4Q4JA 3ZGXA 4ZDKA 1VCOA 2JLRA 3PEVA 3TJZA 1KY3A 1Z29A 3DHWC 3EAQA 3EWSA 3IIKA 4M9QA 4F4JA 3GP8A 1C4OA 3DKPA 3M6AA 5JRZA 2JDID 1UADA 1EFRD 1GTVA 3RVBA 1OYYA 4TYPA 3TBKA 3WY9A 1KSHA 5BN5A 2OCYC 5JJIA 2ZSAA 3BFVA 4WA7A 1YRAA 3QNUA 5L3VA 1VTKA 1VCMA 1GIAA 5IHPA 4NYMQ 5KSOA 5FOVA 2ZI5A 3BB1A 3FGNA 3LQQA 1PVOA 2ZU0C 2FWRA 3PVSA 3CW2A 4GFDA 2E1RA 5UKDA 5HE9A 1ZD1A 3NHAA 3KX2A 1D8TA 2P6NA 3CIOA 4U02A 4B3CA 3FHTA 2VF8A 4WW0A 1EFUA 1MRSA 3IQXA 2J1LA 4Q1DA 3RSLA 2P67A 4TZ6A 3PXGA 4D25A 5D3MA 4LBZA 2IF2A 2W83A 3FKSD 3U3MA 4DSNA 1MV5A 2IC5A 1NBME 2W0SA 1TNDA 3K1JA 1XCGB 4NL4H 2N42A 3BOSA 4G5GA 1GRNA 2AWOA 2VO1A 4P4SA 1F6BA 1AGRA 1KO1A 1P2TA 4BGDA 3AVTA 2REOA 3NH9A 4KHZA 4TQUS 3RRZA 4YMVA 4DSOA 1GNRA 4LCBA 2VP2A 3B1WA 3SN6A 2PJRA 1OKKA 2YWHA 2J0SA 4UNPA 1XB2A 3MMPA 4L16A 4FCTA 5CB6A 3GEIA 1NKTA 4HB3A 1XZQA 3GEHA 3LX5A 4XTRA 2ANBA 2XSZD 4TYNA 3CPJB 2P5TB 1VG8A 2QUZA 3KKMA 4GPTA 2YOHA 3LV8A 3I1FA 1E4VA 4J0QA 1S96A 1EK0A 1MH1A 4PHTA 3W90A 3FPAA 3MGCA 3CRMA 5J4VA 1ZIPA 3SBDA 1W1WA 2HLDA 5EE3A 4UJ5A 5TY0A 2O8FA 4DIDA 4YXWA 2RGNC 4PO1A 3QVVA 3ZVMA 4W5WA 3T06B 2JLUA 4DLTA 1ZC4A 4QKQA 1P6XA 3SYNA 2OLKA 1MRNA 5FUYA 4Q5IA 4QHTA 1DAHA 2HXYA 5FPHA 3SE0A 4B35A 1B23P 3LXXA 1HE8B 3QEJA 2ORWA 3UIEA 1IY0A 4OYHA 4IOKA 5K8LA 1F3OA 3O8BA 3AV0B 2JAQA 1SVIA 5DNYB 1A5TA 1JECA 1RJ9A 2IL1A 2QAGB 3WBKA 4Q4HB 4TL8A 3I8XA 2CHVA 2Z0MA 3IHWA 4C0SA 3OEHA 4S2EA 4D0NA 1OSNA 2RH5A 3CRQA 1JXOA 2JJ8A 1OFUX 2WAXA 5TMPA 4TQ9A 1GL6A 4I1SA 4KYUA 2C2HA 1P9RA 3GQBA 2A7QA 4EUNA 4TLEA 4G3XA 3CZPA 3SEAA 3BWDD 3LXRA 3JZMA 4OI0A 3L2OB 5JRJA 3T15A 1IXRC 3AUXA 1KI6A 4NCHA 2AXPA 4PXAA 1Z2AA 2NO1A 4B71A 4NKRA 1HY3A 2QT1A 4QJ4A 4KLZA 2IXFA 3FWYA 1ZUIA 2ZPTX 1OFHA 4JBWA 4LGMA 4JLPA 1KYIA 4GBMA 4JLMA 4Q1CA 3ZDQA 2GK6A 3KKQA 4DRZA 2GXAA 4ACBA 2O8DA 3AGPA 1KK1A 2QN6A 1CJVC 2OO7A 2ZUCA 3GEEA 3R7WA 1KI8A 1X8LA 1N2CE 4RD6A 1GRQA 3TUZC 2AKAB 1G21E 4A0FA 5FUWA 1HT2E 4RD0A 3VNUA 3NEYA 3W6PA 4Z8XA 4DDWA 3QXSA 1ESMA 4P33A 2J0VA 4EQ6B 3VX4A 1P2SA 4IXMA 5DO9A 4Q7MB 1K5DA 2P6UA 4NCIA 4B3DA 3U2QA 4K8OA 3IIMA 3T34A 1E9EA 1G7TA 5HE8A 3B9QA 1E98A 4TMTA 4KLNA 3DMDA 1G20E 3AUYA 3KB2A 4PHHA 3THWB 1XP8A 1HV8A 3DM9B 3IBYA 1SGWA 1W4CA 4PC7A 2B8WA 4M9XA 4LBVA 4ZDJA 2A78A 4DB2A 3EPKA 1PJRA 3O8DA 4KI0A 2VTKA 1KNQA 4A2PA 4HYYA 2FPKA 4BE7B 1OIVA 3S1AA 1VG1A 1T9HA 4AI6A 1NLZA 3VQTA 4BPBA 4NMMA 4B3GA 3HDTA 4YC7A 4F38A 3LVQE 1T6NA 3LBHA 2HF9A 4HUQB 4XVRA 1AA9A 1OF1A 3CR7A 2QBYA 1J70A 3GJ5A 4ZCMA 2XX3A 4HAYA 1NL3A 4US1R 5CB8A 3RS2A 1G7CA 3GLHE 1AK2A 2XOKA 3GLFA 3OZXA 4ZO4A 2AFIE 3LLMA 1ELOA 1XD9A 4JVLA 3L8ZA 4FCVA 4JBXA 1N0WA 3K0AB 1W5SA 5DI3A 2WWGA 1DPFA 3LD9A 5KU1A 2HT1A 2C99A 2RGGA 3B13B 5EE9A 1XPOA 1VG9B 1FPMA 1R5BA 4LYHA 3HU2A 2EQBA 1VECA 1A7JA 4XH9B 5HZHA 2GEVA 2ZI9A 1ONBA 3A8TA 4Q01A 2QGNA 2OUKA 4CDGA 3GPLA 4OQLA 4LBWA 1T8UA 1CTQA 1KK2A 1HUQA 1Z0FA 4BLRA 2CVFA 4C30A 1ZM7A 2H8KA 2ZRDA 1UPTA 4G01B 4KFTA 4NYMR 4RD3A 3H86A 1AS2A 3E1SA 5KOYA 1YVDA 4B75A 4B34A 3RC3A 2C04A 1DTSA 3GCGA 2WMNB 2ZETA 2A5YB 4FI3C 4ILEA 3NBYC 4P0TA 2A5GA 3FHOA 3QXJA 2ZJOA 1U9IA 4JJZA 4N3NA 1G6HA 3AVOA 4P3YA 4OHXA 4DUGA 3ZJYA 3WRYC 3GLHB 2VP6A 2BV3A 1NI3A 