3U3KA

Crystal structure of hsult1a1 bound to pap and 2-naphtol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
TSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3kA00
1H8ED 3WXMA 4TMVA 1U81A 3B1XA 3SJBA 2SHKA 4P4TA 4ZDJA 5KU1A 2CVHA 1CP2A 2BMDA 4TT3A 3VX3A 1II9A 4JS0A 4B76A 3FKSA 5J47A 3IQWA 3A1VA 4LZZA 1XD8A 2CJWA 3EZ2A 5EUMA 1CR1A 1FX0A 4CT4B 1RJ9B 2FG5A 1NI3A 1P2SA 2O0HA 2FSFA 3B2EA 4JJZA 4QBIA 5L3RA 4XVRA 1OH7A 5FUYA 1GM5A 2BV3A 2ORIA 3A8TA 3CRMA 3HU1A 4DJTA 2RGDA 2ZI5A 2IYSA 2QEQA 1NJFA 2XOKA 1AZTA 3N5CA 2K5UA 1M7HA 1GL7A 5JECA 2WTUA 3WP1B 5FFMA 3R7WB 3AVPA 4DUGA 3LV8A 3TR5A 1P6XA 1AK2A 1T5IA 2GILA 1J99A 1GRNA 4ZDKA 1GZSA 2YINC 3NH9A 4LDJA 2ZS7A 1TL7C 1FMJA 1VG0B 3QPWA 4A0FA 4Z54A 1H65A 4M1MA 1MR3F 2ZI6A 3NHBA 4HSEA 1JJVA 4U7DA 1KO8A 3FMFA 3OFND 1QHIA 4LK2A 1MO3A 1T8TA 2V1UA 3UKDA 3GD7A 4B48A 4V0NA 5ANRB 1E1QD 3GLFE 1HUQA 2J45A 3HR8A 5CJ2A 2B8TA 2RHDA 3W8NA 2WOJA 4KVGA 4GOXA 4CVNA 2GK7A 3LD9A 2HXYA 3VR1A 1TUIA 4KV9A 4JLAA 1YR9A 3GEEA 4S2EA 1VIAA 3ADCA 2V4ZA 1VYVA 3HU3A 4LJ6A 3QF7A 4M53A 1XU4A 1ZNXA 3QBTA 3SN6A 1ONBA 4EPVA 1I2MA 5SZHB 4DBLC 1IAQA 4HI0E 4Q4AB 4IKEA 1YU9A 3KFVA 3ZS8A 1PJRA 3GJ3A 2ZETA 3IPXA 1LB1B 2MSDB 1R7RA 5FOTA 1NRJB 4OI2A 1FTNA 2G6BA 2RH5A 4HEJA 3GFOA 1Q12A 2J3EA 5BYJA 1JR6A 4TTPA 5CM8B 3U7HB 1E2QA 4Q4HB 3TSWA 2C78A 5FOVA 4A0HA 4HLUA 1NVVQ 4Y0AA 4B43A 4ZCIA 2HYIC 5DN6D 3KKQA 2ZJ5A 1YVDA 4PZLA 3RRZA 2QAGB 4Q1CA 2B8WA 4RD6A 2IS1A 2IUSA 4C4PA 1CF4A 5L3QA 2C77A 3CH4B 4CW7A 3VR2A 1BO6A 1PLLA 3HYRA 1J8YF 3MWYW 4MA4A 1N6NA 2XTNA 1ZM2A 2RGGA 3A1SA 3I32A 2QMHA 3KZ1E 4MYTA 3K70C 4HB4A 3W6OA 1AKYA 1JI0A 4B2IA 2AD5A 2C9YA 2QTHA 2Z83A 1QHSA 1GNQA 2WHXA 1JQLB 1VG8A 4A92A 2F43B 4FN5A 4AKEA 4HAVA 3DOEA 3K0EA 5GJBA 3IO3A 1E2JA 2J0UA 4LYJA 4OKSA 2J46A 1P2TA 4DLXA 1DOAA 1QHXA 1RPZA 1RC8A 3CR7A 3HYTA 4JJKA 3OIUA 3FKSD 1ZD9A 1IN5A 4P32A 4Q5IA 3DEFA 3DL0A 3IBGA 2PT5A 3DM5A 2OE2A 4TYQA 2ECKA 1VCIA 3CRW1 1SVIA 4ZKDA 2DB3A 1E69A 1G18A 5EZ5A 4FMCB 2GNOA 3FMOB 2J9RA 1G20E 2BVNA 4D25A 4XIGS 2W00A 2OSBA 1ZP6A 3IKJA 2OBLA 1E2PA 2GF9A 2VP6A 2NQ2C 4TYNA 1QF9A 4C7OA 2A7QA 4QJ4A 1XPRA 4JLMA 1KI7A 5J4HA 1Q1ZA 2ODNA 1ZUNB 2ZRKA 2G0NA 2QPAA 4UXIA 3K9GA 4ESHA 3L8ZA 1EFUA 2WSSD 3QKUA 2GK6A 1GP2A 3SFVA 4DSTA 3PUXA 1UKVY 4Q02A 1EGAA 3C16C 2QPTA 5FR1A 4EUNA 1OF1A 1W2GA 5E95A 5J5CA 3LW7A 4HAYA 2P6UA 3PUYA 4YDHB 3ADKA 1ZCBA 2GBLA 3CX6A 4KHZA 4BRWA 5L3SB 1XCMA 5B64A 1DBSA 4DVGA 1RRGA 1KI4A 4TLAA 3SBDA 4JBYA 5HZHA 1COWA 521PA 1EESA 2QG6A 3QXHA 2NPIA 3CLVA 5EE0A 3UMSA 5CDFE 1ZNYA 1P60A 3SJZA 3K0SA 3SYLA 1YZQA 3VHLB 3HJNA 4XWOA 1QBKC 5H8WA 4KITB 2BKEA 4CEJB 1Z6YA 1DELA 4D4KA 2Q9CA 3WHKA 2FPLA 4I1VA 3GJ0A 5FOXA 1KKLA 4KLZA 1IBRA 1W2HA 1KK2A 1LFDB 4UNPA 3AUYA 4MKIA 4IVPA 4A4DA 1G5TA 2IUTA 4O25A 2XEXA 3QKRA 3ETLA 4IEEA 3MRSA 3MJRA 4HAXA 2CE7A 3C41J 3SJCA 1K8RA 2FPKA 3LBIA 1DPFA 1SKYE 4KFTA 2O8BB 2DFNA 2UKDA 2CBZA 2N1BA 4NCKA 5FTJA 1MT0A 1A82A 3T1TA 3SFZA 4TYWA 3B6EA 4BFVA 4G5GA 1GSIA 1Q20A 3CX7A 4P4SA 3CH5A 1ZNWA 4QBGB 1CU1A 1D6JA 1F48A 3VKWA 2NO6A 3LXXA 3TH5A 3PENA 3Q85A 4IXNA 2JA1A 3K0CA 2F1RA 2QRNA 1JR3A 2ZSDA 3QJYA 1T3LA 3R8FA 4RCZA 3RC8A 1E96A 3MWLA 1QVRA 3ND9A 4AYWA 2RAPA 2QGZA 5F3WB 3U3JA 1JEDA 3WHLA 1NMYA 5C1BA 5JMTA 5AUNB 5BW8A 2WSMA 1W36C 1KI6B 5LB2A 2LKCA 1WCV1 2YYZA 4A2PA 4M1TA 2VHJA 2WOOA 1ZM7A 4DCUA 4ZV4A 3DOFA 4Q4LA 4BLRA 2WWXA 3ZJYA 1DS6A 4US2R 5JJKA 1E2FA 3GJ4A 4UJ3A 2GETA 5JSZA 2QTFA 4OYHA 2BMEA 4TTQA 4B6FA 4L15A 1YR7A 3C14C 1G8YA 1LNZA 2AHOA 1N5LA 5DH9A 4JSYA 1IHUA 3H2YA 3RC3A 3CM0A 2JLZA 4PXAA 1S1MA 4E5UA 2AWOA 2VYFA 3CWQA 4TLCA 4MKGA 3ZZTA 3C4JA 1RKBA 1TPZA 4YLGA 2IYRA 4ACBA 4FMDB 1W49A 3T5GA 2G88A 4DXAA 2HCJB 2FGKA 2Q0HA 3F0TA 1UM8A 1NVUQ 2FFQA 2BC9A 3H1TA 2IYVA 4IRUB 4OHWA 2GJAA 3MWKA 1XCPA 1OXTA 2D7CA 4W5JA 1IJEA 3FWYA 2J59A 3ND8A 5E4FA 4Q1EA 2XXAB 4BLTA 121PA 3P26A 4Q9HA 1D5CA 2A5YB 2YOGA 4EQ6A 2ZRIA 1F2UA 1E2DA 4A6PA 4W7SA 1DAHA 2KJQA 1ZIPA 5CITA 3PUZA 1S4QA 2F55A 3BFKA 1X8KA 2BJVA 2OCYC 3GLIB 5GVSA 4MRRA 2ZR0A 1BYIA 3W34A 2WKRA 4IDHA 4DCNA 2F1HA 2BWJA 3IEUA 1HV8A 3JZMA 3ADDA 2YNMA 5E7IA 1HQCA 1WA5A 1XRJA 2IYLD 2ZJYA 3QOFA 3ZD7A 2ZVQX 2EW1A 2BEJA 2G0TA 1SXJB 2QU8A 3MMPA 4DCTA 1M8PA 1UPTA 1IXRC 2OUKA 2WKQA 4E03A 3FDIA 1IY0A 2CL0X 3CUEF 3GJ6A 5B2ZA 3AGQA 2JJ2A 3V00A 2DBYA 3CPEA 3QEJA 3GLIE 4URVR 3WNCA 1OYYA 2JASA 3V4RA 5HKKA 1QVAA 2VL7A 3GPLA 2QTVB 4RJLA 2OCBA 2A5FA 5HR5A 5DI9A 1ZUIA 1SVWA 5EP4A 4JL5A 3DMDA 4ZDIA 