3U3KA

Crystal structure of hsult1a1 bound to pap and 2-naphtol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
b'TSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3kA00
1CJMA 1FZQA 4ARZB 2AN9A 3L0OA 2FA9A 2AHOA 1WRBA 3BFKA 4HB0A 4MKFA 3U44A 1YU9A 2QGNA 4HDCA 2ZREA 3SOPA 2OCAA 1X6VA 3LQQA 1ELOA 2H92A 2QRZA 4HB2A 4D0GA 4RCZA 2ZRIA 4TMXA 1DOAA 3P4XA 3QF7A 1XTJA 3TUIC 4G5GA 4IVPA 4EIWA 5JI2E 2IYTA 5FI0B 2RGXA 4WOPA 2IYUA 5JMTA 2DWOA 2BBWA 2VYFA 2LKDA 4ZDIA 3E5HA 4EUNA 1FNNA 1TF5A 4US1R 2GILA 3TE6A 4B47A 4EDHA 5TVKA 1HTWA 2ZRNA 5ANRB 4OK5A 2F43A 4NH0A 3I32A 1FTNA 3ZQ6A 1N0VC 1H8ED 3C4JA 1FMLA 2RGBA 1E2JA 2XXAA 5HZHA 5EXXA 4BEBA 3GJ0A 4QHSA 4QBHA 1IJFA 1AGPA 1Q1EA 2H5EA 5DYIA 4HLUA 1QHNA 2IYQA 1DPFA 3B7GA 4TQ9A 1NSTA 1CR1A 5FFMA 2HT1A 4RJLA 2JJ8A 4X8MA 4O2LA 1X1RA 1E1QA 3HR7A 4TYPA 1N6OA 4GP7A 1P2SA 5DH9A 1XF9A 3QKSB 1QHHA 1NJFA 4QG7A 1OFUX 1GFIA 4OI4A 5CIQA 5CM8B 5KO2A 1CEEA 5FUVA 5FUYA 1R5OA 4ESHA 3DKPA 4UJ5A 5CB8A 2ZRHA 3TSWA 4LJ6A 4UXJA 2P5TB 1R0YA 4PO1A 3GP8A 5GJBA 1D5CA 3CF2A 1YZQA 4QNMA 5F9FA 3B6EA 2PJZA 4LBZA 1U8AA 4IOKA 3RS4A 2IYWA 2VP6A 4BFSA 2YNMA 2W00A 2PZFA 5GVSA 3BH6A 3EC1A 5IT5A 2XJ4A 1JJVA 3GLIE 4CF7A 1U99A 1S9HA 2R6GA 2ODWA 4C0QC 1MV5A 1DAKA 2IS1A 1GL6A 1J7KA 2X77A 4MYTA 3T1QA 2QENA 2BV3A 1ZJ6A 3D3QA 4HAUA 2VTKA 4Q00A 4U02A 3UKDA 4MRRA 2V7QD 4PFSA 2A7QA 2BIFA 1NN1A 1BKDR 3U5ZB 4LC0A 1L4YA 1RKBA 2JEOA 5CDFE 3W5JA 3PITA 1ODFA 1N25A 4GT1A 3ZZUA 2NOAA 1LF0A 1ZC4A 2REXB 4LYAA 4BQSA 4XIGS 5DYGA 3N2EA 4JLJA 1E6CA 3MWKA 1H8EA 4F7WA 4W5HA 1D2EA 4KI0A 2XOKD 3ZD7A 2ZIAA 2MMGA 2N1BA 3B9PA 1UDWA 2R9VA 1KI7A 1OJLA 1FUKA 1EFCA 5KSYA 1R0XA 1F5NA 3KTAB 3I62A 3FMFA 1HT1E 3LDAA 2FNAA 4A1FA 2OSBA 1Z6TA 1UM8A 1XXHA 5JWOA 2IYLD 3AVPA 3QKUA 4Q18A 5J40A 4TL6A 4QM7A 3W6PA 3VQTA 4NCHA 2ZSDA 3CRVA 1CRPA 1VKJA 2WWHA 1OH6A 2F3TA 4HB3A 2Q3MA 1FQJA 1FMJA 5JZVA 3R7WB 4XOIA 4Q4HA 2ANCA 4RD0A 4XD7D 2O8CB 4C0JA 4PR0A 5KHOC 1O3YA 4JVSB 2BBTA 3WYAA 4ACAA 3QG1A 1RPZA 1OH5A 4JL5A 4B3XA 3CBQA 2H17A 1XFAA 2XAUA 1RRGA 1G6OA 4DLRA 2XB2A 2IWHA 2B7CA 2NO0A 1W36D 2Q21A 3ASZA 3C14C 1GWNA 1TU4A 4MRVA 1SHZA 1E9RA 4AG5A 5J47A 2RGCA 2V7QA 4PSKA 1LTQA 2J0VA 4V0OA 1YZNA 3H0KA 2REOA 1KNXA 2R8RA 1R2QA 1T8TA 4AG6A 1MABB 1CJUC 3LXXA 1E1RD 4G3XA 2P6UA 4XJXA 2O8DB 2QGZA 4YONB 2AFHE 2GEUA 2VP2A 8OHMA 1EFTA 1YRAA 4NP6A 2HJVA 3UWKA 3ND8A 4NHOA 1ZCBA 3X1ZA 3R9WA 5KNBA 1KK3A 3U3KA 5E7MA 1IN4A 2XOKA 4IVQA 3PFIA 4NDZA 3ADCA 3C5CA 5KPJA 4BFVA 5LB4A 1ZNZA 3SYKA 3VR4A 4KFSA 4AY2A 4Z51A 3EZFA 4F93B 3BBPA 2GF0A 1SGWA 5KU1A 3SJZA 4M9XA 1QHSA 1GOTA 1JR3D 5BYKA 5EE9A 4UXIA 1KSGA 1NRJB 1E2PA 5KTYA 5GJVC 1EG7A 2QL6A 3NEJA 2DFNA 5FBQB 4DDTA 3ICQB 5IDVA 1E2QA 4OKSA 4XD7A 4LPKA 1IONA 1HA3A 2F9LA 2ZRDA 1EGAA 4D0NA 1N3BA 2NIPA 3RS3A 4PO8A 2HCJB 3GLGB 1R8SA 2QPAA 3FFBA 3KUCA 2ZPTX 5CJPA 2VHQA 4AWXA 1FX0B 4B34A 5EP2A 3WNBA 4BFXA 3SQWA 1KDRA 1QF9A 1YZUA 1COWD 5FL3A 2BJVA 1JPNA 3ZZ0A 2PBRA 4BFWA 3AKYA 4TZ6A 5EE3A 4XH9B 4B32A 2JCSA 2BCJQ 5JRZA 3U7EB 2VP5A 4ON9A 4Q7LA 4RD1A 2RAPA 3EIHA 2A5YB 1ZM9A 1E1RA 2VSFA 3CLVA 1W46A 2GCNA 4EJSB 1DG1G 1G8PA 1I4DD 4OJKA 3RRNA 2IX3A 2ZR0A 4S2EA 2JLSA 4D4MA 4MRPA 4NCJA 4WZ6A 3QE0A 1WDTA 4M1OA 4PPQA 4RKEA 4BRUA 4EFMA 4YMVA 2C9YA 2HLDA 5CYPA 3ZVLA 4NYJQ 4DIEA 1KO4A 1Y3AA 3SBEA 2B8WA 4B3FX 1ETUA 1Q0UA 3AF1A 4LWZA 4ZV4A 5JJLA 3RNLA 3AVQA 1XCMA 1LS1A 2DWPA 1X8JA 4N1AA 5E7JA 1T8UA 3L8ZA 1JXMA 2QORA 3AEZA 4Q4JB 4NBSA 1WF3A 1ZU4A 3ND9A 4Q9JA 4HB4A 4AD8A 1G8GA 4YMTA 4EPTA 2QP3A 4EPXA 1CR4A 1JR3A 3V4FA 4WZBE 2ZJYA 1E9FA 2GJ8A 2IYVA 3QXJA 4F91B 1Z28A 3KFXA 4IHQA 1ZW6A 2FV8A 4HAVA 5B30A 3DO6A 2P6RA 3QOFA 1XJ0A 2LCFA 3PUVA 3FHCB 4ZDKA 2IYXA 3QXCA 3FMPB 1GRNA 5BXQC 2WMNB 4URUR 4I99A 3LBNA 1E2EA 5AJZA 3A1SA 1MRNA 4IDHA 4MITA 1EESA 2GDJA 1EFHA 2GAOA 4CRWB 1COWA 1P6XA 2CHVA 1F2TB 2J0UA 1GNRA 4N3NA 5EE1A 3NWJA 1Z29A 3FKQA 4TTRA 2OHFA 1DG3A 1XMSA 3AP2A 4RFVA 2JJ1D 3SU8A 4AKIA 3LWNA 2RKOA 2WICA 4LBYA 4LX0A 4Q47A 2IS6A 3P27A 3R9IA 1KY3A 1XD2B 3OF5A 5D3MB 1OH8A 3BXZA 3P20A 2DPXA 2QAGB 2OLKA 4UNPA 1E9DA 1G9XA 3A8TA 3EIEA 1CR0A 4JVMA 3GLGE 4C2TA 1M7BA 1OFTA 5FTNA 1GNPA 4LC1A 3IEVA 2QEQA 4NONA 1AJEA 3TVDA 3PG5A 1VPLA 1Z0KA 1F48A 2H1LA 3QPUA 4G01B 4P3YA 2KBFA 1KI9A 3DPUA 4R98A 2I3BA 1II8A 1YR8A 4BZPA 1P4SA 2VQSA 2C96A 1M7HA 2BM0A 4POAA 5DSZA 4YDSA 1U0JA 4ITRC 2PL3A 2QP4A 1Z47A 3K70D 3QEJA 4BZQA 3BB4A 1YKSA 3SJCA 4TYQA 1VYVA 2Q9BA 2X19A 2FN4A 4ZIRB 1KHTA 1C4OA 5C18A 1II9A 2D06A 1TTTA 4HEJA 3AVUA 2WOJA 2HF8A 2ZI6A 5G41A 1WXQA 3LRPA 5DI3B 4EPWA 3A4MA 4OYHA 2EVWX 2H16A 4ZCMA 5FOSA 5JLJA 1W49A 1V43A 2ZR9A 3EW9A 4TMKA 5JJKA 5TXGA 2ZANA 1UBGA 1VYTA 4MDFA 1FW6A 1G7SA 1U0LA 3PEUA 2PX3A 3GJ3A 2PH1A 1P2VA 3F3YA 1HQCA 4K46A 3FOZA 1GITA 2CBZA 1KIMA 4BFUA 1IN6A 2JJ1A 2YWHA 3TLXA 5HZKA 1YQTA 2F43B 1UPTA 2D7CA 3BFXA 2ZS9A 3VX3A 2G3YA 1XZQA 2O5VA 1P73A 2YZ2A 5L3SB 4DLSA 2GBLC 4PPGA 2OBMA 2ORVA 2I1QA 2Z5FA 4ABYA 4TWZA 1SXJD 3NEYA 3PJRA 3WYFA 4C9BA 1Z2CA 2G0TA 2R6AA 3GJXC 3PUZA 2WVJA 4X8HA 3UANA 4DDUA 5CIWA 5L3QB 4JLDA 1V5WA 2F1RA 3L0PA 5H1YA 1Z0DA 3QQ5A 