2OCPA 1W2HA 1DO0A 1UKEA 3PCRB 4MA4A 2OBMA 4ZI3A 1DAGA 2B6HA 2O8EB 3PUVA 1XMSA 2ZE8A 1P61B 4JVNA 5ELXA 2ZI6A 4QHSA 3AVYA 1CKEA 4V03A 2DB3A 3J81k 4KITB 4BLOA 1G19A 1N0UA 3L0PA 2BBOA 4PANA 2GETA 1N3BA 2F9LA 3ICQB 2GESA 4X8MA 521PA 4TL9A 1OW3B 3JVUA 2GVZC 1MOZA 3K9GA 5KTYA 3LBIA 1JALA 4YLGA 1SHZA 2HJVA 4POAA 4Q7KA 2WIBA 1GFIA 1XRJA 2IXGA 3CR8A 5DHFA 2OCAA 1SZPA 4F4IA 1DBSA 3DOFA 3N2EA 3TMKA 4EFLA 1M7HA 2WIAA 3T12A 4URWR 3EA5A 1N6NA 4PPNA 5FH9A 1P7CA 4MGKR 1E0JA 4CEJA 3QUSA 5M04A 1ZJ6A 3DKVA 4F92B 4LWZA 5IRCD 1NSFA 3FDIA 2PLRA 4BFZA 5BQ5A 4QFMA 1Q3TA 2FFHA 4C0KA 2RGDA 3OIWA 3W9YA 2DWPA 3BIFA 5K8IA 4MYCA 3FKQA 4A8JC 4DT1A 5HR5A 2BKEA 2TMKA 3QIAA 4ARZB 1G4UR 3I8SA 3QF7A 3TQCA 3NTUA 2OBLA 5HTKA 4R71A 1L2TA 4XOIA 1SXJD 2GILA 2NG1A 3GLGE 1AS3A 4X8OA 4OHYA 4V0ME 4L9SA 2KI5A 4JT4A 1T3LA 1Q44A 2JJ2A 2D4HA 1FNNA 4HB4A 4A92A 1ZCBA 2GZHA 1NNEA 3NH6A 5FTJA 1E2JA 2BBWA 3BORA 5AJWA 4OK3A 3VR5A 3LVRE 4EJSA 1SXJC 2IX3A 1ANKA 1CIPA 4RFSB 1IOZA 1D2EA 1GZSA 2BMJA 4LJ9A 5JWHA 2XXAB 2GBLC 8OHMA 1NBMA 3LO5A 4JL5A 1D5CA 1E9AA 4RKEA 4ZIRA 3CX6A 4UXHA 4GZLA 1LVGA 1HTWA 5KNCA 1Z0DA 4TMZA 4FIDA 5GJCA 1U2RA 3QPUA 4QBFA 4R98A 1RFLA 2A9KA 1SKQA 3I62A 4TSFD 1XCPA 1LB1B 1KJWA 3OAAD 2O8BA 1CR4A 4KBFA 4QM6A 1KI7A 1NY6A 2WJGA 4E09A 3EW9A 3FYHA 1G5TA 1L4UA 2WM9B 3CH5A 3TW4A 1XTIA 4G5OA 3H4MA 4RKFA 3KQKA 3AVUA 3KDSE 1CRQA 2DPXA 3AP1A 4QBIA 5JMTA 2YWFA 3U3JA 4M9SA 1WB9A 1XPRA 1E79A 2FSGA 3A1WA 5AJVB 3CO5A 3QF4B 3EPLA 5IDVA 3THXA 2SHKA 4BFVA 1U8AA 1OPXA 4JLJA 3UWOA 2GK7A 3ZZTA 3Q85A 1DAEA 3A58B 3W8RA 4DIEA 1IQPA 5LDDC 2FFBA 2ZAOA 5KSPA 4BQSA 4CVNA 3RDPA 3U60B 4URUR 2FDCA 2VHJA 2FSFA 3VKHA 2A2ZA 1AQYA 2ZRNA 3GFPA 4YMWA 5EE5B 2HF8A 2D2EA 3A4LA 4ON9A 1EWRA 4I1OA 2PZEA 1FNMA 4KSCA 1KAGA 3OESA 4UXIA 4LX0A 3UK6A 5JBQA 3DOEA 2XITA 3B82A 3U6KA 4Q4AA 3SR0A 2P6RA 3LFUA 3KXKA 2C96A 2OEPA 4JBYA 4TTRA 1JAHA 3AP2A 4IJMA 1NY5A 2RKOA 2IHYA 3ZZ0A 3T35A 2QGZA 4Q9IA 2ZR7A 5L3SA 1PLJA 2QORA 5TB5A 4WZAE 2YNMA 2FZLA 2FA9A 1V43A 2EYQA 4QM7A 2W6ID 1VYTA 4GMXA 4NU0A 2QT0A 2J5XA 3EZFA 2QENA 4DHEA 4B6EA 2W6JA 3THWA 1NF3A 4PFSA 3QPWA 4A2WA 1JR3E 3RRNA 4ACAA 3FFAA 5FOXA 1TF5A 3KFVA 2AKYA 4M0LA 1SVWA 3SYKA 3BH0A 2IA5A 3TAUA 1RC8A 3KL4A 3AF0A 4JVMA 3KXLA 5BWMA 4Q18A 3SS8A 1SKYE 4IDQA 1JPNA 1UBCA 5CIQA 1M8PA 1T5IA 2XTMA 1P3JA 2GCOA 3IIJA 2CHGA 3NDPA 1Z28A 2A30A 3MSXA 4IDHA 5FL7D 3QG1A 3PUXA 4X8HA 2VH5R 3KJEA 2FF7A 2REXB 3U3RA 2DYKA 2KE5A 1HH4A 2WWIA 2Q0HA 4GL2A 4C2TA 2I4IA 2BMDA 3QVUA 2V1UA 3WYAA 3KUDA 1E2NA 5HPYB 1N6IA 2A5DA 3MWLA 1XD2B 1G4AE 1ZNZA 3CBQA 3VKGA 5A0FA 4RY2A 2HUPA 5FL3A 2OFOA 1F2UB 1NMYA 2W2XA 1FOEB 5AR1A 4PHGA 3RAPR 4LJ8A 3OE7A 5BXQC 4Q9HA 3CNLA 3U7HB 3O8RA 1COWA 2ZUBA 2O8CA 3T1QA 4Q7JB 1G9XA 3KFXA 4B32A 1N6PA 3T5DA 3GFOA 4OI4A 2NQ2C 4ZCIA 5KNBA 2VP0A 3ZD6A 2WHXA 3JZAA 1EXMA 4X8LA 1IXSB 4UNNA 1VIYA 2YV5A 3KB1A 4KBGA 4M4SA 5LB4A 1SKYB 2J7KA 4ZDIA 1S9HA 2ZTSA 3QI2A 4P4UA 3PIRA 2BJVA 4JSYA 3QBVA 5KDLA 1Z0KA 3B1VA 5FOTA 1II8A 3HU3A 4US0R 3THYB 3WHLA 4D4LA 2EFEB 3I92A 2PLFA 4PZYA 2OSBA 4Q9JA 1CBUA 2H16A 1J8MF 4WXRA 4KO8A 1ZBDA 1Z47A 2DR3A 2CK3D 1GILA 1ZM3A 4QBGB 2R9VA 1S4QA 1KKLA 1S8FA 1N6HA 1XXHE 