1OKKA 2Q6TA 1EXMA 1Z29A 1KDRA 2ZRJA 1KI9A 4M21A 3TUIC 1TNDA 2RGBA 3MSXA 3QXCA 5JI3E 2P6RA 1ZMXA 4AG5A 3EAQA 2OESA 5AJVB 5JBQA 2W83A 4P0TA 3LLMA 4B73A 2VEDA 2ZU0C 4JBWA 4UXJA 1J90A 1HH4A 2F9MA 2IT1A 4DB4A 3R7WA 3P32A 3L0OA 1SXJC 2ZITA 3TAHA 1E2IA 4NE2A 2ZRMA 2GAAA 4TQ9A 2WWHA 4AYTA 3KUDA 4B2PA 2PX0A 4OQNA 2QNRA 5TV2A 4TMWA 4PPQA 1PUJA 2F3RA 4G5RA 1CR2A 4M9SA 2GXUA 1Q1EA 4B6EA 3JZAA 4DKXA 1W0KA 2VSXA 2JLYA 2H16A 2VF8A 2YJTD 1SZPA 4CRWB 3FHCB 1VG9B 4PX9A 1WXQA 3KQNA 5AJXA 1AGPA 3KDSE 3CW2A 2X1VA 3RS7A 221PA 5FBQB 3CRRA 3IEVA 4NONA 2GJKA 4OQMA 3MJHA 3U3RA 2NMVA 1NKSA 3W3ZB 1U99A 4JLPA 4PC7A 2HDNB 5FI0B 5K8TA 1SQ5A 2IXGA 4WZ6A 3FHTA 1D2NA 1EFCA 1KK1A 2XNDA 4IW3B 5JEDA 4Y0VA 2R6AA 3S1AB 2D3WA 1MO5A 5FOSA 3A1TA 3PCRB 1S9DA 2PT7A 4Q4AA 5KDLA 4AKGA 2AXNA 4PO1A 2H5EA 2YWEA 2ZRCA 4QFMA 1MO4A 4B34A 2OLKA 4W5WA 1A7JA 1OHHA 4WAUA 5IF9A 3UPUA 4HLCA 4D0GA 5IK2D 5EQTA 3RABA 3QE0A 2RHMA 4OJKA 5KOYA 4Q4HA 4DLUA 3LNCA 2HXSA 4EJSA 5GADl 1E0KA 3OAAD 3QY0A 4LJ8A 4MKHA 3TVTA 4ON9A 2QAGA 2JJ8A 3EX7C 1Q1BA 3B1VA 2V7QA 2ORWA 3DKVA 4BLSA 3DHWC 1NN3A 2F1IA 2AFHE 3UWKA 1K6MA 2V1XA 2WMOB 1ZM3A 5J4YA 1AQYA 5GJCA 2ZI9A 1DAEA 3KB2A 4EKDA 1GKUB 2L0XA 3CX8A 4A2QA 3MFYA 1AS2A 3O8DA 3NBFA 1GDDA 3OESA 821PA 4Q66C 4LOAA 3RLFA 4F91B 3NWJA 3GQBA 5KUTA 5D3MB 2F43A 3T1QA 2WPDA 5CK5A 2RGCA 2GEUA 3P4YA 3UXMA 1E94E 4QNRA 3MG9A 3C15C 1LY1A 3SNHA 4BZPA 3A4MA 1ZNZA 4S35A 3I8XA 4BFZA 3ZIAA 2G83A 2VP4A 4MGKR 2RB4A 3TQCA 2ZJOA 1XJQA 3QUSA 1XFAA 2CLCX 3D3QA 2QE7A 2W6ID 2QMOA 3U44B 1E99A 2R9VA 4BZXA 1UEJA 3BWDD 5DSZA 2FSGA 1H8EA 4YC7A 621PA 4Q47A 2PBRA 2O8FB 2Q3HA 1IXSB 4QGFA 2CEAA 3TW8B 2OM2A 3AGPA 4V0LA 3LWNA 4I99A 2ZE5A 1FOEB 2JIZD 2ZRGA 1LV7A 2FMXA 1G8GA 4DLRA 4IEIA 3W5IA 4QM7A 1M34E 2H1LA 4C2TA 1JQJC 2ZRPA 5CDFA 5KDOA 4Z1MD 3LH5A 1ODFA 4I81A 1OB5A 2FEMA 3SBEA 2CLSA 3TNFA 2PL3A 3BERA 4NCNA 4DLSA 4K81B 3I3SR 1BYUA 1GOTA 5AUOB 3KXIA 1JEEA 2ZUDA 1XTQA 4XTCS 5L3SA 4HAZA 1OE0A 1OFIA 2BBSA 2JLQA 2ZE7A 5CLQA 1ZRHA 4AURA 2J7PD 1AQUA 3ZQJA 4POAA 2D06A 4MDEA 1UKEA 3U61B 1OFHA 1QHHB 3AKDA 3U2QA 2J41A 1OJLA 3UMFA 4A8JC 1GKYA 4CEJA 1KMQA 1CR0A 1ZM4A 4HLQB 1MABB 1RZ3A 3HDTA 4ZI2A 3NIBA 4QBHA 2GCPA 1DAFA 3OFNA 4E07A 2IS4A 3B13B 1TMKA 2ZRNA 1VIYA 2IYYA 1R5BA 3QBVA 1GILA 1VECA 1XJCA 4WIAA 5FL3A 1QHGA 3GEHA 1E1RD 1E1QA 1RIFA 4KO8A 4RZUA 3TRFA 1R0WA 1VYUA 3Q8XB 1RRPA 4HB0A 4LHVA 4Q21A 1EWRA 4QRHA 5H1YA 3K70D 3U7GA 2GHIA 3PG5A 4FMDF 4ZKEA 1N5KA 5J4VA 4M2LA 4Q19A 4G3XA 4N3NA 3RWOA 2LWIA 2O8BA 2ZU6A 2P3SA 4Q9IA 1KI1A 5LPNA 3R9XA 4PHTA 3L43A 3SR0A 1SVOA 3AP2A 3TJZA 3IILA 2C03A 5EUQB 3RS4A 4JL6A 3Q5DA 3GLGB 3DVLA 4D6PA 1RE0A 5FBLB 2FN4A 4GI7A 3PXGA 2ZSFA 4DHEA 4V0OA 2ANBA 4PC1A 4LC1A 4OI0A 1KK0A 2JDID 1E9RA 2VF7A 2ODBA 2WJIA 2REOA 5LD2B 4DDTA 3O47A 2G1KA 1FP7A 1KI6A 1S2MA 5FTNA 3T35A 3IDQA 4BASA 2ZAMA 4UNNA 5DN6A 4MYUA 4AKIA 3NEYA 5E7JA 1MV5A 1NLYA 4A82A 5G3ZA 1U2RA 1OH5A 5FUVA 3KJIA 2HT1A 3VU9B 2H17A 2R8RA 3PUVA 4AG6A 4G5SA 4HUTA 1IN8A 3ZIAD 2V3CC 1I4DD 2D74A 4TL8A 1IQPA 4LX0A 3WBKA 4PAOA 5G3YA 4QOSA 2VP9A 1ELOA 1N0VC 1XNJA 4LPKA 1O87A 2H8KA 2RKOA 2EFHB 2AK3A 2CL7X 5FUWA 3B7GA 3EC1A 3F5FA 4PO9A 1Z6XA 4HB3A 4DSUA 1JAIA 3D31A 2Q21A 3GLHB 5KPDA 4C0SA 2BMJA 5DLQC 4C2UA 4NMMA 4MITA 3ADBA 4FIDA 3L0IB 2QA5A 3TMKA 1K5GA 3UG7A 3ZZUA 5IHPA 5LD2C 2QL6A 1ZUHA 2ZUBA 2O5VA 5HE9A 4LC0A 3QPVA 1C9KA 2Z4SA 2FFBA 3PEVA 1S9HA 1NNEA 1TAGA 2HUPA 3I62A 2P6NA 5FPTA 2XXAA 5D3QA 4HAUA 3FFAA 1ZVQA 3GLHE 1XZQA 3CO5A 1P7CA 4URUR 4ARZB 1Q44A 4B44A 1FMLA 2FFHA 4Q7JB 4XH9B 2ZYVX 1ZU4A 1O3YA 3QPUA 4TMTA 1WB9A 4URZR 5EZ6B 4BEJA 4TLBA 2BBOA 2E9SA 3KQLA 3AVTA 3GLIA 2FU5C 4I1OA 4X8MA 2WSSA 3W6NA 4D0NA 1PLJA 1G7SA 3TVDA 3ZLJA 5C46F 1EFHA 3G5UA 4LJ4A 1GAJA 1N6KA 1RW4A 1A5TA 1T6NA 2VH5R 4L8GA 4Z51A 1FW6A 1SXJA 4D4LA 4QKQA 4QBFA 2GXQA 3ICQB 4MUBA 4PHGA 3SHWA 2ZJZA 4X8OA 1YJ5A 1S0UA 4R98A 2Z5FA 1I4TD 1G3QA 1VCMA 2A78A 3QNUA 6Q21A 3QSYA 2EFCB 2BBTA 2VSFA 2ZYTX 3PITA 1E9AA 5AJWA 2OT3B 2BCJQ 2PZFA 4IDPA 5HTKA 1Z83A 4HZUB 1HT1E 2AX4A 3WNBA 3ZYCA 4B35A 3AF3A 3FHOA 2Z43A 3HWSA 1JB1A 4LBYA 1G3RA 2OCAA 1UBEA 3NC0C 1WF3A 2W58A 5KSPA 4DIDA 1FUKA 1M7GA 4F4IA 3KJEA 2DWPA 1LVGA 1E6CA 5A0FA 3A1UA 3K70B 5AJYA 2PJZA 1TU4A 2XAUA 2JLVA 3GCGA 3LQRA 3LBNA 4IXMA 4US1R 1TF5A 1P75A 2J7KA 2ZYUX 2YV5A 1FQJA 3G82C 1G3UA 1OXVA 2MMCA 2IHBA 4DSOA 1GKIA 4PTLA 1OFUX 2DWQA 3WRYC 3T12A 2CHVA 5A4JA 4OK5A 3I73A 1NY6A 1FZQA 1KIMA 1EG7A 4JL8A 3H0KA 2IWRA 2JEOA 1A4RA 1L4YA 