3ZVNA 1NN3A 1E9EA 3JZMA 5C46F 4B6FA 2W6ID 4MYUA 4K81B 1YZLA 4A36A 3UMFA 2ZJOA 1E9SA 2E9SA 3I1FA 5A5GA 2VHTA 1E99A 3PR1A 4PZYA 3UG7A 2WWXA 4FMDF 2PX0A 4WIAA 3MWJA 5JWRA 2C98A 2FH5B 4LHWA 3TAUA 1MRSA 4A8JA 3AF3A 4DKXA 4TMZA 3IHWA 5JS8A 3PENA 3I5YA 3K0FA 1ZAKA 5BN5A 1P60A 2WJYA 1FTSA 3K0EA 3W8RA 3HDTA 1IN7A 3OE7D 3J81k 1GG2A 2NG1A 4QL3A 1OKKD 1MT0A 4GDFA 5LD2C 1E79D 2JA1A 2QA5A 3LVQE 3FDIA 3ADDA 3HP1A 2WJJA 3W90A 3THXA 2G1KA 2HXYA 1KO8A 3EX7C 4DCSA 1Z83A 4MRSA 2QY9A 2WIBA 2ZI9A 1WB9A 2W2TA 2OCYC 1E2FA 3IDQA 4BGDA 1KK0A 2ERYA 2ZVQX 1JNYA 2F1JA 4HUQA 3SBDA 2GVZC 1SXJA 2QM7A 2B8TA 1ONBA 4Z54A 3M0EA 1TADA 2L0XA 4FCVA 5SZHB 3TGPA 4O25A 1OT3A 2A30A 3VR2A 3V00A 1G3RA 4KYIB 2FSHA 1W2HA 4KBGA 1NY6A 3NDBB 3ZLJA 2V6JA 2G6BA 2W6IA 5FPTA 4DLYA 2CL6X 2PCJA 2UKDA 3ZGXA 3EIQA 2BC9A 5E7IA 3TRFA 3GLFB 4HZUA 1QVAA 4URZR 4LHXA 4QC2A 4JBWA 4OQFA 3T1TA 1KDTA 4GNKA 2KI5A 5J4VA 1F3OA 3BRWD 1W1WA 3VAAA 2IYZA 5EUMA 2JLWA 4PAQA 4PC7A 2V1UA 1ZINA 4PPFA 1VG8A 4DRZA 4CEIA 3NBXX 2P2LA 3VFDA 1TF7A 2A5DA 2GF9A 3AF4A 1XD9A 3GFTA 2C9OA 4IEIA 3NBZC 5FTJA 1TQDA 2IL1A 3OE7A 2QE7D 4NL4H 4Q7JB 2R62A 2EFEB 1OB5A 1OKKA 1R5NA 4ZO4A 1LY1A 1Y63A 3VKWA 4TYWA 4PHTA 1E79A 4NCIA 2V6IA 4US2R 2AXNA 2WV9A 4QFMA 2HV8A 1IN8A 2FJUA 3HU3A 4PAOA 3WNDA 1YZTA 3MG9A 1TQ2A 1GNQA 3LXRA 5HCIA 3QY0A 1RRFA 3AKDA 4JT2A 3QVUA 4KXFB 2G9NA 3E1SA 4BLTA 2IC5A 1JEEA 4MDEA 2QTVB 1XPOA 1MO4A 1SKYE 1VIYA 4R2IA 3V4RA 1T3SA 2FDCA 4Q9HA 1KJWA 3WHKA 3K0AA 4GOXA 4JKIA 3Q72A 3I73A 5C4GB 2GAAA 1F60A 3MJRA 3W3ZB 2AWNA 2ZS8A 4LZZA 1XB2A 2OT3B 1AS3A 4Z1MD 4M1MA 3K53A 4DSOA 1OIWA 4KSCA 4ZDWA 1BMFA 2WWWA 1W5TA 2O0JA 4XSGA 1OYYA 4AKHA 2VH5R 3SHWA 1HE8B 2ZI3A 3OAAD 3WXMA 2HXSA 5UKDA 1DARA 4DIDA 3HYTA 2FSIA 4NKRA 2NO6A 4WXPA 4NE2A 2ATVA 3SN6A 3TAHA 3UATA 1PLJA 4U00A 4AIIA 3CRMA 1EX7A 1G8YA 1LB1B 1K6MA 3LQRA 5AR1A 2GEDA 2XSZD 3KL4A 3KDSE 2XEXA 4DCTA 5BYJA 4B71A 3QKTA 4UNRA 2D4HA 5HE9A 3F8TA 1KYIA 3KQUA 3L0IB 1S9DA 4XVUA 5IRCD 4JMPA 2IYRA 3NTUA 3GJ8A 3OIYA 2VF7A 5KNDA 2QE7A 1FPMA 3VMFA 1PJRA 2YYZA 1IQPA 2GESA 3MUFA 2PLFA 1Z5ZA 2WJIA 4P0TA 4M9QA 4TLDA 1CLUA 3UMRA 1OB2A 2ORWA 3FGNA 2NTYC 3OIVA 4HDOB 1ZD1A 4OQLA 4C7OA 2GKSA 2Q3HA 1A5TA 4LJ9A 2J45A 3W34A 2PZEA 3U61B 1NMZA 4HUTA 4QJ4A 3BD9A 4IVRA 1IXSB 1RJ9A 4WBSA 5B64A 3A1VA 1D9ZA 5J4LA 3KKQA 4Q9IA 2BKUA 1G3MA 3KXKA 1GP2A 2XB4A 1LVGA 2F9MA 4WZAE 2O0KA 4Z1MA 3K0SA 5KOYA 3G0HA 4LV5B 4HAYA 4XVQA 4Q9KA 3AP1A 4C0AC 1CF4A 1AS0A 2RGGA 4I1OA 2ZM5A 1D2NA 3KXLA 3OAAA 4I4LA 4DUGD 1GKIA 4FXPA 3AKCA 2J87A 1X1SA 1CR2A 2CJWA 3B1VA 4EJSC 5AUNB 3SJBA 2ZJBA 2PT5A 1KK2A 1ZUIA 2PEYA 1XDBA 1F2UA 1ZIOA 4IEEA 3ASYA 3GJ7A 2MSDB 5BW8A 2XSZA 1US8A 4JVLA 1KSJA 4YDHB 1ANKA 3C15C 2AK3A 1DELA 4RKFA 2ZETA 2BOVA 3PV0A 1JAIA 3QPVA 1TNDA 1ZUHA 1XP8A 4ZKEA 3B85A 1FP6A 3GMTA 4A0HA 3PEYA 4NYMR 3ZH9B 4TZ0A 1JI0A 4AKGA 2Z4RA 2QBYA 2OCPA 5TV2A 4NYMQ 5HE8A 3IO3A 5J4KA 4GFDA 2DYKA 1NF3A 4JLPA 4NPHA 2FPMA 2GCOA 2ZRFA 4OHZA 3Q85A 3QBVA 2C78A 2NPIA 4MGIR 2OCBA 4FMCF 3EPKA 4DB2A 1RRCA 3QF4B 2XTZA 3B1ZA 3PEWA 2W83A 1NY5A 2J0SA 4YMWA 5GJWC 5G3YA 5DLQC 2NZ8A 4DT1A 1YZGA 4F4JA 4HATA 1Q3HA 2CLDX 1E98A 2SHKA 3BOSA 2FF7A 3K9GA 2QAJA 5K8UA 3CZQA 1VHLA 4X8OA 1GRQA 3SC3A 5FBLB 3GPLA 3THWB 4PPNA 4QGFA 3UMSA 4DUGA 2OXRA 2J0QA 4RVCA 2V9PA 3CNLA 1NKTA 2NQ2C 4HAXA 1GIAA 3RLFA 1ZYUA 3DHWC 2DR3A 2GJAA 2HF9A 2GXQA 3D31A 4FWIB 2HDNB 5JECA 1N5JA 3KQNA 5G40A 4TT3D 4C0BA 5C2JB 4P31A 1QHXA 4CW7A 1A1VA 4D25A 4NU0A 4A0RA 2GXAA 2BM1A 1XTKA 3N70A 4XVRA 3R9XA 2YC2C 4RZ2A 5EZ6B 2DB3A 2GJSA 1KI3A 4CEHB 4NYIQ 4Q4AB 1IY1A 4ZI3A 4CT5A 2WJGA 2WWGA 1R0ZA 1SVWA 3ZJYA 3TW4A 2ZE7A 5BWMA 2ORIA 2ZRJA 3JVVA 3ZDQA 3LBIA 1XBTA 5DE3A 1I2DA 1ZM2A 3FE2A 2ZEJA 4URVR 1PUJA 3ONWA 4KBFA 2G0NA 4QGGA 1KZGB 3VKHA 2OLJA 4KO8A 5CK5A 3LFUA 1W4AA 1DAMA 4KU4A 4LSGA 3IBGA 4PQFA 1SHKA 4DCVA 1AKEA 1Z0JA 5EZ5A 2WAYA 1VCIA 3CW2A 4ACBA 3FTQA 4CT4B 1MO6A 1S4QA 4JLBA 4CIDA 2C03A 1ZIPA 2VLIA 5F2EA 5FOXA 2JDID 4B2IA 2PT7A 3QIAA 3K70B 1OIVA 4H9GA 1HY3A 3V9PA 4AK9A 3EC2A 1MO3A 2W0SA 5AJXA 4YMUA 1E0AA 4KSBA 1VECA 2VEDA 2IHYA 2OFWA 4EFNA 3DZDA 4V0ME 4A8JB 3EPLA 4GPTA 1NSFA 5AJVB 1CJVC 4DWJA 1YR6A 2A9KA 4ERNA 5JBQA 1IXZA 4FIDA 3KKMA 1EXMA 1KI8A 4JYBA 4TL7A 4UXHA 2HLDD 4TT3A 1L7VC 3I3SR 4P4SB 5D3QA 3MMPA 3TR5A 1U94A 2O8EB 5DGXA 2Q9CA 4M1TA 1CU1A 1FL9A 3D7MA 3OIUA 4YXWD 4RFSB 4TLAA 1XJCA 5EE0A 1GVNB 1M74A 1R4AA 2FX3A 1H8HD 4NCNA 1S96A 2A5FA 3HPRA 4FMDB 2R6FA 1HUQA 1OW3B 3FKSD 4RZ3A 2O0HA 5F3WB 1W0KA 4FCTA 1KO7A 2MSCB 3IEUA 3NH9A 4M4SA 3WY9A 2P65A 3IPXA 3HWSA 1N6KA 4UNNA 1SZPA 2B21A 1VG1A 3AUXA 1U90A 1JEDA 2RHDA 4PC6A 5EP1A 4AI6A 1SXJB 3U3OA 1XEXA 4Q7MB 3ZIAA 1P75A 2CXXA 4P4TA 1W48A 1VYUA 5TB5A 4UQOA 2YVUA 2YOFA 3CR8A 5IK2D 4JS0A 5H70A 3EG5A 2ZAOA 1UBCA 4PHFA 1A7JA 4Q4LA 2HCBA 1BIFA 3P4YA 5G3ZA 1QVRA 4JBYA 1RIFA 3U7GA 2JDIA 4D81A 2R44A 1QHYA 3A1TA 3F5FA 4RD2A 3FYHA 4BFZA 2JIZD 4JL8A 2JASA 1Z0FA 5EP4A 3F0TA 4HZUB 2CK3D 3CZPA 4JLKA 3B2EA 3S1AA 3U2QA 3TJZA 4MH0R 2C2HA 4JKYA 2F7SA 5CM9C 3AGQA 1RRPA 4NYJR 1PLKA 4LI0A 3EARA 1UJ2A 2C8VA 1G8FA 4CEIB 2WJVA 