3U3KA

Crystal structure of hsult1a1 bound to pap and 2-naphtol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
TSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3kA00
3MAAC 1ZD1A 3EIHA 3KJGA 3KB1A 1RRGA 4NCIA 4B75A 3VFDA 3JZMA 4BFTA 4C0HA 3CWQA 1NKTA 3KFVA 1NJGA 4JSTA 5IK2D 1KNXA 1NKSA 3NC0C 1CR1A 1G18A 2KE5A 3C5HA 2IW3A 4E09A 2QPTA 2A5GA 2WWGA 3F8TA 4FMCF 1OE0A 2R65A 4M1KA 1ZM7A 2F3RA 1Z6XA 3SBEA 2A7QA 2GEVA 2HEIA 2N1BA 2VH5R 5JHGB 1XZPA 2IYRA 4LRWA 3RS4A 1HE1C 2ODNA 4DCUA 3KQHA 3U3RA 2P0EA 1GVNB 2RGDA 3KZ1E 3X1XA 2OAP1 3UMRA 1X6VA 5FPKA 2ZJAA 3LX5A 2WZQA 3LBIA 2AD1A 3GEEA 3OEED 4Q18A 4ARZB 4B2IA 3RHFA 3GLHB 3C15C 3K70C 4N0EA 5JECA 5IK2A 4HB3A 2YINC 2D3WA 5DI9A 4HYYA 3HPQA 1GM5A 1UAAA 4U5XA 4Q66C 4LYAA 3AM1A 2F1RA 2G83A 2W0MA 4RFVA 3A1SA 2LCFA 2CK3D 2BIFA 1KSHA 1M1YE 4R9UC 2FMXA 4CYMA 1TQ6A 1JI0A 1U90A 2G0NA 4G5SA 1OPXA 1TNDA 4KVAA 2CVFA 3WBJA 4DWJA 4TLCA 2VEDA 1OKKA 1FFHA 2B21A 3UMSA 5JRJA 3BB1A 3L0SA 1HH4A 2HV8A 3D8BA 1KDRA 1NY6A 4BRUA 1D2MA 4BGDA 5KU1A 2ZR7A 4LHVA 2IC5A 3OESA 1G9XA 1II0A 3H1TA 1G291 4BEJA 2ZUBA 1KJWA 4KSCA 2IEZA 1GP2A 4DLTA 2WWXA 3K70B 2PX0A 4I4LA 5HPYB 2HUPA 2QAGC 2YYZA 4FWIB 5FUYA 1KI1A 1SQ5A 2CE7A 1D2NA 1XX6A 4XIGS 4W5WA 3LVRE 1R0ZA 2PZFA 721PA 1F60A 1QHIA 1Z6TA 3H0KA 2RGNA 2VIIA 1P72A 4IFEA 2AX4A 4PO9A 3V4RA 4Q03A 2AFIE 3PUVA 4D0LB 1ZNYA 4BLSA 3SC3A 1IM2A 1NSTA 2JJ2A 2GXUA 3QKTA 4XD7D 3JZAA 5H1YA 3A4MA 3TVDA 1TF5A 1XTRA 2QP3A 2ZYUX 4HLUC 1FQKA 3WYAA 1MO5A 3BERA 4Q9JA 4AURA 1QHSA 4CGZA 1AGRA 4V03A 5JJKA 1ZYUA 1GNQA 2CHVA 3ZVNA 1OIWA 1L4UA 1KGDA 3SS8A 3K0FA 3IIJA 2VF7A 5DN6D 3AVOA 1J8YF 3OEHA 2Q21A 5DH9A 1RJ9A 1OFTA 5LD2C 4IDNA 5C18A 5K8LA 2WOOA 3SJBA 2RB4A 1XEWY 2FEOA 1VYUA 4A15A 2GRJA 1A5TA 2C96A 3K0AB 3WNDA 1QVRA 2VP6A 4Y0VA 1TMKA 2WWHA 2ZSEA 3CKLA 1CEEA 1YZTA 4HAYA 5L3SB 1J8MF 3QF4B 3LD9A 1GZSA 2OCAA 5H68A 2IA5A 1JR3E 1P9NA 1RZ3A 4V0MA 2IYVA 1ZC3A 3FWYA 4LGMA 3HJNA 1E2QA 3EIEA 2BCJQ 2QTHA 4HI0E 3IDQA 2C95A 4IEIA 5CIWA 3EC1A 3BIFA 3EARA 2ZJOA 1E2DA 5AUOB 4MA4A 1YU9A 2QG6A 1Q3TA 3ADCA 2EFEB 2GJSA 3A8TA 4HLQB 2XZPA 4ARZA 3LBNA 4RVCA 3UATA 1JPJA 2AWNA 5TDHA 2ERXA 1R0WA 3D7MA 4TL6A 4EPYA 4JVMA 4JBWA 1L8QA 2GESA 2CJWB 2YC4C 3IHLA 4YLGA 3OAAD 4NBSA 2ZRCA 1Z5ZA 1U0HC 4JYBA 1N3BA 2X8AA 1CJKC 3PQCA 4IOMA 5FR2A 3TBKA 3LNCA 2WSSA 3RRNA 4EQ6B 1P2SA 1EWRA 2PLRA 3VNVA 1E4VA 5H70A 3ZVMA 2CL7X 1Q22A 5KSOA 4GZMA 3OFNA 5ELXA 1WBDA 1T3LA 2ZRMA 4M1MA 1KI6B 2V8OA 1XNJA 2TMKA 4BFWA 3HWSA 2HLDA 1NN0A 3WMFA 3MJHA 1JQLB 2ZRLA 3U4QB 3FOZA 4QGAA 2EW1A 4D82A 3BB4A 3TJZA 1KO5A 2AWOA 2IT1A 2WHXA 4RZUA 4V0ME 3B1YA 3VAAA 4URXR 1E1RD 5KNBA 3K70D 1AKYA 1Z22A 2AKAB 3AVTA 4D80A 2RGBA 1CR0A 3D6TB 4LJ9A 1L7VC 3W90A 1NG1A 1XMJA 4FD2A 4ZKEA 5FBWB 2QTVB 1MKYA 1W0JA 1K6MA 1FQJA 2HXSA 3LH5A 1GFIA 2JAQA 4A6XA 2O0HA 4FMBB 2AL7A 4NKRA 3ND9A 1G3MA 2FGJA 3KFXA 2VA8A 3ZZTA 2XB4A 3KL4A 2QU8A 1ODFA 4IVQA 4B71A 1OIVA 1CULC 1ZM9A 3KX2A 4U00A 4CRWB 4E07A 2FF7A 2W0SA 2IWRA 4GL2A 5BN3A 1Q1EA 1N5KA 1G16A 2GK7A 4BQSA 3I5XA 2DFLA 421PA 2NQ2C 1ZINA 1QG2A 4OHZA 1Z8FA 3BRWD 3S1AA 1HT2E 5CK4A 5FR1A 2GJ9A 4HZUB 2BDTA 3TKLA 1PZNA 3TSWA 1JAIA 4BRWA 4ZDKA 4LBVA 2IEYA 2QPOA 2ZANA 3PFIA 5CIQA 1SVMA 4EJSC 3O8CA 2G6BA 1WCV1 3L8ZA 4KV9A 4PC1A 3TSOA 2W6ID 5BQ5A 1NBMD 4TQUS 3NEJA 1BO6A 3GJXC 1VIAA 1EFUA 4QKQA 1NY5A 3U3KA 1C1YA 4KYIB 3ETLA 4AKHA 2I3BA 4R7ZA 5HE9A 1Z2CA 4JYCA 4JLJA 4F91B 5DYIA 3EPJA 1KO4A 3NXSA 3P1JA 3Q72A 1KZGB 4FW9A 1KK3A 1GUAA 1R5OA 4WXRA 4MKIA 1AZSC 1ZAKA 2Z4SA 1II8A 3AV0B 2WV9A 2AK2A 4JJKA 5J4VA 2W83A 5J4KA 2Z4RA 1VYVA 4Q00A 4M4SA 3GFOA 4EFMA 1A7JA 1N25A 1LVGA 2QRNA 4ZDWA 2F43A 5AUQA 2I4IA 3W3ZB 4B3BA 4NCNA 2C98A 4Q1AA 5KDDA 4YC7A 4BLOA 2FX3A 2H5EA 2W6JA 1T8TA 1UPTA 2IX3A 1TUIA 2ZE6A 3X1ZA 3CX8A 4YDSA 3I8XA 2F3TA 4DIEA 1LB1B 3R20A 1ZNXA 2V9PA 4QGFA 3I1FA 5KSZA 1CJTC 4K8OA 1GITA 2QQEA 2GNOA 3HR7A 3N5CA 1NVXQ 5AWFC 2J9RA 1V43A 3BH0A 2QAGA 3C7KA 3H86A 4KYUA 3QKRA 2REOA 4BFVA 1S8FA 2PT5A 1UADA 2D2EA 3X1WA 4V0NA 4QNRA 5A0FA 2IYXA 2IUTA 3NKVA 5BN5A 5C4MA 5FBRB 3CPJB 1M34E 3IPXA 4M9QA 2FN4A 2EFGA 1TAGA 2EYUA 2CJWA 1G7RA 2YNMA 1XJQA 1GIAA 2ZJ2A 3VTKA 2AXNA 4UNSA 1KSGA 4TYPA 1XTJA 1XPOA 3QXSA 1DAGA 2C8VA 1IY0A 3VMFA 1G20E 5GJVC 1A2BA 4CEJB 2QSZA 3OZXA 3VX4A 1IN4A 2QMUA 4NH0A 2XXAB 2XTMA 4URUR 5DI3B 2F7SA 5JWRA 1LFDB 3B9QA 1OH7A 1JNYA 1YRBA 5DYGA 4DHEA 1FZQA 2X2FA 3FMOB 1AIPA 1R7RA 2B7CA 3K09C 1RYHA 4EFNA 4L15A 1UBCA 4DDVA 2VLIA 1Q20A 3WP0A 4FN5A 4LZZA 1E9SA 2BBOA 3MCAA 1Z2AA 4Q1EA 4NP6A 1YZKA 1GDDA 1I4DD 1OT3A 1GG2A 4QJ5A 3MJRA 4JVSB 3GLFA 1XJCA 2YC2C 1NN1A 2AD5A 1PLKA 1RJ9B 1KY2A 3RS5A 3IBYA 2GEUA 1BMFA 2ANBA 4JSYA 4RD1A 4IEEA 1XJ0A 2GF0A 3EZ6A 4LDJA 4AG5A 4X8MA 4IXMA 4MRPA 3SYKA 3THOA 2J7PD 4D26A 2NO0A 3NIBA 5KPJA 4M1TA 4PO8A 4DLRA 3GJ8A 1N6IA 1XTQA 1KO7A 2QGNA 2B8WA 2ZITA 2BEJA 4W5JA 4U7DA 2JCSA 3KJIA 3W34A 2JDID 2WAXA 4YXWD 1A4RA 1W0JD 2ZUDA 3ND8A 1DPFA 3QIAA 1XPRA 3O8BA 1N6HA 4PHGA 1JR3D 2JEOA 1CRQA 4A8JA 1JJ7A 4C0JA 1XMSA 3AVVA 1IHUA 3KKOA 2E9SA 4HLCA 3SEAA 4DXAA 2C9CA 4QL3A 2R6DA 3KKPA 2ONKA 1P75A 