1OH6A 4Q01A 5EXPA 3QKSA 3GP8A 2FA9A 4JIMA 2D2FA 4LGMA 5EE5B 2QENA 3MUFA 2R2AA 2V9PA 2G9NA 4BGDA 3ZZ0A 1Z0IA 3KQKA 2QI9C 4H1VA 3AVOA 2R62A 3T1OA 2FSHA 2WAXA 1FTSA 3WMEA 2JLXA 2FPMA 1GRQA 3GFPA 1RYFA 1S8FA 2ZANA 2PJRA 2NOAA 4TYYA 2VP5A 1W5TA 4CF7A 1OXXK 1XP8A 4MUAA 3V4FA 4NBSA 4O3MA 1Q21A 2IK8A 2FSIA 2AD1A 1G21E 1T3SA 1TX4B 2O8EA 3DZDA 2IEYA 4BFWA 4DCVA 2QSZA 1E79D 3S1AA 2IWHA 4BUJA 4D2IA 3BORA 1VCOA 3EIHA 4IOLA 1DE0A 3F3YA 4M1YA 1WE2A 4JYBA 1PUIA 5KSZA 1R0ZA 2FWRA 1NBMD 2QP4A 2O8DB 2A5DA 1T0HB 4KJZA 3T5DA 5DO9A 5LDDC 4PSKA 3U6KA 4C0LA 3K53A 1G64A 2EU8A 1EK0A 3R9WA 1XEXB 2OBMA 1GG2A 1CS4C 4LHZA 4OHYA 1GRRA 2WBLC 2Q3FA 3LW8A 4FD2A 2PCLA 4GOKA 4TYPA 5AR1A 1OV4A 1UEIA 4LPSA 5JS8A 4M1KA 1B23P 2PLRA 4LYAA 1G41A 3K09A 3O8RA 4MQBA 1XPUA 4L4UA 1C4OA 3L82B 2KWIA 5ELXA 1SXJD 4R2IA 5DE3A 2ZJBA 2PZEA 5D3MA 1PZNA 1W4RA 2O0JA 4XVUA 3TUZC 4XVQA 1XX6A 1D2EA 3ZQ6A 2AK2A 5CIQA 4ZO4A 5GJVC 1SHKA 1AS0A 3QG1A 4ACAA 1NN1A 2EFDB 2HF8A 4DT1B 2FOLA 4IDQA 4LJYA 2BCGY 4Q1BA 2CK3D 3I1FA 1UBGA 1OLOA 4NYIR 4BFSA 4WXRA 3EPHA 1NIJA 1R4AA 2IYQA 4Q7LA 3OEHD 2F9LA 1P5ZB 1U8AA 3U44A 2GF0A 4C0BA 4BFYA 2O8CB 1F2TB 4ZPXA 5C4GB 1W36B 3RRYA 3I72A 1DO2A 2O8FA 2JAQA 4JLJA 1EFTA 4KI0A 1AIPA 3KX2A 2QORA 3QF4B 2ZJAA 3IIMA 4JMPA 2N46A 4B47A 2Q9AA 4P4UA 2OCPA 1TF7A 3CKLA 1FUUA 2QPOA 1R5NA 1KJZA 2OHFA 3VHXA 2NZ8A 3B8HA 3EZ7A 1KY3A 1QRAA 3SJAA 3I5YA 4CIDA 1F5NA 2YKGA 1Y63A 1V43A 3AVQA 1D2MA 3G0HA 2PCJA 4QM6A 4Q7MB 1J8MF 1Z6GA 3EA5A 1Y3AA 3ONWA 2ZRDA 4L9WA 3BD9A 1XXHB 2IL1A 1CR4A 4FCWA 1SVMA 2A2ZA 5UKDA 5EE3A 4PQRA 4U02A 1W4AA 4QG7A 1OIVA 4QGAA 3A36A 2GJSA 2NIPA 1U9IC 2QMEA 2IEZA 1QHHA 1KDPA 1FPMA 1CIPA 4LV8B 4PSAA 2N42A 1MABA 4F4CA 1RFLA 4GZLA 5K8LA 1AKEA 2ZI7A 2WV9A 3BH7A 1XXHE 4KLNA 4EAQA 2ERYA 4M22A 4Q03A 3K0AB 4GL2A 3REFA 5F2EA 3LX8A 4F92B 4CEIB 3C5HA 2KB0A 3GMTA 1D8TA 4UJ5A 2GCOB 2OXCA 1T5LA 3U7FB 4KFRA 1VMAA 4TQUS 3RNLA 3QENA 4D82A 4EIWA 4HAWA 1ZJ6A 5BQ5A 1GTVA 1DO0A 2JLRA 5BWMA 2D2EA 2EQBA 1KTVA 2OV2A 1X8LA 5CJPA 1E2EA 3OEED 1YR6A 1GL9B 2B7CA 2JLSA 4IVQA 4L16A 4TL7A 5FOUA 3GLGA 4JVMA 5K8IA 3THYB 3LX5A 4HATA 4GNKA 5JEEA 3KKMA 3HR7A 2LCFA 3QIAA 4DLTA 1IN6A 2ZS9A 3AVUA 2KI5A 1G7CA 4MRNA 2R6CA 1VDZA 2FZ4A 2YOHA 1U8ZA 2E1RA 4A6XA 1N0UA 3IGFA 3N70A 5KPJA 2WJYA 2DFLA 5IK2A 1WBBA 2TMKA 3A6PC 1OW3B 5KNCA 3OAAA 2A9KA 4CZ2A 4E22A 3RS3A 1KO7A 4LHXA 2YVUA 4BLOA 3PR1A 4B3XA 1KI8A 5C4MA 3B1WA 4O2LA 4TMKA 4TLEA 1YQTA 2CL6X 4M4SA 4OK6A 5EE9A 4YXWA 3WP0A 3AVYA 3TKLA 1E9EA 2A3RA 1Q22A 2QUZA 1NBME 2FDCA 1HE1C 3QQ5A 2CVFA 1DARA 4AY2A 1NSTA 4FINA 4ASUA 3BB3A 5GVRA 5C2JB 2BHRA 3BFXA 2WMNB 1TQ6A 2H92A 3I8SA 4HDOB 4OHXA 2WZQA 2VHCA 4PPNA 5FBRB 2CE2X 1TF2A 2WWIA 4KAXA 2ZREA 1NSFA 4PPFA 4BLPA 2GZDA 2QP3A 2ZI3A 3IIKA 3NKVA 3GLHA 4GZMA 1TQ2A 3T06B 4URYR 4AKHA 1N6HA 1Q3TA 4DLZA 2CCKA 3BBPA 3EZ9A 3VKGA 1G1MA 4OQXA 3ICEA 2ZRBA 4LYFA 3LQQA 2GXSA 1GVNB 3A37A 1KNQA 1AZSC 4JZKA 4K46A 4XOIA 5CB6A 3P1JA 2W6IA 1SXJE 1RJ9A 1YE8A 1JXMA 1N5IA 5KYKA 1T0JB 2VP0A 3R9IA 3WNDA 1J2JA 1BS1A 2Z4RA 3QEOA 4C0JA 1TEVA 2ZSAA 4IHQA 4FCTA 1V5WA 3D6TB 2GXAA 4ARZA 1NVWQ 3IHWA 5FR2A 2UZ3A 1AN0A 1JJ7A 2XITA 2JIZA 4JLDA 4C9BA 4RY2A 1BKDR 1NL3A 1NLFA 3VTKA 1G8FA 4DEXA 2QT1A 4LCBA 3KKPA 3RSOA 4CDGA 3BH0A 1IOZA 4Z1MA 3T61A 5HPYB 1SULA 2VO1A 4FW9A 4DIEA 1MRNA 1RRCA 4I1UA 2QSYA 1CRPA 4RD1A 3CRVA 1XTKA 4NYMR 1ZBDA 1WDTA 3K9HA 4F4JA 5TARA 2V54A 2IBMA 3CR8A 2AR7A 2GTPA 5FPKA 1WP9A 5TB5A 1OH8A 2CCJA 5GJWC 1IXZA 2YC2C 2J7PA 2ZR9A 2VP2A 4FWTA 1XMJA 5SZJA 1E98A 1HEIA 5FL7D 2DFKB 1G8HA 1JPNA 2W2XA 1MO6A 5DISB 4GDFA 4EFNA 1U90A 1E1RA 1N0WA 4QHYA 4BQSA 1ANKA 2VHTA 1II8B 4FMCF 3WYGA 3B9PA 4ZDWA 3AM1A 3NVAA 2ATXA 1VHTA 4JT4A 4J0QA 5CIWA 2WKPA 4ZIRB 1E2KA 2WVJA 2H7VA 1XD9A 2NZJA 4DCSA 4BZQA 3D7MA 2UZIR 1E0AA 4NHOA 1P9WA 5TDHA 2IYXA 2EWWA 1P62B 3OIWA 2EFGA 4RSGA 4LJAA 1R10A 5FTMA 1GWNA 2HT6A 5JCPA 4HZIA 2IA5A 4D26A 3DDCA 4UNSA 1F6BA 2EVWX 1SVSA 2BDTA 1Z6TA 2IUUA 4YXWD 4HLUC 4DEYA 3KKNA 3LO5A 4TZ0A 2JDIA 1A2BA 2IS2A 4PC2A 1HY3A 1N6OA 5SZKB 4A1FA 4ASUD 4A15A 4OHVA 1GNRA 1N2CE 2NG1A 2R44A 1CTQA 5B58C 5M04A 2JJ1D 1CJKC 2P67A 3SU8A 1LTQA 3IIJA 4HYYA 2AKYA 4C7OB 1P3JA 4PQFA 4XTRA 1PVOA 3EASA 1N6PA 2ONJA 1RYHA 5H70A 2QGNA 4BLQA 2QT0A 1KO1A 4IDNA 1R8SA 1X6VA 2C2HA 2HV8A 4L5BA 2NGRA 2WAYA 5JWHA 5EP2A 5EE1A 1PLKA 2KE5A 3CPHA 2O8DA 3SI7A 4QNMA 2Y8EA 1OIWA 4P3YA 1ZW6A 1ZC4A 2C04A 2W6JD 3O8CA 3NBYC 3RDPA 1LF5A 1YRAA 3KL4A 2P5SA 2RGAA 3SC3A 3W9YA 4A8JB 1XEXA 