3HPQA 4YMUA 4B76A 3O8CA 2ODEA 2FE4A 2F43A 2PX0A 2MSEB 3LA6A 4U00A 3Q9LA 2QPAA 1P62B 3WRXC 1RKBA 3EG5A 4QGGA 3B8HA 4LHWA 3VHLB 3PEYA 1E0AA 2GTPA 1TU3A 2VSOA 4PC1A 4PQFA 5FUXA 5BN3A 2G0NA 1UKVY 3NBZC 4TMXA 1AIPA 3RNLA 1G3RA 3EASA 3EWAA 3OIUA 3K53A 4MDFA 2PT5A 3LLUA 1TF2A 5AUOB 4MQBA 2V3CC 4OI2A 1TX4B 2BKUA 1IBRA 1BMFA 1UBGA 1KY2A 3V4FA 4HSEA 2IK8A 4AD8A 2WWYA 4G5QA 2IW3A 2I1QA 5L8VA 4RFVA 3MJRA 3GJ8A 5AWFC 2GVDC 3GJXC 3QJYA 2CJWA 3HPRA 1H8EA 1XTJA 2ZI4A 3QE0A 3QKTA 3WP0A 1KZ7B 3TIFA 2X2FA 4RZ2A 2AD5A 2VP9A 1Z5ZA 5LD2C 3ADCA 3CF0A 2Q9CA 3MWYW 1KO5A 2ZITA 5KSYA 2CHQA 3FVQA 1XXHB 2JLVA 2H18A 3ADDA 4DDVA 2V7QA 4HEJA 1L7VC 2HDNB 2EWVA 3HR7A 2JLXA 1G3MA 1KK0A 5FOWA 5H70A 2HYDA 2P2LA 3ADKA 1OHHA 1US8B 4CT5A 4UXJA 2JJ1A 3ECCA 3NXSA 3CRRA 3H84A 4QC2A 1WMSA 2DY1A 1G18A 3M0EA 4NCJA 1Z83A 1FL9A 3KTAB 4XWKA 1JBKA 3NBFA 4OK5A 3B85A 5JS7A 1DE0A 2QL6A 2JLYA 2CCJA 1VHLA 4HLCA 1W0JA 4TZ0A 5JJKA 3K0FB 2AWNA 2C77A 1IY2A 1II9A 4JSTA 1Z6AA 1LF0A 4D2IA 3I32A 1KTVA 3ZIAA 1F2TB 1KHTA 3C4JA 4DCSA 1K8RA 4CEIB 2EFGA 4NDZA 3QEOA 4IVPA 1OXTA 2FOLA
chains in the Genus database with same CATH superfamily
4A1OA 4XPZA 1NAHA 5EIOA 3OCZA 4UZSA 4C20A 5LPNA 3PX3A 1ZMXA 4D9MA 2L2QA 2O5CA 3VGPA 1U4SA 1MVNA 2OHHA 3C7KA 4H17A 4Y7CA 4UOEA 3PLAE 3VO9A 4EHKA 4MS1B 2EP7A 2CLLB 4ZT7A 4D6XA 1DRVA 5TJHA 2X7XA 3ZVNA 3RS8A 2EKDA 2R62A 4G5HA 1O5TA 1E1QA 1T2CA 4O1IA 4EJFA 1KQ3A 4LISA 1KAHA 3BHIA 2YIJA 4OA8A 2JFHA 2QE6A 2BHRA 3L4JA 1EZ1A 1T2AA 2YYZA 4JNCA 2Z2KA 1NVDA 4HNQA 1Z2PX 5AVJA 3FIUA 4MEBA 2G76A 4L5CA 1PTJC 2W93A 4Y0AA 1JJ7A 1QDUA 1M74A 2XNDD 4MI3A 5JHGB 3C0KA 2DFLA 2IQ5A 2Q8PA 3EEBA 3ND6A 3NHKA 3IR5A 1YS2X 5K6AA 1E3TA 4L2IB 2NU7A 2G17A 1H1DA 2TMYA 3OWOA 3E7DA 4KQKA 3TLKA 1UK9A 1VKOA 5IK2D 1TCBA 2OXRA 5AKZA 5E38A 3PYMA 2GBCA 2LKCA 3LPLA 5T6MA 4Z4EA 1GCOA 4F91B 5KYYB 3L02A 3P7MA 3GG9A 2PEYA 2GD1O 4G0PA 5HKOA 4M7WA 3DE2X 5CJ2A 3ROEA 2HD4A 3PI7A 2JEYA 1Y9EA 2QTVA 4INZA 5CJPA 3K0CA 3VR6A 4IHJB 1E8NA 5FPSA 4F6RA 3WV4A 1ILEA 2QROA 3DAOA 3LY5A 3LZCA 4GSLA 3NT4A 4ZVPA 3HZRA 3O95A 3ROXA 4AF8A 4ALMA 1QVWA 1TQ8A 2QAJA 4M1YA 4BEBA 4JLDA 4MUIA 1JR3D 3JQ7A 3H18A 4J9UE 3EDCA 3K8YA 3OD1A 2E2WA 2XAAA 5L40A 3IQEA 5AXDA 5J2UA 1NQUA 2FH5B 1U1FA 3FUWA 3ITDA 2C97A 2B20A 2OFXA 4MULA 1KSGA 1Q1EA 3RGGA 3SBEA 3UFXA 1YH3A 3UAGA 4B1FA 5HRAA 3BWYA 2C57A 4M7RA 3D0KA 2WPNA 1E32A 4ANFA 1OJ7A 5KOHA 2V7UA 3EJWA 4UBNA 1U0EA 3QH4A 2CLEB 3U3KA 3E22B 2A35A 1XRRA 4S05A 2GFIA 2JDIA 4KGVA 5ALNA 3CXRA 3TL2A 2W2KB 3JATA 1J4AA 3F6EX 2AXNA 2XNHA 1PK8A 2N75A 5JFOA 4XIFA 4IXNA 2D3WA 2REBA 2UYOA 3SHOA 4DDHA 3FVTA 3MGAA 1J0EA 1G8AA 1YQDA 3K5PA 4OV6B 4EFMA 3SVLA 1CIVA 2B92A 1L4KA 1JQDA 1XT6A 1XYGA 1FRFS 3ND8A 4QGFA 3OCXA 4N01A 1U3FA 2GR9A 3OLXA 1I9CA 1ZQ9A 5AIBA 2JBAB 2RKBA 1GLGA 2PSEA 3WK8A 3HBNA 1TU4A 3N7AA 2GUWA 3OU7A 3SM3A 3ZYCA 4TX1A 3LK7A 3AY7A 3TLMA 2H92A 4Y6QA 4IAOA 3UKOA 3BE6A 1DC6A 3BRCA 1XJWA 3P27A 1FF9A 4MVJM 2HCBA 4J9VA 4R1TA 4MYUA 1XHEA 3IQIX 1H9BA 3JD0A 1CNFA 1Q50A 1YJ8A 3FKSA 4KXQA 2ZUTA 4B7ZA 3ZHVA 1RMTA 4N7RA 4OXNA 4K3VA 2NAFA 4H15A 1NNUA 3THOA 1KI1A 2R1VB 2VI5A 4EZEA 3BWCA 2WTMA 5JOQA 4YAOA 1KO4A 2PQ2A 3VDNB 