1HEIA 3W5JA 4BFYA 4ZI3A 1MT0A 2LKDA 2VRWA 2XSZA 3FVQA 1OH8A 1RKBA 1I2MA 3ADBA 3GFTA 1X8JA 3OFND 4TYWA 1UBEA 4XVUA 1HUQA 1Z28A 2QP4A 4N1AA 4DSOA 2QA5A 4Q7KA 3RWOA 3OHMA 3GLHE 3UANA 3TUZC 3DZDA 3DZ8A 4LYHA 4Q48A 4C3ZA 1ZJ6A 1M74A 5JHHB 4PHTA 1GOTA 3B78A 2NO7A 4WBSA 3RDPA 1F6BA 4ACAA 5E3HA 1E1RA 2DPXA 1KK0A 4NTZA 1N5JA 4JVNA 1XXHB 3K9GA 2ZRPA 4FMDB 4QBFA 4QJ3A 1G64A 1DEKA 1US8B 1WXQA 1ZC4A 4A2QA 1OXXK 4ZDJA 2O8FB 1IONA 2J0SA 4AYTA 1F3OA 2ZM5A 3L82B 2OT3B 1US8A 2FE4A 4IFBA 5B58C 3OIUA 2WJHA 2CLCX 2XZOA 4P4UA 1YQTA 1E9AA 1FUUA 2OLKA 4B47A 2PZGA 3UWKA 1JXOA 5AUNB 1G19A 2RAPA 4WZAE 4UKDA 3U4QA 1RC8A 2ATXA 2G88A 3R8FA 2Z5FA 1KIMA 2ATVA 1U0LA 2BOVA 2J0QA 2GF9A 4IHQA 4D0NA 4AD8A 3ZS9A 2PJRA 4NL4H 2OCPA 3HDTA 3T1QA 4DSNA 4BPBA 3N70A 2H16A 2CLSA 1NSFA 4TLEA 3THYA 1G1MA 3K0CC 1NMYA 1PLJA 2D06A 2JLZA 2RMKA 4KVGA 3TE6A 4QRHA 3EASA 3BK7A 3PUZA 5EJEA 2V1XA 1W5TA 2AR7A 4IKEA 3CNLA 3LX8A 3GFPA 4B2PA 1LTQA 3NBYC 3OF5A 1G4AE 4V0LA 1BYIA 5FUVA 1VDZA 2GCOB 2NPIA 4LPSA 4JLOA 1OW3B 4QBIA 2QN6A 1WDTA 2BBSA 2O8CA 2VTKA 2QY9A 3QBVA 2KB0A 1N6KA 1U2RA 3FB4A 4Q7JB 4ASUA 3DOFA 1E79A 4DSUA 3X2SA 2FZ4A 2FPLA 4O2LA 1G3IA 1U94A 4LYJA 4B32A 4HAVA 5FI0B 4OK3A 2FU5C 3OIVA 1W1WA 1Z07A 3QEJA 1E9EA 5KHOC 2QQ0A 4KHZA 4XWOA 3BFKA 5EXTA 1E9CA 3B2EA 4PZZA 2CXXA 1P6XA 1W5SA 4B33A 2BKUA 3P32A 4JLKA 2QMOA 5JCZA 3NH6A 4DDTA 3ZJYA 3RS3A 1WA5A 3L0PA 3PUYA 4RZXA 3IQXA 2OFXA 4RD2A 5J4LA 3U60B 2V55B 4LY6A 2VP2A 3ASYA 1KKMA 1R0YA 4LV8B 2N46A 4P4SB 5FOUA 4ZO4A 1OF1A 4CF7A 3KXKA 5F98A 2DYKA 3R9IA 5FUWA 1WE2A 3B5JA 2JJ1A 5JRZA 1AS3A 1UEIA 1IN6A 2ASEA 1P2VA 3OIYA 2GA8A 1LW7A 2IYQA 2RKOA 1KZ7B 1Q1QA 2XITA 3EWAA 2RGEA 1T9HA 2DBYA 2NGRA 4EFLA 1D8TA 3CNNA 1P3JA 4M1YA 4HAXA 4KI0A 2RCNA 5J4HA 2X1VA 5CK5A 1T0HB 3H2YA 3FMIA 1S0UA 3NG1A 3EXAA 5K8TA 3NTUA 3SQWA 2GBLA 2ZE8A 3LAWA 4F93B 2A78A 1GNPA 2QP9X 2IS2A 2IUSA 3GP8A 4GOKA 1YR8A 3RANA 4QG7A 5SZHB 2NZ8A 1UKEA 4MGKR 4RD3A 5HZHA 4PC3A 1ZUHA 4PQRA 3ZZ0A 1CXZA 2XX3A 5CJPA 2QGZA 3GCGA 3QG5A 2XNDA 3BH7A 3VKWA 2QAGB 5JFGA 3AEZA 4MUAA 1Z0AA 3MRSA 4US2R 2UVQA 4FCTA 2KJQA 3L43A 4Q1CA 1ZU5A 4II7A 2F9MA 2ZRFA 2O8DB 2D74A 1XBTA 1QZXA 2ZROA 4HDOB 4HLDA 1X3SA 2FSHA 2ODEA 3NBZC 2QORA 2Q9AA 1OHHD 4A2PA 2GCPA 3OE7A 3Q5EA 5KNDA 3RC8A 2ERYA 4KFUA 3DDCA 5DHFA 4B3CA 5JJLA 1QHYA 3A4LA 1KK1A 4GBMA 1SKYE 2ZJ8A 2Q9BA 1GL7A 4A2WA 4HAUA 1GTVA 1IXZA 1MR3F 1QHGA 1UBFA 3C8UA 3HP1A 3PR1A 1CU1A 5L3QB 5IRCD 1E2MA 3AB3A 4LHWA 2FGKA 1R5BA 1GKUB 4GDFA 2XAUA 4GRAA 5BXQC 4YDHB 3EZ9A 2QMHA 2VHJA 4TLAA 1PVOA 1KMQA 4P4SA 1GKYA 1VIYA 4KAXA 3QVVA 4P4TA 2JLXA 2C9OA 1P9WA 2C78A 5EQTA 2VO1A 2F6RA 4Q7LA 3THXB 2FV8A 1EGAA 4DUGD 2YOHA 3QEOA 2H57A 2ZI4A 4ERNA 5AJZA 5H8WA 4KCGA 4PAOA 3AVYA 3CB4A 1XFAA 1ZNZA 1R10A 5HE8A 2ZXUA 3UK6A 1E0JA 2KI5A 2BMJA 4LV6A 1KOFA 1V5WA 4WW0A 1JXMA 2BBTA 1GRQA 5BYKA 4DCTA 1K5GA 2O8EA 1X86B 4H1UA 3AVQA 3B1XA 2H18A 1XCPA 3P20A 3ZVRA 3AF4A 2OBMA 3M1IA 2IXGA 2L0XA 1ZCBA 2J59A 3TGPA 2C04A 5KOYA 3HYTA 2Z43A 5LB2A 1N6OA 1G21E 3DEFA 4Q4HA 3QNUA 1VCNA 2F55A 3U7GA 2WVJA 2EWWA 1DO0A 3F0TA 1OSNA 3Q3JB 3DMNA 3WRYC 1KI4A 1GILA 2IK8A 4TZ0A 2FG5A 1S9HA 3ECCA 4OBEA 4FMCB 2NO1A 4FI3C 1BH2A 4CEIA 4LK2A 4I81A 4QFMA 1E2KA 2Q9CA 4EPWA 1UJ2A 2PMKA 4DLVA 3FE2A 2OZEA 1M7GA 4PANA 3BB3A 5G41A 2VHTA 4GT1A 4JVLA 3LXXA 3S1AB 5B30A 5CB6A 2GCOA 2HT1A 3WMEA 2NMVA 4ESVA 1O3YA 2R6FA 2D4HA 2QM7A 4NYIQ 2R6AA 4G5OA 3J81k 4EQ6A 1B23P 2GAAA 3IBGA 3KTAB 2ZR9A 3AP2A 3PENA 1TU3A 5AJVB 3ZIAD 3A37A 3P27A 4M1OA 1KK2A 3CZPA 1Z6YA 1WRBA 1JB1A 4IOJA 5LBIA 4DEXA 2OFOA 2YZ2A 3AH8A 2WAYA 1N6NA 3GQBA 2ZREA 2ZJZA 2BWJA 5KDLA 2Y8EA 2CDNA 3P26A 3KQKA 1FUKA 3CIOA 4NCHA 1MV5A 3E2IA 1E2IA 1J99A 3EAQA 1A1VA 2RHMA 3AP3A 3SJZA 4JL8A 2EVWX 3FMPB 3RVBA 4BLQA 1DAMA 2WJVA 4E22A 3QF4A 3BWDD 3QKSB 3F3YA 2QRZA 5JI2E 2QL6A 2ZRGA 1Q12A 1KI6A 5C46F 1E0SA 3EPHA 1ZM3A 4DLSA 1XCGB 4EJSA 1Y63A 4C4PA 4D4JA 2ZRHA 4NZYA 1E9BA 2OLJA 4UNNA 2R44A 2YJTD 3DMDA 3CF6R 4DB4A 3VR2A 2O8BB 1KNQA 1JEEA 2J7PA 3MLEA 1SXJD 3FGNA 1Q1BA 2GWHA 2NZJA 2WMOB 3FFAA 3I92A 4UJ3A 5TARA 4A8JB 1EG7A 3EZ2A 4Q4JA 4QM7A 4NU0A 3U7EB 3VX3A 1XD8A 2VPPA 4HDQB 3SU8A 2ZI7A 4PR0A 2HJGA 4M0LA 5GVSA 1E3MA 1FW6A 3FYHA 2RGXA 3CW2A 3RNLA 1NRJB 1PV4A 2JIZD 2ZPTX 1CF4A 2FSFA 1A82A 3I3SR 1NVVR 3FMFA 3NVAA 4LJ4A 1Q21A 3CRRA 4DRZA 2AXPA 1M8PA 4S2EA 2P6UA 3BORA 2QEQA 4HB0A 1UKVY 4BLRA 4F92B 2DFKB 4C2TA 4UNRA 1T8UA 3MWJA 3DVLA 1VPLA 3B9PA 4E03A 4PHFA 5KPDA 3KB2A 1E2PA 1CR2A 1Q0UA 3AF3A 3EG5A 1OV4A 3GJ3A 4GP6A 4I99A 1MOZA 1EK0A 5J4YA 1U9IC 2REBA 3CX6A 5DLQC 2YOFA 4TN1A 2PCJA 5JJIA 1OHHA 5FH9A 3R7WA 2HF8A 2EQBA 3RABA 3BGWA 1SVIA 1E1QA 5JLJA 3GLFB 4Q1DA 2X2EA 1H8HA 1IXRC 2ZI9A 3GJ4A 3GEHA 3T5GA 1UKYA 4EPRA 1W44A 4Q4JB 2DWOA 4EIWA 4CEJA 4B3DA 1G17A 3MWKA 2OCYC 4ZIRA 4A92A 1CR4A 4MDEA 4FCWA 3K53A 4Q1BA 4GI7A 3RWMB 4P32A 4RKEA 3TQFA 3DKPA 2ONJA 2ZS8A 1KHTA 3AVPA 3QKUA 3B6EA 2R62A 2JLVA 3PITA 1U8ZA 4UQOA 2P5SA 4TYNA 2NOAA 3E70C 4ZDIA 2O8CB 1Z29A 4X8LA 5DN6A 3U3OA 4DCVA 4W7SA 1BMFD 1RIFA 1HY3A 4KFTA 3Q7PA 5SZKB 2QBYB 1NBMA 2OG2A 2F1IA 3CR7A 4KBGA 3EW9A 2DWQA 