3IBYA 3X1DA 4JSTA 1M6NA 2FFAA 3FGNA 1DEKA 3BB1A 4DB2A 5JRZA 3E1SA 3EG5A 5SZIA 3LY5A 3PVSA 3ECCA 4TWZA 3HU2A 5BN3A 4RVCA 5B30A 2BOVA 3KTAB 3RS2A 2C98A 2J0VA 3T34A 1VTKA 4OBEA 3UIEA 3KJGA 3OIVA 1CEEA 4PQYA 3THXB 4JYCA 5C18A 1Z63A 3TUJC 1G7TA 4KYIB 2P65A 5TY0A 3RANA 2UVQA 1H8HD 2J5XA 3NBZC 4JBXA 3EXAA 1DAKA 2NO7A 2NO0A 4V0KA 2W0MA 3U3OA 3TK1A 3EIEA 4IFEA 2I4IA 4TMZA 3SE0A 1IONA 3OZXA 3BJIC 4NYJQ 1G17A 2REBA 3DPUA 4RD2A 4US0R 1Z06A 2FZLA 5FH9A 1KJWA 2GBLC 3KXKA 1KAGA 4LBWA 1T8UA 2VBCA 1G19A 2XZPA 4R7ZA 4YDSA 1XEWX 1ZC3A 3FTQA 1TTTA 3VR6A 2X77A 2RGEA 1US8B 4TSFD 2E87A 2VRWA 3VQTA 4Q4JB 2IF0A 3PV0A 4C30A 1IM2A 3VR4A 1F2TA 2PEYA 4WZBE 2NO1A 4B3CA 1BMFD 1R8QA 5TXGA 1ZINA 3CONA 3QF4A 1P61B 2WICA 3W8RA 5IRCD 1KJYA 5FI1B 2CLDX 1GIAA 1Q57A 4PHFA 2IXFA 1R2QA 2D62A 1TEXA 5G40A 3EWAA 1I2DA 2FF7A 1E9FA 4PANA 5DYGA 2V8OA 1OT3A 4HDQB 4M9QA 3NTUA 3X1YA 1KY2A 3LVRE 2AFIE 1X3SA 4MRVA 3R8CA 4GSYA 5JI2E 3B78A 4LJ9A 4RZ2A 1XXHA 1M74A 3RYTC 5F9HA 1XMIA 2QZ4A 1E0JA 4B33A 4V0ME 1CXZA 1YZNA 3BC1A 5DNYB 4OI1A 2XX3A 3MAAC 3QXJA 4JKYA 4C0QC 3K0CC 5HCIA 4URXR 1ZCAA 1NJGA 1WBDA 2B6HA 2V6JA 4H9GA 4C0AC 1FQKA 3L0PA 4AI6A 2ZUCA 4LSGA 3P4XA 4GP7A 3GLGE 4PSVA 2IYTA 1J70A 4B32A 1LS1A 1MKYA 2DHRA 4B3FX 4YQFA 3TAUA 4V02A 4OQFA 3CZQA 4KFSA 1D9XA 2EYQA 4HB2A 2QP9X 4FWIB 4NP6A 3FYHA 4CEIA 1Q1QA 4B3BA 4BE7B 1HA3A 1W46A 1Z47A 1DTSA 1XB2A 3QKTA 2BEKA 5JWOA 4A9AA 2GCOA 1HT2E 3I4LA 2O0KA 4TL9A 3NHAA 4PZZA 4X8HA 1F2UB 4NDZA 4MGYR 2I3BA 2Z0MA 4MH0R 4NCIA 3SEAA 1EX6A 4Q1AA 5JZVA 4U00A 4MGZR 3BXZA 1L7VC 1N3BA 2J1LA 5EXSA 5JHGB 4YMTA 4KXFB 1E79A 2QQEA 2PMKA 2FE4A 4F38A 2GESA 3EA0A 1AGRA 4LBZA 3E2IA 2ZSBA 2OAP1 4DLYA 1DVRA 4W9MC 1BH2A 1L8QA 1ESMA 2IF2A 5BN5A 1NKTA 1NBMA 1FP6A 3LFUA 1E9DA 1UDXA 4Q9JA 1G4AE 3V9PA 2X2FA 2A30A 3K0FB 3TR0A 4R9UC 3WYAA 4JVLA 1G4UR 4FMBB 4BECA 5TMPA 4NYJR 4QGHA 3WRXC 4C0KA 2ZSEA 2VQSA 1VCNA 3AB3A 1W0JD 3HPQA 1KI2A 1UF9A 4M1OA 2JGNA 1KNXA 1U0LA 4JLOA 4XD7D 1FL9A 5JHHB 2IS6A 1E9BA 4D80A 1E9CA 1UKYA 3MCAA 1KDTA 5G41A 1CJTC 2VSOA 3I92A 2BKUA 1IN7A 3IPYA 3ZH9B 3MWJA 3BIFA 5AUPB 2ZI4A 1J7KA 1KGDA 4ILEA 4WBSA 1W36D 4MGIR 1DG1G 5LB4A 1U8YA 3GLFB 5FOWA 4WZAE 4AYXA 2WJHA 3U6BA 1JALA 2C96A 5JJIA 1XF9A 2CK3A 1T4GA 3LBHA 1P9RA 2OZEA 4LUCA 4QJ3A 4TZ6A 5J40A 4MDFA 1YZUA 3OHMA 2EWVA 3L8YA 3OEHA 5HE8A 2BJWA 3B82A 1UAAA 1F3OA 1R0YA 1ZAKA 4NYIQ 1CRQA 2CHQA 5CK4A 3AVVA 2FEOA 4PPGA 2DYKA 2QROA 4DRZA 1GFIA 5AWFC 4OI4A 1SVKA 1VHLA 2WWGA 5FPSA 4JT2A 1XZPA 2WM9B 3O8BA 1KOFA 4LJ7A 3NDBB 2ZRFA 4U5XA 3BRWD 3X2SA 4Q00A 5P21A 3THOA 3AP3A 2ZQ5A 3AVXA 2CDNA 1I4LD 1M2OB 4EFLA 2W2TA 2GRJA 2Z6VA 3CBQA 3A58B 3FMIA 2PLFA 4KU4A 4MRSA 3EZFA 5J4LA 2RCNA 3HP1A 3FMPB 4NPHA 2OFOA 4YONB 3DO6A 4M0LA 1TQ4A 1AJEA 2CMKA 1EWQA 5B57C 2MMGA 5FBWB 4QL3A 2WIBA 1B0UA 1CKEA 1ZM9A 4LBVA 5CYOA 4PHHA 1LS6A 3MLEA 4XSGA 3I5XA 3OE7D 3D8BA 5A5GA 1X1SA 2IHYA 4EFMA 4G0NA 3BFVA 4KVAA 4QGGA 4TMXA 3FKQA 4EJSB 2GVDC 3KUCA 4B3GA 2XTMA 1IJFA 1UADA 1LW7A 3TGPA 2BBWA 1G3IA 3EARA 3NEJA 3U3KA 3PEWA 2D4HA 4GPTA 4FI3C 4TTRA 1II0A 4EPYA 4NH0A 1XEFA 1II8A 5H68A 1Q3HA 4QHTA 4ZCMA 5KSYA 2X2EA 3M1IA 5CLLA 2WWWA 3AF1A 1X1RA 2JCSA 3ASYA 1UDWA 4RKEA 4ZIRA 4PR0A 3A1WA 4Q7KA 5KHOC 2PEZA 1HE8B 2AL7A 2OG2A 2PX3A 1N5JA 4KBFA 4WA7A 4AD8A 4E09A 2IXEA 3AH8A 1U98A 1P73A 2H18A 5FTLA 4N0EA 2HLDD 1SKQA 3VMFA 3OEEA 3C7KA 4XWKA 2J0QA 3B9QA 5JFGA 5DI3B 2XZLA 1Z2CA 4TT3D 4BEBA 1CJUC 2I1VB 3RWMB 1MH1A 4HDCA 4EJSC 1AS3A 1OIXA 4AWXA 1Z8FA 4IVRA 4FXPA 2QAGC 1R0XA 4TL6A 3LAWA 3DZ8A 3AF0A 1NLZA 5HZKA 1XEWY 4AK9A 1NG1A 1KMHB 2IC5A 2ZTSA 1N6IA 1XTJA 1TADA 421PA 4N0DA 2OLJA 4YMUA 4Q48A 4G5OA 4NCHA 3BGWA 2XOKD 2I1QA 3HPRA 3LXRA 3FOZA 2JATA 2A5JA 5KNBA 3DM9B 3R20A 4RD0A 4DUGD 3QVVA 1EFRA 1C1YA 1HQYE 1NMXA 4BPBA 5LBIA 3CZPA 4D4JA 1AM4D 1KSHA 1VKJA 2ZJ8A 3QVUA 3A4NA 2YHSA 1DAGA 4BFUA 4MYCA 2X19A 3UK6A 4QJ5A 5AUQA 4LRWA 1G9XA 2ZJ2A 2P5TB 2ZPTX 4UXHA 4A2WA 5FUXA 4A8JA 3Q3JB 1E2NA 1W7AA 1KO4A 3B60A 2QM7A 3MGCA 1YKSA 5FPHA 3U5ZB 3CNLA 3LVQE 4GP6A 4Q1DA 4ESVA 3NG1A 2CNWA 3ZD6A 1SKYB 3KTAA 1ZU5A 3B5JA 3EWSA 4RFSB 3ZVRA 4Z8XA 3VR5A 4B3DA 4DWJA 3ZDQA 2B21A 1QDEA 1G6HA 3THXA 4HUQB 1W4CA 2QBYB 2MSCB 3W5JA 4K8OA 4R2HA 3AQ4A 2Q9BA 4KODA 3U3MA 3GJXC 2XB2A 1KYIA 4KCGA 4DDWA 4MRPA 2A5GA 2X8AA 1OXUA 4FCVA 2CHGA 5CYPA 2ZRAA 1XTSA 2C99A 3H4MA 3THWB 3VNUA 4MYHA 1NVVR 3M0EA 2XNSA 3AF4A 3VX4A 2FV8A 2AN9A 3W90A 1OB2A 1XD2B 4TLDA 1TU3A 2DR3A 2VPPA 5DYIA 1GL6A 1RRFA 4OL0A 3TIFA 