3U3KA

Crystal structure of hsult1a1 bound to pap and 2-naphtol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
TSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3kA00
1IY2A 1E9BA 1Q12A 3OHMA 2VA8A 4LJ4A 4DSNA 2XX3A 2RGNC 4OK6A 5L3QB 5CIWA 2ZJ5A 4GOXA 4A2WA 4R71A 2IEZA 1NJGA 3P1JA 3IO3A 3VU9B 4KFTA 2XNSA 4IDQA 3OEHA 4TYQA 5H68A 2F3TA 1GL7A 1JB1A 4DB2A 2QSZA 1TAGA 3IPXA 3SC3A 2NZJA 1K5GA 1IN8A 4WBSA 2F43A 4RSGA 2ZSEA 2CCKA 2FV8A 2D7DA 3N5CA 3TUJC 2BCGY 2BBWA 3ZH9B 1BH2A 2HYDA 5B64A 4B2LA 5JEDA 2F9LA 2MSDB 1TPZA 1T5IA 4TMWA 3F3YA 4NYIR 3TKLA 2WWHA 3QIAA 2ZRIA 1UFQA 2Z6VA 2Z4SA 2ZREA 1A5TA 3FOZA 1OIXA 4TMVA 2BV3A 1GG2A 5FL7A 2V3CC 4GOJA 1JPNA 4B34A 1R4AA 2OFOA 3Q72A 2RGDA 2WJJA 2YNMA 2IYUA 3C7KA 3VNUA 1ZCBA 1T0JB 4JLMA 2A5JA 3MWKA 2QENA 1DE0A 2CK3D 2W2TA 1XJ0A 2GCOA 5JCPA 1CBUA 3D8BA 4MRSA 4HB4A 2ANBA 4MYHA 3VFDA 1F2TA 1G19A 2HDNB 4QJ4A 4PR0A 3C5CA 2VF8A 3WMEA 3SYNA 3NHBA 1W5TA 4ZKDA 2VO1A 1ZM3A 3L0IB 4XTCS 2IUUA 2W0SA 3QVUA 1U81A 3CRVA 1UADA 3AGPA 2ZI7A 2XEXA 4G5SA 4U00A 1RZ3A 5SZKB 1VCIA 4FINA 1C9KA 3ZVLA 1SVWA 2WKRA 1G41A 1KSHA 5BN5A 3U44B 4PSVA 3WNBA 4Y0AA 1UBCA 4RZ2A 2XXAB 2NZ8A 2VHUA 1LFDB 3O8RA 4QHTA 1XTKA 4Q03A 1KSGA 1G64A 1VYTA 1Z2CA 2RCNA 3AF1A 5K8UA 5JEEA 4LWZA 4PHFA 1U94A 2NMVA 1XFAA 1Z3IX 1L8QA 1E0KA 2DWPA 5BN4A 2ZROA 4PSKA 1Z06A 2KB0A 2VSXA 3T12A 2V6JA 4NCHA 4B3DA 5JRZA 5DHAA 3GLIA 1OFHA 3TNFA 4DDUA 2ZI5A 2VHJA 3MRSA 2ZSDA 4OHZA 1KI6A 4BZXA 1WBBA 4MRVA 2QG6A 4XOIA 3W90A 1W44A 3ZQJA 1HE8B 821PA 3QSYA 4XSGA 5G41A 3CZQA 5C46F 4B3CA 4U7DA 2WMNB 3H4MA 1JBKA 1X8JA 4L16A 2G1JA 3U3JA 3ADCA 4TLEA 3GEEA 3KTAA 1OIWA 4NYMQ 4OHXA 5FOXA 5DNYB 5AJWA 4EPYA 4TWZA 2WSMA 4LV6A 4OQNA 2R8RA 2N1BA 3Q3JB 1OXVA 4BLTA 1GITA 1C4OA 1N5IA 4HUTA 3RS3A 1PLJA 1KDRA 4LK2A 4IFEA 5HZHA 1Z0IA 2IUSA 1O3YA 2IYLD 2AHOA 2ZR9A 2Z0MA 1UEIA 5FBWB 3SEAA 2XNDA 4FCVA 3MJRA 1S9DA 1HQYE 2VL7A 4EPWA 4OQMA 3AF4A 3LAWA 4IOLA 2PJRA 2F9MA 3SJBA 4IEEA 1QG2A 1QHHB 4XTRA 2F55A 2CVHA 2YWHA 3KFXA 3QEOA 2QT1A 1Z28A 2QGNA 2IF0A 4HDOB 4JL8A 1TQDA 2D74A 3GFPA 3TSZA 3UIEA 4Q5IA 1E1RA 1KMHA 3RWOA 2PZGA 1X8LA 3RRNA 2GVZC 3I3SR 3TSWA 1R0XA 3KFVA 2V55B 4DC9A 5LD2B 4DIDA 3MLEA 2HXSA 221PA 1OE0A 2HT6A 2OV2A 3OE7D 2QE7A 1HA3A 4ILEA 4MUBA 4ARZA 2CNWD 2DPXA 1QHIA 3ASYA 2PZFA 1N5LA 2ZU6A 1W36D 1L7VC 1N6PA 2XTNA 1ELOA 3CF6R 2PL3A 3FYHA 1FTNA 2OCYC 3RLFA 1RE0A 2O8CB 2GK6A 4GDFA 2ZQ5A 2WKPA 2X1VA 4YLGA 1QF9A 3BS4A 4OK3A 3RYTC 3SYKA 1VTKA 3HPRA 1GNQA 1ZIPA 4G5QA 4QM7A 1DO2A 4QRHA 2ODBA 1QDEA 1Q1BA 3GLGE 4Q47A 3PITA 4I1SA 4Q01A 1KKMA 3LFUA 4U02A 1II9A 1RFLA 2JLZA 1NLYA 2X77A 2IX3A 4TZ0A 5EXTA 2XTMA 1US8B 1DPFA 2R65A 1XZQA 3FKSA 1TUEA 4I99A 4G3XA 4JLJA 2V1UA 5B57C 2GJAA 3AUXA 3BFVA 3Q85A 1RVDA 3H1TA 3H84A 3SDZA 1KNQA 3WYAA 3UG7A 1UKYA 3T5GA 1UF9A 3M1IA 2O8BA 5UKDA 2BBOA 2P6UA 3OFND 1VG0B 2XB2A 1NG9A 3O8DA 1U98A 1Z6XA 1NG1A 2QAGC 3ZDQA 1U0LA 1II0A 1GRRA 2JJ2A 1GSIA 3GJ3A 4TMXA 1Z5ZA 1GKUB 2ZS8A 2XZPA 2HF9A 3CIOA 4DLUA 1XDBA 2PX3A 3L0PA 1CR0A 3PEYA 2QTFA 4NCKA 2FWRA 2QEQA 4TYPA 2EFEB 1R6BX 2E1RA 1EG7A 3MG9A 3BERA 2OXRA 1NL3A 2ZTSA 2IYXA 1OXSC 1Q57A 4L9WA 1AK2A 1M7HA 2HJVA 5L8VA 1Z8FA 3KL4A 1ZM7A 1MKYA 2V4ZA 4MKHA 4DHEA 5KSOA 3BH7A 3OEHD 1VCMA 2GEUA 2HEIA 1ZD1A 4OJKA 3BAFA 3H0KA 2HV8A 3K8YA 5F9HA 1P6XA 2QP3A 4Q4HB 1L4YA 5CYOA 3W3ZB 3PG5A 4DT1A 3EPJA 1JEDA 4BRUA 5KNDA 4QGHA 2LKDA 3Q5DA 2QROA 3V9PA 1LNZA 2IC5A 3N2IA 2OHFA 4M53A 2IT1A 4P0TA 2J41A 2QY9A 5B2ZA 4EFLA 2JLXA 2A3RA 4BEJA 3DDCA 2OILA 2WOJA 4ZKEA 1R8SA 4A8JB 4Z51A 3F5FA 2VEDA 5FL7D 3ZLJA 1I2MA 4B35A 2DY1A 3SYLA 2D4HA 1HEIA 4TZ6A 2GAOA 3K0AA 3REFA 1CJVC 3KJEA 2VP9A 1NSFA 2A2ZA 4XSHA 3U4QB 1Z0DA 4RZUA 4GL2A 4LBYA 1KHTA 1IN5A 4ESVA 1S9HA 2CEAA 4ITRC 5TB5A 1XCPA 4I81A 5FOWA 4BFSA 2NTYC 3NC0C 2BMDA 1RPZA 4MH0R 1AS0A 1O87A 1ZNXA 4HDCA 2JCSA 3BFXA 4ZCMA 1WBDA 5FH9A 4LUCA 3AKYA 3FB4A 1EX6A 4BGDA 3L0OA 4WZAE 2OG2A 4RD1A 4B3GA 1GKYA 4G0NA 3MWLA 1FTSA 4DUGA 1R8QA 2UVQA 3K9NA 1GUAA 3K09A 4LHYA 4YMTA 4JKIA 1ZRHA 4FMDB 2QMHA 4FMCF 4JVLA 2C8VA 5TARA 4JS0A 1NN5A 4HUQB 4M9SA 2Q3HA 4URVR 3WRXC 5TVKA 3BB1A 4L5BA 4A4DA 2OE2A 1E94E 4JT4A 1P62B 2NPIA 2Q9BA 1P61B 3EC1A 1BYIA 3MSXA 1G3MA 2GZDA 2Q6TA 2CHQA 5JS8A 2JLUA 1OH5A 1NVUQ 2ONJA 1J99A 1F60A 1G4AE 1QHSA 1W46A 3VHLB 5C2JB 4QC2A 2W2XA 4HAUA 3EPHA 2PMKA 3LNCA 2O8EB 4YC7A 1J8MF 2PT5A 2OXCA 3EASA 3HJNA 3TSOA 4NHOA 2FU5C 5EQTA 1N0WA 5EP4A 3K0FB 1E2PA 3K70C 1ZVQA 1A1VA 1JXOA 3IIKA 2ONKA 2BVNA 5L3QA 1BS1A 3PEWA 1Z0AA 3I8SA 3X1XA 1X8KA 3THXB 4PAOA 2O8FA 1KY3A 5G40A 3AKDA 4A36A 2XNDD 2YJTD 2P2LA 5IT5A 3WYFA 2Q9AA 3KXLA 1XXHE 4LPKA 1DG3A 1OFUX 1VDZA 1TU3A 1FL9A 1OJLA 1UKZA 1QRAA 3LV8A 4Q19A 2P5SA 1TU4A 5L3SB 3WYGA 1E1RD 3GLGB 5AUOB 3PUXA 5A5GA 1D2EA 1XB2A 5HR5A 3IQXA 1XRJA 3MJHA 4KLNA 4C0KA 3R8FA 1G5RA 3GLHE 4X8LA 2IYZA 3WMGA 4B2PA 5JJLA 4N0DA 1E2MA 3FFBA 1EFUA 1X1SA 1Q0UA 4MGKR 2QE7D 1SXJE 3EZ2A 4JLVA 1IJEA 2XZLA 4UNPA 1YJ5A 1VIYA 1YRBA 4B74A 4JZKA 1ZP6A 4UJ3A 1GL6A 4P32A 4QNMA 1T4GA 3Q7PA 4CW7A 2C5LA 2VP6A 1U8AA 2G83A 3LQQA 3W34A 4RFSA 4B3BA 2NOAA 1R7RA 3TLXA 