5IHPA 4IRUB 4A2QA 5GJCA 2QRNA 4L9WA 5TARA 4D26A 3GLIA 3RANA 5B57C 1NLFA 4Q1EA 2JLZA 4W5JA 2FEMA 2G77B 4FCWA 4JYCA 2OAQ1 3THYB 2ZJ2A 4YXWA 4AURA 3UWOA 3GLHB 4MKHA 4Q1DA 2ZSBA 3H4MA 2W6JD 1NBME 1H8HA 1W44A 2UVQA 3RS2A 2ZYTX 1KMHA 1DTSA 2RGNC 3K0CC 1CXZA 3DM9B 3FKSA 3U3MA 1I4TD 4GSYA 3AGPA 4DBLC 4MKIA 3T34A 5JSZA 3CX7A 5CDFA 1EWQA 2GBLA 1N0WA 1T9HA 1GKYA 3U4QA 4AYXA 2YWGA 3RS7A 3O8BA 3IIMA 1G4UR 1IHUA 1PZNA 3SJAA 2ONKA 3CF0A 3IKJA 3NC1C 4HDQB 4Q02A 3ZD6A 3MJHA 3A1UA 3TH5A 1UKZA 2ZE5A 1A2KC 1UFQA 2F6RA 1NLYA 2CHGA 1JECA 3RWOA 3ZS9A 1N5IA 1XEFA 5IK2A 4ARZA 5JFGA 3X1YA 1T4GA 2EFDB 1KY2A 1Z6XA 5FPSA 4B76A 1G64A 3FPAA 4PTLA 4NZYA 1X3SA 1PV4A 2IF0A 2WSMA 1D9XA 3DOEA 4R71A 3MWLA 3EZ2A 1RYHA 1NG1A 3AF0A 3KQKA 3WYGA 1KDOA 2JIZA 3DMNA 1T5LA 2PMDA 2Q0HA 4D82A 4BASA 2CK3A 1CJTC 1OHHD 1XCPA 2FGJA 2DHRA 4K8OA 2VPPA 2ZROA 5KDDA 4CEJB 3NDPA 1UKVY 3LX8A 3RS0A 3TK1A 2BWJA 3LVRE 1R10A 2TMKA 1G17A 5DI3A 2ZU0C 4N0EA 1N6IA 3SNHA 3LA6A 3R8CA 1ZRHA 4JT4A 2XGJA 1JQLB 2ZRPA 5TDHA 5HTKA 2ZJAA 1T91A 5FBRB 4D4LA 3ECCA 3JZAA 1FUUA 2AX4A 3CONA 3CRQA 5FOVA 3RSLA 1JJ7A 4QBFA 5P21A 4QJ3A 2KBEA 1G5RA 2GNOA 1JB1A 2W6JA 3KJEA 3L2OB 3OEED 4Q21A 4DLXA 1R5BA 1RFLA 3QKSA 3WRXC 1K8RA 1NVUQ 4PAMA 5L3VA 4OI0A 3RHFA 5DHAA 4WW0A 1OXSC 3GJ6A 3AVWA 2FG5A 2OZEA 4V0MA 2HJGA 2MMCA 4EAQA 2I4IA 3WP0A 2V8OA 1DS6A 5FOTA 4IKEA 4WAUA 3LAWA 3PUYA 2D3WA 3GEHA 2DFKB 2YHSA 3AQ4A 2GWHA 2LWIA 3RYTC 1RE0A 2RHMA 4TSFD 1T6NA 1W7AA 2J5XA 4LUCA 3UIEA 5FI1B 2AFIE 1HV8A 1VG9B 1K5GA 1QBKC 1TEXA 2EYUA 3K09C 4BRWA 4JLMA 3I4LA 5HR5A 3U44B 3HU2A 1M6NA 4RSGA 4GMDA 3Q7PA 1AK2A 3AB3A 3DZ8A 1Z6GA 4XWOA 3M1IA 3BJIC 2OAP1 5AJWA 3I61A 1CTQA 2VHJA 521PA 1DADA 3O8RA 3QKRA 1P72A 2WSSD 3IQXA 1KGDA 1EFRD 2ZRGA 2EW1A 1NG9A 1LNZA 4QXAA 4M9ZA 2GTPA 2QT1A 1OHHA 4EPRA 1D6JA 1TEVA 5JS7A 2C99A 3LX5A 3X1XA 2BVNA 4XTCS 2Z43A 2XXAB 2WMOB 2ZI4A 1US8B 1VTKA 1ZCAA 2GK6A 5TY0A 3WNCA 4XSHA 4RCYA 3A4LA 4TLCA 4EPYA 3DL0A 1AN0A 1E3MA 4B3CA 3SFVA 3KTAA 3TUZC 4HAWA 4PZLA 2AXPA 3C5HA 4B3GA 1ZBDA 1GILA 3OEEA 1QHHB 2FGKA 3QBTA 3NVAA 2J3EA 5KSOA 2JLXA 2WM9B 2HUPA 4O3MA 1Z8FA 3FWYA 1DAGA 1NJGA 1SQ5A 2JLQA 3CWZA 5JCPA 4CDGA 3R7WA 4NMMA 3OESA 2LKCA 4RZXA 2O8CA 3TIFA 5HPYB 3A37A 4NTZA 5IF9A 2P6NA 2ZAMA 1UBEA 2ZRLA 5FTKA 4TSFA 4MUBA 4C0KA 1XEWY 4DSNA 2CL7X 4PHHA 3B13B 1CULC 1NI3A 3U3JA 2ZRMA 3C16C 2YOHA 2GA8A 5E4FA 1KI1A 3KQHA 1U81A 2H18A 4I1UA 4ASUD 4M9SA 4F4IA 2WWYA 2PLRA 2E87A 3QVVA 2IWRA 4DT1B 2Y8EA 3H86A 1G5PA 4G5QA 1N5KA 3CIOA 3Q9LA 4I1SA 2ONJA 4BLRA 5LPNA 3WHLA 1N6PA 2ZSFA 4UKDA 1E0JA 2WSSA 1MABA 2QT0A 5BN3A 1E2KA 1EFRA 4Q66C 2KB0A 4MYCA 2O8DA 1TQ4A 4DLWA 4FMCB 3KKOA 4FINA 5EJEA 5FPKA 3OFND 5H68A 1E2HA 3LW7A 3VTKA 3U6KA 2ZU6A 4OQMA 5AUQA 1S1CA 3ZVMA 2AL7A 4ZDJA 1TAGA 1GL7A 2WKRA 4A2WA 5A4JA 2QQEA 1N6RA 1DVRA 5KDLA 1BYUA 1AS2A 5CB6A 1Q44A 4M21A 1SULA 1SKQA 2IXEA 1XXHB 4OHVA 3KXIA 3A6PC 3MWYW 2RMKA 4M53A 2IUTA 1FFHA 3D6TB 3CRW1 3AVVA 4C0SA 3AUYA 2J7PD 5CJ2A 3TSOA 1G7RA 2ZYVX 1HH4A 1OXVA 4Q4HB 2ZQ5A 2OG2A 1SVLA 1BMFD 3KZ1E 3RRMA 4DCUA 1T3HA 1CJKC 1TL7C 4HSEA 1NNEA 1W4BA 4QOSA 1XRJA 3KQLA 2ZUDA 3SS8A 3T5DA 1RC8A 2QU8A 4OQNA 1GSIA 2FFHA 2OBNA 3GLGA 1YHNA 1E69A 4PHGA 5AUOB 2OILA 4TL9A 3LY5A 1AZTA 1FX0A 4MKGA 4ASUA 3RC8A 3I72A 1VCMA 3NBFA 2H57A 1E2DA 1DAFA 4IDPA 1TQ6A 4DDVA 4JBXA 4O0MA 3QSYA 3T1VA 1DBSA 1Q20A 4B44A 3K9NA 1EX6A 1SVOA 2WZQA 2J1LA 4IOMA 4B3BA 1E9BA 4LV6A 1MH1A 5EP3A 1CS4C 1QRAA 5SZKB 4URXR 2WHXA 3EWAA 3P1JA 2XTNA 2QQ0A 1W47A 4Q1CA 4EJSA 1IM2A 2O8FA 3SE0A 3RABA 1T0HB 4G0NA 2JJ2D 2VBCA 3OIWA 4LPSA 3GCGA 5C4MA 1GTVA 5TMPA 3OFNA 4IDNA 3PXGA 3CF6R 4PC3A 4F4CA 2C95A 2AWOA 2QMHA 5KUTA 1JALA 3WP1B 2G88A 3BORA 3TMKA 2JLYA 4J0QA 2DFTA 2CLSA 2XZLA 1YZKA 1XU4A 4MGYR 2X8AA 3CNNA 4FWTA 1FNMA 2WKPA 1IY0A 4Q1BA 4MA4A 4CZ2A 4PXAA 4V02A 1T5IA 3X1DA 5JJIA 2YINC 4Q4JA 2ZE6A 3REGA 3TUJC 1AGRA 4JLVA 1G19A 1M1YE 2D2FA 1E2IA 5AJYA 3AVOA 3NG1A 1MOZA 3U6BA 3CX8A 2J7PA 4TQUS 1KI2A 4TMVA 1DAHA 4V0LA 1AIPA 4WVFA 4I1VA 1WMSA 5E95A 3VU9A 2KWIA 3RWMB 4DZZA 4M1KA 1XMIA 2QMEA 1L2TA 4LY6A 2JATA 3QENA 3HU1A 4Q19A 5LBIA 4OK6A 4L15A 2CEAA 1P3JA 2AR7A 4W9MC 2P0EA 2OXCA 4LHYA 1CP2A 1ZVQA 2ZRAA 1W36B 3BH7A 4P4UA 1XEWX 3G5UA 2GCPA 1XXHE 4GMXA 3T35A 4D2IA 4GL2A 4C30A 3FHOA 1F2TA 1OSNA 2J59A 2DBYA 3Q8XB 4XTRA 4Y0VA 5K8IA 2V55B 3BS4A 3CH4B 2OEPA 4PX9A 2CCGA 2ASEA 4E22A 2BDTA 4JZKA 4LJ7A 3Q3JB 3PUWA 821PA 1G7TA 1WBDA 4GOKA 2GXSA 4TLEA 2JJ2A 4A15A 2FSFA 2QP9X 2R6DA 1XD2A 3LNCA 3GLFE 2FSGA 1KAOA 2FZLA 2WOOA 1N2CE 4KLNA 4TTPA 5CYOA 1OH7A 1AZSC 2AKYA 1TF2A 2VIIA 3HYRA 3UPUA 4R9UC 4B3DA 4C4PA 4RZUA 3ZS8A 2CL0X 1GM5A 4LRWA 3SDZA 1D2MA 4Q1FA 4DLTA 2BCGY 2RGAA 4C0HA 2J41A 3MD0A 3PIRA 3C8UA 4D6PA 1NVWQ 4HLDA 2N42A 3T15A 4B6EA 5KSZA 1Z3IX 2WIAA 5FPHA 3REFA 1TPZA 3WMEA 2IEYA 1G18A 2QPOA 3BK7A 4A82A 4KCGA 2VP9A 3X1WA 4EKDA 1DO2A 1EWRA 1NLZA 5FL7A 4GI7A 2BMEA 4DLUA 221PA 4BFYA 5EQTA 2W2VA 2BKEA 1G1MA 3WMGA 1G21E 3EA0A 4IDOA 1N6LA 4Q9LA 1GZSA 3DKVA 4US0R 1KDPA 421PA 1HE1C 1E0KA 3KUDA 3KKNA 5HCNA 4YC7A 1T0JB 1T3LA 2J0UB 2ODNA 4QJ5A 5DISB 1U9IC 