4XSGA 3TIFA 2OE2A 4US1R 3ZH9B 4XD7A 2QM8A 3CBQA 5BYJA 4BFUA 1QDEA 1E9RA 1SVLA 4C30A 4LJYA 3I62A 1W2GA 4M1WA 1VG1A 1X8KA 1XTKA 1NVUQ 3CRVA 4PSAA 3PVSA 4TQAA 4AWXA 3GMTA 6Q21A 1G7TA 1MO6A 4OQXA 4DEYA 4D4LA 1LV7A 5TB5A 4TLDA 1UM8A 2RGCA 2XOKA 1FPMA 1NLYA 3GLHA 4OJKA 2V1UA 1JPNA 2WIAA 4OYHA 1NL3A 5FOVA 2GVDC 4AI6A 1XTSA 1E2JA 2OHFA 3K9HA 3EC2A 2ZRAA 3VR4A 4KBFA 1VCOA 1ZD9A 3QF7A 1CS4C 1E94E 2Q0HA 2A5DA 5J40A 4CT4B 5C2JB 5KNCA 3K0SA 2O8BA 4G3XA 2F1JA 2PBRA 1EWQA 1VYTA 1D6JA 2A2ZA 3PIRA 4R2IA 1MABA 1W4AA 2WSMA 3CR8A 3ZQ6A 2YV5A 2GILA 1UDXA 3QENA 4MRRA 1ZIPA 3ZQJA 2BC9A 3HR8A 3QPVA 4NE2A 2WWFA 4A8JC 5CB8A 1JR3A 1P9RA 4POAA 4OHYA 5TVKA 3RS0A 3GJ5A 2XTNA 1F2TB 2DFNA 3QVUA 4RFSB 5AK0A 1JBKA 4H1VA 3V00A 4LOAA 1OFIA 4QXAA 2E1RA 4DT1B 1OFHA 2A30A 2ZSBA 4XOIA 1HT1E 2H17A 3ZGXA 3TUJC 4O25A 4IOKA 2XGJA 1N0VC 2X77A 4ILEA 4BFXA 1J7KA 4GMXA 1UEJA 1CJVC 1U8AA 2IYUA 2OUKA 4XTCS 1T3SA 1BOFA 4B43A 1EFRD 4PZYA 3E1SA 1XF9A 1SKQA 1R6BX 2I1VB 3I5YA 1ZMXA 3R9WA 1Z3IX 3RC3A 2JLQA 4YMUA 5FL3A 3A1UA 3KTAA 3ADKA 4PSVA 1OXTA 3B85A 1ZBDA 2VSXA 5HCNA 2IWHA 5JBQA 3OE7D 4JT2A 5FTNA 3A6PC 4CEIB 1VHLA 2LWIA 2RHDA 5EE1A 2J7KA 3GLGA 1YVDA 2DHRA 3OEEA 4HUQA 4AG6A 1VMAA 2P6RA 4P31A 221PA 3SYNA 1Z6AA 2VF8A 4TWZA 2CBZA 3ZVLA 4IVRA 3U7FB 1G8PA 3L0IB 4Q4AB 3BS4A 1U8YA 1G3RA 1U81A 1W36D 1E9DA 1GRNA 3M4YA 5FPYA 5K8IA 2Q3MA 1XD9A 3GJ0A 4LUCA 5TXGA 3WRXC 3TVTA 2VSOA 3IEUA 1XEFA 3A1VA 2V7QD 3L8YA 4A0GA 4EKDA 3RAPR 4XVQA 1R0XA 5DNYB 4Q47A 4EPVA 3SZRA 2HT6A 1B0UA 3JVUA 8OHMA 3KXLA 3SR0A 4DUGA 2GVZC 2P65A 4Q9HA 1UFQA 4CEHA 1VKJA 2V7QA 1KI2A 1TU4A 3ZZUA 3B8HA 3L2OB 3KKQA 1Z6GA 1G8YA 4JLAA 2VP9A 2XZLA 1E0KA 1VCIA 4MGYR 3PXGA 1G4UR 1D5CA 2OXRA 1DO2A 2IYSA 1OB5A 3O8DA 4C7OA 3CF0A 4Q7MB 2HYDA 5GJWC 4YQFA 4KO8A 4WA7A 2F9LA 1G7CA 2MSEB 4MYTA 5EE9A 3DM5A 1DG3A 4R2HA 3LDAA 1Z08A 1P2UA 3FFBA 4OJQA 3MWLA 4AK9A 5JCPA 1W36B 3T35A 2QE7D 4FXPA 3EZ7A 5SZJA 3UXMA 2BMEA 2BM0A 4S35A 2FH5B 4KXFB 4RCZA 2IF2A 5CDFE 5CM8B 4M22A 2FZLA 2IBMA 2ZU0C 1DAEA 3UMFA 3QG1A 4JT4A 4JKIA 2RH5A 2IXFA 5EXXA 1KO8A 2EFDB 3QPUA 2YWGA 3BBPA 4GFDA 2VP4A 3IIKA 4FCVA 2PZEA 4F4JA 2JLYA 3VNUA 4B3GA 1HYQA 4TL9A 5EUMA 1NVVQ 1OXUA 2R2AA 1KMHA 2RGGA 1FX0B 2WKQA 4OHVA 3ZDQA 1QHHA 4OKSA 1JECA 4MUBA 2WIBA 3BH6A 2NG1A 1BIFA 2ZJ5A 1E9FA 2CL6X 2ZRNA 2CE2X 5D3MB 3NBXX 5IF9A 1IN8A 2GDJA 4QNMA 4TMKA 1OYWA 5HR5A 4C0SA 1XRJA 2WTUA 4C0AC 2J3EA 5EP1A 5AJWA 1OH5A 1SVOA 3W3AA 1SXJC 2H1LA 1P5ZB 1ZIOA 4US0R 2PH1A 3BC1A 4OI1A 4PHHA 4KITB 2HYIC 1FL9A 4TSFA 3RS2A 4A82A 1E32A 4HB2A 4X8OA 1KSJA 4B3FX 3CO5A 1HTWA 5HCIA 4DCNA 4JLNA 4JIMA 3WP1B 1W49A 4A6PA 3FDIA 2P5TB 3L0OA 1E0AA 3T61A 4IDPA 1W0KD 2FFAA 1RRCA 4MITA 2IS1A 1KJZA 4LWZA 1QBKC 1LNZA 2A5YB 2H8KA 2FA9A 4UXJA 621PA 4HLUA 1W47A 5GJBA 2JGNA 1IXSB 4C0BA 2EFCB 4PPFA 3U5ZB 4Z1MA 4H9GA 4PAMA 1UBGA 2JLSA 3TNFA 1ZP6A 5IHPA 2IF0A 4QOSA 1P2TA 1PLLA 3BFVA 1RVDA 5A5GA 4GNKA 1P60A 4HAZA 4DLUA 5FBQB 3ICQB 2ZRJA 1G5TA 2JJ1D 1KJYA 1LF5A 3K9NA 3U61B 2QTFA 3IHWA 1R8SA 5KTYA 2G1KA 3KJHA 3SHFA 5ANRB 3GLGB 2NIPA 2G77B 5TY0A 1AS2A 2J0VA 1K8RA 1CP2A 1OFUX 4LJ8A 5G3ZA 1RW4A 3CF2A 2HLDD 5AR1A 2FSGA 1HURA 2JIZA 2QI9C 5E4FA 2CHGA 3E5HA 3AVUA 2OFWA 2QAJA 1AN0A 3C41J 2OM2A 3U2QA 1G6HA 4M9SA 1H8HD 4TYQA 2D7DA 3GLIB 4BLPA 1NNEA 3BJIC 2WKRA 3IGFA 4WXPA 2W2XA 4PO1A 1IN5A 4OQFA 2J0UA 5KDOA 2OBLA 2HXYA 1BKDR 4G5GA 1P7CA 4EJSB 2GHIA 1Z0FA 4MH0R 1KSFX 1ZM4A 2IUUA 4HAWA 4LC1A 5FTLA 2IYTA 4Y0AA 3FKSA 2B92A 2GJKA 3RRZA 2XSZD 2IYYA 2OBNA 2WPDD 1NVWQ 2CNWD 2R9VA 2WWIA 3NHBA 3LV8A 1YZGA 5JWOA 3Q85A 3SYLA 2PMDA 1W48A 3IIMA 3QXXA 3THYB 2HF9A 1ANKA 2VHQA 4GOJA 2A5FA 1F2UA 3REFA 2FOLA 1DBSA 2E87A 2O0KA 2CK3A 3MUFA 1ELOA 1ZUNB 4EUNA 4NONA 1EX7A 1OLOA 4B44A 2EWVA 2C2HA 4BZXA 2FFQA 2WJIA 2ZAOA 4JLVA 1H8EA 1D9XA 3H84A 4LHYA 2EYQA 4DSTA 3I61A 3IO5A 3LW7A 1E2HA 2XJ9A 1L4YA 4MGIR 1FTSA 4UNQA 3ZD7A 3NC1C 1F5NA 4B6EA 1F48A 1E96A 3K0EA 3TUIC 4LV5B 2QBYA 5JEDA 3RS7A 2V54A 4ZV4A 1J2JA 3ZS8A 1WB9A 2ZE7A 2XEXA 1IY2A 1FTNA 1LS6A 3CRW1 3WYGA 1HQCA 4JLBA 1BS1A 1W4CA 1N6PA 3B7GA 3IO3A 2GTPA 1E6CA 2J0UB 1SVWA 5K8UA 1WMSA 2WOJA 2WBLC 2DB3A 2V3CC 4MYCA 1C9KA 1L2TA 5FOXA 4F4IA 1VG8A 2REXB 1OH6A 2R8RA 2DCUA 2AFHE 2HCBA 1FNMA 3Q5DA 1NIJA 4A0FA 2GZAA 5L3SA 1YZLA 2R6GA 4D4KA 2HDNB 1E2LA 5EE0A 1CRPA 4NHOA 4L9WA 2P6NA 3K0AA 2KBEA 2ZAMA 5FI1B 4Q4HB 3SI7A 1Z0KA 5JZVA 4RD0A 1NBME 3LXRA 2OILA 1Q44A 1U98A 3VU9A 5F3WB 2WJYA 4YMVA 3GLIA 4LC0A 4WZBE 4M9XA 3H4MA 2PJZA 2ZRBA 3HU1A 3OAAA 4PC7A 4TT3A 3B1WA 1NJFA 4G5RA 2C03A 2BMDA 3QY0A 4F38A 4C0QC 4AKGA 1R2QA 4LJAA 3RLFA 4NYIR 1GAJA 2QT1A 4TT3D 1E2EA 1AA9A 3AKCA 1WQ1R 2IHYA 3K09A 1PUJA 1QHNA 3LO5A 4L4UA 4O0MA 5FL7A 1AK2A 4BECA 3D3QA 5KUTA 1QG4A 4L8GA 3CONA 2BHRA 2A9KA 4IDHA 1MRNA 1QHXA 4OI0A 3N2EA 4A36A 1GRRA 4IW3B 3AF1A 4CDGA 2ZJYA 4NCJA 5JS7A 3K8YA 521PA 1FMJA 3C16C 1I2DA 1EX6A 4DLZA 2V6JA 3BFXA 1NLZA 3AGQA 3A1WA 5CJ2A 5GJCA 1QVAA 4TL7A 1VG0B 2VHCA 3WBKA 4LJ5A 1X8LA 3I73A 1NF3A 4YONB 2CMKA 1ZNWA 5FPHA 5JSZB 3WYFA 3AKDA 1H65A 1KTVA 4MRVA 2VSFA 1DARA 3NHAA 1E98A 2CLDX 2QMEA 1U0JA 1U99A 