4X8HA 1JQJC 1X86B 2UZ3A 3RS7A 2VYFA 2DBYA 2ZRNA 2IK8A 5P21A 1CULC 4CDGA 3EWAA 1R5NA 2ZI4A 3HU3A 1XMSA 2ANCA 1XPRA 2XXAA 3FKSD 1TX4B 2EFCB 1FMLA 2RHMA 2OZEA 3ICEA 1IY1A 3NDPA 2BEJA 2R44A 2XSZD 3QY0A 5AUQA 2JA1A 1Q20A 1ZMXA 1UBFA 3AKCA 1SVLA 1YR7A 4L4UA 2QGZA 1RRGA 1TMKA 2QTHA 2EVWX 1KI1A 1NY5A 1S4QA 1KK3A 1OF1A 4LJYA 2VP5A 1P60A 3TVDA 4HLQB 4M22A 2AWNA 4OI0A 1HYQA 1LF5A 3DM9B 1KNXA 2JJ2D 2QPOA 3GJ5A 1KKLA 1JNYA 3QXCA 4B2IA 3KQNA 2QP4A 4DLWA 2WJGA 2QAGB 3VR2A 3GLFA 4RZ3A 2ZE7A 3F8TA 1ZBDA 2P65A 3IEVA 1KTVA 1BIFA 3PQCA 2HUPA 3GPLA 1OXUA 4UJ5A 4EIWA 1JR6A 4BQSA 4Q9LA 2B21A 2ZI6A 1HE1C 1GRNA 1DAKA 4Z54A 5HPYB 1WDTA 4RD4A 4KO8A 1NLZA 3BGWA 3CZPA 5FUXA 4O3MA 1P72A 2A5YB 1GZSA 5D3MA 4W9MC 4KYUA 2VHQA 3HDTA 3NVAA 4LHVA 3QBVA 3SFZA 1DAIA 2VHCA 2I1QA 2N42A 2QI9C 1W48A 3EC2A 5H8WA 3GMTA 3EG5A 4LV5B 3THYB 1QHHA 3LXRA 1NVVQ 3WBKA 4JIMA 1FUKA 4JVNA 421PA 3I73A 2IHYA 1SKQA 1Q1ZA 3NIBA 1WXQA 1G5TA 1KOFA 2OBLA 4JLBA 4E03A 3KKMA 3UMSA 1M74A 1VCOA 1NMZA 2AXNA 2J1LA 1N6RA 2HJGA 4YQFA 3AP2A 3TRFA 4N1AA 5KNCA 1HURA 2FFBA 2ZUDA 1NBMA 4HLUA 3QXSA 3AKEA 1M2OB 2RGCA 3MCAA 5FOUA 3WY9A 4B43A 4M4SA 1KDTA 3IDQA 1H8EA 4K46A 3AVOA 5KDDA 4YMVA 2AL7A 1AKYA 2BJWA 2W6JA 1ZM9A 4BLRA 2ORIA 4A2QA 4US2R 5B30A 1D9ZA 3EX7C 1L2TA 2ZRBA 1AKEA 2IA5A 3I8XA 4MQBA 1M1YE 3RNLA 4KU4A 3PIRA 3OIWA 2OSBA 4ACBA 3AVPA 2MMGA 3WMFA 4DBLC 5GJWC 4KJZA 1N3BA 3ZD7A 3QPWA 3OIVA 5JRJA 2P6NA 3RS0A 3K70D 3K0CC 3LA6A 4DUGD 5J40A 1TQ6A 3D6TB 3I5XA 1D2MA 4OI4A 4C0AC 2RGEA 4Q7JB 4Q9KA 1A4RA 2OM2A 1EK0A 2ZR0A 4IEIA 1NI3A 4CEHA 3KXKA 3A37A 1UDXA 1B23P 2QNRA 2PEZA 1UBGA 3NEJA 3P4XA 4Q1BA 2YOFA 4II7A 4Q21A 2IWHA 2ZJZA 1ZW6A 3QXHA 5EP3A 4ZIRB 1GTVA 2BCJQ 4HZIA 1ZYUA 1M7GA 3UANA 4HLUC 2YC4C 1WP9A 3P26A 3AUYA 2R6GA 2BMFA 5FR2A 4JSTA 3UK6A 1WB9A 2C9OA 1OHHA 2V6IA 1G5PA 4CEJB 3LQRA 1RRCA 1W4CA 4UXHA 1E2IA 4FIDA 2OT3B 1G3UA 2FGJA 3AH8A 3FMFA 3ETLA 5CB6A 5F98A 2AR7A 3P20A 3DM5A 3T1QA 4JT2A 4NYIQ 1IONA 4O2RA 2EWVA 1G8FA 1XCGB 1XEXB 3C15C 2H5EA 2GEDA 5DYGA 3FMIA 3ASZA 4KSBA 1E9AA 2HCBA 4Q1DA 2K5UA 4EPXA 3I61A 4IOKA 1G7SA 4PO9A 3RS4A 2VTKA 1KJYA 4PQRA 3GJXC 4IJMA 3IKJA 2F1JA 1G7RA 1AZSC 1E9FA 1S1CA 1EFCA 1MV5A 5ELXA 1W36C 2ZAMA 2IXGA 4DJTA 2R6DA 3CBQA 3FWYA 3GFOA 3AVTA 1E79A 2YWFA 2REBA 3EZ6A 3U5ZB 5IDVA 1ETUA 1PJRA 3WRYC 2TMKA 4C3ZA 1E2KA 1KI8A 5FFMA 4NKRA 4WW0A 2B6HA 3CF2A 4PQFA 1E0AA 3A1WA 4DZZA 1KSJA 3BC1A 1YZTA 4TTPA 3QG1A 3W3AA 2X2FA 4DIEA 3AVUA 1J7KA 1XD8A 2QQEA 5D3QA 5EP1A 2DFNA 2VQSA 2FDCA 4TLCA 2NIPA 4XD7A 1U0JA 3EZFA 1N5KA 3UWKA 1G291 2GESA 2A30A 4MKFA 2QTVB 2GJ8A 4WZBE 2J87A 3GJ6A 4D0NA 1K8RA 2X19A 4DCNA 4WXRA 1T6NA 1CKEA 3GCGA 3B9PA 4JBWA 5SZJA 3BOSA 1FP6A 4B6EA 5CIQA 1E32A 1VECA 3AQ4A 3MUFA 3KXIA 2CLSA 3OAAA 2R2AA 4YONB 4D26A 4OHWA 3B6EA 2VP4A 1GILA 3ZGXA 1XX6A 1R10A 4MRRA 3VR6A 2IYVA 4PHGA 1SVKA 5BN3A 2VF7A 1ZUNB 1ZJ6A 2MMCA 5FPTA 3RDPA 2IYRA 4F91B 3V4FA 4NL4H 5KYKA 2IEYA 3NG1A 3R9IA 1XMJA 4G01B 5LPNA 2MSCB 1QG4A 1OYYA 3CRQA 4DDVA 1TTTA 3TQFA 3CR7A 3Q8XB 1NMYA 2BM1A 5GJBA 1OT3A 4UNSA 3UMFA 3NBYC 4BLPA 5JSZB 1AJEA 3UKDA 5C18A 2CCJA 3C14C 1OLOA 1YZQA 3AF0A 1XPUA 4JVMA 5KUTA 3T1VA 3HPQA 4ESHA 3SZRA 3QPUA 4P4SB 1EX7A 1FPMA 4GOKA 3FHTA 1RJ9B 3ZJYA 1SQ5A 3L8ZA 4Q7KA 4AYTA 2UZIR 3LH5A 3B9QA 4QL3A 2QUZA 2G77B 4LY6A 3KB2A 2Q3MA 1MO6A 1YRAA 4EUNA 4TQAA 2PBRA 1SVIA 4LYHA 2IYQA 1MOZA 3CM0A 2O8EA 5E95A 3JZAA 5LB4A 3A4MA 1RKBA 3B2EA 3Q5EA 1KY2A 1WCV1 2IYWA 4JLNA 1NSTA 2W83A 2ZRKA 2WAYA 4LJ5A 3SJCA 3EZ9A 4RD6A 3VAAA 1P2UA 4S2EA 2ZRCA 4TT3A 1KSFX 4JMPA 1R0ZA 2BBTA 1JEEA 3TGPA 1E98A 2OAP1 4UNQA 3FPAA 1HV8A 4TMKA 4BZPA 1KJWA 4URZR 4BFWA 3J81k 4KITB 1UM8A 1GOTA 4IDPA 4RCYA 4NMMA 4JYCA 3QKSB 5FBVB 3GP8A 1E6CA 5J4HA 4EFMA 4HAVA 2PT7A 3ADDA 5TDHA 3GQBA 1KI9A 5FTJA 4XWOA 3SU8A 2ZYUX 1X3SA 2BBSA 4DRZA 4V03A 2GBLA 5K8TA 3GLGA 1BMFA 3KB1A 1QHXA 4RD3A 5DSZA 2BMJA 3A6PC 2PMDA 1DAFA 2ZJYA 2B8WA 2B92A 1FX0A 4Q4AB 4D25A 1P4SA 4KAXA 4KSCA 2EFGA 1N2CE 3TW8B 3OESA 1KK1A 4JSYA 2VP2A 3G82C 3RRMA 5E3HA 1II8A 2GWHA 2H57A 3CWZA 4AURA 1NBMD 4C0SA 4EAQA 2J7PA 2RGAA 4U5XA 4F4JA 3U6BA 2GA8A 1H8ED 1G3IA 4UXIA 4MYUA 2Z5FA 2W6JD 3B1ZA 4Q1CA 4RVCA 2CJWB 1LTQA 5EZ5A 4B3FX 3NDBB 1XZPA 2OCAA 1FZQA 2WSSD 1GNPA 4AK9A 3S1AB 2QN6A 3KKQA 1G9XA 3U6KA 4EPRA 4Z8XA 1VG8A 1F5NA 3A1UA 3NWJA 1GFIA 1KYIA 1DAEA 4Q1AA 3SJZA 5K8IA 2B7BA 4HSEA 3KQKA 4TL6A 3NHAA 1S0UA 5DHFA 1E2QA 2ZSFA 4FMDF 4L9SA 3FVQA 4NCIA 2ZS7A 5HZKA 1HQCA 1QVAA 1HY3A 1DBSA 1Q44A 4FN5A 1DAHA 3CRRA 3JVVA 1L4UA 4MRPA 3PJRA 4ZDJA 2J46A 5JFGA 3ZS9A 2FPKA 3UMRA 3EZ7A 4GMXA 1Z6YA 4HLCA 3V4RA 4OHYA 1AN0A 1H8HD 4LX0A 5G3ZA 3I5YA 1OHHD 3P27A 5HCNA 3UXMA 3H86A 1A2BA 5L3VA 1JR3A 3NBZC 1I4LD 1S96A 4LZZA 1M8PA 2H92A 1E2FA 5TV2A 4TMZA 2DYKA 1W49A 1ZD8A 2FG5A 1UPTA 2WJVA 3LX8A 4LBWA 5TY0A 2PCJA 4W5JA 2IXFA 4M9ZA 2KBFA 2VRWA 2QBYA 4MDFA 3IGFA 4FI3C 1PUJA 1GIAA 1XD9A 1HH4A 521PA 4GSYA 1H65A 2CL6X 2XTZA 1XJCA 2ZRFA 4IHQA 1P3JA 1TUIA 5DI3B 1IY0A 2ZYVX 1S8FA 1E99A 1RYFA 1XF9A 2CMKA 4NYJR 4HB3A 2F1HA 4UKDA 3KKPA 5CITA 1DELA 4PSAA 3SBEA 2JLWA 4KBGA 2ZRJA 1WA5A 2V9PA 4BFXA 