3GEEA 1GUAA 2WTUA 2X1VA 2QM8A 1IJEA 4YLGA 621PA 3K9LA 4KYUA 4O2RA 4UJ3A 1IXRC 3M6AA 1YR9A 3X2SA 1ESNA 2MSEB 3TNFA 5E3HA 721PA 2F3RA 4C2UA 2VSXA 4HI0E 3OZXA 2OESA 3NIBA 4R7ZA 5K8TA 5JEEA 1Q57A 1DAIA 2ZR7A 3U3RA 3B5JA 3ZQJA 4DSUA 5KDOA 4OHWA 2H8KA 1UKYA 5L3SA 2IBMA 2UZ3A 1Z6YA 4I81A 1AKYA 4NCKA 2AD5A 4L16A 4E03A 1TUEA 1G5TA 5A0FA 4V0NA 3A4NA 5HKKD 1Q1QA 3O8CA 2YJTD 5LD2B 4DB4A 4JSYA 3KJHA 3VR6A 1VG0B 3O8DA 4JLAA 3HR8A 2XJ9A 1GAJA 1II8B 1J90A 2DCUA 2QSZA 2R65A 2YV5A 4URWR 5L3QA 3IQWA 3N2IA 1XNJA 2GHIA 1J70A 2QTFA 1XD8A 2RGDA 2W2XA 3I8XA 1KJZA 2EFGA 3SFZA 3IUYA 4PSAA 1NL3A 1IBRA 1XX6A 4LGMA 4GZLA 1P62B 2DFLA 3ZZTA 4ESVA 2VO1A 2NPFA 2EFHB 2XITA 3CPJB 3VNUA 4DXAA 3IIJA 3EA5A 3AVXA 3VR1A 3AF2A 4KVGA 4URYR 4AKEA 1J99A 2FMXA 4F92B 3G82C 2FPKA 1RVDA 2GEVA 3CH5A 4IXMA 4N0DA 2QZ4A 3L82B 2IUSA 1Z07A 3C41J 1IAQA 1E4YA 2QAGC 4NYIR 3QKRB 4CYMA 3EAQA 5FR1A 5SZIA 3CKLA 3T1OA 4BECA 2J9RA 3I8SA 1XJQA 3PEVA 1JR6A 1JR3E 1ESMA 1IN5A 3K1JA 2IUUA 4JLOA 3SYLA 4HZIA 1U2RA 1E4VA 1VDZA 1W0KD 2CMKA 3DDCA 1RZ3A 1E9AA 2V3CC 5FTMA 1Z22A 3L43A 1KAGA 2GJKA 3D8BA 3EZ9A 3EASA 1YR7A 2R6CA 4DEXA 3VHLB 4LJAA 3ZIAD 1KNQA 3GFPA 5HKKA 3CWQA 2NZJA 3GEIA 5J5CA 1CBUA 3Q7QA 1R8QA 1ZNWA 1G16A 4XWAA 3SZRA 2RGNA 3K0CA 3BB3A 4HYYA 4W5WA 3W9YA 4TTQA 4TL8A 5L8VA 1E32A 1DO0A 2OFOA 1OIXA 2QMOA 1CKEA 1KOFA 4R2HA 2I1VB 1W5SA 2IA5A 5F9HA 4MRNA 4GP6A 5JHHB 2JLVA 4M1WA 4HLQB 1LW7A 4LBVA 1UBFA 2RCNA 3LLUA 2FEOA 4V03A 1BH2A 1GL9B 1XTRA 2CVHA 4B48A 5B58C 3GLFA 1NVVR 1A4RA 5GVRA 4L4UA 1AQYA 2F1IA 5ELXA 1JBKA 1IY2A 3RAPR 4JJKA 3WBKA 2A5JA 1NVVQ 1SVMA 3K0FB 2Z6VA 3GJ5A 1EFUA 1P7CA 1Q21A 4EQ6A 3RRYA 1HEIA 1KSHA 1PLLA 3NXSA 2C77A 1Q12A 3GFOA 5JHGB 1KI6A 2GETA 2WAXA 3NKVA 3PQCA 2EQBA 4HLUC 4GBMA 4LK2A 3SR0A 1N5LA 4DVGA 2O8BA 4RD3A 2QNRA 3L0SA 1QDEA 1TMKA 1D8TA 1E9CA 3THXB 2OBLA 2IW3A 4AYWA 1L8QA 2ZJZA 1QZXA 1Z0IA 2OV2A 1BOFA 2GJ9A 2R2AA 3MLEA 1G20E 1A82A 2V4ZA 3AV0B 4BLOA 2EWVA 4TYNA 4PC2A 1ZM4A 4DHEA 4OHYA 1P9WA 2ZRBA 3O47A 4QNRA 2YOGA 3KX2A 3R20A 1N6NA 1VHTA 4HUQB 1OPXA 2FWRA 2HT6A 2ZRCA 4JL6A 5L3RA 4MGZR 2P5SA 3W5IA 4Q03A 3RDPA 5FH9A 1OFIA 4BE7B 4M1YA 4JSTA 4KFUA 4LHZA 2CE2X 3DEFA 3A1WA 5FR2A 2BHRA 2FU5C 3RSOA 4FMBB 4JLNA 4JIMA 3IPYA 4YMSA 2FOLA 4LDJA 3RC3A 2FPLA 3EZ7A 1HURA 3HJNA 5J4YA 5KSPA 3CR7A 2IK8A 1E2GA 4BLSA 2WWFA 2VHCA 3LLMA 2F1HA 3SI7A 5EXSA 1XTIA 1ZD9A 3CX6A 3QXXA 1J8MF 4IOLA 3K09A 3ZVRA 3U7FB 1KO1A 1W4RA 4KAXA 3GD7A 1TU3A 1L4UA 4Q48A 1E2MA 2P3SA 5LB2A 3EXAA 4A6PA 1DEKA 3VKGA 2ANBA 2ZE8A 3MCAA 1SVSA 4PSVA 4ZCLA 2BMFA 4JVNA 3LW8A 1ZP6A 1TX4B 3QJYA 1G8HA 3RVBA 3LD9A 4H1VA 4OI1A 2NMVA 1F6BA 2ZITA 1XCGB 3Q5EA 4OI2A 3KB1A 1XPUA 5AK0A 2O8FB 3ETLA 1NIPA 3HPQA 3ADBA 2VSOA 5LDDC 2WWIA 1X8KA 2QSYA 4LYJA 1KKLA 1ZU5A 4QGHA 1GKUB 2Q6TA 2ZUCA 4CVNA 1G3UA 2OE2A 3B1WA 3EWSA 4Q01A 1NKSA 1W0JD 3AKEA 1U8YA 1R0WA 1ZD8A 2IXGA 2GVDC 4LBWA 4BLPA 4Q5IA 4D80A 2KSQA 1P9RA 5C1BA 3FHTA 3K0AB 5CK4A 2GK7A 5M04A 2D7DA 2RH5A 3FMIA 4UNQA 3TBKA 3AM1A 4GRAA 5BN4A 1LS6A 3Q5DA 5JWHA 1G4AE 1OF1A 4GZMA 2Q9AA 2UZIR 2FFQA 3P32A 4M22A 5EXPA 1K5DA 1A2BA 2YWEA 3VU9B 3W6OA 4B73A 3PUXA 4ZKDA 2IEZA 2GZHA 1Q22A 3A58B 1NMYA 5JCZA 2VA8A 4QBIA 1KSFX 3WRYC 4PQRA 2PJRA 1PVOA 1H65A 3H1TA 1II0A 4A0FA 3TSZA 1X8LA 1CRQA 5DIFA 2ZS7A 4LYHA 1SXJE 2B7BA 2IS4A 1KKMA 1VCOA 2Z0MA 3P26A 4LCBA 1KZ7B 5SZJA 1HQYE 6Q21A 3EPHA 2C04A 4BZXA 5J4HA 1G41A 1QG4A 2HEIA 5K8LA 3OEHD 3N5CA 4IFEA 2BJWA 3L8YA 2PZGA 1JPJA 2JLUA 4IOJA 3CO5A 1M8PA 3AH8A 5FOWA 2A2ZA 4EPVA 1CIPA 3NH6A 2VRWA 3QI2A 2QI9C 4C7OB 4E5UA 3MGCA 4LYFA 1P2TA 5JI3E 4A6XA 5DO9A 2WKQA 1XTSA 1E0SA 1MKYA 3BIFA 3K9HA 3U60B 2E1RA 3QNUA 1AA9A 1W0JA 4KODA 1XMVA 1X86B 1RJ9B 1BYIA 3SHFA 4LJ5A 3MFYA 3QF4A 4DCNA 4BPBA 1KMQA 4L5BA 4ZPXA 1S2MA 2WBLC 1P2UA 1Q1ZA 3KKPA 3NBYC 1R7RA 1OFHA 1Z6AA 2EFCB 2ZI5A 1P5ZB 1S3GA 3GLHE 4FW9A 4KLZA 2QROA 1NBMD 4LJ8A 1W36C 121PA 2Z83A 3VR5A 2VP0A 2QN6A 1NN0A 2XNDD 2XX3A 4MUAA 2V1XA 2ZSEA 4OHXA 4B35A 1PUIA 1FP7A 4KITB 5KNCA 4D0LB 1NN5A 3THWA 1S8FA 2ODEA 1WP9A 4LOAA 3LBHA 1S1MA 1UEJA 2ZSAA 2CJWB 1RYFA 1C1YA 1UADA 1F2UB 3AVYA 3QUSA 4RD6A 4IXNA 1OYWA 2WPDD 3EPJA 4TQAA 2EYQA 4RD4A 2JLRA 4AYTA 1LF5A 5DNYB 4Y0AA 2OO7A 4WA7A 3GJ4A 3FB4A 3MSXA 3OEHA 1B23P 3BWDD 5G53C 2ATXA 5GADl 4CEHA 4Z8YA 4X8LA 2ZYUX 1E94E 4Q4AA 1G3QA 2ZRKA 2P67A 3UXMA 3QG5A 2QBYB 2X2FA 1JAHA 2JGNA 2GRJA 5FBVB 2O52A 3THOA 3W6NA 3BGWA 4PC1A 1DE0A 1E2NA 1WE2A 2Z4SA 3OHMA 4L8GA 3BE4A 1Z0AA 4B43A 3IIKA 5DHFA 2KJQA 2NO7A 1AQUA 2GCOB 3RS5A 4ZCIA 4S35A 1G291 3B9QA 4A2PA 1ZNYA 3T06B 1ZNXA 2YKGA 4YQFA 3WBJA 5EXTA 2ZVPX 3TR0A 2PMKA 3FVQA 1KJYA 3TVTA 4M1SA 5BQ5A 4HLCA 1OXXK 1VMAA 4G5OA 3ICEA 3DVLA 1NVXQ 2VHUA 2N46A 1NBMA 3KB2A 3MRSA 4QBGB 4DC9A 4BEJA 2XNDA 4DEYA 3W8NA 4OBEA 4CGZA 4OK3A 4KHZA 4G5SA 3CRRA 4PQYA 1WBBA 2AK2A 1YE8A 4MQBA 4TLBA 2PEZA 4ZI2A 1B0UA 3A36A 1DAEA 1G6HA 1QHGA 2KE5A 3BERA 1P61B 2ZI7A 1Q1BA 4G5RA 4TYYA 2IS2A 2XZPA 1ZC3A 1SKYB 1E2LA 5AWFC 1NIJA 4FI3C 2ZJ5A 3CM0A 2NO9A 3B82A 1SVIA 3RRZA 2AKAB 2WPDA 3T61A 4A0GA 2O8EA 1OV4A 4P4SA 1KI4A 2B6HA 2V54A 4F38A 1FOEB 2CLCX 2EWWA 