3SDZA 3B82A 4NCKA 3T1TA 4UJ5A 3TK1A 3AP1A 3G5UA 3KUCA 1JALA 2J5XA 4G01B 3AF0A 1SXJA 3ZLJA 1KI3A 1Z06A 1YR6A 2SHKA 4YMTA 5D3MA 3W6OA 1Z0JA 1TEXA 5E7IA 1IBRA 3PCRB 3SN6A 2O8DA 2KWIA 5LDDC 3KQUA 4B3XA 2BVNA 1QHHB 5B57C 4IDOA 4ITRC 4Q02A 5FTJA 2FPMA 3KUDA 4Q5IA 1E69A 4D81A 4RSGA 5EE5B 1N0UA 1OJLA 2ODWA 3X1YA 2W00A 4CZ2A 1HQYE 1CJUC 2ZS7A 1VTKA 4DLWA 2EU8A 5HKKD 3CPEA 2C5LA 1GL6A 4ABYA 2FPKA 4BZQA 5G40A 4Q21A 2JATA 4G1UC 5BW8A 2BMFA 3NDPA 5EXPA 5KSYA 2XJ4A 3T34A 4DKXA 1I4LD 3C5CA 1KMHB 5J5CA 1KKLA 2XXAA 2RGAA 3UG7A 4AC9A 1XTIA 2WJGA 3IEVA 1KI9A 2B7BA 1DE0A 4KJZA 1XXHE 2B6HA 1W2HA 2WKPA 3TRFA 4AYWA 4NMMA 2YVUA 1SHKA 5A4JA 3ASZA 4GP7A 1G8HA 5EXSA 4KSBA 3DOEA 1FP6A 2ZVPX 5DISB 2G0TA 4JKYA 4G5QA 4KU4A 5EUQB 3UKDA 1E99A 2ANCA 5JEEA 4I1VA 1S3SA 3SQXA 2O5VA 1TL7C 3UG6A 4URVR 4UXHA 1T0JB 2WWYA 4PPNA 4YMWA 1RRPA 1UKZA 3A58B 3GEIA 4WVFA 1KO1A 1JR6A 1NN5A 5EE3A 3KQLA 2PX3A 2PEZA 4URWR 1AS0A 4EDHA 2ZYTX 3CUEF 4P0TA 4HZIA 4UXIA 4NYMQ 3EPLA 4C2UA 2FFHA 3QI2A 1GSIA 2IYLD 2QT0A 1M2OB 4J0QA 1FMLA 4DCSA 1W4RA 5AUPB 1KAOA 3IILA 4TMZA 3VKHA 4D6PA 2Z6VA 2W2TA 5DSZA 1DVRA 4ZCMA 4LPKA 1W7AA 4I1SA 1G5RA 1CKEA 2Q6TA 4OK5A 3DPUA 5FTKA 2ZIAA 1XMIA 4Z8XA 4D25A 2D7CA 3ICEA 4OQLA 2NO9A 4HUQB 4MKHA 4QBHA 2WWWA 3VHLB 4MYHA 4LBZA 4V02A 2NPFA 1G8GA 1M7BA 2ZEJA 3MWYW 4YMSA 2MMGA 3HU3A 4XJXA 5C1BA 1ESMA 3EX7C 2JLRA 2J41A 5CYPA 1DADA 2VL7A 1YRAA 1JJVA 3B13B 5G53C 1UF9A 4Q4AA 4URYR 1VECA 3A1TA 2EFHB 2UZIR 1W36C 1EESA 2DWPA 4M53A 2C9YA 2GXAA 4WAUA 1N2CE 3DHWC 4PPQA 1WBBA 1R5NA 2ZTSA 3GLIE 1TQ4A 2YWHA 3EA0A 4Z1MD 4ZCIA 3LBHA 2FFBA 2NTYC 3FHTA 1KI7A 4ASUD 2KBFA 2VP0A 4XSHA 2VP5A 2O8EB 3QE0A 2Q3HA 1C4OA 1FP7A 2BCGY 1SGWA 1M7HA 3KXIA 2GAOA 4IOLA 2XTZA 1COWA 3QOFA 1IOZA 1ZD8A 1KY3A 3C14C 4RFSA 5CITA 2ZSFA 4R71A 1T91A 3P4XA 3T12A 4BZPA 4CVNA 1ZW6A 3ZD6A 1ETUA 3K1JA 1JEDA 4M21A 4P33A 2GEDA 1HV8A 2OSBA 3RYTC 3T5DA 1LS1A 4AIIA 1LY1A 5E95A 4CT5A 2ZYWX 1R4AA 4L9SA 2JA1A 2GXSA 3K9LA 1MABB 1T4GA 4ESHA 1TF7A 4UNPA 1E4YA 2GKSA 3QBTA 5B64A 1IAQA 3T15A 5FFMA 1GWNA 1PUIA 3PEUA 2QUZA 2QSYA 5KO2A 4LHZA 1G3QA 2XB2A 5CLLA 4TTQA 1OKKD 1E2FA 4JLMA 3D31A 3GD7A 1SVKA 4PXAA 3ZIAA 4XWKA 1A2KC 2GK6A 3KKMA 3CX7A 3P4YA 1DAIA 3W9YA 1VHTA 2C77A 4QGHA 1XEXB 5J47A 5EP2A 3SNHA 3PEYA 1WP9A 2CHQA 1W46A 5G3YA 4DDWA 1NG9A 1P4SA 1YR9A 4JZKA 3EA5A 4BUJA 1ZUIA 2ORVA 3V9PA 2IS6A 1WF3A 3PEVA 4LSGA 1E2GA 1ZU4A 2R6CA 4OQMA 4B35A 1S2MA 4URZR 1MO4A 2OEPA 4XVRA 2I1QA 3QPWA 1IQPA 1SVSA 4I1UA 1QRAA 3CPHA 2ZS9A 1TX4B 3TR5A 3FKQA 1YZNA 3GJ6A 4TMTA 1AQUA 1GKIA 1X1SA 2V6IA 1KI8A 1S4QA 4MGZR 1FX0A 4GSYA 2IYZA 2Z83A 4OHXA 2QPAA 2ECKA 3SBDA 2BM1A 4AKEA 2CL0X 1DAFA 2QZ4A 4LJ7A 4MRSA 5CYOA 4B74A 1YJ5A 4DB2A 2QE7A 3U6BA 3THWB 4F4CA 3LW8A 1SXJB 3T1VA 1EFHA 1NMXA 4JL6A 4M8NE 4LCBA 3SE0A 2ZETA 4DBLC 4KFRA 2PT7A 3Q8XB 3UWOA 2BKEA 4Q4LA 3QUSA 4IXNA 5DHAA 5CM9C 4F7WA 1N5IA 2YWEA 1IY1A 4Q01A 4RCYA 3SOPA 2OXCA 4LI0A 5LPNA 1NN3A 4QHTA 3LVQE 1EFCA 1XZQA 2J46A 3RSLA 1G3UA 2IS4A 5GADl 1Z63A 2IXEA 2YHSA 3M0EA 3U44A 1G5PA 3UPUA 2FNAA 1J90A 2H7VA 4NYMR 4ON9A 4PQYA 5TV2A 5EZ6B 5EZ5A 1X1RA 4RD4A 2G3YA 3W6NA 1P61B 2X19A 4TMVA 4DC9A 3M6AA 3VU9B 1TTTA 4JLPA 1Q1ZA 3FHCB 1G41A 1YKSA 5AJXA 4X8HA 2ZSAA 1VCMA 1BYUA 2YKGA 4HDCA 2W58A 4RZ3A 3QQ5A 2KSQA 2DR3A 1E1QD 2O52A 3K0FB 1OB2A 2DY1A 2MSCB 3R7WB 4DVGA 3SHWA 3MFYA 2CEAA 2GZHA 4ACBA 1XWIA 4TTPA 4AYXA 4ZCLA 3WY9A 1KAGA 3U44B 1Z83A 2H92A 1DAKA 3DO6A 3GLFE 5EP4A 5B2ZA 4EPTA 5DI3A 1CIPA 1CJMA 2A3RA 1XB2A 3I8SA 4PQFA 2NO6A 1NLFA 5JI3E 3VQTA 4EPXA 821PA 1Z0IA 1N0WA 3AKEA 4A1FA 4JS0A 5BN4A 4Q19A 4B2LA 3SFZA 2GJ8A 3HU2A 4LX0A 3N2IA 4DJTA 1CTQA 4V0OA 4HSEA 3LFUA 3THWA 1ZRHA 4LHXA 4P3YA 2ZRDA 3BXZA 1Z47A 1DS6A 4KODA 3VR1A 5FOTA 3QJYA 5L3RA 4BEBA 2BEKA 3QKRB 4IRUB 3TW4A 1XU4A 5L8VA 1AKEA 1YHNA 4HEJA 3ONWA 4LJ6A 4V0KA 3WHKA 3PV0A 4XWAA 4Q1FA 3OIWA 2K5UA 4OHWA 3SJAA 1T5IA 1XDBA 4QHYA 1N6RA 1Q3HA 3NBFA 4C0LA 1IJFA 4DIDA 2F1HA 2UKDA 3DM9B 3CM0A 1G7SA 4G0NA 4RD6A 2FEMA 4GOXA 3LRPA 5DIFA 5HZKA 3LLMA 3EZFA 1HE8B 4DLXA 1TQ2A 4OK6A 3DKVA 1TF2A 1YR7A 1DELA 2CVHA 2WM9B 3SFVA 3B1VA 1XEXA 3FHOA 1JQJC 2IHBA 3DL0A 1O87A 3IPYA 3REGA 4MRNA 2AN9A 2ZYVX 4QGGA 2O8FA 1G8FA 3MGCA 1TADA 3IKJA 4DDUA 1AGPA 2OCBA 2CCGA 4JBYA 1E2NA 4DLYA 1GNRA 4BFSA 3U3MA 3C4JA 3G82C 4ZI2A 2ZJBA 4ZKDA 4B73A 4A4DA 2UZ3A 3I4LA 4KLZA 4NYJR 3RSOA 2QROA 3PUWA 4FMDF 5D3QA 1OIXA 2JASA 3W8RA 2WPDA 4K46A 2JJ8A 4LYFA 1RFLA 2ZVQX 4PAQA 2MSDB 1Q57A 2RGNC 4MKGA 2VQSA 1OXVA 1XXHA 3W8NA 3FKSD 3PG5A 2ZRIA 3BE4A 3I32A 3AUXA 1F2UB 2Z0MA 2ZI3A 4ZPXA 1SXJE 5DGXA 2D2FA 2Q3FA 5AJYA 5HTKA 1D9ZA 1D2EA 3CNOA 1GL9B 2O0JA 3QXCA 3EWSA 4M2LA 1ONBA 1EFRA 4B34A 1S1CA 3WHLA 5FL7D 2N42A 4K81B 4M9ZA 1R8QA 1PJRA 1SULA 1XP8A 2P67A 3K0CA 3U6KA 1NMZA 4OI4A 4NYJQ 3LQRA 4OL0A 3I72A 1E79D 4JJZA 1P62B 1NI3A 4OQNA 4PX9A 3TSZA 5BWMA 3HPRA 1Z0DA 1ZM2A 2HJVA 3O47A 5E7JA 3VR6A 2W6JD 2ZRKA 4HB4A 1HA3A 2XOKD 2PEYA 3AVWA 1T6NA 2GZDA 4CIDA 3GLGE 5IT5A 2P3SA 3O8RA 2XNSA 3PUXA 4Z51A 3LY5A 4E5UA 2JLWA 5C4GB 4PC2A 2YWFA 4ZIRB 1OXSC 2ORIA 1XPUA 1VG9B 2OV2A 1TUEA 4W9MC 