4R71A 4PFSA 3VAAA 3FPAA 5L8VA 4JVSB 1Z0JA 5F98A 4UNQA 1US8A 3ASZA 1QZXA 4PC3A 4XWAA 3U4QB 5FTKA 1WQ1R 2QN6A 2YWGA 4Q4JA 1XPOA 2IYUA 1UJ2A 1Z3IX 1W48A 5IT5A 1E3MA 2VHUA 1JNYA 4IFBA 3CPJB 4NYMQ 2C8VA 4ZCLA 4D0LB 3KJHA 2OEPA 4F7WA 2RGNC 3X1XA 1S3SA 1UKZA 4BFTA 2ANCA 5FL7A 3ZVLA 4V0MA 2QAJA 3VR3A 5BYKA 4JVNA 4IOKA 4GMDA 1YZLA 1R6BX 1VG1A 3E5HA 2XB4A 4OJQA 1E2GA 3BH6A 2AKAB 3GJ5A 1XBTA 1P9NA 5JRJA 3SOPA 2DPXA 4X8LA 1BOFA 5E7MA 5AK0A 3CF0A 3H84A 3K9NA 1HYQA 1CBUA 1QG4A 3N2IA 4KYUA 3Q7QA 2ZIAA 5J4KA 4CEHB 1CULC 1YZKA 4MKFA 4ZI3A 3PIRA 2GEVA 4DSNA 3SQXA 3SS8A 4JLBA 1KKMA 3RS0A 5KNDA 1Z08A 3JVUA 1U94A 1XMVA 1G5PA 4M1WA 4TQAA 1E2MA 2R65A 2F3TA 4LWZA 2P0EA 4LV5B 3KXLA 3L0SA 4DDVA 5HCNA 1YRBA 2GKSA 3TQFA 1VPLA 4G1UC 3EZ6A 2V6IA 4DZZA 2P2LA 2HF9A 3FFBA 1G8PA 3PQCA 1E9SA 4AIIA 2CCGA 4RKFA 2IYZA 3T1VA 3VU9A 1W5SA 2REXB 1YZGA 2CJWB 2OXRA 4JLVA 1E32A 1EFRD 1JECA 2KBEA 4B75A 2F6RA 2JLUA 2DCUA 2XTZA 1FX0B 3L2OB 2G77B 3GJ8A 2ATVA 4EPRA 1T3HA 1Z07A 3T15A 3A4LA 1G5RA 4NL4H 4CGZA 2JJ1A 1S96A 4NTZA 1OPXA 1E0SA 1G3MA 2ERXA 1CJVC 4JKIA 4QXAA 3CNNA 2NPFA 1IY1A 3X1WA 1KI3A 1P2UA 4DLWA 1COWD 2HYDA 1Z0FA 2IX3A 4L9SA 3AKYA 3NC1C 4Z8YA 4G5QA 2ODWA 2AWNA 2BM0A 1ZD1A 3E70C 3EPJA 2CNWD 2DWOA 2FX3A 2NTYC 2C95A 2VTKA 4OHZA 2EFEB 2W6JA 3NXSA 5DGXA 3K0FA 1KZ7B 2WWFA 5KTYA 3ZVNA 2ZS8A 1L4UA 4WVFA 5JCZA 3SHFA 1JBKA 1ETUA 1NF3A 1TUEA 2EYUA 4GMXA 5EXXA 4B71A 3AUXA 4PZYA 2AXPA 5EP3A 1NN5A 3RSLA 5KDDA 3WMFA 2OO7A 4OK3A 2GCNA 3CF2A 2B92A 2J87A 2J0SA 3K9LA 4PAQA 3RRNA 4UQOA 4I1SA 3RAPR 3WBJA 4YMVA 4A36A 1H8HA 2HCBA 3IUYA 2WWYA 3EPKA 4I4LA 1R5OA 1KAOA 1M7BA 2CXXA 4CT5A 2QRZA 1JR3D 1KO5A 1P2VA 1ESNA 2ZEJA 5JJLA 3GLFA 3Q5EA 1KZGB 2FH5B 4RCYA 3AVWA 2OAQ1 3KKOA 2QY9A 3PFIA 2YC4C 2YWHA 4HZUA 1S3GA 2PMDA 3DMNA 1Z0DA 3CNOA 1S1CA 4EPTA 1Z0KA 4KSBA 4AC9A 1GUAA 3FB4A 4NKRA 2VLIA 4EPWA 4RD3A 4BRUA 3SYNA 4TSFA 2ORVA 4M8NE 3CWZA 2W2VA 3QKSB 2FJUA 4LHYA 1NN0A 3H86A 5DIFA 3WY9A 5BN4A 4RFVA 1A2KC 4PAMA 4O2RA 1BMFA 5L3QB 3NBXX 1NP6A 1NG9A 3C8UA 3QI2A 1Q0UA 4IOJA 5FPYA 1FNMA 1G16A 2KBFA 2ZVPX 1JPJA 2ASEA 2GWHA 1P4SA 1N6RA 3CRQA 3P27A 4PC6A 4ABYA 4GFDA 3SZRA 1F60A 2C9CA 2GDJA 1OFTA 3KQHA 3IQXA 2C9OA 3CF6R 4O0MA 1IN4A 3IHLA 1G7RA 1IY2A 3RS5A 4N1AA 1U0HC 1BIFA 1W4BA 2F7SA 4B2LA 4DLVA 3GFTA 2HEIA 2V55B 3SYKA 4LYHA 4IJMA 3RHFA 2ZRHA 3PEYA 4RZXA 2NO9A 2O8EB 1NVXQ 2J0UB 1KSJA 1YHNA 4W5HA 2B7BA 5CM9C 3UMRA 5EJEA 2XGJA 2GAOA 3NH6A 1XWIA 4BWYA 3UANA 1E2HA 3QXXA 2LKDA 2GZAA 2ZE6A 4B74A 2JLWA 1QHYA 5EXTA 3LLUA 1KK3A 4NU0A 3EPLA 2DY1A 1EX7A 1QHNA 4HLDA 3SDZA 3KB1A 3RVBA 3AV0B 4A0GA 1SVLA 2OFWA 3OF5A 4EPXA 2RMKA 4A0RA 5KO2A 3K1JA 3UG6A 1A1VA 2HJVA 3FVQA 3EW9A 1Z6AA 1M1YE 2FNAA 1OXSC 1RVDA 1UBFA 2Q3MA 2ZAOA 4LV6A 3C5CA 2XJ4A 3AF2A 1WRBA 2PH1A 4UNRA 3NDPA 2WJJA 3AKCA 3KFXA 4YMWA 1NY5A 2G3YA 1KHTA 3TSZA 4WXPA 4DDUA 2MSEB 1N6LA 3LA6A 3Q9LA 1Z28A 3LDAA 4M9XA 3VKHA 4KSCA 4GT1A 3CIOA 4Q9LA 2YWFA 1DADA 1XDBA 2JJ2D 1SHZA 3TSOA 1CLUA 3BB4A 2G1JA 4V03A 3I61A 1T9HA 4LHWA 5HKKD 5DI3A 4TN1A 3PJRA 4D81A 4NCJA 4P33A 4KFUA 1XTIA 1E4YA 3LRPA 2ZXUA 1XCGB 1OKKD 4WOPA 2WJVA 1GNPA 1ZIOA 2GJ8A 3GJ7A 5DHFA 2RGXA 1FNNA 1Z0AA 1KMHA 2BMFA 2XSZA 2YZ2A 5CB8A 2H57A 2BIFA 2GA8A 3J81k 3OIYA 721PA 5F9FA 5FBVB 3QKRB 1VYTA 1W0JA 1TQDA 1YZTA 4Q9KA 3WYFA 3K09C 3M6AA 1OYWA 4DT1A 3QG5A 4XD7A 2C5LA 2OILA 4G01B 1D9ZA 3BOSA 1CJMA 2XJ9A 1ZYUA 3AEZA 4F93B 4P4SB 1SGWA 3QXSA 5G53C 3TE6A 1X86B 3B85A 1U9IA 2O8CA 2O52A 3WMGA 1W0KD 4GOJA 1AA9A 5E3HA 2R6GA 3PUWA 2IW3A 2VHQA 1HURA 2GVZC 2GZHA 3BS4A 2ZYWX 3JVVA 4WW0A 4NZYA 3P20A 3U7EB 3UATA 4EDHA 5K8UA 4LY6A 2ZM5A 3GEIA 3W6PA 4URWR 5TVKA 1UFQA 1LF0A 4II7A 1XTRA 1Z5ZA 3UWOA 3ZGXA 3PEUA 1DAIA 3AKEA 4PO8A 4IDOA 4XJXA 1Z22A 4RFSA 1W1WA 1P72A 4Q18A 2GEDA 5BXQC 3SQWA 1DAMA 4HUQA 2RGNA 2QBYA 1JR3E 1NMZA 2OBNA 1KDOA 5JS7A 2HJGA 5JSZB 4UKDA 2XNDD 4QC2A 1MOZA 2ZROA 4IOMA 2ZRLA 2QM8A 5AJZA 1XJ0A 3M4YA 4DC9A 1FFHA 2OFXA 3CB4A 2W0SA 1JXOA 2PZGA 3THWA 3W3AA 3EC2A 3TW4A 4C0HA 3Q72A 5DHAA 1OHHD 1W47A 3BK7A 3B1ZA 3IO5A 3VFDA 1XD2A 4XSHA 1NIPA 1GITA 2WIAA 3DKPA 1G291 1N25A 1X8JA 1L2TA 1KSFX 3AP1A 1K5DA 2VA8A 3U4QA 4M9ZA 4BFXA 4KBGA 3ZVMA 1E2LA 1WMSA 2V7QD 2VIIA 2YOFA 2BM1A 3K0AA 4LJ5A 4D4MA 2ZR7A 1DG3A 3Q7PA 4JLKA 4OQLA 2F1JA 4GBMA 1UBCA 3OE7A 4GRAA 8OHMA 1QG2A 3VNVA 4YMSA 3MD0A 2GJ9A 3N2EA 4Q1FA 3U60B 2WJGA 3BAFA 3REGA 1E4VA 4H1UA 3FE2A 5EP1A 4EQ6B 4CYMA 4QHSA 1HTWA 1T91A 5KSOA 2D7DA 1PV4A 2ONKA 4ITRC 2QQ0A 2WPDD 3F8TA 2ZE8A 3RRMA 2ODEA 2IYWA 1OSNA 3B1YA 4P31A 3ZS9A 3KQUA 3X1ZA 5JWRA 1YR8A 2KSQA 1ZD8A 2DFTA 3THYA 1Z2AA 1U0JA 4C3ZA 4CEHA 5JLJA 4JLNA 4RZ3A 5L3VA 1MRSA 2QE7D 3EIQA 1G6OA 4M1SA 5IDVA 4ERNA 1W44A 2R6DA 3K8YA 1KSGA 4LI0A 2HLDA 4RD4A 2QMUA 1JAHA 2FGJA 2XSZD 2R6FA 3TBKA 2XZOA 1XMSA 3TLXA 3BE4A