2QUZA 3E70C 3FFAA 3I92A 5FPYA 4MGKR 1ZM3A 2ZJ8A 4Q7KA 4QKQA 4FN5A 5FOUA 2D62A 3VNVA 4C3ZA 2ERXA 4RFSA 2W0MA 4LJYA 1M34E 3VR3A 4L9SA 2GZAA 1W4CA 4M8NE 1WQ1R 2IHBA 1Z2AA 5F98A 2F55A 2G83A 3VHXA 3K8YA 2RGEA 2W58A 1GDDA 1XZPA 2IF2A 3CB4A 3LV8A 4QHTA 4B2PA 1RW4A 3AVTA 1XPRA 1UF9A 1WA5A 4DJTA 1KK1A 1M2OB 4H1UA 3PVSA 3TQFA 4D4JA 2EU8A 4IDQA 2DY1A 4BUJA 5DN6D 2ECKA 2BMDA 1I4LD 2VP4A 3EZ6A 3NHBA 1TUIA 2OM2A 1U8ZA 2CE7A 3B1XA 3DM5A 3CUEF 4QGAA 1BO6A 1NP6A 4KFTA 2OUKA 2IYSA 1MO5A 3NHAA 4DSTA 5B2ZA 1ZM7A 3W3AA 4QM6A 1N0UA 2QPTA 5CLQA 2ZYWX 3M4YA 3B8HA 3U7HB 2X2EA 4LJ4A 3FMOB 2XTMA 1OXUA 4KJZA 4OJQA 4OQXA 3C7KA 4C0LA 2CCJA 1YJ5A 3TQCA 4DLZA 1J8YF 4TN1A 1JXOA 3CNOA 4B2LA 2NGRA 1EK0A 1C9KA 1R6BX 1YRBA 1KTVA 4ILEA 5CLLA 2IYYA 4E07A 5DI9A 1SVKA 3JVUA 3WMFA 3PCRB 3UG6A 4JJZA 5JRJA 4EQ6B 2IXFA 3MAAC 1GRRA 4TMWA 1U9IA 4BWYA 2Q3FA 4KFRA 1OE0A 2FFBA 1NMXA 1QG2A 2JAQA 1KI6B 5EE5B 1N6HA 4BLQA 3THYA 1IOZA 1I2MA 2O8BB 2A78A 3GLHA 2B92A 2D74A 3GQBA 2BBOA 1O87A 1UEIA 2J46A 2CVFA 2HYIC 1KO5A 5FUXA 4UNSA 4U5XA 3IGFA 4A4DA 1ZUNB 2IT1A 2AD1A 4FD2A 4Q1AA 1YVDA 2A3RA 2RB4A 1Z63A 4U7DA 2CNWD 3AP3A 3B60A 3BFVA 3CPEA 2GZDA 4IFBA 5KYKA 5FL7D 3K70C 1ZMXA 1U0HC 1XEXB 3NC0C 4DLVA 3E2IA 1HT2E 5DN6A 3VX4A 3B1YA 2ZXUA 2D2EA 3KFVA 2H7VA 2XZOA 2VL7A 4II7A 4A8JC 4W7SA 1Z06A 4B75A 3T12A 2PCLA 4IW3B 1G7CA 4WXRA 3ADKA 1VCNA 1U98A 3BAFA 4BFTA 2VF8A 1S3SA 5AUPB 4M2LA 4RY2A 1UDXA 4PANA 5H8WA 4A9AA 1FQKA 2DWQA 3QEOA 3IBYA 4QRHA 4LHVA 2REBA 1OLOA 1J2JA 1Q3TA 2FE4A 3BC1A 4AC9A 2FZ4A 4V0KA 4LV8B 1LFDB 1Z08A 3QXSA 4IJMA 3S1AB 4EFLA 1AM4D 2BEKA 5CITA 3T5GA 3UK6A 4TMTA 1G3IA 2G1JA 5FUWA 4MYHA 4P32A 5FTLA 1W2GA 2ZTSA 2QMUA 2ZUBA 3DMDA 2FFAA 4KVAA 4CEJA 1UKEA 1VIAA 2CCKA 3BB1A 4KV9A 5D3MA 5EUQB 4M0LA 1UAAA 5FBWB 4P33A 1XWIA 4Z8XA 2QAGA 3IO5A 3KJGA 1XTQA 3ZYCA 3GLIB 3I5XA 2K5UA 1JQJC 2CHQA 4DDWA 1BS1A 1P9NA 2J7KA 3BH0A 5KPDA 1HYQA 4D4KA 1MR3F 3SEAA 4HAZA 1OXTA 4QHYA 1E1QD 1M7GA 3KJIA 2HYDA 2QTHA 3QPWA 3H2YA 2BEJA 1SXJC 4PO9A 2BBSA 4GOJA 1QHIA 1KMHB 3SQXA 1E96A 2CDNA 4B33A 2ODBA 5JSZB 3TKLA 4XWKA 2QG6A 4A92A 2NO1A 4E09A 3U4QB 3H84A 2BMJA 1XMJA 1LV7A 3IILA 2GXUA 3QXHA 3DOFA 4OL0A 1S0UA 3TW8B 2YWFA 4B74A 3B78A 5JEDA 2OFXA 1WCV1 2C9CA 2A5GA 2CNWA 2XNSA 3IHLA 3LO5A 4PZZA 4ZIRA 3R8FA 3CPHA 2WJHA 3SYNA 2YC4C 4G1UC 3LH5A 2C5LA
chains in the Genus database with same CATH superfamily
1CJMA 1KERA 1T13A 5GV8A 2AN9A 3L0OA 3MINA 3NIGB 2FA9A 4M0PA 4AO8A 2JCYA 4G0MA 1HE4A 1WRBA 4CLRA 1XQXA 2O1XA 2QLJA 4EG8A 3HJCA 4RQUA 1MBZA 1X6VA 1IZ7A 1L4MA 2A33A 1I1NA 3PX2A 2CNBA 2OO3A 4H0FA 3TRJA 3WMEA 3NI2A 4EB3A 1A7KA 2ZIZA 5F1OA 1ZO8A 5HKBA 4G5GA 4IIXA 2PO5A 2XDAA 4OGGA 3M6WA 2IYTA 2JC3A 2YXEA 3H9UA 4WOPA 5JI2E 5JMTA 3KPVA 3VJRA 3AJ9A 1XT6A 2FQQA 3QUBA 3PC7A 5KJEA 2LKDA 1Q0RA 1X42A 2GILA 3U1TA 1I36A 4KL8S 3BTOA 3LUHA 4B47A 4CMKA 4RPKA 1BJRE 1PAUA 3P52A 4ZT6A 1QM5A 3PE4A 3ZBQA 3VZCA 1N0VC 2JS7A 5THXA 5ICEA 3C4JA 4ZAYA 2RGBA 3I8OA 3MBKA 4TWJA 3QOWA 4EABA 4EYOA 2IOFK 5EXXA 2OV1A 3P4UA 4QBHA 1Q1EA 3DL4A 5DYIA 3QPDA 2ISSD 4CCWA 1QHNA 3LS2A 1GA4A 3B7GA 3NONA 3PX3A 1AA6A 1NSTA 2HT1A 1O5IA 2R3SA 4R9SA 1CUJA 2VDUE 2FZ5A 1TM3E 1UJCA 3CRNA 4FU0A 1KQNA 3TLEA 1ADJA 3WO0A 4BQIA 1VSQA 1XUOA 4Y2QA 4GP7A 2PS0A 2ZUWA 3NWEA 3S5JA 2CMGA 4JGIA 5B1IA 1XF9A 1A4IA 3IKMB 3P9CA 3K8OE 4QU5A 1GFIA 3ORHA 3UAGA 4NXNB 3FYDA 2JG3A 4L0DA 3QFSA 1ZQ1A 3WIUA 4R01A 3T5MA 4K0KB 2HW8A 4W5RA 5KQLA 4A26A 4PO1A 3V1TC 2FK7A 2CNDA 2VR1A 4MQFB 4DIOA 1D5CA 1QGYA 1OI3A 1XAIA 4GI3A 4QNMA 3DDUA 1CUZA 5ALWA 2QG4A 2FEAA 2D5CA 4RIEA 1DUIA 5LQSA 4BFSA 1QTIA 2PZFA 4F45A 1UZNA 3EC1A 4OQDA 2OG1A 3GLIE 1RYBA 1S9HA 1U99A 2NV2B 4HMPA 2REQA 1PFKA 2ZT5A 4P3XA 1FXWF 5K3EA 2PUBA 1L6IA 2HMSA 2Q6LA 3OPYI 3STVA 2Z6AA 1DAKA 1ISPA 1GL6A 4OM8A 2EJWA 2X77A 2ZUVA 4FS3A 1SBNE 2BV3A 1ZJ6A 2QENA 3D3QA 4Q00A 5L7YA 2X6QA 1PL8A 1UKAA 3P9YA 3HP4A 2AC4A 4PFSA 1NN1A 2EGUA 3IQHX 2XBMA 2B4QA 3BN3A 3FMGA 4JB3A 3E4CA 3DF7A 4OFWA 3P0JA 2Y0CA 2P2GA 1PJTA 4WH0A 3DP9A 1SBTA 3CLHA 4BP3A 5CDFE 3AK4A 1I6LA 1YXMA 3PITA 2H54A 5CDUA 2YX1A 1DIGA 5I3ZA 4D8YA 3IEMA 1WQ4A 1LDGA 1BD3A 1Z4LA 3C1AA 3D2BA 3QWAA 2REXB 4OGKA 16PKA 1P1KA 1FXSA 1PS9A 2D2IA 3CB2A 5DYGA 3N87A 1KQGA 3T5PA 5DASA 2C20A 2WDPA 4F7WA 1BH6A 4CETA 1D2EA 4RMHA 1UK8A 2ZKLA 1GYQA 1M0EA 2XWPA 3AUUA 2K2QB 2MMGA 4IJWA 3B9PA 1J4AA 2R9VA 3IBSA 3LF1A 4NECA 4QBKA 2EEZA 4KI7A 4LRSB 3ABQB 5I51A 3UK7A 1Q84A 3GRUA 1YL6A 4A5OA 4A1FA 2O5CA 2BP7A 13PKA 2VOJA 3ELBA 2IYLD 1SA0B 4Q18A 5KINB 2PZJA 4RYDA 4E88A 1QLJA 3D4IA 4NCHA 3ZI4A 2ZSDA 3CRVA 1O6FA 3QLJA 1NVKA 3ZKWB 3C3BA 4FD3A 1JKJA 3T95A 1FMJA 4QBTA 5JZVA 4XOIA 4DMCA 5HJ7A 3PR2B 2EW8A 1K6IA 2HB6A 4GE3A 4RD0A 2ACKA 1D04A 3RC7A 5CT8A 2DUWA 3GEDA 4JVSB 3BE5A 1A8PA 1W29A 3USCS 4EB0A 4BJ3A 5HG0A 1B14A 4JL5A 4B3XA 5EMJA 3T5BA 5FIUA 5AESA 5LQCA 2DQYA 4FQ8A 1JHMA 4BNLA 1XFAA 1RRGA 1S2GA 3KQYA 4GOLD 4IBOA 1F9EA 4RLQA 4WY2A 2IWHA 2XB2A 2R66A 1DQSA 2GPBA 2Q21A 4Z0PA 3TLYA 3UT0A 1GWNA 1TU4A 4RF4A 3ZH2A 5AI0A 3L93A 1E9RA 4LF6B 1GZ3A 3LGAA 4AG5A 1U04A 2CHEA 4V0OA 3EXIA 3JWEA 