5IMSA 1ID8A 2JLAA 2J7PD 2WM2A 1P91A 3C2QA 3COZA 1OI2A 5JQGF 2BAGA 2PXXA 1FRZA 4X1IA 1JVSA 4P84A 4DQVA 3IQDB 3D4NA 1QR6A 4GVPA 3LVFO 3EB9A 1KMHB 3D2LA 2PMFA 1YFJA 1MW9X 1GNLA 1U63A 1Y9JA 3N6XA 4ZPXA 3KWFA 3FCCA 1L8QA 5LA6F 1FVHA 4WZ6A 1D1QA 2QN9A 2G0AA 1VDMA 1T9GR 1V11B 3BJZA 4AZ3B 4WZAA 1E6LA 1JXMA 1L4EA 3HB9A 1E9FA 1NFQA 3M82A 4NCNA 2H00A 2WV7A 2C9OA 1NONA 3B6EA 5DSTA 4Q3BA 5GV7A 3AVWA 1C41A 3V48A 3GVPA 4Z0TA 4X45A 4GDFA 3FHJA 1IB6A 4Q47A 3JYQA 1DL5A 2ZIGA 1HLPA 1NG1A 1KKMA 1ISGA 2NXJA 2X22A 2XYPA 3TTXA 1E5TA 5BW4A 2AN9A 2GZMA 1VIMA 4GG1A 4GI7A 2FZKA 5B1DA 4L9WA 5CXUA 1FFYA 4UDNA 3OQVA 1W73A 1FUUA 3L40A 1NIPA 1CHNA 1V47A 2QM8A 2YCLA 1AKWA 4I9FA 1KOFA 3SJUA 3EQ7A 3IVGA 1NLMA 2CXQA 3EIUA 3VVMA 4O6VA 4N0EA 2Q7XA 3EISA 4BMNA 4LAFA 1F5SA 1P7WA 2ONYA 4HBZA 4HDMA 3OJCA 4CCAA 1GQOA 3FNIA 2WNIA 2COUA 3ZDDA 5EIHA 4RPIA 3FM9A 1PFUA 3ZOKA 1I5OA 3IE1A 3K9CA 2XJ9A 3NO4A 5IAKA 4I50F 4FR5A 4JXJA 3OTOB 3KSBC 2ECFA 4Y1FA 1RLTA 2J59A 4NXMB 5HEKA 2FRDC 4DCPA 3P0EA 4M36A 4FHFA 3KKPA 4JDUA 4X6LA 3B7WA 3NLLA 3T9FA 4ZAWA 1GKIA 3O7WA 4P7KA 1WU8A 2WKRA 2XTNA 4EY4A 2PGLA 2II6A 2WTEA 4N82A 3NBUA 3ZY5A 2IU4A 3P0FA 2YY5A 5ELMA 1JEYA 3TAHA 3FUUA 5JASA 3V8EA 4HD8A 2GCNA 1NQAO 4HBGA 5EIBD 3X1KA 1XZLA 3BQNB 4S1NA 4F04A 3I9NA 3ONWA 3SK0A 3UF0A 2HMYB 4J1TC 1AKQA 2KLBA 1H8HD 4GP9A 4ASUD 4KJZA 5ICCA 3J7AC 1N3LA 4PLGA 3NYRA 4DLAA 1D07A 3JVDA 4H9GA 1JQ5A 1OXVA 2FSIA 2FZVA 2X15A 4MO2A 1GAWA 2B7LA 5LZ2A 2GM4A 3NIBA 3A1SA 4H08A 2PQMA 4HRVA 1PV4A 3RF7A 1KJ9A 1VL2A 3IRUA 5JNRA 1SKAA 4JZKA 1Z7GA 1QRUA 1DOZA 3QIVA 4ETMA 1JFFB 1NMXA 3R7LA 2FY8A 1CVRA 3PRJA 2Q27A 3OCVA 2R7AA 1WEHA 4LDJA 3AMVA 1R5JA 1X94A 1GNPA 2WT8A 4LGYA 4YJ2B 1QZUA 1P7ZA 1KZ9A 4IH4A 1UQUA 2OORA 2YIMA 3OEED 1G0OA 1OB5A 3WX0A 3MTGA 1XZMA 3VKVA 4BJ5A 2BISA 1JW9B 2QTRA 3HU1A 1EJ0A 2UUPA 2AMJA 2FSVA 2FW7A 4MKFA 1Z88A 1PP4A 1FVOA 4GKVA 1HL7A 1IN8A 4P81A 2DETA 2GJAA 3PTLA 3GDHA 2VR1A 4EO4A 4CCSA 3B51X 1KKUA 1B6TA 2MYNA 4O2BF 2GA9A 3Q98A 2GXSA 4UVGA 3U40A 2HO4A 5JQGA 1HBJA 1W48A 1ESDA 1XZ8A 2AQIA 1KVTA 3GWGA 4J0JA 4YCBA 5IT0A 1JFLA 3DWGA 1AZWA 4KPUB 5AW6A 1KXZA 1ZIXA 2X1HA 3WWDA 2WI8A 5KYWA 5DM60 3JR3A 1QGOA 3HCPA 4QOHA 1A82A 5LA6A 3REGA 4PAMA 3V6LA 2F7SA 3X2SA 3HH8A 3G7NA 1UKCA 4QODA 3PDCA 5C1BA 3A2LA 4IILA 4PYKA 2VUSA 1IH8A 4I55B 3U17A 5KEIA 2AI1A 1RZVA 4OU4A 1BX0A 2A94A 4ESVA 1KQPA 1EFCA 1M33A 2IPLA 5G02A 3KQQA 5TQ0A 3WNQA 5AVRA 1NRWA 5C1IA 5ELXA 3T7EA 3ZWCA 4QPCA 1NXWA 3LQRA 4RK1A 4A4DA 4R1SA 1UF9A 1MN6A 2PBFA 1SOMA 2MJLA 1J5EB 4C7OB 3QTTA 4LZLA 5LBTA 1YZQA 4R01A 4EDHA 3ACBA 2B3DA 3DULA 4DQXA 1QF7A 4NPAA 5K3SA 1N6KA 1OLSA 1WNFA 3E3LA 3KVYA 1MLDA 4R9UC 2C9ZA 4Z1MD 1BW9B 1SIBE 1ZXXA 3ZNQA 1Z0ZA 1RFGE 3IAHA 3PWSA 3OF5A 4I5DA 3NFYA 4MW9A 4H3KB 4PO9A 5CLLA 5EKDA 1Q77A 1GZ7A 3D6NB 4V0LA 4XUGB 1FTYA 3M83A 3EVCA 2HTFA 2W22A 3DT8A 4KQ2A 3KQNA 4FSXA 1YRLA 3P97A 5HCNA 2PQ6A 1L5VA 1SIUA 2H5LA 4JEHA 3D3JA 4A73A 3V4RA 5IZ4A 1SQ5A 3AU9A 3N0XA 3UMFA 2AZTA 3N53A 4NNPA 2J0QA 2HSDA 2IH2A 3HLKA 5JEDA 1X2EA 1Y6QA 4G0MA 2RI6A 2QLJA 2JHFA 5KX5F 2V59A 4RPJA 3RVPA 2HC9A 1WZIA 4BVKA 2DTEA 1AF7A 4AWXA 3CO0S 1I8TA 2BSAA 2B98A 4TKVA 4I1PA 3ZOZA 