3NEYA 3R9XA 4IDQA 1EXMA 4PTLA 4A0HA 4GZLA 4JBXA 1RRFA 4MKFA 4HATA 2FSIA 2PLFA 4DZZA 5M04A 4I1OA 4PC6A 2HCJB 2BJVA 4JLDA 2ZE5A 3T1OA 2CCKA 2FDCA 4QM6A 3CH5A 2J1LA 5TMPA 1N6LA 1ZVQA 4EAQA 1YZUA 4W5HA 1SKYB 5L3VA 2QENA 3LQQA 4PSKA 1U9IA 5LD2B 4IVPA 2YOGA 3T06B 3AGPA 1XCMA 1IJEA 2WMNB 4M1SA 1M6NA 3F5FA 2ZU6A 3VHXA 1QF9A 3FPAA 4LBWA 2ORWA 3HYRA 2PL3A 1RPZA 3ZYCA 3PJRA 4AKIA 1EFTA 2GCNA 2JJ2D 3JVVA 3Q9LA 3WNCA 4CW7A 4Z54A 5FBVB 2ZSDA 2OO7A 2AKYA 3THXA 1IN7A 4QC2A 1T3HA 1ZCAA 4PFSA 4MDFA 4B76A 4AY2A 3UIEA 3EIQA 3AVXA 1CBUA 1DOAA 3OEHD 3TR0A 1G6OA 1KDPA 5FPTA 3GJ7A 1XD2A 1KDOA 5SZIA 4KLNA 4B6FA 3RRMA 5L3QA 1XEWX 4TL8A 2ZI5A 4L5BA 1S96A 1II9A 2CNWA 4JL5A 2GETA 4TZ6A 3B1ZA 3TAHA 3NWJA 5JMTA 1DAHA 3TH5A 4WOPA 4BWYA 1I4TD 2DFTA 4IJMA 2GBLC 1S9DA 1J70A 2BV3A 3KKNA 4D4MA 3G0HA 3IQWA 4TQ9A 3B60A 3BAFA 2CCJA 3VR5A 4BE7B 1CLUA 2D62A 3IUYA 3AF2A 4HUTA 5F9FA 5EP3A 1RE0A 5KSPA 3MG9A 4TMWA 3NDBB 2WJJA 5P21A 1TPZA 3W5IA 121PA 1W0KA 5FPSA 3NH9A 3WXMA 4Q9IA 4YXWA 2XNDD 2B8TA 1XD2B 3QKSA 2C99A 2BJWA 3KDSE 3AKYA 3LLUA 4RJLA 4TMXA 1SHZA 4R98A 3PEWA 3MD0A 3Q7QA 2J45A 3AUYA 2GXQA 5CLQA 4FWTA 5FUXA 4C7OB 5F9HA 1II8B 4RZ2A 3CH4B 3TMKA 1MH1A 2OAQ1 3A36A 4XH9B 1DTSA 2WSSD 5DO9A 3KJEA 1S1MA 1W4BA 3A4NA 4JMPA 3TAUA 1RYFA 2QNRA 5HKKA 4U02A 2AHOA 5JSZA 2GJAA 5CDFA 4MQBA 2OESA 2F43B 4L16A 4C9BA 1NIPA 3CRQA 4TYYA 1UDWA 2IYWA 4QHSA 4MYUA 3TW8B 1ESNA 4QJ4A 3TLXA 2G9NA 1MO3A 2VBCA 1AQYA 2G1JA 2ZUCA 5UKDA 2FJUA 3MMPA 4A9AA 4N3NA 3WMGA 2LKCA 3VR3A 1OYYA 4A0RA 1KDTA 1K5DA 5E7MA 1NP6A 5FOSA 3QXHA 2FWRA 4O2RA 1YZQA 2ZQ5A 4NPHA 1FOEB 4HZUA 1Y3AA 4Z8YA 3ADDA 4QBGB 4N0DA 4WZ6A 1S3GA 5IDVA 2VYFA 1AZTA 4GMDA 3W6PA 1MRSA 4CEHB 4B48A 3LA6A 2A5JA 4Q9KA 4TTRA 2W6IA 4TSFD 3EPKA 1SZPA 4FIDA 3BOSA 2VHUA 3QXJA 4GPTA 4KFSA 4XTRA 5FBLB 5F2EA 5FTMA 1H8ED 4Q9LA 1F2TA 3LWNA 3R8CA 4RY2A 2WICA 4C0KA 3CZQA 3WNBA 4RKFA 5JWHA 5DE3A 4PPGA 2IL1A 3V4FA 4PZLA 2PCLA 1N5LA 1AJEA 3VKGA 2W2VA 3U3JA 3MSXA 3AQ4A 1AM4D 1YE8A 1XMVA 4BASA 3CWZA 4FINA 1T5LA 1COWD 3SJCA 2ZR0A 1TQDA 2BBWA 3X1DA 4DT1A 2JDIA 3KQNA 3QSYA 2J87A 3CLVA 1P73A 4BLTA 1TEVA 4D0GA 5GVRA 2MMCA 4O3MA 1FNNA 1JAHA 5FOWA 4BFZA 3GPLA 3RRYA 3FTQA 4OI2A 5LB4A 3U7HB 2ZI6A 2AK3A 5KYKA 5JS8A 2ODBA 2P2LA 1DG1G 1LF0A 4NDZA 4WIAA 4D2IA 3TQCA 2V4ZA 4LBYA 1KYIA 3BD9A 4TLBA 2JLUA 3CRMA
chains in the Genus database with same CATH superfamily
4KB5A 5CFMA 5BRJA 4B75A 5B55A 2W2QA 2GUGA 1G8SA 3HL4A 2QQ5A 3MPOA 1QWOA 4C0HA 4BFTA 4EGQA 1P0IA 4Z86A 1NJGA 2I76A 1TTQB 5IK2D 2FWIA 1NKSA 2XKBA 2C4TA 1X7XA 3HBLA 1KOLA 2A9RA 2KE5A 1ZK0A 5JJ5A 1E7MA 1AN9A 2H2WA 4O4LA 2FR8C 2DUWA 3FPCA 1ZGZA 2D2IA 1GGKA 1GQRA 2F3RA 2EDAA 2N3ZA 2YW9A 3A3OA 4D57A 1RS0A 2HEIA 3KZNA 5BSWA 2N1BA 5JHGB 4MQEB 3RYHA 1NPTO 1RYDA 3KT8A 2ZZKA 4YRDA 2WMDA 4RL4A 5IXSA 2Q2QA 4KR6A 1ZR4A 2YR0A 1C1HA 4JGGA 3ZJ5A 4E3WA 2FHSA 3UMRA 3DUWA 3OJWA 4YBRA 3EDQA 2WG0A 2HDHA 5IEBA 5KYVA 4BGIA 4EY7A 2HIAA 3AUKA 1T1JA 2VWPA 1N5OX 3GJSA 2VF4X 4LMBA 3IAXA 4Y30A 4DLPA 5IK2A 4YAGA 2HHCA 3RGWS 2D3WA 4UUOA 1FYFA 2CXUA 3TW0A 5JXGA 3AJDA 2FJPA 4U7PB 4RFVA 2G83A 1ZSNA 4UD2A 5LYJF 1YH3A 3A1SA 2CK3D 4F6RA 1KSHA 3AUTA 1PL7A 4J91A 1B6RA 1XQXA 2FMXA 2PXHA 2C1ZA 3ME5A 4WNIA 1SH7A 2Q7DA 4TVSA 1XN1A 1U90A 3AZOA 4BBZA 3G2QA 4G5SA 5EJ6A 1OPXA 1ONPA 4GVXA 2CVFA 4KVAA 4TLCA 1SKBA 2VEDA 3LYLA 4JJ8A 3RWBA 2VYND 3EIOA 1HH4A 2HV8A 4NR0A 3U40A 4BRUA 1D2MA 2FETA 3H6HA 3QHQA 5A5VA 1IWBB 2ZR7A 4LHVA 4XGNA 1O95C 5KBYA 2IC5A 5IG2A 3ZTTA 1II0A 1JHQA 3HB0A 2HBQA 3RI3A 1QIFA 4BEJA 4KSCA 1G60A 2NTJA 3HKEB 4DLTA 3V1TC 5J1SB 4IBOA 5HPYB 2YV3A 5G0WA 3OKPA 2B25A 2I87A 3K1AA 5ESRA 2CE7A 4YNBA 1XLTA 2Z6UA 4OFWA 2M1ZA 1E61A 3HL0A 1U1EA 5T3UA 1Q11A 1V3UA 3H0KA 2RGNA 1ZW1A 2XCRB 2XCLA 3QYFA 1UBRS 3TTXA 4Q03A 1BWQA 3ZGLA 2C0QA 3SYKA 3WL7A 5DM70 4BJ1A 1CUBA 4DC0A 1NSTA 4ERXA 1I0IA 2AN5A 4IGIA 2GXUA 3QKTA 4XD7D 5H1YA 1XTRA 1WHSB 1QHSA 1EBUA 1XVAA 2P30A 4DIFA 1YB1A 2O8VA 1AGRA 2WV7A 3PDUA 5EKTA 3ZVNA 1TAHA 2DH6A 3GLRA 2VYVA 2EJBA 3PJFA 3FZEA 3LHDA 3K0FA 3B48A 3LK7A 5DN6D 1PS0A 2F3PA 2QVXX 2VF7A 3O5AA 1UFOA 2C3MA 2Q21A 4PCVA 5EVCA 4ZYUA 3KELA 1LDNA 1OC2A 4IDNA 3STTA 4C05A 3NAMA 3HFJA 4RS3A 3DUFB 3C7CB 3VO8A 1VYUA 4PLZA 2GRJA 1A50B 3IQZA 4DAEA 4A15A 1KS9A 2FR0A 3BZBA 3TLGA 5K3OA 1JKJB 1S89A 4E2ZA 4Y0VA 4CKXA 3OZTA 2WWHA 4MZDA 4HAYA 4AULA 3LD9A 3C85A 5H68A 2H7XA 4C4XA 3EF1A 1NQOA 3ONDA 3SEQA 1XQWA 4RGYA 4MMXB 4C7XA 4GU5A 2HSEA 3EMKA 2A1TR 4TX1A 4EA7A 4YJHB 3HP7A 4X1YA 4BB5A 3N2NA 3LDUA 1MNQA 1ZK3A 2HTFA 1V6CA 2QRJA 2XADA 3GUUA 3B3JA 3DDZX 3IDQA 4LCEA 4ND1A 4OVKA 3SX4A 1SKAA 4C0WA 5AUOB 4BIIA 2QG6A 1Q3TA 4S2UA 3ADCA 3U4GA 2AFIA 1Y4DE 2R4UA 4AF6A 3MILA 1JPJA 4CN8A 4EBFA 1Z0ZA 1AX9A 1EHIA 2XD4A 3VC3A 4JBWA 5ALMA 3RVMA 2GESA 5ILGA 4KVZA 3IHLA 2C2YA 2E82A 4KXNA 3BCUA 3ZWBA 3C3PA 4G97A 4X7MA 4HRVA 4JYBA 2QXYA 5PNTA 4FFBB 2G1UA 1I4EB 2NUAA 3PQCA 4IOMA 4FFSA 5TQJA 4TXMA 2CXRA 1P2SA 3Q0EA 2HU8A 2AE2A 3HGTA 3VNVA 1EB8A 1YCDA 4ZAGA 2CYBA 1C1XB 4C88A 2K87A 4YWHA 1WBDA 3SOZA 3RFVA 5LWQA 3Q98A 2IIPA 4KE7A 3KPUA 4O59O 5ARDA 4FDVA 4LY0A 