3CLVA 3CPEA 1P9WA 1G3RA 2QT0A 5DO9A 5JI3E 2DFKB 2CL7X 2JEOA 3GJ0A 3QF4B 3T5DA 4QOSA 1E79D 4A9AA 2IL1A 5TXGA 2HXYA 1PV4A 4FWIB 2OCPA 2V1XA 4B6FA 1G7CA 2XJ4A 4K81B 1W36B 1CEEA 1G18A 3CPHA 1IXZA 1MO4A 4DSOA 3THYA 2ZUBA 4H1UA 4GMDA 5JCZA 5DE3A 2J0UA 2GXAA 4TSFA 1W4RA 2AD1A 2BM0A 3BK7A 1G8HA 2C98A 2YOHA 2E9SA 4TLBA 1SKYB 4E22A 1G8PA 1FFHA 4JLOA 5DN6A 2W58A 2JLYA 3BB3A 4XD7D 1LVGA 1F2UB 3IILA 4LV8B 1G7TA 1EGAA 1CJMA 3BBPA 1ZU4A 4N3NA 2CDNA 2SHKA 3ZYCA 4W5WA 2P0EA 5C4MA 4NONA 1YZNA 1OKKA 1D6JA 2G9NA 3FKQA 2O5VA 3WXMA 5A4JA 4C7OB 3OAAD 2FA9A 4G5OA 1S2MA 3DMDA 4I1VA 2G88A 4R7ZA 4WIAA 5J47A 4GP7A 1RIFA 4A82A 1N6KA 1GP2A 1FNNA 2N46A 4WOPA 2J0QA 2IW3A 4D4KA 4D81A 1EWRA 4Y0VA 4C30A 5F3WB 5JWRA 2ZYWX 3C41J 2GJKA 2OBNA 4V0ME 4DKXA 4EDHA 4HZUA 5EE3A 2C9YA 3K1JA 3SS8A 1TF7A 4AYWA 1XTIA 1Q1QA 2FFQA 3EWSA 3B8HA 4F7WA 4EQ6A 2ASEA 3GD7A 3IO5A 3PVSA 1CR1A 4LC0A 4BLSA 4EJSA 4ZIRA 4AI6A 1YZGA 4URUR 4YDHB 3NH6A 3VTKA 4IDOA 1NN1A 1M34E 1XXHA 4B71A 2JAQA 3QPVA 4WAUA 3PFIA 5BYJA 3K9LA 5FPKA 3B7GA 2ZRDA 4WXPA 1D2NA 1QBKC 3DZDA 4KODA 5CK5A 4P31A 5FOVA 4QJ5A 1IN4A 4HI0E 1P9RA 5FPYA 3SJAA 3SFVA 2DHRA 4OBEA 3ADKA 1KO4A 3W8RA 1E0SA 3GLHA 1OH8A 4ZDKA 2EFDB 1XTSA 4LBZA 1UKEA 3M4YA 4BUJA 4CF7A 1MRNA 3THOA 3QKRA 4TT3D 3HU2A 1CJKC 4DXAA 5BYKA 4NE2A 1E1QA 5FTLA 2ZSAA 1ZC4A 3T06B 4GRAA 1SXJA 1TQ4A 4NCJA 1G21E 1DG1G 4HB0A 4Z1MA 2V54A 4M1MA 3O8CA 1IJFA 1DO0A 4CGZA 2GCOB 1GWNA 3LX5A 4J0QA 1F2TB 2OAQ1 4Q9JA 3R9WA 3PUZA 1Q21A 3ADBA 1BMFD 1VG9B 1T3HA 2CLCX 4IVRA 4QXAA 4URWR 4EFNA 5J4KA 3UWOA 1KK0A 3K09C 1N25A 4NPHA 1V5WA 3FGNA 4OHVA 1TF5A 4RD0A 4UNRA 2R62A 3AVQA 1XEFA 2YKGA 2GKSA 3FE2A 1D9XA 3VU9A 3SR0A 2F7SA 5CDFE 1XD2B 4O25A 2QP9X 4AC9A 2YINC 4CEIB 2ZU0C 2J7PD 3VR1A 2Y8EA 1HUQA 1DAMA 2FJUA 3C4JA 4IFBA 4I1UA 3L82B 2FSHA 2WKQA 5JWHA 3W5IA 3EIHA 2WAXA 2WWWA 2ZJ2A 4KVAA 3A36A 1U9IA 2R9VA 4E07A 3CUEF 1VKJA 3LW7A 5KTYA 1ZIOA 2VP0A 2QL6A 3P4YA 2DR3A 2GHIA 1EFRA 4DEYA 3EIQA 3TK1A 3B82A 3EIEA 4RJLA 1CR4A 5FTKA 5KU1A 3NKVA 2G1KA 2J9RA 3I72A 3SOPA 1VPLA 1KI6B 1Q3TA 1NVXQ 2ZPTX 1ZINA 1UAAA 4BE7B 2H18A 3SQWA 3CR8A 2QPAA 2WVJA 2GK7A 3KKNA 2QPTA 4Q1FA 1Z6AA 4MYTA 3ZIAA 1X1RA 2GXUA 1HT1E 4BECA 5JHGB 3B5JA 2Q3FA 2C96A 2WWGA 3CX8A 3KTAB 4XVQA 4CYMA 5JZVA 3NTUA 2JIZA 2PLFA 3TVTA 2BKEA 2AN9A 4XH9B 1E2NA 1NLFA 1SGWA 4P4SA 5G3YA 4DLZA 2YHSA 2ZRGA 2ZXUA 3WP0A 4TYWA 4JYBA 5KHOC 3I32A 1JR3D 4D80A 5BW8A 3QE0A 3RAPR 4QM6A 5FOTA 1QZXA 1TEVA 1MO3A 4NZYA 3OEEA 4AG5A 2Q0HA 2O8DB 1FMJA 1IAQA 3Q7QA 2CVFA 4NBSA 4B73A 4DB4A 3U44A 1E69A 1G1MA 1AQUA 1G8YA 2QSYA 1W47A 1TNDA 1KMHB 1NJFA 2R6FA 3JVUA 2RKOA 1LS6A 1OW3B 2YZ2A 4WVFA 2YWGA 3QVVA 1Q22A 1GL9B 3L2OB 2A9KA 2FGKA 1Y3AA 3B60A 2FX3A 3U61B 4MDEA 1VHTA 3SHFA 4GI7A 3X1YA 1CIPA 2QQ0A 3HR7A 2RHDA 3CWQA 1KJZA 3QOFA 4ARZB 3CPJB 2ZRAA 3LW8A 2FPLA 2LCFA 2YYZA 2GRJA 3QKSA 4HATA 4D82A 4QHYA 4LI0A 2D06A 1KAGA 5IK2A 2YOGA 3HR8A 1TL7C 4D4JA 4LHXA 4G5RA 2GZHA 3VMFA 2KSQA 4DLYA 3HWSA 4TSFD 4TYYA 3AP1A 3LLUA 4BFTA 721PA 2BWJA 2J3EA 4KFUA 2HLDA 2WWFA 4ASUA 1OFIA 2JJ1A 2AKYA 2PCLA 1R0YA 4HYYA 3R8CA 5DN6D 3HYTA 3PR1A 5GVRA 3ICQB 1XEWX 5BQ5A 4C2TA 2G0TA 2LKCA 2A5DA 2I4IA 5KO2A 2OBMA 4KBFA 1AZTA 4F93B 3K9GA 1UEJA 3BFKA 2P6RA 3ZS8A 5B58C 5CM8B 1UBEA 3QJYA 3FMPB 1OKKD 2VPPA 3R9XA 5JJKA 5FI1B 5DYIA 4JVSB 2C99A 2EQBA 4A0FA 4D4MA 1G16A 4L15A 1KI4A 1E2LA 2REXB 4CZ2A 1NNEA 1CJTC 3D7MA 3I4LA 3M6AA 3I1FA 4R2IA 4TL7A 2O8BB 4NTZA 5KSPA 1PLKA 3KUCA 1GKIA 4Q1EA 3SHWA 1EESA 2RH5A 3QXXA 2BIFA 3LBNA 3CRMA 2OFXA 1I4DD 1NF3A 3QXJA 3THWB 2R6AA 2BJVA 1KI2A 2H17A 3CX7A 2WICA 1R5BA 2JASA 2WIBA 2JATA 1T0HB 3A1SA 4QBGB 1G3QA 4QG7A 3A8TA 4OQFA 3Q9LA 4PPQA 4POAA 3WBJA 1J90A 4D0LB 1P75A 3B1YA 3OZXA 3E5HA 3AVXA 2QMUA 1W2HA 2QRNA 4MUAA 1FW6A 1U8YA 1OB5A 1ZU5A 2WZQA 3KQLA 2VBCA 1F6BA 2O8CA 5E7JA 4IOJA 2WJYA 3K9HA 3BH6A 3T1OA 1E2JA 3U3MA 2WWIA 2OUKA 3A1TA 4I4LA 2B8TA 2ZE6A 3DPUA 1CRQA 3OF5A 4DWJA 1G4UR 2ZRHA 5JMTA 3LRPA 4BRWA 2WV9A 4C0JA 1W1WA 4RKEA 4DT1B 3VNVA 4IDNA 1T8UA 3IHLA 2GJSA 4JLAA 2AFHE 1AGPA 5K8LA 1GVNB 1BOFA 4ZI3A 3RS5A 1LB1B 2J0SA 2ZSBA 3G5UA 2WMOB 4US0R 4BWYA 1US8A 1Z29A 2RB4A 4EPTA 2AK2A 5CLLA 3SBDA 2GDJA 3A58B 1E0JA 1XTJA 1E1QD 5FR1A 2EYUA 4OI1A 1HTWA 2AWOA 3QENA 5GJCA 1W4AA 5HCIA 3GLFE 1SXJD 2IS2A 4AKGA 4CRWB 1PLLA 1XP8A 4M1TA 4AY2A 1ZAKA 1ZM4A 2ZEJA 4H1VA 4A2PA 3K0AB 1TF2A 3ZZUA 1TQ2A 3U7HB 4Z1MD 2FEMA 2IWRA 3WNCA 2ODWA 4KYIB 3TUIC 2J7KA 3QF4A 5FBLB 2JLSA 4DLRA 2Z83A 2DFTA 3U3RA 1AM4D 1S3GA 1EFHA 3CF0A 4JLKA 2IS1A 4XVUA 1FOEB 4P4TA 3H2YA 2Z43A 2QU8A 2NO7A 2NPFA 5FTMA 4DCVA 1CU1A 2AFIE 4DLTA 4M1KA 5IF9A 2PZEA 1YR6A 5EJEA 2FSIA 1RRPA 1S3SA 1Z08A 1A2KC 3GEIA 3HP1A 4YMWA 2EWWA 3K70B 1A7JA 2QAJA 2XITA 2F3RA 1E2EA 2RGNA 4MA4A 3EPLA 3TE6A 4JJZA 1CJUC 4PC1A 2FOLA 3DVLA 3PUYA 3RSOA 4Q4HA 3KQHA 1VHLA 2GXSA 4MKIA 3LVQE 3BB4A 1NBME 2EU8A 1IXRC 1XTQA 2RMKA 1VYVA 5EUMA 4KI0A 4F4IA 3AVVA 2QM8A 1EFRD 3QEJA 5AR1A 3ZVMA 1UDWA 2W00A 4HAWA 4A8JA 1NRJB 1VCNA 3CH4B 4KFSA 1E4VA 4LCBA 2Q9CA 2AKAB 3FFAA 4EPVA 4IDHA 4TLAA 3BORA 4DCSA 4XWKA 4S35A 2FNAA 2NQ2C 2WJHA 2Z4RA 