chains in the Genus database with same CATH superfamily
1H8ED 3BZBA 4BQOA 2Y6UA 2HJRA 3MJTA 2ONZA 4YTEA 5A3JA 3WGIA 4OYRA 1PZMA 4L4XA 1ZJ4A 1V16A 2BFOA 3H13A 5FWNA 1Q0QA 2NUAB 3OWXA 4INPA 1P4AA 3A1VA 4Z4CA 4LZZA 3WIUA 1J49A 3KV1A 2ZSKA 1XQ1A 4JWTA 4YJ3F 2BGWA 2D7JA 1CR1A 5EUMA 4CT4B 4EQZA 6ADHA 2FG5A 4GIBA 4Q16A 3OC0A 1OUMA 1EX1A 2FSFA 1OBOA 2J5BA 1XTBA 3JQ9A 3TTVA 4RXUA 2CV2A 4F72A 4KO2S 3WDKA 5FUYA 1GM5A 1U8CB 3NANA 1TAUA 4P3NA 3K9WA 2RGDA 1FYXA 1ZWLA 1N2BA 2QEQA 5PGMA 4BNKA 3JU3A 3LU1A 1AZTA 3N5CA 1XNHA 3N05A 3W4IA 1YAHA 2VYQA 4QU8A 4G07A 5JECA 2WTUA 1C3LA 2CBXA 5KQGA 1ZGJA 3KQTA 3AVPA 4KQ2A 3R7WB 2Q99A 3TR5A 1P6XA 2A1TR 1AK2A 2JFGA 2ISQA 4RUKA 4AQDA 3NH9A 3Q87B 4R69A 2IUFA 2AUTA 3RIYA 4LF4B 4A0FA 1Q11A 2QYTA 4H27A 4DCOA 3ED1A 3FMFA 1J7JA 1XMPA 5AK6A 2O0LA 3U9LA 2MTBA 5CVUA 3GGOA 4H59A 1MO3A 2V7BA 1C8KA 4B84A 4DFDA 1GCGA 3GD7A 3OCUA 2GASA 3AESA 4QFBA 5ANRB 2OZPA 3B51X 1GXSB 1NDHA 2G1AA 4JFRA 1OILA 5FNVF 1XP5A 2RHDA 1EUCA 5GIOE 4CVNA 1W59A 1Y82A 3GPIA 4NESA 4BX3A 4MAAA 4RQBA 2Z8XA 4Y6PA 2QLNA 2HXYA 1N32B 4RU1A 3BT7A 1B00A 4ZVOA 1VIAA 4FKBA 1T3TA 1ZGCA 3ONDA 2QVXX 2V4ZA 1GZ6A 3TIXB 2YZMA 3E8SA 4KXQA 2ZKIA 2QZPA 3CCCA 4CM8A 3QF7A 4M53A 1NXVA 1BX1A 3CW9A 6CHYA 1SXQA 1P0MA 1V4VA 2PJUA 3JD1A 4ND3A 3BFJA 3C6QA 2YZNA 3OJCA 5SZHB 3WK9A 1NLUA 2JFUA 1WXHA 1VKHA 2NV2B 1FFEA 2VJCA 1VIVA 3IPXA 5K3FB 5C8VA 1LB1B 3G23A 5BXYA 2MSDB 1RFGE 2AOTB 1U7ZA 4MINA 1NRJB 4ZT3A 5FOTA 3D4PA 3PFKA 3LIPA 2B94A 4P86A 5TRTA 3TJMA 4NENA 1FXSA 3AZOA 4OM7A 1W1UA 3OCVA 4O4LA 4KYTA 1NG9A 1CZOA 2JFWA 2RARA 2R47A 3K0KA 2VC2B 4Q4HB 4ZV9A 4HLUA 1N3LA 1M66A 4ICIA 4Y0AA 1PYOA 4DA6A 4ZCIA 5KYYB 5HEKA 4V39A 4PZLA 5JZ9A 5KI6A 3ISJA 3HA7A 2QAGB 2R66A 3MINB 4Q1CA 2HPHA 2BGIA 4U0KA 3OA2A 1Y4SA 2IUSA 3OTWA 2RONA 3ZHSA 3BGVA 4CI0B 3OURA 1USIA 3BSSA 3GC6A 3ZQUA 4C4PA 5LIPA 2NU9A 1B14A 2NADA 1NASA 2Y76A 5AW2A 4LCJA 4CW7A 4ND4A 2GGSA 3VVMA 2ZP1A 1C1HA 2HLHA 3KPYA 1ECLA 2F3PA 1JAZA 3OLQA 3Q2IA 1N6NA 2V65A 3O8OB 2C97A 2RGGA 3B5IA 1GV1A 2QUJA 3EA4A 3OF2A 3Q11A 1LX7A 2A0FA 1WL8A 2HF7A 4JB8A 2Z83A 2GK3A 4N8EA 5FB3A 3K8ZA 2J3QA 1JQLB 1A5ZA 1ONNA 4Z4QA 4LJSA 4OQ4A 4HAVA 2FG6C 3K0EA 1K9SA 2J0UA 2ZJ1A 3R24A 4LYJA 4LMAA 4OKSA 2J46A 2PX5A 1QVZA 1DOAA 4LFCB 4RM3A 1P44A 2WW8A 1E4EA 1L4FA 3CR7A 3P5SA 1BXKA 5JPIA 2G25A 3HYTA 3JAWB 1R6DA 3DNPA 3FKSD 3OIUA 1J21A 2Z2JA 2R6HA 4JJKA 4Q5IA 4YCBA 1AY0A 1EK5A 1AG9A 4X84A 3DM5A 4DL9A 5IU6A 5CT6A 5IAGA 1VCIA 2A58A 1SVIA 2Z2IA 4ZKDA 2DB3A 1G18A 3EGXA 4RKRA 4FMCB 3FMOB 5DEOA 1Q95A 2J9RA 3BK1A 3JYOA 2JGMA 2X3YA 3BIXA 1D04A 2HM7A 5CHYA 3PC2A 4L5CA 4JDUA 1AKMA 4U9IS 1PJCA 3G2PA 1V6CA 4MW5A 1QF9A 4ZGGA 3V1TC 5CFPA 2A7QA 4MW7A 3IT0A 4JLMA 3TNJA 2D0IA 3IIEA 2V9ZA 3Q9NA 2GQ0A 2ODNA 2RC5A 2ZRKA 1QYXA 3HMQA 3K9GA 2HNBA 3LKVA 4ZT4A 1AGXA 1EFUA 2GKOA 3L7AA 3THRA 3PXUA 1GP2A 4JLSA 4OBBA 3PUXA 4DSTA 5IKXA 4UEOA 2ID8A 3SEZA 3WWOA 4YYEA 1OF1A 5E95A 2CLLB 4HAYA 3M33A 3K5WA 2EATA 2P6UA 3PUYA 4YDHB 1OYOA 3BTUA 3F67A 4QYXA 4X66B 4BRWA 1O4WA 3MZ0A 1XCMA 1R4MA 2D1FA 3GNQA 5ILGA 4DVGA 1KI4A 4EO9A 3SBDA 1X7WA 4DARA 2FP3A 1HO3A 1COWA 1BDBA 1YHYA 2QG6A 2UDPA 2B4YA 3PPYA 4UVHA 521PA 3CLVA 3UMSA 3WSTA 3L40A 1WWKA 3ZXXA 3FWNA 3REQB 1A98A 4XWOA 3QYPA 4CEJB 3NHJA 2ZBDA 2Q9CA 1RPTA 1M34A 2UXBB 2FPLA 7REQA 1OI3A 4MQFA 4J3NA 4F84A 3OBBA 4MQEB 2VATA 4XWYA 2JKYA 3CUYA 1W2HA 3ENNA 3LQYA 1XJ5A 1X1TA 4I4IA 5ELMA 2WLTA 3AUYA 1KP2A 2WHPA 3LPMA 5GP1A 3WWDA 4CMGA 3DMTC 4IVPA 3TLGA 5LNK1 2IUTA 2XEXA 5I8WA 3MHTA 3ETLA 2XQKA 3HNPA 5DTJA 1MJFA 3L4SO 1VLQA 2IYEA 3MJRA 3C6KA 3MRSA 5DBOA 1PJ8A 2PWPA 1XTVA 2C5SA 1Z5PA 1B6SA 2WUGA 4ALIA 4BOYA 1O4VA 4KRFA 3GRFA 5ALZA 1WV1A 5EN4A 3NI2A 1YFJA 4B3MB 1QH1B 2CBZA 2B37A 2N1BA 4RKWA 4YRTA 2BELA 3OCXA 5FTJA 3G9ZA 2R8BA 5MGNA 2NSLA 2AYYA 4AXBA 4LRUA 1Q20A 4M37A 1TLTA 1GQFA 3SZLA 4A1OA 2J3LA 4EB6B 4XYMA 3T54A 1CU1A 1V26A 1F48A 2X4IA 2JRLA 5I01A 3TH5A 2PANA 4DV6B 3PENA 4LJLA 1YI1A 2JA1A 3LUCA 1EINA 3P7MA 3RC8A 2V59A 4RCZA 3VHQA 1GG9A 1KC3A 1QTQA 1YCFA 3KUXA 3MWLA 4PSCA 3ZGZA 2RAPA 3PDIA 3QYFA 4QYIA 2IFTA 3D7RA 1YSCA 2MSKA 5F1YA 4CIAA 4HGQA 2Q4RA 5AUNB 1YFZA 4REQA 3T1YB 5T5QA 