4IO1A 2ZRLA 3ANMA 3U4QB 3H97A 1SOMA 1P5FA 4MWOA 3TLKA 1TC2A 2EW1A 2I3DA 3BB4A 5CLFA 5KCZA 3TJZA 1NMEA 2WFLB 3QWBA 1E1RD 3RUEA 1Z5VA 4L57A 5KNBA 1AKYA 1Z22A 5K4GA 2JZOA 3R7FA 2C88A 4MYDA 4AS3A 2RGBA 3KOUA 1J33A 2J08A 2WM8A 3W90A 1XMJA 4B80A 1Q7TA 4O2AB 4V39A 1EK5A 2W43A 1IBSA 1FMTA 5FBWB 1CY1A 3VM6A 3ZWYA 2HGZA 1K6MA 3GU3A 1WW8A 3DL2A 3LH5A 1GFIA 2JAQA 4DZTA 5L9AA 1I2AA 1K06A 4RVDA 1GTRA 2C7BA 2AL7A 3R3ZA 4NKRA 3ND9A 4ZU6X 1G3MA 2FGJA 1FFDA 3KFXA 1KZ6A 3S2SA 1KMCA 1C5KA 3RSZA 1XFDA 2AEJA 2PBFA 3ZZTA 1I32A 3V32A 4D3SA 1ODFA 4N8DA 4CL8A 2P1DA 4U9HS 3UXEA 1N8KA 3C3JA 4U00A 5ICCA 1T0IA 2W0SA 1E4EA 4I3GA 3RF6A 1BGXT 2GF2A 3DVRX 3MHTA 3WO0A 1G16A 4AZ0A 1RI2A 3I5XA 4HVAA 4RORA 4RZSA 2QRQA 3NTVA 3CLRD 3SZGA 1VCHA 1STOA 4OMFG 4OHZA 2ARKA 1IDN1 1JIUA 3M5DA 3S1AA 3HN6A 3HUUA 2UUPA 3M1LA 2BDTA 1I14A 5HW0A 2BMWA 3EUAA 2YS7A 1DX4A 1OJ7A 1SVMA 5H80A 5BOSB 2G6BA 3Q7TA 5F1YA 4EKIA 3EQ8A 5B7GA 3D81A 2B1IA 1ATZA 1M5TA 3JATB 5JTUA 4UDOA 1T2NA 1PU2A 2PYZA 4FOTA 5KAMA 2B2CA 5D5PA 1HOTA 4GECA 1NBMD 3GJXC 3VMMA 3AI7A 1EUCA 3CTPA 3M7IA 5FBHA 4EL0A 3L7KA 1H2BA 3VSEA 4C7BA 4QKQA 4UPEA 1LZLA 5L4NA 3S2FA 1U1FA 1NY5A 3U3KA 1L3BA 3P9XA 4KYIB 2QTVA 1RTKA 2I3BA 4FNGA 4PNZA 3HU5A 4CQJA 3E9RA 1QUEA 1E4EB 2I54A 3RODA 3DV0A 3GEMA 5DYIA 4DV1B 4JELA 4B85A 5AVOA 3VPHA 2ZCUA 1GUAA 2OQIA 3NJRA 4WXRA 1ZAKA 1W30A 1II8A 4KQ2A 3KYIB 2AK2A 4K6FA 1RXCA 1P1RA 2AG8A 2CFTA 4YROA 4ZAWA 5J4KA 3FTCA 3WGQA 1Q0RA 1XDZA 3HXLA 1G38A 1A7JA 1X1EA 2DBRA 2YXPX 1TLLA 2OZVA 1L5HA 3WB1A 4TS3A 4B3BA 1Z2PX 2A0KA 3C74A 5FUMA 1XMOB 1LQ2A 2E4WA 4OX9B 4Q1AA 2XT6A 5U1PA 2NXCA 1PZMA 4BX0A 1MENA 1RWPA 1B0ZA 1F4PA 2AOVA 3F9CA 3OCZA 2Z3ZA 3AIMA 4BZZA 2XXJA 1VKRA 4HS9A 5F4ZA 2IX3A 3ZWVA 2Q6KA 2RSLA 3WYNA 3X1ZA 1U3CA 2PR2A 3G5AA 5HS6A 3WLQA 1LB1B 1TZKA 1NQVA 3L8GA 3LUCA 2H1IA 4P36A 2JLAA 1WD7A 3E2PA 3M6UA 4IIEA 4P38A 4QTYA 1MB9A 5K0BA 1ZNXA 2WI8A 3I1FA 1CJTC 4KKXB 2XEDA 3II6X 3N58A 1WXFA 2O5EA 3N5CA 1NVXQ 4JLSA 5KHLB 1I4WA 2FPSA 1OLUA 1M8FA 1MB3A 2OB2A 5JU6A 4M8KA 3LL4A 1UADA 4P82A 3UAXA 4QNRA 2IYXA 5BN5A 5FBRB 4OHRA 3UK1A 3KEQA 1AXRA 2FQWA 4FC6A 1GIAA 3VI4B 4CM1A 1JTEA 2AXNA 4EP1A 1GN8A 1TA4A 3ABRB 4TYPA 1XPOA 3PWTA 1DAGA 4F56A 1BA3A 1IY0A 2C8VA 2YZMA 5LA6F 2JAXA 3K4PA 1QJ4A 1FXWA 4PNHA 2J3KA 2XXAB 1SC6A 4URUR 7MDHA 3S8EA 1FU4A 4I1PA 2PWAA 2D1QA 3FMVA 5JWRA 1LFDB 3F3MA 3TFWA 5KYUA 5FAXA 2CUTA 1L4EA 1WZNA 2CMFA 2JAHA 3RW9A 5LZ9A 3FMOB 3LC1O 1I2CA 1R7RA 4FYWA 3K09C 3ZWNA 1RLTA 4L15A 3DLTA 4S04A 4IHKA 3C87A 3ITEA 4L2IA 3MCAA 2VSQA 1Z2AA 1ONSA 1U31A 1JA9A 3BN3A 1OT3A 3TX6A 5AIBA 1SKMA 2GVNA 4UNIA 5LM3A 5K3CA 3G89A 4JVSB 4ZU1X 3UY4A 4YJ2A 1XJCA 2YC2C 2AD5A 3KOZA 4IGKA 1WMEA 4WECA 1BMFA 4GQBA 4UAJA 1NNSA 1EZ1A 4E5DA 3ZNOA 4DV5B 4IEEA 3OTHA 4RK6A 1EK6A 1H94A 2H2GA 3PR2B 2X2PA 1QP7A 2F62A 4FHDA 3NBKA 4AG5A 1U2QA 3D3JA 5BUSA 4MR8A 2WHYA 1Z12A 4D26A 2NO0A 3NIBA 3LF1A 5EUBA 4BQFA 4CETA 3E9MA 4G4SP 4QFDA 4YY3B 3MGBA 2ZITA 5B58T 1N3YA 1UFVA 5DIZA 1GY8A 4W5JA 2BTEA 4U7DA 2VJOA 3KZXA 4L3OA 1XLUA 5IYZF 2HHLA 4UTPA 5CFZA 3PE4A 3VBEA 3OCJA 2R7AA 2IEBA 1W0JD 2X6RA 1EUCB 1BWRA 3HEMA 4YLEA 3QIAA 4BV3A 2XYPA 3I5AA 3LKDA 1SNYA 3PDWA 2FRXA 5JRDS 1CRQA 3FRJA 2QV0A 1J42A 5F73A 1GV1A 3MT8A 2E9SA 4DRYA 2I4MA 4MUXA 3DHVA 3HMKA 1E6MA 2BF7A 4RMHA 1LQTA 2R6DA 1P3DA 1P2DA 3D6HA 3OTWA 4GAEA 4BFYA 3HABA 2IU0A 3WL5A 2LKDA 3JQFC 2HA0A 4ARBA 1I2MA 4XE5A 4CTKA 3ADBA 3GVIA 4JA2A 1X8JA 3QZUA 4TYWA 1Z28A 5KMGB 2O6HA 2A0XA 5E8JA 3DL4A 4NZZA 3GLHE 1JDPA 1NJ2A 4DCOA 3WLEA 1XQYA 5FEUA 4IIXA 2ZJ0A 3A27A 1IQUA 1SBIA 2YN2A 3DZ8A 4FR5A 4Q48A 5AJUA 1ZJ6A 2DE0X 3TL2A 4C3ZA 1KYYA 2NO7A 4DMLA 2HZBA 3JQPA 5TQVA 2DPXA 5BVGA 1KK0A 2V5AA 3AW9A 1N5JA 3RYHB 1UXHA 1YS1X 3E6AA 1DEKA 3KUKA 4MUFA 2FG6C 4A2QA 4EUFA 4FNOA 4KWHA 4AYTA 2ZM5A 1TIKA 4F0JA 4ZAXA 4ICIA 4YHBA 5M5BA 3STWA 3I12A 3GRKA 3N59A 4NE9A 1X70A 4BHTA 2C9ZA 1ICIA 2WUWE 5LFAA 4CKBA 1SOVA 4P4UA 1QDLB 2G4LA 1E9AA 1FUUA 1R0RE 1WO8A 1FDIA 2PZGA 5TMBA 1JWBB 5HWSA 1PW5A 4WZAE 5CTAA 3NYQA 3CA8A 3GY0A 5IMSA 2G88A 3GHHA 4KEAA 4RHUA 1KIMA 4LECA 4R6WA 1QCCA 4EEZA 1RYNA 1XPJA 1U3GA 2XUFA 1PKEA 4OJNA 3R9KA 3W6UA 4D0NA 2J0QA 3NYWA 3M5CA 4JUBA 4BE9A 1NJ6A 2PRSA 1SC1A 2WFMA 2OCPA 3HDTA 3QTBA 4IIJB 1WMDA 1GXSA 4DSNA 9GPBA 2AB0A 2QTTA 3THYA 1QGZA 1O6CA 2PM8A 1PN3A 1K88A 2Q0SA 1PLJA 2D06A 4N7JA 5BXYA 4Z9XA 4WJKB 2G5PA 3TE6A 3HA2A 3PUZA 4QRHA 2RD2A 1O0CA 5AVJA 1HNWB 5EJEA 4C29A 2V1XA 1AV6A 4QODA 4WK4B 3HCWA 3ONEA 3QJGA 3CNLA 3NV7A 1WIWA 3ZH2A 4J0CA 5JLJA 5JDIA 1CDDA 1JSLA 1G4AE 3LOPA 3IEXA 4NRDA 5F9MA 1J9ZA 1JYEA 2C5AA 5FUVA 3WWCA 1X1QA 4POOA 2QJWA 1L7XA 4PG5A 5EFZA 4JLOA 4RNCA 2O23A 4E88A 4EI7A 3I9NA 5JQGF 4HYTA 4UUPA 4J1SA 4QLAA 2VTKA 3DE7X 4E1BA 2IODA 3MUNA 3QBVA 1RZUA 1JQBA 3I6YA 2FCRA 2GN0A 3ENWA 3O1IC 3X2SA 3ZEAA 5BWLA 1K27A 1PJLA 2RHGB 2ZSKA 1SZDA 3ISTA 4O2LA 1W25A 4PCLA 2FPPA 3FCCA 2JAPA 3FPEA 2XNJA 4I55B 4LYJA 4X20B 4OK3A 3FJ1A 2ZJFA 1SU8A 1W1WA 3HI4A 3FTDA 5K6TA 3G9XA 1T3ZA 4AP6A 3QA9A 5E1OA 2PUGA 1GFWA 3NP7A 5G02A 2VT2A 4BQEA 2VEOA 4KQXA 1U0RA 3L0DA 1CUSA 2CXXA 1P6XA 