4AJ4A 1R2QA 1MABB 2XUZA 2G4CA 3UYLA 5BN3B 1XWFA 3FUUA 3PFKA 1XVIA 5HNKA 2XUAA 3TRKA 3ZYZA 2P27A 2ZQYA 4J94A 3KZVA 2JPDA 2WWRA 1F20A 1PZHA 3BF8A 4YONB 2GQ0A 3LIIA 3PNLA 3AUTA 1EFTA 4CXMA 2HJVA 2I03A 5KWIA 4OUDB 3DO5A 3TNYA 1FRFS 3AEKB 4NHOA 1ZCBA 3X1ZA 5FFFA 1SRRA 2P69A 4Q0MA 5KNBA 3F73A 1KK3A 1A8UA 2RAUA 3OMWA 4GDMA 1IN4A 4QOGA 4RGYA 5EHNA 4NDZA 4UUBA 4UMEA 3TQHA 2B8JA 1PJCA 1S2DA 3T38A 1I5EA 4ZC1A 1YIOA 3WGJA 1C7RA 3VR4A 4EMSA 4KFSA 4UULA 2CFTA 3DMPA 4ZZ1A 4ZZ2A 1UFVA 2BGRA 2PYDA 1SWWA 3QVGB 2IQIA 4WOCA 4YK7A 2EG5A 1YTLA 1IIRA 3N28A 3D0KA 3HWWA 5I9MA 3E6AA 1QHSA 2VJDA 5TPWB 5TQ0A 4KK3A 5EE9A 5BYKA 5K8CA 2X0EA 1KSGA 1XVAA 4LHSA 5CH5A 1EG7A 4DDTA 1HL3A 4Y6RA 5IM4A 1E2QA 1E62A 2B78A 4XD7A 2GRUA 4LPKA 4OHPA 1Z37A 1Z75A 2PIAA 3HCRA 1IONA 1HA3A 2F9LA 1I4WA 1R8YA 1C3EA 1F06A 1VE7A 1WUTA 2VHWA 4OOFA 4QPCA 3U80A 3F5QA 4QOFA 4D0NA 3RS3A 4PO8A 3PDIB 4MJ7A 4MLCA 5LZ8A 4EB8A 3GLGB 1NVTA 3L6RA 4XARA 5FXMA 4ECEA 1NBHA 1SBYA 3FGOA 1FSGA 2PSSA 4MQUA 3AWDA 3BIOA 5IC5A 1AHIA 2AJCA 4D9HA 1FUYB 3HFRA 4RPIA 4H6VA 4EA6A 1YVUA 4LISA 5EP2A 3A4IA 3F6EX 5FL3A 3LQ4A 4D8UA 4WY5A 5EE3A 4B32A 2I4MA 2I2WA 1MGOA 1EKXA 2BCJQ 2OQ2A 3KHSA 3AERA 3O1IC 1YDHA 4ON9A 5JRZA 3WK8A 4YAIA 1X77A 4BU0A 4TMFA 3HVIA 3WICA 4UBKA 5CA0F 3KSZO 1F12A 2GVNA 3EIWA 3MK31 3MWDB 5H83A 3CLVA 1LJLA 3RQSA 1W46A 4KUHA 4ZWNA 1J8QA 1KEUA 3ELDA 3L9WA 4QQKA 4EJSB 1U2GC 1I4DD 1Q3KA 3FYTA 1IOVA 3HRHA 1A9PA 4S2EA 2VTVA 4Y6GB 1V41E 1BXZA 2AOXA 2E4YA 2BDUA 4M1OA 4RKEA 4M88A 4QFBA 5REQB 3I2HA 2C9YA 2HLDA 3PT9A 3OOYA 3RIGA 2INGX 4UD6A 1Y3AA 4CU2A 1G9TA 3E81A 3RYHB 4AZVA 2BFAA 3FKJA 2C5GA 1NYQA 1Q0UA 2BFOA 2MHCA 2QZPA 1DEOA 2DRIA 3JCZA 4MULA 4W7IA 3VZDA 3VZBA 1GKLA 2PZMA 2OORC 4N7BA 3FCEA 4R8RA 1LS1A 1C1XB 2DWPA 5IS2A 1FBTA 1CS0A 3CMMA 1X1BA 3EPPA 4ZQHA 1GYPA 3CCCA 4Q4JB 3AEZA 5CA0A 3ROFA 2QS9A 1GFZA 4NBSA 1ZU4A 4C7XA 1GPAA 4AD8A 1BE1A 1EK2A 3SM3A 1OX5A 2D0OB 4A6DA 4YMTA 1BVUA 1OI7A 1OQAA 2HMAA 2QZSA 3LXMA 3T3OA 1JR3A 1WKVA 3V4FA 5T41A 5JDCC 3TVYA 2DMRA 2ZJYA 1RPAA 1GSOA 4QLBA 1FC0A 1Z28A 3KFXA 2Y1CA 1RWWA 2NAPA 4JU9A 3S2IA 3D3NA 4EM6A 1XJ0A 5AKZA 3QTBA 4TKVB 1G6Q1 3O2QB 4BQFA 4ZDKA 1C7EA 1FRNA 2I8CA 4LZWA 2V96A 3O4GA 3WTCA 5CBKA 1Z5UA 4ML3A 3FMPB 4UAVA 2GSWA 4DC1A 2PWBA 4QVKA 5AJZA 2WT8A 3A1SA 1PSDA 4MVJE 4TN5A 4X1IB 5HBGA 4ENUA 6ADHA 5HQ3A 2AR0A 3Q41A 1KDYA 2GAOA 1B4DA 2X0IA 1YUMA 2JVIA 1R27A 1P6XA 2QTCA 4E6EA 1F14A 5LP6C 1VKNA 2J0UA 3IDOA 1GNRA 3X1MA 2QE6A 5CA1F 5DWVA 4DF3A 4IJ6A 3PUKA 3ZI7A 5KTRA 1XJWA 3NWJA 1U2QA 3FKQA 3KD3A 2OHFA 4E08A 1DC6A 4RJJA 1KEZA 2YJGA 3KB8A 2WICA 1V37A 1PEYA 4LBYA 3R3JA 4H6XA 3BD8A 4Q47A 4BO2A 1T3TA 2RC5A 5AXCA 1JG1A 4YFVA 3R9IA 1NATA 2BR5A 2Q8QA 3CVJA 3HCFA 3PRKE 5ICMA 3BXZA 2DPXA 5ADWA 5CLGA 3BXXA 4I5IA 3KETA 4EOGA 1SQFA 1HL7A 2QAGB 4K9KA 3A8TA 4O33A 5B5SA 4DR5B 4G4JA 4MJ3A 1G8SA 1M7BA 1VGVA 4BATA 1WQ3A 4LC1A 4G36A 4NONA 1AJEA 2DTDA 3HYLA 1Q77A 1VPLA 3PG5A 2GGSA 1F48A 3GCWA 1M0SA 2H1LA 1I80A 3B5EA 4I6GA 2PUVA 5CA1A 2NP6A 3DPUA 4R98A 4U7FA 5AI5A 1SBZA 1VSUA 4QYIA 4ZQCB 2Q1XA 3WBBA 2IUFA 2I6TA 3I39X 4HQOA 2QTNA 5JH7F 5A0TA 4RKYA 3GELA 1GYRA 4B4VA 2CXTA 1TUBA 5ECWA 2AE1A 3VDQA 3IBTA 4BQQA 2OD2A 5JYBA 3HHEA 4JP1A 1UKCA 2YMMA 3ONEA 3EULA 2B0CA 1GZHB 3LA8A 4B5KA 4AS1A 1AKRA 1YE5A 3PGXA 4NEGA 1I7NA 1YMVA 1EINA 2PBZA 1NP3A 2ID7A 2W2PA 3CLUD 2IP4A 3O1LA 1C2YA 3EYWA 1TCUA 2DF8A 2Q07A 4NJMB 4ZCMA 1PFVA 1W49A 2ZR9A 3B48A 1XNGA 3N5KA 4TMKA 1RXUA 5FQNA 5L4SA 5HF5A 5TXGA 2EP7A 3S0JA 2C84A 4G0XA 2GZMA 5BP7A 1RMTA 2XVAA 3QVOA 4ZAWA 4MDFA 4TXNA 2CKMA 4UFPA 2WNSA 3OFVA 2QV0A 1RPJA 3IAHA 2I2DA 5BXYA 3MJFA 3UV7A 1F5SA 4KGXA 2RHJA 3WWEA 2PH1A 1Z4MA 2AN4A 4YRBA 3OCZA 3L02A 1C29B 3HA2A 3MTQA 4GMFA 1YNOA 2XDQB 3K9WA 1FDRA 5L4NA 1YB4A 2QM0A 3DLIA 4XGKA 4BFUA 2YWHA 2JJ1A 3VH2A 3BCSA 4RA6A 1TVKB 1YQTA 4GM0A 1ORTA 2NPOA 4B81A 5E4JA 2G3YA 4ALMA 3C87A 1XZQA 3SOZA 5HIMA 2AF4C 5CFQA 1C7FA 2VJOA 4WACA 3DV2A 1GPNA 2WUEA 2OTCA 2XQFA 4PPGA 2W70A 2ORVA 5D6NA 2I1QA 3SY8A 2OZLA 2EAUA 2H08A 2F00A 5ALRA 1R5JA 5G02A 1FLNA 1H6BA 5AOBA 1G38A 3PUZA 4KP7A 5ALZA 3FCOA 5AW1A 2I0FA 4DDUA 3WZLA 4PYIA 3VR2D 5L3QB 2I2BA 2ZSKA 4JLDA 2F1RA 4WSOA 3LUGA 2G9UA 3IR7A 2IZOA 1VJGA 3ZOZA 1SUEA 1JWBB 2BTQB 2W6ID 3VYWA 4IL5A 2XUGA 2R8YA 4UOQA 5F35A 3U7JA 4BNXA 3N39C 2C7RA 3IXMA 2C7OA 1E99A 4F96A 4JASB 1BGWA 5LQNA 5AI9A 1D5WA 5HTOA 2PX0A 1JWLA 1FRZA 1SIBE 3SVLA 3A6ZA 1D6NA 2XKJE 4CUKA 3NAGA 1FU8A 2J9ZB 4EGJA 3HUDA 3JR7A 4TS9A 4DKXA 3EEBA 1CK4A 5JS8A 4NU6A 4IVRA 3VISA 1QR2A 1ZRNA 3KALA 3E5MA 4GQBA 4K6FA 2PL5A 5EYPB 1IG3A 1P60A 3V7NA 2PUDA 1LWNA 1FFSA 2Q99A 1I5OA 3E3MA 3BEDA 1AG9A 3TZKA 3VC3A 2P7HA 2G06A 4AECA 3J81k 1GG2A 3DZFA 4JFRA 1U2DA 4DR2B 3HDVA 5HHTA 1OKKD 2NUAA 2PANA 5BNZA 2RARA 2GD1O 4GDFA 4HBGA 1GLVA 5DEOA 3PQFA 4B0OA 1E79D 2QA5A 1KH2A 5J2UB 2Q7OE 1QC5B 3T4UA 2VDQB 1JDBC 2VRNA 3H3XA 1CYEA 2VNKA 4KGZA 1U3GA 5ELLA 1Z83A 5AYVA 1U5CA 2WIBA 3RIHA 1TVCA 3ORYA 4CCYA 2R79A 4DNOA 3A2NA 3GPBA 4N3AA 1JQEA 3L49A 1KFEB 5CMLA 4OX9B 1TA9A 1KK0A 2QV7A 1GCAA 3HYCA 2AC7A 4HL6A 2ZVQX 3TOCA 1REQB 3IXLA 