4CR7A 1NP6A 2LWIA 3TFWA 2WKQA 4KFSA 3PSHA 4P31A 1OBFO 1YMQA 4OATA 3WRYA 3ZDCA 1BC5A 3NYWA 1M76A 1R6AA 2FVXA 2JC3A 2R66A 3NW9A 1RT9A 4KE9A 4DBZA 3JZFA 4F84A 5JXWA 5ADWA 2J6CA 2O0MA 3OKFA 4MYTA 1U0NA 4ZAZA 3KVVA 4BP3A 3QE2A 3FTQA 2W9XA 6REQB 4YCCA 3WGIA 3UMVA 3PP8A 2NPIA 5HKKD 4NWIA 3CF4G 5HK8A 4RC9A 5EZYB 4YUAA 3PWKA 4C6TA 1VI2A 5KHOC 3TFOA 1OH5A 1MIOB 1IG3A 2JHPA 2XMSA 3BTSA 1XEFA 4FWIB 3ANYB 4XW2A 4KV9A 3ZY2A 2QRNA 3ET5A 5MGNA 1E0SA 3MWJA 2FV8A 2H5JA 4NAHA 1RKQA 1MJGA 4M89A 4RD4A 5I48A 3ON5A 1OX6A 1HDCA 4JJGA 4XCXA 5EUQB 3IJRA 3FHCB 3WTCA 3KYDB 4Q19A 3EGXB 1IOLA 3VPHA 2J6IA 2CZQA 3G1UA 4O2BA 3SJBA 2DT5A 1AH2A 3NKVA 4GICA 4JEIA 2RGAA 4TN1A 2NGRA 4R9RA 3T7JA 2QAGA 3LZ6A 4E3ZA 4Y2XA 4FXPA 4JKYA 4TWRA 3RRBA 1W7AA 1I6KA 3IIEA 4Z8YA 4UOZA 2UYYA 4HAOA 4HGYA 4EFDA 2QKYA 3MW8A 4RVCA 3WSTA 4J2TA 3M4YA 4PR0A 3Q12A 2CNWD 2FPGA 3M6XA 1QUFA 3IVMA 4RANA 4BZQA 1VLZA 1LLFA 3DV9A 1PJ2A 1TEXA 2WM3A 2H1VA 3VR2D 2JHGA 1GFSA 2Q6KA 3KG2A 4JL8A 4F56A 1MFPA 4P4SB 4GR4A 1F9AA 4BP9A 1VCHA 4KZKA 3SZRA 1GL7A 3IUBA 1Z37A 1TCCA 2R7LA 4PNPA 3WOVA 5C2JB 4FJ0A 1BO6A 2BPOA 4WDRA 1XOIA 1V41E 3HMKA 1RZ3A 4KUGA 1VCIA 4P3NA 1NLYA 3WKBA 1NMSA 5LQMA 4JSRA 2NZWA 4N5LA 4N9QA 2CBXA 3IB6A 2D1RA 2QVCA 2J32A 3Q10A 1BGVA 1YCFA 1GKUB 4HLUC 3NG1A 5IABA 3SIPA 2VZLA 1GNVA 5CCEA 1WUJS 3BB3A 4FJ1A 3RRYA 1IEVA 1QZTA 4UFNA 3JR7A 1RQRA 2BCEA 4OQEA 4JVOA 1U0BB 4KQ6A 2D8AA 1SXHA 2Y1OA 5KTPA 2JLSA 4LI3X 1QGAA 2O20A 3OTGA 3GI1A 3PG5A 5IDQA 1EDEA 2WYVA 3U7JA 5K8VA 5FPQA 2DCMA 2E4YA 5L53A 4FGZA 1N5RA 4P38A 3W7VA 3NHBA 1R74A 4YMTA 5JG7A 1KTIA 5D1NA 3ZJ4A 1RYZA 5KC8A 4ZZ3A 2GJKA 2UXDB 1SCUA 3DO8A 1D1PA 4G4JA 2JFNA 4O2AB 5EPUA 5KX5A 1SCAA 4X64B 5TVGA 1N8TA 4JGIA 1N92A 4MUJA 3HA3A 2NMVA 4OLJA 3L7OA 3B1XA 4V39A 4GX1A 5HJEA 2R5NA 4C3ZA 1B3RA 4W7SA 3U37A 2POQX 3Q0EA 1CLUA 4N8EA 4Q00A 5K20A 1QIKA 1USVA 2KW5A 2V6IA 3C3CA 4GOOD 4I19A 4B8YA 3AL3A 3WMGA 2QX7A 3U7IA 2GOYA 3QUTA 1EK6A 3H1TA 3FDFA 4O4IF 4AN4A 1BWPA 1YOVA 3VU0A 2DBYA 1GAQA 5LNK6 1Y5MA 5LQSA 5FIUA 4HUQA 4ID3A 3CKMA 3DG9A 2W98A 5FHRA 3H8VA 5K9ZA 3ST7A 3R0VA 2V0GA 3DZDA 4OLAA 2F9MA 1IEXA 1P1JA 1IAQA 3B1ZA 1OYOA 4OH1A 2ZZMA 3NV7A 5JIBA 2IHBA 1VSUA 1IN4A 1AB6A 3AM3A 1QHYA 4QELA 5DCWA 4LEIA 3SI7A 2ODNA 4M9CA 1J09A 1ZH8A 2A0XA 3O21A 3DF9A 4ZVQA 2O3TA 4QT4A 3K0AA 2NZUG 1H05A 4QO8A 4RZIA 1OXUA 2AYXA 3LUPA 4CQJA 4LF9B 2VYFA 3D7NA 2RHJA 2J31A 1H1LA 2KBEA 4I2VA 4MZXA 3VDRA 5JAPA 2FP3A 1Y9DA 3R5JA 4BASA 1NP7A 2PCLA 1YR7A 2YJNA 3HCOA 3RC7A 3IODA 1PZNA 1D2CA 1HKHA 2O3UA 2HA6A 3HY4A 4LOJA 2QNRA 3WGUA 5K0BA 1W36B 1TAUA 1G20A 1Y4DE 4FEEA 5I7HA 3GBVA 1MC1A 1NR1A 3EZ7A 4AWAA 1T6XA 4BNGA 5FFFA 4R54A 3R0JA 1GTJ1 3WHPA 5IHXA 1EVJA 2BEWB 4LXYA 3BL5A 1PSZA 3R3UA 1P0PA 5IAEA 4YQEA 2GA8A 3DE3X 3UY4A 1Q7RA 4F60A 2WE8A 4QDUA 5FP0A 1C9YA 4FD3A 4RKQA 1EWTA 1IULA 1UJMA 3RRMA 5J23A 3HM9A 1IJBA 2Z30A 1NDHA 4C0LA 1BEZA 2J5KA 4CKCB 3WLTA 1DIBA 3FYDA 1F8GA 4CKEB 5IP5A 1Q12A 1X1QA 2E4AA 5CDFA 4OGKA 2J09A 2P2DA 3L7JA 2JFZA 3U4QB 5KC9A 5K4GA 3DGEC 2I8CA 3ISVA 4KODA 3PX2A 4IIEA 1Z8FA 2ZYRA 3FKJA 4LHXA 5K01A 2XF8A 1XZKA 4TUYF 2HBRA 1ZGAA 3K9NA 5CH3A 5E2IA 1EVIA 5SZJA 2W6IA 4JUAA 4IW3B 