1W5SA 4BN4A 2BKUA 1LWNA 2QMOA 1OYOA 1WV0A 3AINA 2W5UA 2I6QA 1VSQA 1WA5A 4RD2A 1C0KA 8MHTA 3TG8A 1SU4A 1TO2E 4LQ4A 2V55B 4DMGA 4GW3A 3EOAI 4EX6A 3ASYA 3ER9A 5I3ZA 5DASA 3RSQA 4P4SB 2XR1A 3KDPA 5DEOA 1V8PA 1DEHA 4BLUA 4HS4A 1JEYB 1OF1A 4LTDA 1ARZA 4XARA 2ZKLA 2B4QA 3AF6A 2L18A 5AOAA 1SZCA 3T1YB 2VQEB 5IFKA 4MGEA 1DIGA 2EZ8A 4D99A 4ABTA 2YJ5A 1LW7A 3MNFA 2WJ6A 2CNBA 1U8FO 2FMFA 4Q9AA 5GOZA 2IYQA 2RKOA 2JI9A 2JLCA 4X7RA 1T5BA 2Z6QA 4XB1A 3TVYA 2I4LA 1YRWA 2DBYA 2PBLA 4BNVA 5CX1A 2FMIA 4LXTA 3EDRA 3LP6A 2GBFA 2HD4A 4L50A 4E1AA 5CEJA 3P9NA 4RBNA 4WY2A 4DG8A 1BKYA 2X1VA 1SWWA 1KL7A 4FYVA 1GPH1 1DL5A 5CXQA 2CFRA 1O5TA 1S0UA 2OBXA 3K2QA 5BNFA 3IOEA 1GA6A 4DUPA 3SQWA 3H0EA 1M0WA 2GBLA 2ZE8A 1NBWB 4CL3A 4HDNA 1RYYA 2GKGA 2IUSA 4ZI7B 4E5PA 4TUYF 4BNFA 4AJ1A 5G1PA 3RANA 1TPYA 2XGGA 4RZIA 1ECLA 1PNTA 1IBLB 4X65B 4F04A 4H2DA 4PC3A 1VDMA 2VJMB 3ZZ0A 3I9FA 1PSZA 2CXSA 5A3RA 2CZQA 2H1CA 3G02A 5HKAA 4PZAA 2J6HA 2OC9A 2VH2A 1TGVA 3PGJA 3VKWA 3W8DA 4RK1A 1H9AA 5JFGA 3MRSA 4K6CA 2QLTA 2V6FA 4XQGA 4FCTA 3L43A 1Q14A 1ZU5A 4II7A 4Q1CA 4W63A 3PWZA 2ZLBA 2HDOA 3O4JA 5JYDA 2XYRA 5YASA 4RJJA 1ZJWA 2BZGA 1BRTA 2F4VB 4P35A 1U0BB 4QYWA 1ENPA 4BNIA 1UDAA 2FSHA 4UBJA 3NBZC 1RXWA 1OHHD 1SPBS 3SDSA 1RWQA 1JMYA 3OE7A 5KNDA 1TE2A 2H2FA 4OQYA 1BG6A 4KFUA 4Z9BA 5JJLA 4QPCA 3K0HA 1LXCA 1XZDA 3JCZA 1KK1A 4GF5A 2ZJ8A 4HAIA 1WZUA 1GL7A 1QYDA 1EUDB 5DOZA 2L2QA 1Y5LA 2XYVA 1G9TA 2YV1A 1KMMA 1XYGA 2PYIA 3C8UA 3HP1A 1JTVA 1NYTA 4IYJA 5L3QB 3A0UA 4JX9A 1XHEA 4LNUB 2FGKA 4ZOEA 5JSKA 4ZI5A 1R5BA 4GDFA 3IR5A 3OUTA 2K7ZA 3EZ9A 2QDXA 4NJEA 4UHDA 4CF5A 1HO3A 1Z5PA 1KMQA 4P4SA 1W59A 1AKMA 4C4SA 4EO4A 1B26A 2JLXA 1SQGA 1P9WA 1O57A 2P2GA 3K7EA 3PE3A 4KXQA 3PKJA 4Y2HA 5KYWA 2BEVA 1DUSA 1S8OA 4H3HB 5KAPA 3T7DA 2R1ZA 1P4JA 2PRYA 1W4ZA 3GBPA 1HE3A 2YOHA 2Q5HA 1D2AA 3P9KA 1J56A 5K99A 2JGDB 2H0QA 3GVXA 3AVYA 2Q1TA 3LECA 4A03A 1U5BA 1R10A 1ZNZA 2P4EA 3N6RA 3UJ7A 5A4IS 2WZDA 2LBPA 3DLAA 4IDAA 4YACA 4UTRA 3HXMA 4LV6A 1Z17A 4MR9B 1V5WA 3GFSA 1JXMA 1P4RA 2OBYA 4DCTA 4ZQHA 2EAUA 4WHMA 3WLRA 3DE4X 2IXGA 2J59A 1IUPA 3BWXA 4HNHA 4RY8A 3HYTA 2Z43A 1LDYA 3OZDA 4B84A 4IUYA 1G21E 3QNUA 5ALIA 3B1KA 4RAOA 1EQAA 1XKTA 3C1UA 2VN8A 4A8PA 1GRCA 1KH2A 1XKLA 1DO0A 1DP4A 4NZMA 3RROA 1KI4A 1GILA 1Y1PA 2G7ZA 2IK8A 4AO7A 5L7YA 3M4JA 2NO1A 1A4IA 1UPUA 1ZUD1 4FMCB 5DGCA 4TTTS 5BVHA 3D3WB 3G3EA 3UB2A 5JOQA 2ZXEA 5THQA 2IZ0A 4EPWA 1M1ZA 3QPCA 3M6FA 2ECQA 1UJ2A 4K0KB 4Q82A 2B0JA 3A6HA 3AHFA 5DT9A 2OVBA 2OO3A 4LSWA 1XZKA 1P1KA 2ILTA 4P9NA 1FUYB 4NCBA 1SCUB 5G41A 2C2MA 3A4YA 5KYNA 1HYHA 4NOLA 1X38A 4IL5A 5A9TA 3TCNA 1CDZA 1M2FA 2NSDA 4EW1A 4MUIA 3G88A 1UXOA 4QOEA 2JH8A 2KQUA 2DFDA 2R5FA 3WMEA 4ZYYA 1O3YA 4M0FA 4G5OA 1DIOB 1Z74A 1B23P 4RY0A 5JDIC 4L5JA 1DOZA 1YJQA 2CYCA 4TKUB 2ZR9A 2XQJA 4PYQA 4QVKA 2HMSA 3EHDA 1INLA 5LVAA 3Q10A 5AJVB 1G2QA 3P27A 4XUDA 3SEFA 1N77A 1NUTA 4IOJA 1YJAA 4Z4QA 2OSVA 2YZ2A 4PNEA 2R1TA 3AH8A 5CCBA 4PZPA 3G8DA 3WZ2A 1JQEA 1N6NA 2C4VA 3GQBA 4GUDA 1ADBA 2ZREA 3IHTA 3OMWA 4LNUA 4AICA 2AC7A 2CDNA 1VRCA 3Q3CA 1ZK1A 3D7SA 3P26A 4PYOA 5DW3A 3NDIA 4CKZA 3CIOA 3M3HA 3P97A 1FLAA 2VXBA 1VHJA 5L6LB 3HJTA 3FVTA 5HSGA 1COZA 1E2IA 1J99A 2YV2A 5IVKA 1UR5A 1TM4E 3AP3A 1R4MA 4JL8A 1JR2A 2EVWX 2OGTA 3FMPB 3HA5A 3QX9A 4NHEA 1MDBA 1DC4A 1V2GA 4XYGA 3QLUC 2GB4A 3ZCVA 4P58A 4G1CA 4AZWA 2BGJA 1DAMA 1QHFA 5F77A 3QF4A 5B1YA 4II3A 3CV3A 1B15A 1EE1A 1KJQA 3Q6NA 3WO1A 2QRZA 1KH1A 4W1QA 5GOTA 3PGMA 4EDFA 3EPHA 2VDRB 4MICA 1E0SA 4G81A 1ZM3A 4YI3A 1GKLA 1XCGB 4U2BA 5ADWA 4JYZA 4Q1VA 3QBEA 3EFBA 3O2JA 2NUPB 1M8GA 5ISMA 1YMUA 2CMDA 1YZYA 5DX8A 1X92A 2KHZA 3VNRA 2XRMA 3A25A 1Z18A 1JHMA 3CF6R 3DQZA 2APJA 3TNJA 3VR2A 1KNQA 4DB4A 1A9XB 1E3JA 3MQFA 1Y8RA 3MLEA 1TVCA 1EUQA 1YQ9A 1Q1BA 2GWHA 3RT9A 2QD2A 2WMOB 4BNUA 3EULA 3NHZA 3UJCA 1AQ6A 3JQEA 4L8FA 1VKHA 5I47A 4QM7A 3HGQA 4UHCA 2PKXA 3MEQA 4YRBA 4U0JA 2WTAA 3SU8A 2HJGA 1R6XA 3DHEA 3COJA 1XZCA 1E3MA 4XX0B 1R88A 1T9CA 1I3LA 3CW2A 4BGUA 4COKA 3JS5A 1JDUA 4RDHA 1PV4A 2V96A 1CF4A 2ZCVA 1JFVA 2I62A 1LUAA 3NVAA 1RHUA 1RFGE 3CRRA 4AG3A 1XYVA 1QGED 4CIBA 1RR6A 4DWOA 2IX9A 2R87A 4XJSA 2PLNA 1WVMA 3CUKA 3SQLA 4EZBA 3R4CA 1SD2A 1M2KA 1PYDA 1RAFA 4K26A 1O96B 4G0YA 2HHHB 4MXDA 2Z6AA 2A0YA 3OOYA 4C2TA 2PZMA 1T8UA 4HNSA 3DVLA 2Z3VA 3KU4A 1VPLA 4E03A 2FKAA 1BVYF 1WTAA 1MGPA 1SKUA 1Q0UA 2PS9A 3GJ3A 4REQA 1EWVA 2GN4A 3K6SA 3DOOA 1FIUA 4ZK6A 3LQ2A 4BUZA 3QVKA 4TN1A 1QIJA 4J2HA 3SQNA 5JZBA 1OHHA 4BP1A 1PL6A 1QO0A 1WV1A 1B0AA 2HF8A 5BNIA 1GGEA 1LRJA 1AF7A 4B6PA 1VHWA 4JEIA 3GDGA 1MJGM 1SIBE 4TUYA 2ZIVB 3SS7X 2J5KA 4LF5B 1DX9A 5HIIA 2WTNA 1A9RA 2ZI9A 3GJ4A 5KX5A 4X45A 4F5DA 1PI3A 1UKYA 1V1JA 4F8YA 4L8WB 3K5HA 2PGLA 1TVKB 3GXOA 3UKJA 2DWOA 1Y8CA 3SG0A 4EIWA 3OFSA 4KLAA 3PNLA 1NVKA 2OCYC 4A92A 1CR4A 3I9V6 3JAWB 2JD0A 3GA5A 4CU5A 1L3CA 3KEGA 4I1YA 2E4VA 2ZBFA 4E6EA 2P1RA 4BAZA 2FEWB 1MX9A 2I66A 1M66A 1U3FA 4CPDA 1EJ6A 4DCGA 1JEQA 4RA9B 1TM5E 4YDQA 1W19A 1DC8A 1TIBA 4LQLA 3PITA 2D1SA 1U8ZA 4HXFB 4F9EA 5DGDA 4HV4A 4TYNA 2JGIA 2VRBA 3DZBA 2W6OA 1GSAA 5CNKA 1M6WA 3HJHA 