4TTTS 5K2OA 3LRTA 4PGMA 1GZVA 4AN0A 1EFKA 2IPMA 1WCV1 1XQWA 2LKCA 3U26A 4A2PA 2SCUB 2VZ9A 1VE9A 4GOOD 2G5CA 4GC5A 4D9FA 4PS1A 4FFNA 1E2FA 3HB5X 1HDEA 3C6ZA 1HYHA 4LIPD 2C7RA 2P2ZA 5FD8A 2I62A 4TTQA 1QU3A 1KXZA 1SUDA 2ZJ3A 5KOHA 4WK4B 1HTTA 3FUVA 1G8YA 1LNZA 1PJ4A 1RU3A 2AHOA 2PGLA 3WLQA 4DMGA 4D3YA 3N2ZB 3SYRA 2QTBA 4CR8A 1L3BA 1V9CA 1B8UA 1NAIA 4S2UA 4XGNA 1GQYA 3CLHA 4MLPA 4OSOA 2Q2WA 2AEFA 1G60A 3NEPX 4TWIA 4MKGA 2XUHA 2AN3A 3ON5A 2QJRA 3LP8A 2IYRA 3NDRA 4ACBA 4XGQA 5IG2A 2JIPA 4FMDB 4E5KA 4RTQA 2R3SA 3QU2A 2YW9A 4QSHA 3G02A 5J3JA 2FGKA 2FUG1 2Q0HA 3N8DA 1PS0A 1KY4A 1PQWA 3NM6B 4IWYA 3TRDA 5IARA 5K99A 3G2JA 2F8SA 1EGMB 5EXDA 4LOLA 5JDIC 1VE5A 4W5JA 4LZAA 1CZKA 5JZSA 1IJEA 1ZG3A 4KXVA 1EZ4A 4KAJA 2HPVA 4E46A 1PR3A 5E4FA 4BGVA 1ZH0A 3PFHA 2GD6A 4X1YA 2NXJA 4F60A 4BLTA 1BE1A 4YV2A 5AK3A 2V0NA 4QYWA 121PA 3QPCA 3P26A 3SG0A 3RTEA 4ECEA 1D5CA 4EGQA 3OO1A 3OVMA 4YUYA 2YOGA 2PGOA 1F2UA 2QKYA 3EQ2A 4W7SA 2XAAA 1DAHA 3OJLA 3G8YA 3WLNA 3ZD9A 5DGIA 2XUJA 3H4IA 3PUZA 1QFSA 1S4QA 1ONOA 2ZIXB 2ZZNA 1ZWKA 2F55A 1V95A 1QH0A 2BJVA 2O3QA 2OCYC 1JPVA 1MJGA 2I2CA 3D64A 3FLEA 1FSGA 4MRRA 1JZQA 4OQYA 3UT6A 4G8JA 3W34A 4IDHA 1WZEA 2RJOA 2F1HA 3TZLA 4MW9A 1HV8A 3JZMA 3ADDA 3KDAA 5E7IA 5JRDS 4L0CA 1WA5A 4MR8A 4HYQA 3M9WA 5GV7A 4YR9A 5ALEA 5I7EA 2Q3DA 2ZVQX 3NHFA 4WRRA 1YFLA 2ZQYA 4LI3X 4UU7A 1SXJB 1JMYA 2A59A 2C3YA 5F7ZA 4DCTA 1P1KA 3KC2A 3A32A 1IXRC 4E03A 2WKQA 4BRSA 2DTXA 2CL0X 3GJ6A 1U7XA 3AGQA 1ZKMA 3IAFA 3SYMA 2C0PA 1I2BA 4GX5A 3GLIE 3QW4B 3UHAA 3WNCA 3HH8A 5DM0A 2MU1A 1VRVA 5HKKA 3RADC 2B1GA 3PGLA 3F9RA 1WNTA 4D99A 2OCBA 5LKAA 4EJFA 1USVA 4LAFA 4RSRA 5F5LA 1ZUIA 2EIXA 2FLWA 5E3JA 1IL0A 4HAIA 4ZDIA 1UPCA 4N3GA 4RNDB 2CBGA 1KDRA 3HMKA 5DF1A 3TUIC 1I7NA 3S2IA 4FYJA 4BVJA 3MSXA 1DQSA 2P6RA 1ZMXA 1L5RA 4HR7A 4AZTA 2R5WA 2GARA 1UMDA 3ZXIA 3LY7A 1E3LA 3SZMA 1V5EA 3HFSA 1ZQ9A 2W83A 3G7SA 4O08A 3K30A 2FHSA 4LYEA 4JBWA 2JBWA 4DB4A 4WUTA 4UZEA 5J43A 1WW2A 3P32A 4C6RA 3ZHYA 4WLUA 5HW0A 1RI4A 3MA0A 2P6PA 1G8KA 3R3YA 3BWBA 2D6FA 1A9XB 4NE2A 2GAAA 2WWHA 2G28A 4CR7A 2X6TA 3UYLA 1PFKA 4LQLA 4CM1A 1LJ8A 2A4MA 3M1YA 3KKZA 2ZKLA 4ZICA 1PUJA 1WIWA 4BX8A 4F9FA 5ALJA 4UUQA 4ALNA 6PFKA 2X9QA 1IE3A 1JQEA 3RBXA 3JZAA 1KPIA 3DWFA 5ECWA 1C30A 3UGKA 3NCTA 4B0PA 1HNZB 1W0KA 4NNJA 3ST7A 1PL8A 2VSXA 5KYWA 4LXGA 4IJ6A 2IPXA 3EFBA 1VRWA 3FHCB 2FW8A 4LZOA 4PX9A 3D4OA 1NP3A 1EFLA 1RPJA 2ILVA 3DOIA 4MWOA 4N6OA 5EPEA 5AJXA 1Z2EA 1AGPA 2AEJA 1WB4A 2VT3A 3KDSE 2C3MA 4Y1RA 2X1VA 5IDWA 3DVSX 3K3PA 4QOJA 2NVUB 3PUKA 5IFKA 5EMJA 3MNFA 2P2YA 2QX4A 4FB4A 2D0DA 4J7CA 1KVTA 3VM6A 5IT4A 3MJHA 2IITA 2HL6A 2NQ8A 3W3ZB 4HOYA 1CNMA 1AB5A 1EFPB 4OMFG 4MQLA 4EG1A 5K8TA 3HCEA 1DX4A 4MPDA 3A25A 1SPBS 4JC5A 2W6ZA 1KK1A 3T7TA 5J2UB 1PK8A 2C2GA 4IW3B 5JEDA 2R6AA 3L6OO 2D3WA 3O92A 1WW3A 4D98A 3PCRB 1S9DA 4Q4AA 4AKGA 1L4HA 1SVUA 1I3OA 3JX9A 4M3NA 4LE1A 4CKCB 2Q3CA 1VJCA 5KYUA 4QFMA 1MO4A 3F8WA 2BEVB 1A7JA 1GGMA 2R8PA 4WAUA 4U2KA 5C8YB 2O2DA 3UPUA 2BN4A 3DNFA 4GVLA 3I9LA 3K2BA 5KOYA 3BXXA 4DLUA 2H3EA 2HZBA 5GGXA 1I01A 1DDIA 1NT4A 2PRKA 4I50B 4MX8A 1VLMA 3CMMA 1B1CA 2JI6A 1CV2A 3CUKA 1EZZA 4KNVA 5JDCC 4DG9A 3K35A 2QJOA 3USZA 2P41A 4BLSA 1Z5NA 1NN3A 1EBBA 5JH7F 4P38A 3AEYA 2H29A 3CW8X 4P4NA 4PONA 4X24A 5ALRA 4IMJB 4P3XA 1ZM3A 4IKOA 5I9SA 1E0DA 1SBTA 5GJCA 1UXKA 4DAEA 4RHCA 3KB2A 4U4AA 4BN4A 1GKUB 2L0XA 2YRFA 4BP1A 3UUFA 5IAOA 1UXJA 2Q2OA 4HQNA 1HDCA 4QQNA 3OESA 2N3ZA 2XZDA 3JQQA 4RXMA 3WLLA 4EHHA 4F91B 2AZ4A 1AT1A 2BPOA 2F43A 3FFTA 5CYFA 1DC6A 2WPDA 5CK5A 1K3TA 4MA5A 2RGCA 2VT7A 1DFGA 2QY6A 1HT0A 4K0RA 3V8QA 2VYVD 3QITA 4IIGA 1W87A 3C15C 4BZPA 1IZYA 2UAGA 2W2LA 3HVHA 3O1IC 2C2MA 3ZIAA 2VP4A 4MGKR 3EY9A 4CTKA 3JQCA 1RYZA 1NUTA 4JP2A 3RIMA 2A0UA 1VJRA 1XFAA 3D3QA 2GAIA 4N12A 5E6RA 3L02A 5HIKA 1SCDA 2W6ID 1VMIA 1XKLA 1STOA 1E99A 3ROKA 4ZJZA 3WAJA 5GZ1A 3FDXA 3GEPA 3D0QA 3D1VA 3LCCA 2WU0A 1ST3A 2O1EA 3E05A 1JHOA 2Q3HA 1LA2A 1HE4A 3HRKA 2OM2A 1Z4KA 3LWNA 3ZDYB 2ZE5A 5DBGA 1E3DA 1I36A 1OBCA 3A27A 2QQFA 2G09A 1K6JA 1Q3KA 2FMXA 4QM7A 4IEIA 3SQNA 1SWVA 4ZOQI 3LPNA 4C2TA 4P7BA 1O6FA 1QO7A 2Z4TA 4ROTA 2JAWA 4L4RA 2XMPA 2Z8YA 2EP5A 3IYLW 3LH5A 4M46A 3ZGOA 5LZ2A 1OB5A 2FEMA 1U5CA 2PR2A 2PL3A 3I01A 2H08A 4K81B 3LQ4A 5A1TA 1FPQA 3C48A 3NV7A 1GOTA 2MINB 1M76A 5AUOB 4K2AA 5DNUA 5L3SA 3ZIUA 3DBRB 5H3LA 5BSVA 4M0KA 4G8DA 1QC5A 2DQ4A 3ULKA 5G1PA 3D2BA 3UA4A 5CLQA 3AERA 4ZAVA 4PAWA 1K2WA 4WUVA 1GCUA 3WLOA 3ZQJA 4D3DA 4KZKA 