1JNYA 1YTUA 2FEXA 2B8TA 2X9QA 3P2OA 3TTXA 1RLJA 1TADA 5CLJA 2R7AA 2WT9A 1QAMA 1S01A 2L0XA 4WXHA 3K4QA 2OGTA 3CSDA 1O9BA 2LXNA 3PCTA 2FOIA 5KYVA 5LYJF 2RHGB 3SVTA 4I46A 4KYIB 1H4SA 3MBIA 2FSHA 2GFIA 1NY6A 1QOPB 3ZLJA 2G6BA 1WMDA 4KUGA 5A2GA 2COUA 3MWEA 4I1IA 2QZJA 4GPAA 4JYMA 5EL0A 1X39A 2FEKA 4XPIA 5L6MB 3TRFA 1A5AB 2VF2A 5G2OA 1UC4B 7MHTA 3ZY5A 5KOJB 5LZ4A 1JFRA 4QC2A 3C48A 4JBWA 1V5GA 1KDTA 3JQRA 3MEQA 2I4TA 4GNKA 4NBNA 5CR9A 1SZDA 5AW9A 1W1WA 1RCTE 2ZB3A 1M76A 1ZINA 3BMQB 3LJKA 2MYPA 1EPUA 1NRWA 2JFHA 3HDGA 3AI1A 4CKBA 4DRZA 5BSEA 1YSCA 3L8MA 4ZOEA 3O91A 1KTIA 3VFDA 3B5IA 3LZDA 4CMAA 4ZCTA 4OSOA 1YGPA 3AF4A 3CJTA 2B8NA 3GFTA 4OBWA 5IC6A 3IA7A 4E3WA 4RTPA 3NANA 1GPBA 5FLEX 1NNLA 4JI0B 1Y33E 5JQGB 2R62A 1I0IA 1IFXA 4FILA 1LI4A 4FCCA 2EFEB 4CDNA 4CIXA 1XQ1A 1NJ1A 2E21A 3DMFA 4WUTA 5B55A 1XZ8A 3NTOA 1Y63A 2PSHA 5EXEA 3IBCA 2PN1A 2B1RA 1PE0A 4NCIA 1P1RA 2OA0A 2AXNA 2PUEA 3LCMA 2Z9DA 4D9GA 5LQRA 1Z4IA 2FJUA 2QX7A 2PVCA 4PAOA 4YP6A 4MYSA 3DGFC 3WL4A 3AKDA 4W1RA 3AT1A 4B9AA 2QJFA 3JD0A 4L4ZA 2HSZA 4EG5A 1G21B 4HWKA 1T3ZA 1DL5A 1XR3A 1VIYA 2Y9MB 3ZCVA 3NFYA 3LY8A 1DKUA 2H8GA 1C5KA 2PUHA 3L40A 3V4RA 2FDCA 3HS3A 4HGYA 4JOSA 1KJWA 3WHKA 4WNIA 1NVEA 2P9TA 4WLOA 1Y3DE 3BXOA 5C4GB 1MC4A 3MJRA 3H8JA 3KLOA 1B8UA 2QRGA 2AOTA 1H69A 4M1MA 2CZCA 3KCNA 3K53A 3OBBA 3SXJA 1SBQA 1N7IA 2SKDA 2WWWA 4KSCA 3Q7IA 2WRZA 2ICAA 2O0JA 1OYYA 5ICFA 3OY7A 1UZAA 2VH5R 5F77A 1VMDA 2I22A 1JDNA 3WXMA 1Y6FA 3ONNA 2CJPA 4M7RA 2AR9A 3RRXA 3DVQX 3CY6A 2FSIA 3EIXA 3QX7A 2NO6A 2P9YA 4C4RA 3E9YA 2RKBA 4P2BA 2ATVA 3TAHA 3WQSB 4XGQA 2G72A 3RS8A 3NBAA 1EVEA 1XKTA 3GN1A 1G8YA 2Q5FA 2DUJA 5IABA 2CNOA 1K6MA 3CGGA 5ICSA 2GEDA 2CBXA 3KDSE 4JHLA 1TM7E 2XEXA 2ZDHA 5J2TB 3BZBA 3FOAA 1YASA 3F8TA 3GRCA 3KQUA 3K3PA 4CR7A 5IRCD 3KAKA 3NTUA 2VF7A 2FVXA 3AR7A 1E5QA 3RUEA 4QULA 1Q17A 3RRBA 1FTGA 3RVDA 1A7UA 4CMBA 6REQA 1DLJA 4LDQA 1WABA 3SHTA 3RCBA 2WM3A 1A4XA 2J3HA 1GZUA 3DCYA 4RA9A 5ALXA 3M70A 4P0TA 4M9QA 4M0MA 1X1AA 1PZGA 1J20A 1C7ZA 4NS1A 3G7UA 5I4KA 3DHNA 1P8JA 4GU5A 3VNRA 1ZD1A 2QMYA 2NT3A 4OQLA 1O95C 5BW4A 1A5TA 2HGZA 1U3WA 1EVZA 2GEKA 4P7KA 1KC1A 5AKIA 3U61B 2YYYA 3I1YA 5JTTA 2A4KA 3JYHA 3LOUA 1ZWLA 3TBHA 3DVAB 1PO7A 2ZP1A 3H65A 3K0BA 4PSDA 1EVLA 3ST7A 4ZAZA 1X38A 3ROPA 4D4GA 2OOKA 1Z82A 3H83A 5J4LA 1RWBA 5H4HA 2HHCA 4BO1A 2P5YA 3DOUA 3ZX5A 4XWKA 1FP4B 4L0QA 5BMVF 1ZHOA 3P97A 3IUMA 4WZAE 3EDMA 1K75A 2W11A 3B12A 3O8QB 4J9UE 1GT91 4BB0A 4E1AA 4Z1MA 2DPLA 3H42B 1N2BA 3K0SA 1CDZA 9ABPA 4HAYA 5AVZA 4Q9KA 4KLRA 4C0AC 2WIGA 2VUSA 2OV8A 4G4GA 3V1NA 1AS0A 1FIUA 4G84A 5DHQA 5ALYA 3V42A 3KU4A 1D2NA 3W79A 5H80A 5I5EA 2ZM5A 1U63A 4IKPA 4JJFA 3SZLA 3VU8A 3BRQA 5E9AA 5FWDA 4B3HA 3PQ3A 2UYOA 4FXPA 4XJSA 4C43A 3T4EA 1PEKE 1KU6A 3GLKA 3B1VA 1K9SA 2CJWA 3HA3A 3I6IA 2PDAA 5AUNB 2PT5A 4GSLA 4HFMA 4O2BB 2PEYA 3GWZA 3OD1A 2EZ9A 4J0KA 5JZSA 2J32A 1UMDA 2HSEA 4RAQA 5ETJA 3A25A 5C8YB 2AK3A 2QYSA 1JYFA 1RJDA 2C2BA 5EHIA 4DVJA 3E9NA 5HQTA 4LVCA 3VMMA 1C30B 4LVNA 5BSKA 4TKMA 4ZKEA 3RV4A 2OQVA 3RTGA 4A0HA 3PEYA 3ICPA 3N8DA 2YZMA 4TZ0A 4R31A 5TPZD 2Y1WA 2Z4RA 5H59A 4CI9A 2CB0A 3T9AA 1SUWA 5A4MS 3P5SA 3ID6C 3ZW9A 4EJ0A 3QVTA 4H1HA 2H1OA 3MB8A 1KZHA 1QRDA 2JAHA 1VL1A 4FPXA 1GSHA 1EXVA 3DYVA 3AY0A 3RUFA 5HS6A 3E8XA 2ZK7A 1DQYA 1EWKA 3LDUA 3A9CA 4FKZA 4JLPA 4O08A 2GEFA 1DWPA 5DOZA 5FAKA 5J2UF 3Q85A 1P9LA 2NPIA 2OCBA 3EPKA 1LPNA 1RLTA 2NYRA 1A5BB 4KN8A 4Y1RA 4C20A 4YACA 1Q6ZA 3GOHA 2R1ZA 3FDZB 2W83A 5DMHA 5H3HA 3OKFA 3FGZA 4R8VA 3DMTA 1Q7RA 3MWGA 5HYVA 3BBLA 3KPYA 4JA2A 4X71A 4B5LA 1CRZA 1DC8A 3C3MA 4UATA 4RMNA 3R44A 5CVDA 4BU1A 5A7FA 5HUQA 2ZB8A 2XVZA 3EGDA 5CCDA 2QAJA 1Y3IA 5AKEA 1QFSA 3AFGA 4QUAA 1XTTA 4V0SA 2GBPA 3GLSA 1MXHA 1GRQA 2JGJA 2X3FA 4QUDA 3FTNA 3THWB 2JK0A 3DFZA 3UMSA 4KWTA 1SD1A 4KZPA 4ZVSA 1I51A 1RRMA 3CNLA 2LCIA 1TM5E 3OCJA 1SCUB 1TCCA 5DX0A 1GIAA 3EB9A 3KR2A 1JAXA 1SCDA 2HF9A 5EGSA 3KQNA 2HDNB 2EBWA 1PHPA 4ZYTA 2H2HA 2NUPA 2QUBA 4P31A 4REQA 3ZLVA 1IPHA 3SC2A 2ZPAA 1WW3A 1ULUA 4NARA 2XKAA 3VNBA 5JD5A 4IMPA 1H85A 1KU0A 4XVRA 1WY7A 2WHQA 4XRRA 1BHSA 3UJ3X 1HFKA 1TKBA 2DB3A 1KI3A 1KPIA 4PZ9A 4YRRA 1W5FA 3A3KA 3KV1A 3F9CA 4CMGA 1T0UA 4NYIQ 5EZSA 1R0ZA 1SVWA 1M1XB 3DH0A 2V59A 4H3HB 4U9IS 3WJ7A 1LDMA 1O54A 4WK0B 4Q4DA 3KT3A 3RAJA 5BWMA 2ILTA 3JVVA 4X1YA 3ZDQA 1XBTA 5IWAB 3JVIA 3E53A 1ODCA 3F3MA 2M1ZA 2P9BA 4ZO9A 1AMOA 3IELA 2QVGA 5JQGF 1DZ3A 1PJQA 2OLJA 2WTBA 5F5XA 2VJCA 4DIKA 4HNGA 1W4AA 1DAMA 1ISGA 4KU4A 4LSGA 5BPHA 1J24A 2IIVA 1HYHA 1B76A 2OCLA 3MJ4A 4PQFA 3V8RA 1CJSA 4DCVA 1Z0JA 5EZ5A 3CW2A 1VCIA 4YP7A 4ACBA 3FTQA 2PX5A 3D5EA 5FNZA 4QPJC 2I6XA 1QR6A 4GWGA 1PU2A 4CKYA 2TRSB 2BAGA 2VLIA 1A9SA 1NF2A 2V3WA 5EJAA 4B2IA 3OIDA 4LXHA 1OXKB 4BVGA 1JH9A 3K70B 2ZAYA 1EJBA 1NU6A 2BUBA 5BUCA 1HY3A 1NQUA 2TMGA 3MOGA 3V9PA 1MAHA 2AN5A 4C2BA 3OE4A 3DKKA 1MO3A 3G7SA 1E0AA 2XBLA 4F06A 1EZ1A 1H5UA 4EFNA 3KD2A 1E2UA 2H1FA 4QO8A 2RGUA 2XGMA 1NYTA 4ZQGA 2WYIA 5AJVB 4DWJA 3DW1X 1HO3A 3FYCA 4RX1A 1G5FA 1KZYC 1VLQA 1QAOA 2I7CA 2VNHA 3L8EA 4ERNA 5JBQA 2N9UA 3R5XA 1F17A 1NGSA 1A9QA 