1FFCA 1YS4A 3BMOA 4KVGA 4TLLB 1E1YA 1TK3A 5DYGA 4AZWA 1OH6A 1ICIA 2I99A 2OGUA 2CMDA 5CLHA 2C98A 2D0OB 1XL1A 3I2KA 3KJIA 3TR0A 4XYBA 3AVXA 1S2NA 1EXDA 4ZYLA 2NW6A 1P81A 4G1MB 2IHUA 4NFSA 1J8VA 3EVFA 4RXMA 2RAVA 5BW8A 3BZBA 1IHPA 3RHSA 1QVRA 2Q3MA 3AUSA 4ZQCB 1OLUB 4KDEA 4C4PA 4KL8S 4MV8A 4UTZA 3N87A 5LQRA 2O48X 2A5LA 2Q5HA 1Y7LA 3DDCA 1T2NA 3NKFA 3NOVA 5H68A 1R4AA 2MCFA 1VGRA 1Y48E 2PZAA 3E82A 4MS3B 4XZ3A 5F7ZA 1PDVA 4BTLA 5TNXA 3VHXA 2WJYA 4PNEA 3ANTA 1LQ2A 4HWSA 4QLOA 2ZPAA 1SNYA 1S2GA 3AFOA 1Z6XA 4KYIB 3OZVA 2ERYA 2HB6A 1RSZA 4D9HA 1AUVA 5A1JA 3CPEA 4PE5B 5DWVA 4KXVA 1XMIA 2FCAA 1N2EA 1ST3A 3KKKA 4FMDF 4BY9E 1OC4A 1E7YA 3JASA 4JT2A 2AL7A 5DI3B 4I4LA 2OV2A 5BQPA 1Z15A 1ZVQA 5CDHA 1DBVO 3P9QA 1UKBA 2IIVA 4JUFA 4L08A 1RXSA 5IPFA 3ETCA 1PCXA 1Y3IA 3TRDA 4A0RA 3KV3O 2FU5C 4FYMA 4A8TA 2YH2A 4MP8A 4Q1EA 1J22A 4LV6A 4BQNA 1TLFA 2I3AA 2WOJA 4W8GA 1QE5A 3WMFA 4CMBA 1HFKA 4O4IA 4MVYA 3RS4A 2H2FA 4RL6A 5EGNA 5FO1A 5DMXA 1QGZA 1VIDA 2ZJ8A 5E7QA 3ZDXB 2PUAA 1GL9B 2TYSB 3U61B 1W2GA 4I5GA 1ZCFA 3D1LA 5I7OA 4PHCA 2HQ1A 3BX1A 1WF6A 1RAIA 2CXPA 5CM8B 3PWTA 4R84A 4UUMA 5GADl 3BRWD 2PUWA 1UOPA 2YL2A 5FBRB 3BDIA 2DR0A 2GAIA 5T67A 3ESXA 2DKNA 2RGBA 2PM8A 2MU1A 1Y1QA 4RLSA 4CQMB 4WLFA 2Z83A 3AOEC 1WCYA 3F8WA 2AG8A 4P7FA 5AH0A 1SBNE 1M2VA 2ZBPA 2IY8A 4FR2A 5AKEA 4P92A 4IL5A 3UFBA 2HX1A 2VF2A 4BATA 2FW6A 2XDYA 3AR6A 4Z0PA 1GKYA 4IJKA 4DZZA 4Y30A 1FTNA 2HLDD 2WB2A 2WBLC 1Y5LA 3OY2A 4ZMSA 2G8NA 3D6AA 4YMHA 2NQ8A 3W4KA 4X20A 4Z4IA 3CKLA 2FPSA 1JT2A 1QH1A 2Y1DA 1AXEA 3PFHA 4TKUA 4DBVO 4ECEA 3U4CA 4EHFA 4TV8B 3QA9A 3CZ5A 1TUBA 2A9QA 2I2WA 4BYGA 1QHGA 2REQB 2WD8A 1L5RA 2WJZB 5CGZA 5JFTA 3SVZA 4S1VA 2TRSB 4BU0A 3C6QA 1HRKA 3L4SO 4TTIA 5CCBA 2BCGY 1A96A 2EFDB 3N8NA 3WDMA 2CBZA 3GLTA 1G8MA 1T1GA 2N9UA 3F74A 4MI9A 4LQLA 5FLYA 1W8DA 4OX9Y 4RIIA 3T3OA 1JQBA 3O9VA 4F93B 5FUMA 4HR7A 1YIOA 4GXQA 2I91A 4REMA 2XT9A 5B2EA 4JOBA 2A5FA 4H4CA 3UJ9A 1HR0B 3H05A 3H04A 1K6MA 4BN4A 3PXEA 4CTNA 1IYZA 5DIFA 3PHHA 1GO2A 3T4EA 2JASA 1P74A 4TYYA 2GPJA 3DTYA 3M2TA 4EB3A 3WGGA 4G1FA 2IS6A 2UAGA 5IVHA 3JQBC 3OEHD 5FEUA 4YJGA 1DMRA 1NLFA 2O7QA 2P6PA 3MCWA 4TUYA 1BQ3A 3B3AA 4L3OA 1TQ2A 1NGSA 4FW9A 5KNDH 1I80A 5CT6A 2VUHB 4N7BA 3DTTA 4RSRA 2CSUA 3RM3A 2Z9BA 5ALYA 3WIVA 5BYJA 2IE0A 2YC2C 4EX6A 1PL0A 4ADSG 5BP7A 2GD2A 3GP3A 3V9AA 2X3UA 2VDWB 3QF4A 2HJ9A 2P9FA 3TOZA 4P1ZA 5JV5A 3LQFA 4L51A 1O0CA 2RGXA 2ZJ7A 1WOMA 2D13A 4KYVA 5AM5A 3D7RA 5DLEA 5C7LO 3AP3A 4TQAA 3WKEA 1AMOA 1DC7A 4OHZA 5IF9A 1FFHA 4JYBA 3IP6A 2F1IA 4URYR 4IDDA 4B3BA 4MUFA 4DT1B 5ESRA 2QR5A 1DARA 1HLDA 5FA8A 9LDBA 3IA7A 3OQOA 3QVKA 2HSZA 2PL5A 4Q1AA 1YRYE 2W2LD 3A1VA 2TMGA 4LF7B 4DYHA 3K70D 4AQYB 3OPQA 3VR4H 4Y2PA 2R4TA 3D7SA 3KT0A 4YJ3B 1FSSA 1LJLA 1DJPA 2GTIA 3E4CA 3FNEA 1ISIA 1Q6ZA 4YJFB 3DD1A 2F3UA 4H1VA 2WLTA 1W44A 1WWKA 3R5FA 4YCSA 5CEFA 1FFXA 1SUCA 2G80A 1RQNA 3I9FA 5CEEA 1S8OA 4ZO8A 3TDNA 4NE9A 4EG0A 1NW6A 4I4IA 3VYVA 3E03A 2NO0A 2IELA 1QG6A 1SXPA 5AKHA 4C0XA 5EJAA 4PVCA 2FR8C 3ZXSA 3AI1A 5JPIA 4BX9A 5IJZA 3V4ZA 5GJVC 1E60A 3RJ5A 4TPKA 3T38A 2F6RA 1Z63A 3WGHA 2M1XA 4QG3A 1J25A 2V98A 3WISA 1OVGA 5FYQA 4E0BA 5EJGA 3SJAA 