3W6NA 4GPTA 3U4QA 1ZD9A 4AWXA 1W0KA 5KPDA 4LJAA 5DIFA 2ZUCA 3ZIAD 5JBQA 1M6NA 4JL6A 4LOAA 5AWFC 2O0KA 4RZXA 3KJGA 4DDWA 2JIZD 5KSZA 4DSUA 1E2HA 2C04A 4ZV4A 2YVUA 1JJVA 1A82A 1KDPA 2BDTA 2BOVA 3KJHA 4V0KA 4TQ9A 4Q9IA 3QBTA 4DSTA 5JS7A 4DDTA 1R0WA 3AB3A 2O8FB 4RKFA 1DS6A 1VIAA 1XCMA 3VR4A 2DB3A 1MT0A 2ZITA 2R6CA 3N2EA 5SZIA 4F38A 3OEED 1EXMA 3WNDA 5KDOA 1KO7A 4Q00A 1YR9A 4PC7A 1GM5A 3W5JA 1DADA 2WBLC 3EA5A 3IHWA 1SKYE 5CYPA 3R7WB 4A8JC 4UXJA 2UKDA 3MD0A 4WA7A 2NGRA 1M7BA 4F4CA 1WQ1R 4D4LA 4PHTA 4BFUA 3EPKA 4HUQA 1EWQA 2HYIC 4R9UC 3PV0A 3DMNA 4PHHA 1LY1A 1XTRA 4AKIA 4ZCIA 1KZ7B 5EXXA 2F1IA 1J70A 4PZLA 2WJIA 2QMOA 1NN0A 5AUPB 3LBIA 5HTKA 121PA 5E7IA 4NP6A 5SZHB 1CF4A 1AA9A 4XWAA 2A78A 1N0VC 5HE9A 1DARA 5FUYA 1FQJA 3QKTA 3U7GA 3DOEA 1COWA 3LBHA 4ZDIA 5EXSA 1S1MA 1T3SA 1E9CA 1VG1A 1ZUIA 4TN1A 5IK2D 3X1ZA 2DWOA 1OSNA 1ZM2A 4V0LA 4W7SA 2GAAA 3TMKA 1Y63A 2GJ9A 4WZ6A 2IHBA 5H70A 4Q4JB 4DLXA 1NIJA 3K0FA 2ZANA 3LXXA 4IVPA 5KPJA 2WWYA 5DLQC 1NIPA 2HLDD 4ASUD 4B76A 1PZNA 2HF8A 2JJ1D 4FD2A 3LLMA 2OCBA 3TAUA 4FCTA 1T3LA 1OXTA 4A15A 3CX6A 3UPUA 3THXA 4YDSA 4PX9A 3C8UA 4C9BA 4TYNA 1IHUA 1OIVA 1XD2A 1KK2A 2ERXA 2DFLA 4I1OA 4PC3A 2IUTA 5CLQA 4LRWA 4MITA 4BASA 5EE9A 2KBEA 1Q1EA 4CEIA 1NKTA 2ORVA 4OJQA 2AX4A 4KV9A 2PLRA 3AF2A 4F92B 4GNKA 4B48A 5AJVB 4KFRA 3LDAA 2L0XA 3DHWC 4LSGA 4B32A 4DCUA 4JBXA 4X8MA 4TL8A 4C0HA 5AJZA 5L3SA 2GVDC 4HAXA 5M04A 3T35A 4DVGA 1N6IA 1N6HA 3GJ4A 4QHSA 3VHXA 2F6RA 3CO5A 1SVSA 5EE0A 2A5FA 1YR8A 2B7CA 3BJIC 1F3OA 3NBFA 3QKUA 5AJXA 3G0HA 5FPHA 3RC8A 3VKHA 3DL0A 3AM1A 5LB2A 4YMSA 4OI2A 3AVWA 4QBFA 4ZI2A 2CHVA 5IRCD 2X8AA 2GZAA 1N6NA 3GLFB 4GZMA 2JLVA 3RHFA 4NYJQ 4MGYR 3VR3A 2H16A 3ZD6A 4O0MA 1P73A 2RGXA 1KGDA 1XBTA 1PVOA 4IKEA 2XZOA 2V7QA 4FMBB 4LYFA 5GVSA 4PAMA 3FHOA 1GNRA 3NC1C 3NH9A 5DH9A 5FUWA 4TMTA 1YE8A 1ANKA 1E2DA 4M1SA 5D3MB 4PO8A 3EAQA 1QVRA 2NG1A 1IN6A 3TJZA 3AEZA 2GBLC 4QFMA 4D6PA 4QGAA 3K53A 1KO1A 2O8DA 2XB4A 4CT5A 3HU1A 4RY2A 1P2TA 2ZJ8A 1Z83A 2XGJA 2IS6A 2CE7A 4JLDA 3RRZA 3QNUA 4XVRA 3RS2A 1XPOA 4Q7LA 2H8KA 1DTSA 2ZRLA 4NH0A 4AKHA 3B85A 2RGBA 4HLDA 1GRQA 1KZGB 3NBXX 2I1VB 2KJQA 2CXXA 3BE4A 3IPYA 3ZQ6A 3QI2A 5A0FA 5F2EA 3PEUA 4BFZA 4LYAA 1ODFA 5JJIA 3R20A 2DCUA 1V43A 2F1RA 4PFSA 1IN7A 5FI0B 3UATA 2C9CA 2FSGA 2VSOA 3IIJA 4EKDA 2ZAOA 4OYHA 3SQXA 4OK5A 3ZVNA 2CE2X 4M9QA 1CR2A 2QAGA 1WMSA 1K6MA 3GLIE 3TR5A 3T15A 5J4VA 2VIIA 621PA 3U2QA 4OL0A 1KAOA 2FF7A 4QBHA 4LC1A 4NYMR 2FPMA 1ESMA 3BD9A 4KLZA 2O52A 4V0MA 2XOKA 1E3MA 3O47A 1LF0A 4Q9HA 5HKKA 1JQLB 1NVWQ 3TQCA 2IBMA 2OEPA 4FWTA 4CEHB 1N0UA 4M21A 5C4GB 2KWIA 2FZ4A 1JJ7A 1U90A 1P2VA 2ECKA 4OKSA 4PZYA 5AK0A 5EUQB 3AVYA 1CLUA 2WHXA 2D2FA 3LD9A 2XSZA 3E1SA 2C77A 2FE4A 2IF2A 2Q21A 3X1DA 1AS3A 1FUUA 4QNRA 4TQUS 1PUIA 3W9YA 4PPNA 1P5ZB 2YV5A 4GBMA 5GADl 1J8YF 1OV4A 2PEYA 3KKOA 3U3OA 3ZVRA 3THWA 4E09A 1OFTA 4Z8YA 3RABA 3VX4A 1Z0FA 4PANA 5LBIA 1MABB 4LJ7A 1G6OA 4PPGA 1IOZA 1W0KD 4YXWA 1QHNA 1QHGA 3D31A 5DISB 2ZR7A 2ATXA 1FP7A 2JDIA 5CJPA 4KHZA 3IBGA 4BEBA 4V02A 4AD8A 1E4YA 2GF9A 4QKQA 2CCGA 2BEKA 2WPDA 2REOA 3CNOA 1T5LA 1AQYA 1AS2A 4ZO4A 1LV7A 2C2HA 1ZUHA 5CJ2A 2JLQA 4HEJA 5HE8A 4ACAA 2W6IA 3MWJA 2ZRMA 3MAAC 1IQPA 3EARA 1RW4A 3IQWA 4AIIA 1E9RA 1J2JA 1JR3E 2O0HA 3REGA 3ZZ0A 4AYXA 4URYR 3DKPA 1JXMA 1MRSA 1D8TA 3C16C 3TAHA 4HAYA 3ND9A 1OYWA 1MH1A 3PCRB 3CKLA 1XMVA 2GF0A 4Q18A 3WHKA 4A0HA 5CDFA 1JPJA 2ZJBA 4LHZA 4R2HA 4W5HA 1KO8A 4V0NA 2G6BA 3RSLA 1E9SA 3X2SA 4CEJA 3WP1B 5KDLA 4OQXA 4AKEA 1RC8A 2F43B 3M0EA 1COWD 4PZZA 4KCGA 4M1OA 2ZVPX 1ZC3A 1U0HC 4M2LA 5DGXA 1K5DA 5JECA 2J45A 4TL9A 1UJ2A 3K0EA 3AF3A 4ON9A 4OQLA 3RVBA 2NO6A 4XIGS 5IHPA 4G1UC 3GJ8A 3MFYA 2BMEA 1XEXA 2X2EA 2GXQA 3BIFA 3IIMA 2ATVA 5AUNB 1EFTA 1W0JA 5J4YA 3I92A 4ZCLA 2WOOA 5EXPA 2QA5A 2PH1A 4PAQA 1DAGA 2WTUA 1U2RA 4EJSC 4QGFA 4JLPA 1NN3A 1NY6A 4LDJA 1R5OA 3CONA 3DEFA 2YWEA 3FDIA 4JL5A 4LJ6A 4LJ8A 2G0NA 1CXZA 1IM2A 2GTPA 3KJIA 4Q48A 4C4PA 1MO5A 2NO0A 5KSYA 3LWNA 4M9XA 1WE2A 2EW1A 1GDDA 3CB4A 5GJVC 3L8YA 3AV0B 2IS4A 1YKSA 4PPFA 4A0GA 1T8TA 4GT1A 3KQUA 1E9EA 1W7AA 4LBVA 2PJZA 4RD2A 1KI7A 2VHTA 3DO6A 3PUWA 3VQTA 3LY5A 2V8OA 1XEWY 1KDOA 3VKWA 4H9GA 1YZUA 2FFHA 5JLJA 4PXAA 4PC6A 2QMEA 2WM9B 3T1TA 4RFSB 2HCJB 1CTQA 3BXZA 5DI9A 4M0LA 3SNHA 1SXJC 4ZPXA 1C1YA 3KUDA 4R98A 2C78A 1TEXA 4B47A 2D62A 3RRYA 2P3SA 1YZLA 2V7QD 1JI0A 2YC2C 5LDDC 4IXNA 2C95A 2DWQA 1NP6A 3JZMA 4HAZA 2EFHB 5EZ6B 2OLKA 4LPSA 1OH6A 2I3BA 3GLIB 2GETA 3VKGA 2GEVA 3PEVA 4LYJA 4NDZA 5JWOA 4LHWA 2J59A 3AP3A 3CNLA 1P2SA 1XNJA 3PUVA 3QQ5A 3GJ7A 6Q21A 1AIPA 4MYCA 2ZI9A 3R7WA 3B1WA 4RFVA 1AGRA 2VH5R 1SHZA 4IOMA 2D3WA 5E4FA 4B3XA 3RC3A 3B1XA 3SI7A 4DEXA 2PX0A 5JSZA 1E96A 4A6XA 1KO5A 1FX0B 3ND8A 4BFVA 3TBKA 4JKYA 1OH7A 1RJ9A 3MMPA 5H1YA 1XMIA 1OB2A 3E2IA 1D5CA 1II8B 2KE5A 4IVQA 5BWMA 1U9IC 2CLDX 1TADA 1BKDR 1XJQA 2FSFA 2QZ4A 4FW9A 4A1FA 1FQKA 1R2QA 4DCTA 2FEOA 4P4UA 1XWIA 3CNNA 5ANRB 3TH5A 4CVNA 1WF3A 2AK3A 1DEKA 1W2GA 1W5SA 4JBYA 3DZ8A 3U60B 2ERYA 4HDQB 4DLVA 4BLQA 1OXXK 4Q4JA 3GFTA 4O2LA 1Z47A 1JAIA 2VLIA 4TTRA 5J5CA 4LJ9A 