1OWMA 3IB6A 4TL7A 3RS9A 2OZVA 3TR5A 1TC1A 2BGMA 1CFZA 3M5DA 1L5HA 3CZCA 3TWOA 1TJYA 4DDKA 4V1CA 4M1TA 1VE6A 1FL9A 2DFVA 4KQ9A 3G2NA 5IF3A 2I9KA 3JATA 1NPYA 5BQPA 2XA9A 1MB2A 3O26A 4K03A 2I71A 4RFSB 4AP5A 2GZ3A 3WA6A 3JYPA 1BWQA 3DZBA 3OOJA 1R4AA 3O31A 1V95A 4KE8A 2DH6A 3VKFA 1VJCA 4YB8A 2QMZA 1HUQA 2R6FA 1OW3B 3KJFA 4LRUA 4RZ3A 5DTQA 2XCOA 4XIJA 4ZV7A 4BO4A 3PX7A 2XUKA 3BMNB 4FCTA 2O5EA 2BKLA 1Q7BA 3NFRA 4DNXA 3KZXA 5B7GA 1SU4A 1SC1A 2OB1A 1SZPA 3PQ5A 3GARA 1UPCA 4YT5A 2GUGA 4JNCA 4S1PA 3KXPA 3CEPB 3VSAA 2JGKA 2GLUA 4JJIA 5EP1A 1SXJB 3U3OA 4B6QA 5I01A 3WIVA 4ARSA 1XEAA 4CN9A 1JDPA 2OBYA 1JVNA 5A5VA 1U7HA 3C39A 5TB5A 5KYWA 4UQOA 5IK2D 2YOFA 1KPHA 3EG5A 3V46A 3RLIA 2NV6A 4PHFA 4Q4LA 1EFVB 1Z7YA 2Y05A 1IE3A 2PIDA 4JKOA 1JNXX 1I3NA 5JQWA 2Q1UA 2G1PA 2BFNA 4JBYA 3BQMB 3R5SA 5IAGA 4HQKA 5F23A 1NX6A 1PF7E 3B70A 5LBTA 3A1TA 4LF4B 4BFZA 4N0MA 1DFIA 3STUA 1TM4E 1UXHA 4WKCA 5D1HA 2VJMA 1DRWA 1TOAA 3GUZA 4RD2A 1Q19A 3A0RB 3CWCA 3DCJA 1FS6A 3OD5A 4O63O 4MX8A 4HZUB 4JLKA 3CZPA 4PYMA 3B2EA 4MP6A 4I5GA 3U2QA 3PGVA 4F4UA 3ISTA 1YF3A 4JEUA 2VI5A 3BK1A 4C2UA 4KR0A 3TCNA 1W4ZA 4KMRA 1U4OA 1I4OA 3VPAA 2G5GX 2HM7A 1RRPA 4OYRA 2NUTA 4BJHB 2C8VA 1O4WA 1T4BA 3E3LA 1GU0A 3H0CA 3KQPA 1ZFNA 4IR7A 2P68A 4M9CA 4P0PB 4PYRA 4EF6A 2I6UA 4R8KA 3FRIA 5D01A 3GLIA 3TL3A 4E4YA 1SCJA 2A1IA 1JBEA 1QVVA 4FCWA 3BFPA 3EXHA 4Z0TA 1UFKA 3WLKX 4QOHA 2FUG1 5TEWA 3GLHB 1VMKA 4MVJM 1WU7A 3DTNA 4MR7B 1WPGA 4N8DA 4TS1A 1H8HA 1W44A 1RM0A 1O6CA 2BZGA 5KVVA 2EP5A 3U3MA 2JLYA 1TRKA 4YQYA 2BF4A 2C7PA 2XLCA 3DM9B 3FKSA 4GSYA 4KQHA 4TYMA 3T34A 1YJAA 3CX7A 5CDFA 3Q3CA 3U4QA 1JEYA 3WGGA 3TECE 2PA0A 2H51A 3I0MA 1RWPA 3O8BA 5K3CA 1THZA 3T7SA 3TW8A 3AMVA 1GUFA 4MAFA 3SJAA 1AMNA 1AKWA 3CF0A 3IKJA 3IPAA 5T67A 2AVDA 4IDCA 1XJ5A 2WZCA 5FA8A 2G36A 3A1UA 4EBBA 3W5CA 1ECBA 1TZKA 1RRVA 2CHGA 1P7ZA 2JVKA 3H9QA 1D2AA 1JECA 1JJAA 3KBOA 4ZHSA 1T4GA 4PFKA 3LQKA 3OX3A 4HDRA 2GM5A 4U7PB 3L8FA 4JBNA 5FPSA 3ZBPA 2ZAGA 4NZYA 1RFGE 1SPBS 1X3SA 2H65A 2HMUA 3RAEC 2JH3A 5IARA 3NYWA 1M75A 3EZ2A 4ZARA 1M2VA 3WYGA 5E3IA 2JIZA 1MIOB 4LN1A 1ZI9A 3K32A 1KY5A 3DMNA 1U5BA 2PMDA 2Q0HA 1ZK4A 4D82A 1XZJA 2QLMA 2QNBA 2PD3A 4QSHA 2FGJA 2WUGA 3NC4A 1ACLA 4YJGA 4BN5A 1SBIA 2DHRA 5KQRA 4X20A 2VZEA 1UKVY 2ILVA 3JPYA 5D87A 3HBFA 1FNBA 4TLLB 1R10A 2D13A 1G17A 4DEVA 4BAGA 4PNHA 3SNHA 3LA6A 1WCIB 2VSQA 2ST1A 1ULAA 2PV0A 5DCWA 5B3AA 1PZEA 1JQLB 3NWOA 2R97A 4U2EA 1TLTA 4AMYA 2ZJAA 2W98A 5IMSA 5JIBA 3NTLA 5DBGA 1STOA 3O92A 5FOVA 5P21A 4N49A 4QJ3A 1Y5LA 2G08A 2H7YA 5HIAA 2KBEA 1G5RA 3GGJA 1JB1A 4YJ2A 4CMHA 3ETDA 4L8WB 3REQB 1ZEJA 2Y6UA 3VPBA 3QKSA 1NR1A 4KTTE 4GLOA 2CMHA 4LXUA 4PAMA 3WGYA 4BMYA 2PSDA 4YUYA 4OI0A 3QW2A 2V4MA 5DHAA 3WLPA 4C03A 4Z9AA 2WYWA 5LIRA 5LOVB 2MMCA 2I8AA 3FTCA 4CMJA 1DS6A 3QVMA 2D2XA 2YZ7A 1MW9X 3PUYA 1NJ5A 2D3WA 2PG3A 3L6DA 3FW1A 3AQ4A 4IIJF 2JFQA 4BNDA 4PLZA 4WK2B 1T6NA 1UBKS 3P9IA 4LUCA 3T94A 2DULA 1A71A 2QQFA 3LI2A 2AFIE 2C1EA 3F6CA 3MINB 1VG9B 5JSFA 3K09C 1W30A 2XW6A 4CLRB 1T0IA 3RE1A 3AUJB 4RSGA 3BSWA 3CLTC 4OU4A 1SJ9A 2HDHA 3K7EA 4U6QA 4DGSA 4RTKA 4AW9A 3AB3A 1SC4A 3KL2A 4XWOA 4NPAA 5TNXA 5ICCA 1DIOB 1YA4A 2VHJA 4BX8A 2QXYA 521PA 3O8RA 1I3KA 4PWYA 1KGDA 1A8QA 2C0QA 3PJDA 1S7GA 4PX5A 5AW8A 3DE5X 2DU8A 3OT1A 1UP7A 2QR3A 4HBZA 1X80A 2PQ6A 4XLZA 2UZ1B 3RK0A 2QYHA 4XCVA 1CUIA 2X0FA 4Y7DA 4EPRA 10MHA 4NATA 2FX2A 5JBNA 2DQ4A 2X2OA 5FO0A 2J31A 5I3CA 1Y4SA 2ZWPA 4R7TA 2VPXA 4RF5A 5BWLA 1NUQA 2VSNA 3W4IA 2GCEA 1O9HA 1US8B 5CB4F 1VTKA 1ZCAA 2GK6A 2V4UA 5PGMA 2HMTA 2X0RA 3BDIA 3CNEA 3I45A 4XSHA 4RCYA 3A4LA 4TLCA 4XWTA 2E7ZA 2PAFA 3ZXSA 2PGLA 3L1KA 1U7ZA 4NMLA 4CMIB 1QKJA 1VZ2A 2JIQA 4ENRA 5B36A 4B3JA 4NESA 4E5DA 4B7UA 3KTAA 2IEDA 2ZVDA 4J16C 2RHBA 1X2BA 2AXPA 3C5HA 3VH3A 5SICE 1GILA 2H1SA 3OEEA 3IPRA 1OYOA 3UTCA 3VYVA 3QBTA 2GN8A 1YFJA 4HNQA 1DKMA 3LZCA 3DBHA 1KE2A 5IUKC 5IDWA 4YWHA 1Z8FA 3FWYA 4V0RA 4RLFA 4TWRA 3AFMA 1JRLA 4DV3B 1YQEA 1V4VA 3EFOA 3LWZA 5I9NA 4CDGA 2IHNA 1WG8A 2GO7A 4NMMA 4EHDA 1BZYA 2OBFA 3OESA 1W2WB 3B6ZA 1LFAA 3C8ZA 2DTEA 4RZXA 1H3EA 1LBHA 5AOCA 3TIFA 2X6RA 4LY9A 5CB4A 2YRXA 1LTKA 5HPYB 2ZAMA 2Q49A 1UBEA 3OZ7A 5FTKA 4LC9A 3QPAA 4TSFA 1P18A 4C0KA 1XEWY 1CY7A 2F1OA 5I5GA 3ASUA 1YI8A 2R68A 3CIFA 1CULC 1Y3FE 1CV2A 2OCDA 2IEAA 2REQB 1UC9A 3N3AC 2WTEA 1E1YA 2G82A 2QOEA 2ZRMA 4G07A 5F3RA 2YOHA 2GA8A 1KI1A 4KRFA 3GFRA 4ASUD 4QTYA 1YOBA 3MQ2A 2JIDA 2PLRA 4FOLA 4HWGA 4KIFA 5DGHA 5FFNA 4QPNA 4AY4A 4MVJF 5LVAA 4G5QA 1H22A 2VUHB 1FYXA 1I2ZA 1SUDA 1UMCA 1NQTA 2JRCA 4X65B 2YL2A 5JAMA 2G4VA 2ZSFA 4UZEA 5K6TA 4C3OB 4QWWA 3URMA 5FI5A 3KJNA 4FSHA 1Z18A 3KQSA 1ABEA 4MYCA 2YWCA 3IKVA 4H15A 1TQ4A 5EFOA 4DLWA 4XB6B 4YHHB 3IP6A 5EJEA 4H0CA 4F97A 5H68A 4YRIA 3ZHXA 4XUEA 1CB0A 4ZYWA 3JARA 3UK2A 3VTKA 4OKIA 4LNUA 2MSNA 4ZDJA 3J81A 3CURA 5TEVA 4A2WA 3Q15C 4M0EA 3K9BA 4KB5A 1GPMA 2HSGA 3QOXA 4CQNA 1C7QA 4MVJA 1DVRA 3P9PA 3ZHTA 1Q44A 3T7AA 2RAVA 4I36A 1R18A 2BP7B 2GARA 2PXCA 2XQJA 4S1WA 4UU1A 1N2HA 3QFCA 3FHLA 4G37A 3K05A 1U2ZA 5T8KC 3A6PC 3A2MA 1SKMA 5MGBA 2JLCA 2WSYB 4TUYB 1NQW<