4K9RA 5DN6A 2PJUA 5HJ2A 4DJ5X 4IIUA 1HY3A 1NTOA 4KFTA 4TWJA 1CCWA 5J2TF 3FCXA 3H05A 5SZKB 4CF6A 4YGYA 3CR7A 1K3UB 1QR2A 2F1IA 5AKKA 3ZD9A 1O58A 2O50A 3PFGA 2IY8A 3G7SA 1BFDA 1PO7A 1THTA 3HY3A 1NZJA 4NEGA 4RHEA 3KZOA 3TRIA 1QDEA 4JUCA 2PX4A 3H99A 1EEHA 3CURA 4ZT5A 4AU1A 3C97A 4C30A 3I62A 1PR6A 1FJ2A 3N8DA 5BV1A 2DUNA 3PTZA 2WP8J 4UHFA 3IV7A 1CC1S 4XR4A 3ZIDA 4JV5B 6Q21A 4OQXA 1MO6A 1U04A 2I7TA 1RRKA 2ICAA 3VH1A 1I6LA 3WB2A 3GPIA 4DEYA 3GPBA 4OU4A 4PQEA 2IXDA 2XOKA 3G9ZA 3WK9A 2V1UA 2MT9A 3H04A 3LYHA 4R1MA 4EUEA 2GVDC 1VLHA 1EVYA 5IWAB 2OHFA 3FDXA 4G36A 2QYTA 3EC2A 3L1IA 3VSBA 1JDBC 2VZ0A 2ZRAA 3OEYA 5MHTA 1VCOA 1CS4C 1XDWA 2LXNA 3H5TA 3QVXA 3UW3A 4CT4B 5KNCA 2W71A 4G3XA 4RHXA 2PBRA 2V9CA 3F6PA 3A6EA 5CFPA 2QL9A 5ICMA 3ZHBA 3EXIB 4YRPA 3LYAA 1UDXA 3BJZA 3QENA 2CNLA 1T8WA 1GCIA 1LEHA 4OYRA 1SUCA 1ZGGA 2I9KA 1ISIA 3QPVA 2PX5A 4NE2A 2WWFA 2JFPA 3DV2A 4ZQBA 3V7YA 1P9RA 2RAVA 1CVIA 4IG4A 5BORA 2LUOA 2HNKA 3EBLA 4JQZA 4OATA 1JIIA 3SD7A 3Q87B 2LW7A 5AK0A 4RFSB 4M86A 4KNYA 1JBKA 4H1VA 4GBGA 3V00A 2DQZA 3W2GA 1EBBA 2E1RA 4A73A 1X42A 3DTTA 2ZSBA 1RT9A 2YIDA 4QEKA 1U6IA 3I0NA 5FNVB 1J8VA 2CW5A 1VOTA 1PJCA 4IOKA 3RJMA 1N0VC 1JLSA 4ILEA 5B1DA 2JEYA 1QAMA 2VXCA 3RVNA 1JDJA 3ZY3A 1QTQA 4JI8B 2GZ2A 3N76A 4DRXB 5IYZB 1FFWA 1U8AA 1PQPA 2IYUA 2O06A 1KGSA 1T9AA 1EFRD 2B98A 1QGYA 3DOHA 4ISBA 2FQXA 2JCBA 4KDRA 3TINA 2X41A 1R6BX 3I5YA 1RZRA 3FTFA 1CYEA 1JLRA 5KINB 1Z3IX 4DQXA 1XLVA 4A8HA 3G2JA 2OV3A 1YFZA 5M7EA 1NQAO 1P5RA 4PXYA 1T8YA 3ADKA 3ANSA 1OXTA 1LJ8A 3VZBA 3ESXA 3BSSA 5JBQA 2UVPA 3OE7D 2W6ZA 4CEIB 2BL4A 5H83A 1F17A 4GGPA 3IBFA 2RHDA 3FNEA 1AQIA 3KRTA 4G9BA 5BP7A 3E9DA 5EE1A 1XA0A 1NOIA 3GLGA 2W2PA 4HUQA 2P6RA 3MTIA 5CNJA 2P79A 3LCCA 4WCFB 4P31A 1I1OA 2G8LA 2QQGA 2AFVA 2AG0A 3CGWA 3G9UA 3Q7IA 1V37A 2CBZA 5CEFA 1N2ZA 4KR0A 2XUGA 2QYOA 4V24A 1U81A 3QV1A 3RU2A 1E9DA 3STXA 1HWYA 5K8IA 4WXMA 3AI2A 1NI5A 3LIIA 3UZUA 1F4LA 3IEUA 1XEFA 4IIFA 4V2UA 4EKDA 5BSMA 1PR5A 3KSAC 1VIDA 4BN0A 2NU6B 8OHMA 4TSKA 4Y2UA 3KXLA 3FSRA 2KM1A 4Q9HA 3BSFA 3O7WA 1KI2A 1R3DA 3ZZUA 5F7ZA 2XTAA 2X0IA 4U9UA 4ZRMA 3L1VA 1EYZA 2VP9A 5JAZA 1VCIA 3ERCA 4W5TA 5IDQA 3MN1A 2QN3A 1B14A 4BKOA 2AI3A 2GS9A 2QN7A 3R3WA 1ZVKA 1DO2A 2IYSA 2TS1A 3O8DA 1OB5A 4C7OA 3FOFC 4LAFA 5GJWC 5BURA 4OQ4A 4D3ZA 1RSZA 4ARUA 4YQFA 3N6XA 4G5XA 3QVMA 1G7CA 4XPZA 3E7WA 5EE9A 1QLWA 1DG3A 1TJ4A 4OXQA 4BXOB 3EXHB 2IYNA 1ULBA 1UMDB 1Z3CA 1PGNA 3PDCA 3MWLA 1JLHA 3Q7EA 4GI3A 4OJQA 4AK9A 1O5OA 4DCMA 1AO0A 4FXPA 2R5WA 3BMNA 3EZ7A 4HYEA 3L3BA 1YC2A 2BM0A 3UXMA 3VSDA 4R69A 2RAUA 2YBEA 4OHPA 4RV5A 5CDFE 5MFPA 4L2IB 3O4HA 5E3IA 4LRUA 2QZZA 4YPFA 1RC0A 3DMYA 4TKMA 2EFDB 1V9CA 1E3EA 4GFDA 4YJFA 5TS2A 4WZZA 1NQUA 3K35A 4INJA 2OB1A 2JLYA 2X76A 2C4HA 2FWBA 3FCUB 5A6SB 3RG2A 3RYFA 4B3GA 1EP2B 3CINA 4FZJA 4TL9A 1VL6A 2P27A 5LQMA 1QFSA 2R85A 3O95A 4OHVA 1JWAB 2NYRA 3ZDQA 4YLYA 1H22A 1QOQB 4XPIA 3V97A 5BVGB 5JSHA 2FEXA 2R1VA 4ZODA 5EYPB 1PJTA 1I01A 3FB1A 5TE9A 2BP7B 2UZ1A 2ZJ5A 4B46A 1E9FA 2CL6X 4Q3BA 1LQUA 3C48A 2ZRNA 2JGMA 2OZLA 2E4AA 3NBXX 1IN8A 1IRXA 1ZD5A 3IUBA 2ZUSA 4NG4A 4QNMA 4YJ3F 4YCSA 5B7NA 5WRFA 3OX1A 4K03A 5AHKA 4REOA 3QELA 3MJSA 3U26A 2J3EA 3FYSA 4KYVA 5AJWA 5EP1A 3AOEC 4TS4A 3OQPA 4JHLA 2WRZA 4DM7A 4NULA 1P5ZB 2DQSA 3NW9A 3PP8A 3BDVA 5BW4A 1YOVA 5HHTA 1BA2A 4QJBA 1X80B 4X61A 4OBBA 1CPYA 1GZ5A 1ORRA 2PH1A 1HBJA 1PEYA 4JXJA 1EDZA 2ZUVA 1XLTC 3I6ZA 1E32A 1PV2A 1E58A 1YL7A 1VYHA 4A82A 4B3FX 1HTWA 1CUAA 1QV9A 2BFCA 2PT6A 3UFXB 2VTBA 1E0AA 3L0OA 2WM2A 4PYMA 3T61A 1KFKB 4BGEA 4IDPA 1H1LB 1WUKS 3E4DA 2HJWA 4Z9YA 1GRVA 3ORFA 4ZOLB 4RIHA 4H1WA 5LQNA 4DF3A 3MB5A 1LSSA 1LNZA 1JT2A 2A5YB 1UEXC 1M76A 4LZOA 4Z1OA 1D2RA 3I28A 5ED0A 4HGQA 5GJBA 2QR5A 1Y6RA 4Q4DA 3CLSC 5CT9A 3O2NA 5DBHX 2OFFA 2EFCB 3U5ZB 4H9GA 3ACDA 4PAMA 2JLSA 1OVMA 1ZSVA 1PVVA 1C9JA 2VS1A 2YJ6A 3DD1A 3GIWA 3LKZA 2Q1YA 3DA8A 3WV4A 2EW2A 2FZCA 3DQPA 3FR8A 2D5AA 3HB5X 2PS1A 1G8AA 3INTA 3IUQA 4LCJA 1P2TA 5EJIA 3DDSA 8ATCA 1RVDA 1J1ZA 5C3UA 1R18A 2NAPA 4GNKA 5JZ9A 3T4XA 3X0DA 1G5TA 2JW5A 1E18A 2I6GA 5KB3A 3DULA 1TCAA 4W5OA 4QWWA 1Z37A 4RF2A 4HP8A 3KJHA 3I0ZA 2X6TA 5ANRB 3UAOA 4B7XA 4M3NA 3PUJA 3GLGB 1XZGA 1PQWA 3M3PA 1UK9A 2JFVA 4ENWA 3WLNA 2WJPA 2J0VA 4DYHA 1CP2A 1OFUX 5G3ZA 1YRHA 1RW4A 3AUFA 2B6NA 3ECSA 2FSGA 3LUHA 4YJ2F 1I94B 3G17A 4LXXA 5CFNA 2C3OA 5F7OA 3E5HA 3HV0A 2X1MA 2WJZB 3AVUA 2GHTA 3PICA 4M7PA 1K4KA 3WIDA 4MUYA 4TYQA 4R7TA 3U3XA 1JRLA 1K2VN 4HX9A 5ICEA 1D09A 2WKRA 3IH5A 3IGFA 3JQGA 4OQFA 3KQWA 1FFBA 1M2VB 2W42A 1Z7WA 3R5FA 2LZ0A 1HNXB 3IR7A 1QOPB 3I6QA 3MT9A 2GHIA 4WOJA 5BRNA 2RKBA 2GLXA 3C45A 3UHOA 2FJ0A 5IBQA 3G23A 3ZE8A 1PFYA 2AJLI 4MS3B 2J3HA 2JFGA 3X1KA 4E4RA 5K9ZA 3NJ8A 4Y0AA 1S4MA 2OHVA 3FKSA 3CVYA 2B92A 2GJKA 1BS2A 2ZWMA 5T4HA 4YAEA 4UBOA 3ET5A 4BAUA 2XLBA 3QVJA 5CD1A 2OBNA 5DGTA 5HF8A 2R9VA 3NHBA 4QYXA 2MOKA 1YZGA 3IPRA 2G4CA 2P40A 4AN0A 4C76A 1Q7BA 3LXUX 1A71A 2BELA 3SYLA 3IIMA 3BK2A 2CNOA 2VHQA 3JVEA 4HEA1 2CKMA 3LFTA 4QBKA 2XUOA 3REFA 1E6UA 2A94A 4WEOA 3GDFA 1DBSA 3ON5A 3SM9A 4ITVA 1Q0TA 1JFSA 1OUMA