1Z2AA 4A0RA 4PQYA 1MR3F 2XOKD 4NU0A 3SE0A 5HKKD 4FCWA 2ODNA 2GCNA 1VYUA 1SHKA 1ZNZA 2ZJAA 5FBQB 3B1VA 4C2UA 2ZVQX 1Z0KA 2CK3A 3BH0A 1LW7A 1Z07A 1U99A 1IBRA 2A5GA 4QBIA 5TMPA 4NCNA 2JGNA 5FTNA 3ECCA 1KMQA 2H1LA 3NXSA 2OLJA 3O8BA 4RCZA 1RRFA 2H7VA 2XJ9A 4QJ3A 4LGMA 2OO7A 1BO6A 2ZJOA 3MWYW 1CS4C 3B78A 1SZPA 5E7MA 4B33A 4BZQA 4GZLA 4Q4AA 4C0LA 2BC9A 1NKSA 2FH5B 3F0TA 4MRNA 5CB8A 2IYYA 3BRWD 2QBYB 3CW2A 4FMCB 4MKGA 8OHMA 3IEUA 5JI2E 2FZLA 3A1VA 1I2DA 3HYRA 4Q66C 4JJKA 1N5JA 4YXWD 2HT1A 2IYSA 4DLSA 3TR0A 3W8NA 2JDID 1GAJA 3U7EB 1Z0JA 1YU9A 3A4NA 5FUVA 4D2IA 1E2GA 2CJWA 1ZCAA 1KIMA 1Z6GA 2ZI3A 3V00A 1W4BA 1CP2A 1G8GA 2P5TB 1F48A 5FBRB 3S1AA 3W6PA 2BHRA 1ONBA 1ESNA 1XU4A 2FMXA 1BYUA 2WPDD 3E70C 4K8OA 1Q3HA 2QORA 1DOAA 4IXMA 5L3RA 4BFYA 2BKUA 1G20E 2W6ID 2ZRPA 2W2VA 3IBYA 2AD5A 3VR5A 2EYQA 4HB2A 1OPXA 1UKVY 1P7CA 1Z63A 2ZETA 1SVMA 3IUYA 2ZE8A 1Z22A 3L0SA 2J0VA 3LVRE 4GP6A 3D3QA 4PTLA 3ZZTA 1Z6TA 1FNMA 3OIUA 4B44A 1IXSB 2D7CA 2J0UB 3K0CA 1ZNYA 1YVDA 3FMOB 4N0EA 3I62A 3EXAA 2NO9A 3X1WA 1JAHA 2O0JA 2WWXA 5FL3A 2AXPA 4ZDWA 3RANA 4FXPA 4A6PA 3QF7A 3UG6A 2W0MA 1YZKA 1SULA 2JJ8A 4CIDA 4A92A 4US1R 3U7FB 4BLOA 1JECA 2WIAA 5JHHB 4X8OA 1SVOA 3GEHA 3KDSE 1YQTA 2VSFA 5EP2A 4PO1A 3CRW1 5FPSA 1P9NA 3EA0A 1DVRA 2D2EA 2WSSA 3BWDD 4URXR 4QGGA 2GILA 5LD2C 2ZM5A 1HT2E 5DI3A 4G5GA 5KNBA 3N70A 3FTQA 1W0JD 4AG6A 4KXFB 2XAUA 2ODEA 2A7QA 5J4LA 3W6OA 3FHCB 4C0BA 1G17A 3TW4A 2G3YA 5EE5B 3DOFA 4V0OA 4IRUB 1CRPA 5F9FA 3WHLA 2LWIA 4M1WA 3OE7A 4HZUB 2OESA 2P67A 1KI3A 3PENA 2CNWA 4KVGA 3TIFA 2CL0X 3U3KA 4Q4LA 2FN4A 3B13B 4EQ6B 2ZE5A 3RWMB 4EJSB 5BXQC 2QRZA 3VX3A 3ONWA 1NVVR 1H8HA 1YHNA 3DKVA 5CM9C 1XXHB 4L8GA 5C1BA 4MGIR 2RGGA 5EE1A 1LS1A 5CK4A 4D0GA 2QM7A 3OIYA 1F2UA 1RYHA 4YMUA 3L43A 1X6VA 2IYTA 2NO1A 4B75A 4E5UA 3T34A 1ZNWA 1U8ZA 2CHGA 3AGQA 4MGZR 5AJYA 1VMAA 2FFAA 2ZS9A 3LO5A 3SN6A 1MABA 3P32A 3T61A 1N6LA 3GLHB 3PXGA 2JLRA 1T91A 4P33A 4C7OA 4XJXA 4M1YA 3NEYA 4UQOA 4TTQA 3QKRB 3KX2A 3TUZC 5G53C 3K0SA 4M8NE 2OFWA 1SXJB 1WRBA 3A4LA 2GCPA 1T9HA 2ORWA 1QHYA 1B0UA 3OFNA 4TLDA 3KZ1E 4PC2A 1I4TD 2GNOA 4C0QC 3QG5A 1N6OA 2ZIAA 3EW9A 4ERNA 3CH5A 3MGCA 1E9DA 2KI5A 5KOYA 2J5XA 4Q7MB 1JALA 2ZYTX 3QUSA 5FOSA 4P3YA 2IXEA 2MSEB 4IW3B 4Q02A 1NMXA 4UNNA 3C5HA 1G6HA 4ABYA 4CT4B 2CBZA 2RAPA 4GFDA 2C03A 4BPBA 2E87A
chains in the Genus database with same CATH superfamily
3GVXA 4B83A 3ZDYB 1E9BA 2NTVA 2YICA 3NZEA 1HDOA 3OJOA 1QE3A 3H2HA 4HTFB 5EJ2A 2RGNC 3UTCA 1ZH2A 1V5GA 1A9ZA 2P9TA 1PT7A 3K1AA 1JW9B 1FDWA 3I6MA 5DM70 4MR8B 4MQ5A 1SBIA 2IEZA 3G02A 1DG9A 5G4KB 5E9AA 3A2MA 4KFTA 3ZWWA 3R5TA 1L1EA 1MAAA 4TYQA 2NVUA 2IZ1A 3ZCTA 5H68A 2F3TA 3T4PA 1JB1A 3COWA 2QSZA 2YHBA 2LPMA 4OYYA 2NZJA 4UDNA 1IN8A 4LKOA 2ZAYA 4EY6A 4JI8B 1MN6A 4FFBB 3Q9NA 4GC9A 1YJAA 4CN8A 2D7DA 4KQ6A 4YPVA 4QXPA 4Z9YA 2NXJA 4C4TA 4NF2A 2HYDA 4FZJA 1QDUA 2CYBA 1R0RE 4UAJA 2F9LA 5EGNA 4ZT5A 2V7BA 1P1CA 3F7OA 4G0ZA 4TMWA 1XA0A 1RCUA 3BG5A 3G0GA 3KOYA 4NYIR 4QYMA 5ALLA 4CHGA 3R3XA 4Z4HA 1QH1B 1ICIA 3TQOA 2ZREA 3UB4A 1X1BA 2JFQA 2DECA 1OIXA 4XYBA 3VMMA 1GG2A 3WZLA 5AKHA 3RIXA 3N2NA 1XYYA 2CEKA 4R1TA 3CUSA 5DBFA 1Z5OA 3HDHA 3TGLA 1PHPA 3C85A 2YNMA 1UANA 1QIJA 2P9YA 2WE8A 1ZCBA 2QW8A 2YJNA 4IJ5A 3PQ2A 1T0JB 3IELA 5AVKA 2OYRA 1PEDA 1EHCA 4EI8A 3L1KA 3HR4A 4PZDA 2POQX 2GCOA 2NXEA 4CLEA 5JCPA 2R1ZA 2V58A 1CBUA 4N5DA 4DR2B 3ZXIA 2BEVA 4PYNA 2MHCA 3NGMA 4ZKDA 5BSFA 4Y2YA 2OORA 4OBBA 3U4MA 1PIWA 1YL5A 2AYYA 4LGVA 4RBNA 3T3MB 3MJCA 3L0IB 1HZZC 4NZMA 3QVUA 4QE3A 1KHHA 2GPBA 4FIZA 4LECA 3CRVA 3K4QA 2ZI7A 3ABIA 4XPIB 3PHIA 4P5PA 4RANA 5CIYA 4FINA 3ZVLA 1PL8A 3B2NA 4L0CA 4X84A 1PK9A 2PUDA 4P7BA 3WNBA 3ZJTA 3HDGA 4Y0AA 3NC4A 4OQPA 4GPBA 5HW0A 3D0OA 5CFRA 2G5GX 2VHUA 3TIVA 1Q19A 4QHTA 3ZNNA 1QAMA 3HKEA 4C4AA 3EJ6A 4Q03A 1U4NA 3R09A 1QM5A 1J5PA 1I3OA 2RCNA 3FOWA 5A5VA 1A04A 5K8UA 3R3VA 1M0WA 4GUAA 5JEEA 3IVRA 3E82A 4EM6A 2NMVA 1RYYA 3UJ7A 5C8XA 1CQIA 1TVKA 1MXFA 3AIIA 1GUZA 3T12A 3VAYA 1RYNA 3GLSA 1RD4A 2WFLB 1OFHA 3TNFA 4P0PB 5JVDB 4S05A 1GTG1 3MRSA 2X4IA 3LUBA 3RAGA 3PDJA 4G25A 4MRVA 3DOCA 1KEEB 5IDQA 3S2GA 3C7CB 4EKNB 4F12A 4RH0A 4KNYA 4ZRNA 5G41A 4NBKA 3LWZA 2BKAA 4B3CA 2WMNB 3V4VB 3H4MA 1TE2A 3IAEA 4J4HA 4JH0A 4L16A 3ADCA 1N1DA 3KTAA 2YR0A 1TDJA 4M0KA 1BC5A 3K0BA 3T7IA 5BV0A 2ZB4A 3IKTA 1G63A 2YY7A 1J0DA 2DCMA 4OQDA 5SICE 2R4QA 1W5AA 4PINA 3H83A 4E30A 1YV9A 1OLUA 3JZDA 5LQKA 1KDRA 2IZ7A 4FLMA 3KCQA 1Z0IA 2CXTA 2IUSA 2ZR9A 3GEMA 4MUEA 3CJRA 1KOLA 3GVHA 3V34A 4Z7JA 1HQYE 4Z99A 3M7IA 1RYMA 3AF4A 3HEMA 4IOLA 3CLTC 2E85A 2F9MA 2CMGA 1P4HA 1QG2A 2FPIA 4XTRA 2GEKA 5FI3A 1TOAA 1Y8RA 5K3FB 4V0RA 4YQYA 3EZGA 3QRWA 2I03A 3GFPA 5GP1A 1E1RA 3JR3A 1B8PA 1QC5A 3H6HA 2PZGA 3KEMA 1WY5A 4FUTA 3RH0A 5KNBD 2X23A 2WJAA 3E3OA 4IUCS 4BN5A 5EKUA 5D3KA 1H0KA 4GKAA 2QTZA 3MK31 3EMVA 4IH4A 3N7TA 2P9GA 3UQYS 3IUNA 1O8CA 5IM5A 4F9EA 5LD2B 2RK3A 3H6GA 5FXMA 2GNAA 2NPOA 5IBQA 1RQNA 4N7JA 1YVRA 4ZOLB 4NVRA 5LYYA 4F5YA 1CUGA 2O4CA 3QV2A 4OO3A 1OBFO 4ILEA 3V2HA 4J6EA 1NW7A 2ZZMA 3R4CA 1QHIA 4IGEA 4KDFA 3H1GA 1N5LA 1QNFA 3WLKX 