3PF9A 5EL0A 4ZIRB 721PA 4TKMA 4QUKA 4ZXFA 2O7SA 3OM8A 3OIVA 1EPUA 1X3LA 3HE3A 4Y6GB 5T7BA 1X8JA 4XFJA 1GUAA 2G1UA 2YINC 3FCAA 1XUOA 1EJ2A 4TOIA 3QEMA 3V7UA 4IXTA 5H5JA 4RKYA 1FDVA 2J41A 4DMHA 4X61A 5TSDA 4YDQA 5LLTA 2OZEA 2GLXA 2UZAA 5BUZA 3O2JA 4Z3OA 1CFZA 3O4FA 1YZLA 4WKOA 1CV2A 2O05A 4QLAA 2HF7A 1A0OA 1RRMA 3N0WA 2Q9BA 1RABA 4AY2A 4JC0A 3KEQA 2XOKD 4N0PA 1R3UA 2UUOA 4CG3A 2G83A 4P7GA 5CH8A 3T0IA 4XX1A 1OU4A 2CL6X 3EGWA 4OY3A 2Y8EA 3AF2A 1XD2A 1DXOA 4LY9A 1L7BA 3FDXA 4G8DA 1REQA 1KBOA 1X87A 1GAXA 4TYQA 4Q24A 3STVA 3VVLA 2ECOA 1U5BB 2XMCA 2W4MA 4ETWA 3KZMA 3SX2A 3ETHA 2E49A 1E2PA 4GR9A 3UXMA 5B7PA 1MB3A 2OCDA 1W5BA 1SUPA 5CMLA 2AFRA 3B6KA 1JIUA 1WKBA 1OZFA 3PICA 1RP1A 2XGOA 4R81A 3HZOA 4DCOA 2MMGA 3GDWA 1XZHA 1TMKA 5ABPA 3JS5A 3A04A 1GU0A 4MKXA 3NQ41 3MUOA 4M8NE 1YRWA 4L0DA 1B1CA 4BGUA 4H3HB 2XB6A 3ONFA 5E0KB 4E33A 1LV8A 1HX7A 1BJTA 1X3SA 4KXWA 2LPMA 4QX6A 3V8NA 3E7WA 4ND1A 1CUFA 4CBVA 3ZQJA 5BPHA 2GH1A 2QMYA 3LH5A 1F06A 4JBHA 2K5UA 3IT2A 1NJFA 5IAOA 4FFSA 3THYA 2H7CA 3HKCB 1ISFA 1J99A 2G1KA 3EIWA 3RSSA 4UPEA 5J43A 3KZ1E 1MO5A 1EXVA 1WCIA 3AFHA 5AJZA 1LZLA 2HU2A 1YJAA 1PYOA 1VJGA 4UBKA 4DUGD 3RIGA 4E94A 5IZCC 3QKSA 1WUTA 5IUKC 5TQJA 2Z56A 1N5OX 2OMKA 1M8GA 3Q6IA 2ACWA 4HNHA 3WTBA 1TVKB 3QY0A 5DCLA 1PLKA 5GM1A 4ZTUB 4BPRA 2HI0A 3DEAA 1Q2UA 1ML3A 4JQYA 4LJLA 5JWOA 4QYIA 3GJ3A 3QVJA 1HM5A 2EFYA 1TZKA 2XB2A 1OH8A 3VPCA 1CUWA 3TS1A 2HSWA 3BFKA 3ELUA 1R0LA 2ASEA 2ZBEA 4MROA 1WZNA 1XEWY 2VK2A 3DD5A 3MYRA 3OTWA 1Y7TA 2Q2VA 5HUQA 2QN7A 1VIAA 4C2UA 4MB2A 2C9BA 2QRGA 1G8YA 5AP9A 4BLQA 1V6AA 1G8GA 1ZGBA 2ZRAA 3G2JA 1EYZA 2OHVA 5KAMA 3R7AA 3R3ZA 2VEDA 4WK6A 3KOMA 3MTAA 1YR3A 4D0GA 5FBQB 5AHXA 2V0NA 2FW0A 3I2HA 3LRPA 3LWBA 1V9LA 4Z53A 1Y8RA 4UAUA 5C3UA 4L4XA 2FQYA 5BV8A 1WW2A 4OMDA 5KYGA 3BIJA 1XDGA 2QYHA 2WPDA 4GW3A 4IJQA 2Q2NA 3H2GA 3R75A 1Y5RA 4C04A 4D9GA 4CIAA 1CZOA 1G21B 2EW1A 2X9QA 3GUCA 5K2OA 2PMBA 1V95A 4RZSA 2ZR0A 3QFTA 1DOHA 4UFOA 4DSTA 5C4MA 1G3IA 3F8SA 4ZAVA 4DLUA 3W2IA 3EJ6A 2ZJ2A 4JBNA 2PUEA 1KEUA 4PBSA 3A28A 3ZH9B 5JY1A 3ONDA 4Y2VA 8ATCA 4W4TA 3ZN2A 1N6OA 3RIHA 3BIXA 4L3VA 4A82A 4A0GA 2O8CB 1UEXC 1I7PA 3I12A 4IVQA 2GJSA 1QPBA 1E3QA 3LUGA 1EIWA 1UPAA 1M0TA 2QTWB 4K81B 3OUTA 4E03A 3GCWA 5DYTA 4MW7A 1I7DA 1EFVA 1LVHA 2C3PA 1TAHA 4M0KA 2H5EA 2UZIR 2YTZA 5AI9A 4C01A 1XDZA 2PPLA 4V0KA 3T7KA 1NTOA 4FB4A 2O9JA 3VDXA 4AJNA 3FPLA 2C4VA 3O3NB 1GRRA 1C1XB 4BFXA 3HWWA 3NWEA 4CM8A 3KTAA 4FONA 4IG4A 2QSUA 3VNBA 1AMNA 3U0VA 3ILYA 5B3KA 2X8LA 4UQPA 1II8B 3E9CA 2NZ8A 2IV2X 2UZ1A 5CT5A 4J7CA 3UWKA 3DPUA 3AKCA 2E85A 3R0ZA 1FC0A 1BS1A 3JZDA 3L18A 3PPIA 3P2EA 4GO1A 1J2TA 1E94E 2FWJA 1JG4A 4POOA 5MF6A 2NO7A 4DKXA 1DGQA 2JFWA 1T5OA 3ZLUA 3GEBA 3QI7A 2D7CA 4K9MA 2QUKA 4RZHA 2O50A 3PRKE 1V7ZA 1VDZA 2F43B 2G82A 2BM8A 1IXKA 3DT6A 1D03A 4PCUA 1N2JA 5CA0F 3DNPA 2QMOA 2WDPA 3JVVA 4RSMA 1QQAA 5CX1B 4PRLA 2P90A 3MUEA 4HNTA 1XYVA 5AOVA 2O52A 3QV1A 1QKIA 3TJMA 1LK7A 2XYQA 1SCDA 2X8JB 2B2CA 4UU7A 4ZQBA 5TE9A 4L07A 2XNSA 4CEHB 5DI9A 1P9NA 4PAGA 1IEWA 1JIXA 1VJDA 2R6FA 4C4RA 1D4OA 5DWQA 4JENA 3EDOA 3HP4A 2I2AA 1XMXA 1XNGA 2PMKA 1VIVA 1UJ4A 2ZEJA 4XGNA 1Q22A 2P11A 2N3ZA 