1MVLA 1NJSA 4UUBA 3UA3A 3DFZA 5AKEA 1ELOA 3BTUA 3R3JA 2OCYC 1ONNA 3SIPA 3O91A 3OZ7A 4DR4B 1GN9A 2O8CB 1TM7E 2WKPA 1VLJA 4GGOA 4IF6A 4O4JA 2FRXA 1QF9A 2PJUA 4Q3EA 4ZCSA 3RV4A 2AYZA 2C4UA 3LYUA 1FRNA 3ST7A 3X0DA 4CMHA 1VTKA 3HPRA 4DHWA 5LP6A 1ZIPA 1FPQA 1NZFA 4K9PA 4F46A 9GPBA 2BTQB 3W2EA 2XCRB 3C1AA 3QHAA 3GLGE 1RAAA 3JQDA 4L4ZA 4AUMA 1M2EA 1NVTA 1FYXA 3I4CA 2D5BA 3LFUA 3LU1A 3OQBA 4I1SA 4U02A 4EELA 1II9A 5F7XA 4Z4QA 2I9KA 2B9EA 4XX0B 1NLYA 1Q3KA 5CDTA 4JDPA 2IX3A 1BRMA 1VPDA 2L42A 4A8HA 3WIVA 2XTMA 3KR1A 3EXFA 1U04A 4YR7A 1US8B 4DA0A 5CG2A 1XZQA 1T8SA 4G3XA 1T4MA 3HB0A 3Q85A 4YRTA 3N58A 1UKYA 2HKIA 2ZTHA 3L6OO 4FZ3A 1HYBA 3M1IA 3A04A 3DF9A 5EWJB 2BBOA 2VDNB 3C6QA 3OFND 4LE2A 2XB2A 4N3BA 1DMSA 1E3LA 4NNJA 3O8DA 3CLRC 3KPWA 1Z6XA 1Y1PA 5EMLA 3KQSA 1U0LA 1ISJA 2J08A 4E2WA 1PWXA 1S8OA 4MW2A 2CLOB 3KXPA 3KNZA 4C4RA 4I4CA 1Z5ZA 4HMQA 3GRPA 3SJ7A 5HKBA 2HHHB 1CE8A 1XDBA 1L4LA 4H2DA 1BW9A 5JPIA 3H5NA 1SZDA 2JAXA 1L5NA 1YA6A 1LBIA 1ZN9A 4PN7A 1REQA 2XQJA 3H9QA 3TEMA 3C6BA 1FF9A 4JI7B 4EY5A 3LUAA 1G21A 4OB6A 3GP5A 1LPSA 1EG7A 1U65A 3ZNQA 2W5UA 1XDWA 2JIBA 4RTJA 2BCEA 2QR5A 5D87A 4LMPA 4U2DA 5I7HA 1THGA 3KL4A 2IIPA 4MKHA 4DHEA 2FUNB 3TQHA 3QHPA 1B14A 2GFHA 1K9VF 1NWHA 3S8YA 1QDLB 3PF9A 3H0KA 3KPUA 1CZKA 1YUMA 4PZEA 3ZHQA 1JQ5A 2OV6A 3AHIA 2HHLA 3W3ZB 4X71A 1Z4OA 3PG5A 4DT1A 4R7TA 2AOTB 4L5IA 1Q6ZA 4L50A 4U2GA 2LKDA 1HEUA 2QROA 3Q5DA 3V9PA 1LNZA 3N2IA 5K0TA 4MVJA 1F0NA 1E6LA 1IL0A 4RS4A 1UJCA 3HN7A 5DCYA 3M6WA 4M53A 2HHCA 4WK4B 3C3KA 1WL8A 2ATCA 2PMBA 4EFLA 2JLXA 4HNUA 3DDCA 5C5DA 5L7WA 3JZFA 2R5NA 2OILA 1UKCA 4MI1A 3T4UA 4BV3A 4FI3F 2JARA 3ZLJA 2A5LA 1PX2A 3GPCA 2IV2X 1Z4NA 2D4HA 4KQWA 2YNMD 3HADA 3SKYA 2I6QA 9ATCA 2G1AA 1JZSA 3CR3C 3REFA 4RSMA 5KMGB 1QK3A 3DGEC 2ZW9A 2I1WA 4U7TB 3B52X 2A2ZA 2F90A 2XLCA 4UPDA 4RZUA 2R68A 4ZYXA 1ONOA 3B2QA 5EIXA 3NHFA 1S9HA 2CEAA 4M87A 4ZU6X 1NF8A 4ARSA 3PUHA 4CG3A 1JFSA 4BFSA 2QS9A 1NOJA 3U7IA 3NC0C 1C7QA 1YS7A 3QU9A 3PR2B 1AS0A 1O87A 2HRQA 4FT4A 1RPZA 2PHZA 1WBDA 3BHNA 3ZI7A 4TS9A 5F2NA 5LKAA 4X54A 5DLDA 2YKGA 3AKYA 3O6VA 1VQ1A 3NP7A 4EG7A 4RC9A 4ZCQA 4HDSA 3L0OA 3IC5A 2BR3A 3ESYA 5IAJA 4XB2A 4DV7B 3GBVA 4KB5A 3I9NA 4UVIA 2G9ZA 1DXYA 1KEVA 1W85B 2A9VA 3MJVA 1JPVA 5EMHA 4DUGA 2GUWA 4BNNA 1NXQA 4RIGA 3ZLTA 2UVQA 3K9NA 2FMTA 1X8XA 1KH1A 4QYIA 1ABBA 2X0FA 1H1LB 2C8VA 1NULA 1UT6A 3UJHA 4JS0A 1NN5A 1W75A 5L7TA 1N2CB 3LIPA 1G5IA 3AYZB 2QAIA 4M7RA 3WRXC 2GBCA 4FX5A 4ZO8A 4L5BA 1AXGA 2CMHA 2CLHB 2P11A 2VJYA 4Y2RA 2OE2A 1E94E 1ZISA 2VDKB 3DUFB 4REQA 2NPIA 4YCAA 1EUQA 3FROA 3UFBA 3EFHA 4WOBA 2G04A 3BWEA 4EHDA 3RVLA 4E5KA 5J2UA 1UJMA 1Z6QA 2Q6TA 2CHQA 1XK6A 4GF5A 2P35A 3HLTA 1XRSB 4Y6PA 5LQNA 1J99A 4MAMA 1F60A 1H2ZA 1KEPA 1LRJA 1NONA 1E1DA 1W46A 1GU0A 1U3GA 4NBVA 4UE6A 1CY2A 1MNQA 4LDZA 4YRIA 4L72A 2FQ1A 1ZRNA 3QH4A 3EPHA 5KOHB 2PMKA 3LNCA 2FETA 2VATA 4KO3S 2OXCA 4PX5A 3HJNA 3F1KA 3TSOA 2PFKA 2BISA 2W7TA 4G8BA 1S2IA 3NTVA 3FMVA 2QRMA 4NI5A 2GLTA 1R00A 2IJGX 1ZVQA 4Q37A 1EDDA 2WNSA 1CUYA 2G5PA 2FY8A 1WDWB 1JT9A 2HA7A 5TS2A 4RMNA 2ONKA 2QLNA 2ZJ3A 3JTMA 3NHJA 5TLSA 2BVNA 2WYUA 4G4SP 1BS1A 3L0DA 5ENZA 1Z0AA 2PN1A 1G98A 3I8SA 4RQUA 3RVJA 3SC2B 1N9ZA 3R6GA 5EKSA 1KY3A 1V8BA 3E8SA 2PLWA 5IT4A 2PGAA 4DTCA 4A36A 2YJTD 4PFJA 1ORTA 3E22A 1V9SA 3CZ4A 2QYHA 1M8KA 2W6PA 3FWZA 3KXLA 4DLNA 3QU2A 4G09A 4X97A 1DG3A 1EMDA 3CVJA 3MS4A 5AVYA 1TD9A 4FILA 1OFUX 3LT1A 3LSTA 4MARA 2C4WA 1IY8A 1TU3A 4R1MA 3WLNA 5HIAA 2C0QA 1KVSA 1YDMA 4UTNA 4Q19A 5L3SB 5ULLA 3REOA 1E1RD 5CDHA 2PZAA 1R3UA 2NADA 4MW9A 1JAYA 4P35A 5HUJA 3A3YA 2HR1A 3ISJA 1OYVA 4XDYA 3NONA 1JIUA 4DQDA 4KLNA 3R8FA 3K8OE 1D04A 4MR7A 3LZ6A 4X8LA 2C59A 1L4HA 1Z2PX 2DLNA 4OMFG 1I01A 2Q3LA 2YBDA 3DGFC 1EFLA 1PZMA 3TB4A 2UZ1B 1XROA 4MGKR 1GUYA 3DBLB 3REQA 2DQSA 3ZOZA 1V1MA 1C3VA 2IP4A 3B5IA 3EZ2A 4ZPJA 5F51A 2DUWA 5CT4A 3ZW8A 3TCXB 1RMQA 2BMWA 3DMTC 1VIYA 3CCFA 3DAYA 1IQ0A 4GNRA 5IULC 4JZKA 3CPSA 1CDOA 3WLJA 3N2KA 1GL6A 4M37A 2SCUA 2FWPA 3G0BA 1Y8CA 3F4BA 3HZOA 3KSMA 4WK0B 3SYMA 3FIUA 3ZX5A 3LLCA 5F52A 3ZKWB 2DBRA 3LQQA 3W34A 1NI4A 2B94A 4ENTA 5WRFA 2GUGA 1OZFA 1R7RA 2DWCA 2NOAA 3UAXA 2E89A 2UZ3A 3QU5A 3RS7A 3KZVA 2OKCA 2DBYA 2ILTA 2QM3A 2VNKA 5C3MA 2IK8A 2K7FA 1R5NA 2WKWA 5K0ZA 3HU3A 1T0PA 1XMSA 2ANCA 3PGVA 1JL3A 1RBYA 2J4FA 4TUYF 4ZYVA 3HXPA 4FDUA 4IDFA 4RULA 1IXYA 1TX4B 1YRQA 2EFCB 2PL1A 2RHMA 1QANA 4AU1A 2Q5EA 2J07A 3IP8A 4U4AA 4BO3A 4UUOA 4EJ6A 3WSWA 1D2AA 2JI4A 1Y8AA 2XSZD 3RHSA 4AQYB 4HQRA 2C57A 2JA1A 4LWQA 2XZTA 4BMDA 3EVCA 1UBFA 4YAKA 3AKCA 1YR7A 4L4UA 3UF0A 2BMVA 1A8IA 2JFPA 1LDEA 4GMFA 1LPAB 2ST1A 3MHPA 4L6AA 4RUKA 5ES4B 1RJWA 1HYQA 1LF5A 3BMCA 4W8OA 1W29A 1KNXA 4XA8A 2V65A 3TB6A 4DIFA 4EP1A 3CC8A 1JNYA 2ISCA 2VEOA 1DZ3A 3D7LA 3QXCA 4TLMB 1KE1A 3JD4A 2VBGA 1PR5A 3FA2A 1N0IA 4H77A 2WJGA 1H2FA 2XUFA 4J1QA 4BP3A 5JCOC 3MHTA 3E0QA 3MCZA 3SZLA 4MCHA 1X15A 2J9FB 1PG5A 3GLFA 1ORWA 4G23A 3WK4A 4DYHA 1IBKB 1KTVA 4EVRA 5IXYA 4MUHA 2G9VA 4O4LF 1WOYA 1Y3BE 2QTRA 3DB2A 1OXUA 1ZL2A 2AQHA 1PR6A 4UJ5A 3GPLA 1XZNA 5KCMA 4Q9LA 2B21A 5H7XA 5EHGA 2W8BB 1GRNA 3WGUA 4DKJA 1WB4A 2C54A 1BHQ1 1S5PA 2V7PA 1P8AA 5FUXA 4AJEA 1P72A 4MX8A 4M49A 4DR6B 3HDTA 3NVAA 3RRBA 1YVPA 1J7JA 2GFIA 3R6WA 2NZWA 3FPBA 2XCLA 4LHVA 4R2WA 3SFZA 2VA9A 2RFLA 1XC7A 3CMCO 3QX7A 4TKVB 5CFMA 3V2UA 1W48A 5H8WA 4YJ2F 3DAHA 4CFSA 3LDGA 4ECAA 4Q6WA 4MVJD 3KL2A 4IY1A 4CUZA 3LXRA 4PAGA 1SOUA 4CU5A 5CA0B 1JZQA 1D6NA 1H5QA 2PU7A 3I73A 2NV0A 4Y6SA 3DKRA 2X5JO 3PD0A 1EGHA 1NASA 4AZVA 2SECE 3SF8B 1VL6A 1M74A 3GLUA 2AXNA 3MAGA 4DQVA 4D6YA 1EVQA 1N6RA 2HJGA 3HDVA 5JATA 3AFMA 2NZVG 1GYRA 3TRFA 1JSRA 1ML4A 3HBNA 2W42A 2HL6A 4D9HA 1HURA 3A6FA 3AG6A 2ZXUA 3HCNA 3TUZC 1NBMA 1T10A 4JGIA 1M6VA 3QXSA 5K3FA 3AKEA 2RGCA 3FWNA 3MCAA 1NUHA 2DQZA 2YZMA 4M4SA 1KDTA 5KDDA 3EEOA 2B3DA 1WQ4A 2BGLA 4P80A 4W1PA 2AL7A 3BREA 1SXGA 1VDMA 1FVFA 1XXLA 2QJFA 3E9ZA 3P0HA 3PC3A 2POCA 1D9ZA 3BXXA 3EX7C 1IZ8A 3ZU3A 1BE8A 1Y3IA 2JGLA 2JGIA 3IVAA 1PZEA 1EWKA 2IA5A 2TMYA 2YHIA 5ESWA 2V7XA 1ZSNA 5LSAA 2ONYA 3PIRA 1UBKS 3IQEA 1C29B 3PPIA 1G5FA 3HJTA 4OOFA 1Q0HA 3ZD7A 4CMGA 2A35A 3QPWA 2P75A 2O9JA 4OJTA 1U3VA 3RYCA 2JGAA 4C4SA 1WKCA 1YONA 1J0CA 3DQPA 3EUFA 3K0CC 3RHTA 1VKRA 3D6TB 4DUGD 4CLRA 3CZAA 5K45A 4H0FA 3I5XA 3X3HA 2BM8A 2RGEA 1J39A 4Q9KA 1YU6A 3TDNA 1NI3A 4G63A 5DGIA 4Y2PA 5BRNA 2I7VA 3KXKA 4YCBA 2J5KA 2PEZA 3P4XA 4HWSA 3GFFA 5B4UA 1ZN7A 2WD9A 3QXHA 5EP3A 2GD1O 1CUUA 4ZIRB 5KKNB 2Q2WA 1QIEA 3GG9A 3ZE1B 3NJ8A 2YC4C 2WVGA 5EQDA 3AK4A 3NCTA 2BMFA 1WB9A 4CEJB 3HVIA 4KNWA 2RC5A 2WAOA 3NATA 2JGDB 3CB2A 5DLPA 1XN1A 2FMKA 1Y1LA 2C97A 4JBNA 5SV2A 3AR2A 3TFWA 5B1DA 3TM5A 4R01A 4GBJA 4Q9NA 1XA4A 3D6HA 1YTLA 1R74A 2LZ0A 4RF3A 1COZA 3FMFA 2GGSA 2AR7A 3UFXA 1YS6A 3VDXA 2IW1A 1KQ3A 1UMBB 2FHPA 4JT2A 1CY8A 4GYYA 3VPAA 3TTSA 4MS1B 2D5LA 4X20A 5JAOA 1LC3A 1TUBA 3CBGA 3RIHA 1KARA 2O7RA 4JYAB 4BMXA 3DOIA 3ASZA 5DASA 4C04A 4PLVA 4CG0A 1E9AA 2HCBA 3OJXA 3P2IA 4Y2QA 4YMIA 3BXGA 4DMLA 1S2LA 2K5UA 3BIJA 1E0DA 4LDQA 4AN0A 4RJTA 1DKMA 2WK1A 1U28C 1LDBA 2WPNA 3IKJA 2PUJA 4GE0A 2F1JA 4YUYA 3LSYA 1OZGA 3K20A 5BNFA 2A3NA 2F17A 5F21A 1UP4A 2Q27A 4QATA 1ULBA 4JY7A 1S1CA 2MYTA 4O5AA 5AD1A 1MV5A 3INYA 2NU9B 1C2TA 4BGIA 4DADA 2ZAMA 4N4AA 4DJTA 3CBQA 1SU7A 1RHQA 2HO4A 3F6YA 3FWYA 1V48A 2P7IA 5ARDA 1HKHA 1HWYA 5J58A 1L5VA 2REBA 4D98A 3P0EA 3TLEA 5JQWA 3NIFB 2F8TA 4IS2A 1HSZA 1E2KA 3AI7A 3HGTA 3UXYA 3ER9A 4CKZA 4BNVA 2B6HA 4PQFA 2FZEA 3ETEA 1E0AA 2O2HA 3HVHA 4BEVA 1YI1A 5AXDA 3QPCA 4TTPA 2I7XA 4NG4A 3TPFA 4PBRA 3RSFA 2X2FA 3OF3A 3W0LB 2Y6UA 2X15A 3AVUA 4ZOEA 5E8RA 4DMKA 2G1PA 3HCWA 4OP2A 3VOAA 3UHPA 1AK1A 2JFFA 4IYJA 5DHPA 4TLCA 2FDCA 3GIWA 4NABA 3ROKA 2XQKA 5HGXA 1N2EA 4LFCB 1IPFA 2A30A 3SBOA 4Y18A 5E6RA 5DPMA 3Q7RA 4F4HA 5K8VA 5IZ4A 4DCNA 2H31A 2OBBA 1ZZGA 4DC0A 4KPEC 4F71A 5FWYB 1SVUA 3GX1A 1FP6A 3KOMA 4ARBA 3AQ4A 3M6XA 2X13A 2CLSA 3OAAA 4MRMB 2X8LA 4YONB 2FX2A 3B6EA 5B2FA 4QJBA 1GILA 1Y4UA 3ZGXA 4OY3A 2AXEA 3BKXA 3OZEA 3UMBA 3KKEA 5K09A 3A7DA 3OE1A 3RK4A 5HZMA 5EMJA 4PHGA 4U7PB 5H9VA 1ZJ6A 3AYXB 3OCYA 5FPTA 5LC1A 4F1JA 4YMGA 4EGQA 4F91B 3V4FA 1O7JA 2Y0PA 4NL4H 2XA2A 5BV2P 5KYKA 3JWEA 4TVOA 4KK4A 1XMJA 4EW6A 1JDJA 3I9OA 2BR5A 1ZESA 2EBUA 2MSCB 2ZB2A 4GOOD 3J80A 2CV0A 2Z8ZA 1I2BA 4EJFA 3TQFA 3FX2A 2Y27A 1NMYA 2BM1A 1JQ3A 1WSBA 4ZT2A 2X8JB 4A91A 5GJBA 2Q4TA 2HJSA 1HM5A 1OT3A 2XCIA 3GT4A 3G2PA 3N2ZB 4UNSA 4Y9RA 4EFDA 1XIVA 5JSZB 5F1PA 3H4IA 3UKDA 3C14C 1OLOA 4AJJA 4F21A 4IHJB 4H16A 3QVLA 5T6BA 2FCRA 2YWBA 4P4SB 3L7CA 5EMNA 1XFDA 3JQ6A 3BMNB 2P9QA 1ZEJA 4L73A 2WSIA 2FEKA 2QV7A 3LH5A 4DM7A 2PUFA 2Q5LA 1MO6A 3RI3A 3IKMB 1T1GA 5DU2A 2PBRA 1SVIA 1PT5A 3L7DA 3ETJA 4JUAA 5LL6P 4M7PA 2BSQA 3M70A 2A0YA 1MOZA 3LQ4A 2ZP1A 4FFDA 5E95A 3T38A 4IHAA 4L78A 5LB4A 3A4MA 3B2EA 1KY2A 1QF7A 1WCV1 3EEBA 1NSTA 2ZRKA 4FGWA 4QODA 4DRXB 4LJ5A 3GAAA 5JZ9A 3G2KA 2ZTVA 2W8ZA 2YNMC 3BMQA 3F46A 3VAAA 1P2UA 1FP4A 3NHWA 1V5FA 2E82A 3R44A 5EZQA 1ZL0A 3WVNA 3KJXA 2ZXEA 2VWQA 2ZR8A 1VKNA 3ENNA 3L6UA 5AI9A 1R0ZA 2BBTA 2BY4A 2Q41A 2QRLA 2IEDA 4NOKA 3GPBA 3MQ2A 1EKXA 1Q0ZA 2OAP1 5CT5A 2GM4A 2RONA 3HYSA 1QK5A 4UNQA 1VLHA 1DC5A 1ULAA 5BSMA 1JT2A 4TMKA 4BZPA 2D1RA 4URZR 3H11A 4BFWA 3NOOA 3VKUA 3Q0TA 4MKRA 2OORC 1M1YB 1SCIA 1K3FA 2FSSA 2H1FA 2UYQA 5J4HA 5AK5A 4EFMA 3U7QB 1IEQA 2J09A 1QJCA 2M9MA 3I9V6 3PHCA 3K8QA 1KI9A 3IP1A 5FTJA 4TS4A 1X3SA 2BBSA 1BDBA 4V03A 2GBLA 3KB1A 1QHXA 2EL9A 4EVIA 1X2EA 2BMJA 2FK8A 2LE0A 4FU0A 1T8YA 4JP1A 4MLPA 1LW6E 4RHFA 4Z7NB 5FFFA 1U11A 2BTEA 3OCWA 1TVCA 1N2CE 1R6TA 3TW8B 2HF2A 1FDRA 5A3VA 3FR8A 5GIPE 3UUWA 3BL6A 2VNHA 2XA9A 4YP5A 3WKEA 1IC6A 2X2PA 3CWZA 1PX0A 1NBMD 2P77A 1BXKA 4EAQA 4PPYA 3M6IA 2R66A 3U6BA 3FG9A 2KPOA 4KRGA 3WG9A 2Z30A 1T1RA 1BG6A 4H18A 1K88A 4UXIA 2X76A 4ZA2A 4HAOA 5K3AA 4EHKA 1VB3A 4RVCA 2CJWB 4AK9A 4O2BF 2VJNA 3UB3A 3ICVA 3KKQA 2J3KA 1FC0A 2ACEA 2WR8A 4R9NA 2HQBA 2Y66A 3DE6X 1Z35A 5FA5A 3PRKE 3ROGA 5I7FA 5JY1A 2CUKA 3BWCA 2OGZA 1RWOA 3SX2A 1I3KA 1Y1TA 2NZXA 3C8HA 4IKOA 2VZ8A 2I62A 1O0CA 2MINB 3FYCA 4Q1AA 3L41A 1GFIA 3SJZA 5IS2A 1CRLA 2V0NA 4AX4A 3GRAA 5ITZB 1E3JA 4HQFA 4ZC1A 4YCLA 5KTNA 1P4GA 2R3SA 3KHTA 4QOJA 2ZSFA 4FMDF 1Q6YA 