2RC5A 2WJVA 4GQBA 1AUPA 3RFXA 1M1NA 5C35A 5FX2A 2G9UA 1IPFA 4V0QA 3L1HA 2UYHA 1I4TD 3MWDA 3NWBA 3UK2A 1QP0A 1NKSA 1YQTA 5BN3B 4PX9A 4DQLA 2X8BA 1KDVA 4ALKA 3C3BA 5CPBA 2QG6A 1G66A 5IT4A 4COKA 2I1LA 1TVCA 1F8FA 1SUDA 2IQIA 4QPNA 3C6KA 3PJGA 4YIKA 4MRAA 1UJNA 5ARBA 5HZMA 2NO6A 2AD1A 2RK6A 1FP2A 3JRWA 4MYDA 4S1TA 3TNDA 5IVIA 3VOSA 1YTLA 2PG3A 4F9TA 1G8PA 2FKNA 3GYBA 1NT2A 1UFRA 1K6JA 3QUQA 4YA6A 4YASA 3IAS1 3INRA 4C0HA 2K7FA 1E7SA 2QN8A 3QYFA 4O4JA 4AIRA 3CS3A 4IZIA 2A3RA 1MABA 1IJEA 5AHKA 2Q07A 3LHKA 4OTZA 4Y6LA 3C41J 2ISSD 5BQ3A 3CUKA 4FNAA 1U2SA 3FJYA 3GMTA 3EUWA 2JFVA 2XUAA 3FBWA 1FPQA 3OFVA 5FTMA 2XQGA 1NOKA 3OZRA 4NNOA 4K28A 1T91A 4HMPA 4CUZA 3RRFA 5P21A 1N4DA 3BWBA 1ULHA 3KOWA 2QTZA 1R0BA 3BFPA 1P9OA 3LOQA 4ZA2A 2ONZA 3U44A 3C5EA 3NC4A 4WKNA 1T9KA 5BUCA 4X6XA 1PL7A 3G2KA 4GAEA 3WKDA 2RGCA 4IXWA 5EAIA 2ZYDA 4LF8B 1OXXK 1Y4ZA 3RIXA 4EY6A 4YJHA 3N8DA 1MCZA 1V16A 5EQDA 2I4OA 3AEYA 3V4VB 4IFTA 1SWWA 3N3AC 3A32A 3B6JA 1ZZGA 1IY8A 5CIWA 5I01A 4Q66C 1U8EA 4X7RA 5AJHA 5AKJA 4OHVA 2X19A 1L8LA 3NDJA 2R60A 3HSKA 4RNCA 5GOTA 1OYWA 1QMGA 3PV0A 2YHIB 1ADFA 3ZLBA 2BFWA 4CCYA 3UJNA 2VXYA 3HR8A 2G3YA 3OMLA 4IEEA 1KIAA 5EXEA 3U16A 3PC7A 4UM9B 3M5WA 2VDPB 2EZ4A 1H93A 4JD5A 3UK7A 3ZHSA 5HXAA 4I2NA 3ZKWB 1SVNA 5CYOA 2BRUA 3BXHA 2PWPA 3AYXB 3GLUA 1JEDA 2YNMC 2BMVA 4XR4A 5B3LA 4V1CA 4B2PA 4K6MA 4DLZA 1N2XA 3FWZA 5DP2A 4M0EA 3H7AA 3AI3A 3SKXA 3GFRA 4BFYA 2ZJ5A 3OQHA 2ZR9A 3AF3A 1K7FB 4MRMB 4N7JA 4YFYA 1VPEA 5IN5A 4BV3A 4IMPA 4LYYA 4KE7A 4CF3A 2HNAA 4GPD1 4AJJA 4GP7A 3N8GA 1F0NA 1R0KA 4JKIA 4WXPA 1KDOA 1NQXA 2C42A 2PDAA 1NJ5A 1L5LA 2E4UA 1XSEA 1IM2A 5HS4A 1QZXA 4A8JA 3O3MB 3BMQA 4U7DA 2DWQA 3VAAA 1FX1A 4MAMA 4MUAA 3MRVA 1XDBA 2QI9C 5G53C 3VNSA 3I6BA 4IRXA 3PQCA 5E6RA 2Z3ZA 1EGHA 1CQPA 1MKYA 3WICA 3WK5A 1AXGA 4KPYA 3S28A 4P0QB 2E87A 5GIOE 1KO8A 2AK3A 3H2KA 4P3KA 1ZHOA 1UMDB 4QJ5A 4QE3A 3P0RA 4IIXA 5A4KA 3DEHA 1FMTA 4YFVA 2PFSA 3IE2A 2Z8ZA 4EFNA 2WFLA 3GDFA 1LDGA 2B37A 2P0AA 5DLQC 3RUAA 4OJMX 3WNBA 4RS4A 3I8OA 4KN6A 2IEZA 5AK3A 1M2OA 2IRWA 2YOGA 3B53X 3LX8A 3W5BA 2QB5A 4JLNA 4D9BA 3PKJA 4D9JA 3N5CA 4DLVA 5KNBD 2B4AA 4FN4A 4GX2A 3DMGA 3VYWA 1L3BA 3W3AA 3LZDA 2A1UB 3FLBA 4U9IS 5HF5A 2G63A 3O3OB 3VOTA 1U90A 2F48A 4AB1A 2LP4Y 2O5EA 1IWPB 2JGFA 3KDPA 3A9WA 4L78A 5FA6A 5HUJA 2FEMA 4HJRA 1D6NA 1RWKA 1U3CA 2B94A 2BGJA 3DQZA 4G41A 1CFJA 2OAP1 1KIMA 3CEHA 5JCZA 5K0EA 3WGJA 1EK2A 4I1YA 2CMKA 1C7QA 4M8IA 3STHA 3V8QA 2GM5A 2NXWA 3ZBUA 2BM9A 4P32A 2HT6A 4DJTA 3U62A 1QS0A 1XLWA 2JZOA 2V54A 3CSDA 1QDEA 2JZCA 2ZPUA 4NZPA 3SIWA 3UANA 2RFLA 4KB5A 3HGTA 4LPSA 4OYRA 5IU6A 4JQOA 1F9EA 2C5AA 1RPZA 2X23A 1XVUA 3IDQA 4RTMA 3PKIA 3OIYA 4E5NA 2W8BA 2R5WA 2D1SA 4EHLA 4G6ZA 1V3TA 1OI7A 2Y1WA 1PN3A 4FHZA 1WXDA 2BGLA 2IUSA 4HRAA 2CJFA 9MHTA 1N0VC 5DGXA 2HYIC 1P1FA 3G8BA 3JSAA 2W00A 2SICE 5AKKA 4B31A 1CS0B 1NBIA 3ZWQA 1ZA1A 3FGPA 4OIFA 1K7SN 4DV7B 5F33A 4RHEA 2UYGA 3HNOA 4G36A 4MXDA 3EA4A 1BNCA 2D59A 4INOA 1TEZA 3TIIA 1BMFD 2HDWA 5FTNA 3EXEB 4WLNA 1V26A 4L4RA 1IVNA 1GTL1 3LKZA 3Q9SA 4KXLA 3PFIA 1WCV1 2L0XA 4CT4B 4IZ6A 1SRRA 2OT3B 3CMCO 3MZ0A 5JAHA 3P2YA 1KI6B 1XRNA 3TTWA 4O8ZA 1Z6GA 5A4AA