2V97A 1XLWA 1HQCA 1QVAA 3RBAA 5H5JA 5SY9A 1DBSA 3EXIA 3T1YB 2BLNA 1L4UA 4MRPA 3NR2A 3ZWMA 3PJRA 1DDIA 1XDDA 3ZS9A 4IIJA 4GMXA 1Z6YA 4L4XA 5IJ9B 3V4RA 4MTCA 1VE7A 4LX0A 3PDCA 4HNTA 1NU6A 3SLRA 3I5YA 3P27A 4UM5A 4J4BA 1A2BA 1XZDA 2V6MA 1LPBB 2Z8YA 1I4LD 3K31A 1X39A 2JS7A 5A4DA 2GRAA 4LZZA 4QX6A 1R0KA 1DIHA 1FXWA 1E2FA 2XWBF 2WAMA 4HY3A 2DYKA 1SQ6A 4LBWA 5A3SA 2CZQA 5TY0A 3JX9A 1JLSA 2PCJA 4W5JA 2C58A 2QR3A 3DAPA 2KBFA 1YGPA 4PEVA 3I2KA 2VRWA 2QBYA 3LC1O 4MDFA 2A92A 5EIFA 3FCSB 1XD9A 1HH4A 1BS9A 3EQ2A 1H65A 4JYMA 2Q4OA 1XJCA 2O2GA 4UARA 1P3JA 1TCAA 4LMAA 2HM7A 1IY0A 1FYFA 1S8FA 1E99A 4WZBB 4ML3A 1XF9A 1DX9A 2A88A 2QL7A 3G8DA 4JKOA 3TBHA 2VQ6A 3KU1A 2V7WA 2W6ZA 3KOWA 3D2LA 4ZAXA 3QWBA 5IM4F 4N18A 1WA5A 2ZSJA 4G4IA 4H6XA 3CPEA 3GWZA 4LEIA 5DO9A 1K7FB 2COEA 2CL7X 4ENWA 5C34B 3EF1A 2B4RO 3QF4B 4OBXA 4DGSA 1IZ0A 2EBFX 4EG6A 1F1JA 2IL1A 2HXYA 4M98A 4EGSA 4YJGB 4B6FA 2Y4OA 4IF4A 4MHTA 2LCQA 3ER6A 4K81B 3AJ9A 1CEEA 1SEVA 3CPHA 3ZN2A 5LP6C 5DNEA 3MJEA 2XWJI 4FUQA 5DK4A 5DE3A 2J3MA 4KAAA 2QZ9A 5JJBA 2J0UA 4Z9BA 3KCNA 5F9MA 3N8GA 5FRDA 3IV7A 4Y3UA 5LMNB 2C98A 1G4HA 2W22A 2JD2A 3OZRA 3BGDA 1N75A 4MJXA 4HMPA 2Y1GA 4CHTA 3ASUA 3MOGA 3ZU2A 5BWBA 2EKPA 3K9CA 2UXCB 3PQ3A 1F2UB 1T29A 1EFPA 1ECLA 3IILA 4CCYB 1E7SA 5DCUA 2QZPA 2DJIA 2FEAA 5K0JA 3D0RA 1D3AA 1FEZA 2W2QA 4OHRA 4UTOA 3ZYCA 2P0EA 1M2OA 4QUBA 1YZNA 3E7PA 3JQGA 1JEOA 1XWFA 4U7GA 3FKQA 3T5AA 4N48A 3WFJA 2CVQA 1MAWA 3OAAD 2AF3C 5BUZA 3SX0A 4CU2A 2VZ0A 2X7HA 3HC7A 2VT2A 2V6BA 4G5OA 3DMDA 4HNQA 4I1VA 1I51A 2G88A 4WIAA 5CVEA 3IOMA 3HFSA 5DP1A 4DXDA 4QZVA 4KR2A 1UL1X 1TM4E 5I7AA 3TQRA 3DF7A 1OFVA 4A82A 1RIFA 5JANA 3ANLA 5KVAA 3HJHA 1N2BA 3IDZA 2N46A 4WOPA 3ZCQA 2IW3A 4EX7A 3RUPA 3CNBA 4X6YA 5JWRA 4WCFB 1CX9B 3DA8A 3ENVA 1DGQA 1XZ8A 3UZUA 1QYWA 2P9BA 4LN1A 4LJKA 4P82A 4M0UA 1L9KA 3A9WA 3K1JA 1VHJA 3SS8A 1CY4A 2OENG 3ZDRA 4CF3A 3AUJB 2BMAA 4A5OA 2FFQA 2ZIWB 4EGFA 3CVOA 4EQ6A 5AW8A 1T4BA 1NUQA 1CR1A 1RLJA 1X0VA 4E1AA 5BW4A 4AI6A 3VJKA 2BDEA 3EDOA 4O2BB 1X1TA 2IXDA 4URUR 2FPXA 5INTA 3FGPA 1A7KA 4WMLA 3VTKA 1B76A 1JTVA 1UBUS 2Z95A 2A4KA 3G23A 4P7GA 3BEOA 3ZE6A 5CFQA 1M2KA 1MTOA 6PFKA 2C3UA 2JAQA 2AG8A 1GPWB 3FPHA 1IBMB 3LM8A 4JWKA 4PGGA 3TFOA 1M2JA 3LUFA 3MSCA 1S02A 1RHUA 4Z53A 2W98A 3B7GA 3RUHA 3IT1A 1QBKC 5DMXA 3L07A 5CK5A 1QIHA 2OCLA 5CLFA 4B3SB 1SU6A 2WI8A 3M9WA 4WOJA 1MH9A 2VZLA 2WAAA 3EVBA 4Q15A 2HTEA 5FPYA 4LISA 3SJAA 3GUHA 1PD0A 5AW2A 4KUEA 2F4NA 4OBEA 2G17A 1KO4A 1Y9EA 3W8RA 5JSYA 5HIJA 4ZI7F 1OH8A 2UDPA 3O7WA 3TOXA 1FMFA 4BUJA 2IEBA 4CF7A 3G0DA 3THOA 4BCBA 1B93A 2NNLD 3V8NA 3IDAA 1QQ5A 2R96A 3TMAA 3VBEA 1AHHA 1ZC4A 3JRNA 3QUQA 2JGKA 1SXJA 1TQ4A 1JDBB 4NCJA 3RWBA 4YAFA 1G21E 1DG1G 1POXA 2WB2A 3HUDA 4AQ7A 4RPKA 2HMYB 2YCLA 2GSDA 3DDSA 4RW0A 1CUDA 3BK2A 3E35A 4NESA 3DEAA 3KZKA 1IJFA 1DO0A 5CT8A 4MVJM 1K0UA 1JHQA 1XQ1A 3ZLUA 3LX5A 1GEGA 1JG2A 2IXAA 2HMSA 3D5EA 5A7HA 3WNZA 4YHHB 3ZW7A 3IESA 4UHBA 6REQB 1E59A 1VG9B 4QXAA 3LT0A 5GM1A 3GXOA 4EFNA 1KK0A 2XXBA 2ZAGA 3Q88A 4H3HB 3E9CA 4NPHA 1V5WA 2SKDA 4RIFA 4MVJE 4D42A 2DZDA 2QYTA 4BPRA 2R62A 5ED0A 3AVQA 3C3XA 1XEFA 3E0XA 1ODSA 5JR3A 3N9IA 1D9XA 4LFAB 3IUQA 5CDFE 1XD2B 2QP9X 4FQ8A 2YINC 2YJ6A 1DXOA 1JWBB 2JHFA 3X1MA 3KPVA 2IP1A 3UKOA 2FJUA 1A9OA 1C30A 2XGOA 1ZD5A 2O3JA 1UP6A 1C7RA 2PT6A 3R5FA 4I1UA 1P18A 3L82B 4IFBA 4U7WA 3W5IA 4B5LA 4DMMA 3DJYA 2GBPA 5JROA 3ZD8A 1HPLA 2JCGA 3JSAA 2R9VA 4EZEA 2NVWA 4MYDA 3KOUA 3PT5A 1B15A 5KTYA 4NFHA 1ID8A 1C4KA 3LDHA 2DR3A 4JMLA 5BN4B 1MFPA 5GIOE 3BGVA 4XM1A 3EIQA 3TK1A 1WNFA 3B82A 1CR4A 1R4MB 1XU9A 5KU1A 2BKVA 3OFJA 4WHMA 3W04A 1USUA 2R4UA 3HMKA 3UNXA 1E7RA 4BVAA 3CFYA 1EX9A 2V7GA 3D3NA 1IEVA 2X1MA 2ZPTX 2A9OA 1HL3A 1R18A 5C7OO 4BE7B 2H18A 1UBRS 1JHZA 1QRTA 3G13A 3S0JA 3KKNA 1J2TA 2WVJA 5LNK6 2ZIXB 3TOCA 1DTWB 3DVRX 3FD8A 4MI9A 2I66A 4MYTA 1VKOA 1FRFS 1K92A 1UK7A 4BECA 1TLLA 2G9UA 4DJDC 2JHCA 1QIDA 4LRUA 4XYMA 4B80A 3TVTA 4PYIA 3PLAE 1G20A 2AN9A 1SGWA 4XH9B 4DLZA 1JVNA 3KB8A 2QSUA 3DWGA 1OAOA 1PS9A 1EGVB 4JYBA 2EF1A 3OLXA 5FO1A 4XQ0A 5KHOC 2C7OA 1K3TA 2P79A 3ACDA 3KXDA 4YASA 4YYEA 4N9QA 3L1JA 3WJAA 3D8SA 5IN5A 5BW8A 5K6AA 4LX8A 3PD1A 5C8YA 1TEVA 1MO3A 3QVGB 4HDRA 5DRTA 3BMOA 3K9QO 1PF7E 1VHDA 4C06A 4MHSA 3UMYA 4X92A 3OCZA 4OREX 2IBSA 1Y9AA 1H94A 1E69A 1G8YA 1PR9A 1CZOA 2I3DA 2QSYA 3CVYA 1WPGA 3G9ZA 1SRQA 3ICOA 4GS5A 1JG7A 4LY0A 1TNDA 4MWGA 2R6FA 4PCAA 5ALHA 3RFTA 5FWNA 1OW3B 1OILA 2FMHA 2H59A 3NM6B 1HLDA 3BSYA 5H82A 3QVVA 1VE5A 5LQSA 2JFYA 1JYFA 1GL9B 1E6KA 1FUYB 4OFXA 2QU7A 2PZ8A 3DAGA 4M83A 4ZRMA 1W88A 2D2XA 3O0TA 4HGPA 2PGLA 3ZY2A 4WKNA 1BFUA 1VLLA 5A7GA 4CM5A 4KOEC 1ZLYA 4QBKA 4E3ZA 4ZK2A 2RG1A 3QEBZ 2X1LA 3UJ3X 1BU5A 1KJZA 3CSUA 2DLCX 1DRKA 1Q1AA 3LQ1A 1RQGA 2LCFA 3B7WA 4TQGA 2R7AA 4JGBA 3VI4B 2D06A 4HEA6 2JBHA 1BH6A 1CUBA 3C7TA 4WGGA 4CKBB 5FWAA 4MA0A 3HR8A 1TL7C 4LHXA 4W63A 1A97A 2GZHA 1CZUA 2KSQA 3PC8A 4MLDA 4DLYA 1TECE 4HWTA 4ZVVA 5TS3A 1PNTA 1LVUA 1Y0BA 2D5AA 2FRDA 3GK3A 1H9BA 1VE3A 2VOJA 2VTVA 1AVTA 2J6IA 2ZWVA 4HYYA 3HYTA 3R8CA 4BTEA 4NIMA 1EK6A 1YRYE 3HL0A