2FW9A 3GRPA 1K5PA 1UKEA 3AJ8A 4QTTB 5JVDB 4Z2YA 3RBAA 4MDEA 3U2QA 3GJTA 2YICA 1HLGA 3I1JA 4A8JC 2IBSA 1KMQA 1CR0A 1M5TA 2D4AA 3IDAA 1WUJS 3H18A 3PUJA 4FNMA 4FZJA 5DJ5A 4TVSA 5IF3A 4C2AA 3OQ1A 4QBHA 1JDNA 2CYAA 2GCPA 3AR6A 3V1MA 3UT5B 2FQWA 4NICA 1OU4A 4LKRA 1TMKA 5AXBA 2YIVX 2IYYA 4WNIA 3QBVA 4RZQA 1GILA 2PH5A 4WIAA 3QVTA 3AOGA 2AVDA 3QP9A 3VXKA 4PEVA 1D8AA 1R0WA 3K70D 1RRPA 2OO3A 2RI0A 4KH0A 1EWRA 2WYUA 4QRHA 1P6UA 3ES9A 4D9IA 4KR0A 5CEFA 2XQIA 4FMDF 3BCSA 3CZRA 2BUCA 3L0ZA 2YXEA 3RC1A 2PQ0A 4M2LA 4EL5A 5LD2C 3SVLA 4UM8B 1T25A 4G3XA 2FZWA 1Y0BA 4N3NA 4FEYA 4RC9A 1T6BY 2O8BA 3DLIA 2P3SA 5CRIA 2HK9A 4KGDA 4EW6A 2GWRA 3R9XA 1URPA 5GONA 1SVOA 1XZAA 3NFRA 3V2HA 3D1JA 4UASA 2I9KA 4J1TC 3TFOA 3JARA 2VUHB 3AFIA 1P1HA 2ZUWA 4XASA 1JEYB 3JY6A 3PWSA 1V1RA 4EGCB 4L0DA 3D1LA 4E5SA 2FN4A 1VJDA 2H52A 2ZSFA 3QMMA 3H87A 3AY0A 3E4DA 3B36A 1IQ0A 1MTOA 4YQEA 3VOAA 2X7JA 3DWGA 1CP3A 1Y4ZA 4PC1A 4BP8A 2I65A 4C43A 4JU9A 4E12A 2VF7A 1PQYA 1ZMOA 2JI4A 5I9IA 2I7VA 1KMNA 3HCNA 2O2XA 2REOA 2GHRA 3O47A 2P78A 3T35A 2V7WA 2QD5A 3IJ5A 1V2HE 1DPGA 1QORA 2JHCA 4G6ZA 4IQGA 3SLRA 1QCCA 4BASA 3NRCA 4MYUA 5TLSA 3KBOA 1L7NA 1ID8A 1MV5A 1LC0A 4PRZA 3KQQA 4JITA 3W5UA 5G3ZA 1WW8A 1U2RA 2C7GA 1Y5IA 3EDOA 3CFYA 1T5HX 4Q3DA 1DBPA 3DUWA 1KYQA 2X22A 3GVHA 5J1TB 1ULTA 2CSUA 2V3CC 1I4DD 2X3FA 4JENA 1JE1A 1WKCA 2JHAA 4FFBA 2I3ZA 4N18A 5ALQA 3UH0A 1R6AA 5EMMA 3WBKA 4CKWA 1R12A 1G98A 4MR7A 1FTWA 4TYMA 4ZA2A 4YRQA 2EFHB 4E2YA 3BTVA 2FWJA 3F5FA 3KQYA 3M3DA 2FPIB 3PXEA 2HHLA 2IHVA 1T24A 1JAIA 1CUJA 3D31A 2UUBB 1CEQA 1XVAA 2Q21A 5KPDA 5IZCC 1P9OA 4X7MA 4QO7A 5EIAA 1HSOA 2BMJA 3TO5A 4KE7A 4UTVA 4NMMA 4WBNA 3ADBA 4FIDA 2VVTA 3DDNA 3L0IB 3L1UA 5I5GA 4IO0A 4MWSA 5EYPA 3TLYA 5IHPA 5KJCA 1U7DA 3GWGA 5KVSA 5U9CA 3CEJA 4OAPA 5AIAA 4LC0A 5HE9A 2AI1A 1EG2A 1ITZA 1S9HA 1NNEA 2Q46A 2JAUA 2ZUUA 3B3JA 5FPTA 1H94A 3CVXA 2XXAA 1U8TA 3R0JA 5GOTA 2H1IA 5B1YA 5KOJA 1A7AA 1PUXA 4K1LA 5DBIA 4FDTA 1TCVA 3DF9A 9GPBA 4BKMA 1SJ9A 3PC7A 4URUR 2HJWA 3U0BA 1P7ZA 2IZ6A 2O5EA 4CXMA 5HCUA 2PYIA 3WWPA 3IAM6 2HJHA 4CL2A 4XH9B 4WEOA 2VXOA 3QPUA 4GSKA 4TMTA 1J0BA 5D7NA 5EZ6B 4N5IX 1A9RA 4TLBA 2E9SA 2Q5JA 1P17A 1IC6A 3F6CA 4MUGA 1AV6A 1M1UA 1CDOA 5AIBA 2FU5C 4UC0A 4NPCA 4YO8A 2HBYA 5CAEB 3O9MA 4JJ7A 4ZREA 1U8FO 3TVDA 4GVPA 2HRRA 4C7VA 1UBTS 5A02A 4G0UA 3INGA 4BFCA 5CX1B 3WADA 1DXOA 2RKBA 4JY7A 3SXPA 1GAJA 3GOHA 3GT3A 1EK2A 3M81A 3SWWA 4L8GA 4HEA6 1EVLA 3E9QA 3PNKA 4UAJA 5ALIA 1GTL1 5D3ZA 4D4LA 2DECA 4QUBA 3FGZA 2GERA 4J03A 4MUBA 4TSKA 4B8WA 5BW4A 1OAOC 4D79A 1H69A 3VR4D 4CM3A 1TEZA 1G63A 1R8XA 3AR5A 1S0UA 1VCMA 2A78A 3DULA 3I6YA 3Q3IA 2BBTA 2HKIA 1XAJA 4HXEB 3QSYA 3LL7A 4P3KA 4JNCA 5AKJA 3MTGA 3X1MA 3CG4A 1T1IA 2AX4A 4ODIA 4FZRA 4P3PA 5JNWA 4B35A 4HGPA 4LTNA 1IQUA 1HG0A 1Y8RA 1YONA 4KWHA 1G3RA 2BI8A 4NJOA 1UBEA 1T0PA 3ROMA 1GG5A 1DIOB 4K3VA 5KSPA 1T9DA 4DIDA 4AAYA 1LDMA 1NUUA 3KJEA 3N0WA 1Y9AA 1LVGA 4EGSA 4YV1A 1N2JA 3LGAA 5C8YF 4N8SA 3A1UA 5HIMA 2YIMA 2PJZA 2BE9A 2XAUA 2ACEA 4B6RA 5KAPA 1XU7A 3LQRA 2OFFA 4HAOA 5LOVB 3BQ9A 4I50F 2XW6A 3OM1A 4FOTA 2JG3A 1E8MA 4MP6A 3H3XA 3G82C 1G3UA 2GN9A 3B6KA 3QGMA 3O3CA 3CZ4A 2O57A 4BDSA 3KD3A 3ZDCA 1OFUX 3WRYC 3T12A 4Q37A 3M6IA 3RT9A 4FZ3A 5JC8A 4M0DA 4OK5A 4XM2A 4TWBA 1FZQA 3RYIB 4ENPA 1EG7A 2XWBF 5K0FA 3BD8A 1Z13A 4RVUA 2IWRA 1L4YA 4DCCA 3QVOA 3QUQA 3A9CA 3HFGA 5EIOA 5EE5B 3FLAA 4LGMA 1IBMB 1XO1A 2RK3A 2R2AA 2YMQA 4FFSA 4Q4DA 4JOSA 2G9NA 4IP0A 3HA2A 4LVNA 3S2SA 3UXYA 1AQNA 1C1XA 2XVXA 5CTJA 4MW4A 2ISSD 1FTSA 4D44A 2FPMA 3AUJB 2ZANA 1JH8A 4G0OA 1ILWA 2VP5A 4X44A 5JMPA 5T4HA 3UMJA 3I9KA 1SC9A 4MUAA 3V7UA 4C87A 5T4BA 1JIQA 2AJ8A 1JZTA 3CCBA 1RQLA 5LP6C 3V4FA 4XIFA 3D5TA 4NS1A 5H7XA 4BNFA 5BUQA 2DULA 1ND6A 1Q21A 2WU3A 3IB3A 2QUAA 3OECA 1M0TA 5TSDA 4IIHA 3W05A 3ZV3A 2EEPA 1TX4B 4B81A 1IJKA 1PP4A 2IEYA 4W7IA 1AGNA 2QSZA 1E79D 1E6MA 2IWHA 1EMDA 4NLLA 1BA2A 3M4JA 5EQDA 2FSVC 2JFQA 1DINA 3EIHA 3ZTYA 3F3YA 4I0WB 4RDIA 4M1YA 3LPDA 2VPQA 4NOMA 4JYBA 2YFYA 2C42A 3C3AA 2QU7A 1U63A 2CNOA 1EUYA 1GU0A 3Q40A 3WL5A 2FZEA 4NHEA 2QP4A 4ISBA 5HIAA 2A5DA 1I1QB 1NYQA 1T0HB 4PU0A 4W8HA 5JHHB 4M0EA 1U6IA 3OLVA 5LDDC 2P9JA 3PRHA 2H1WA 1J2UA 3U6KA 2V96A 2GB4A 1R4NB 2I1WA 3ZY3A 3H2ZA 3K53A 3O7MA 4OKIA 2JLAA 5AOVA 2D00A 3RKSA 4YAIA 3R9WA 1JA0A 2D5BA 3CURA 1A04A 1GG2A 1CS4C 2HA7A 1JHXA 3L01A 4YLYA 3ILSA 3OC6A 4K6OA 4OHYA 3HY3A 1RAHA 5T57A 1U2GA 5KMGB 4L5IA 2C7QA 4P0QB 1LTHR 5LLDA 4LPSA 4HWTA 2M32A 1ZJ5A 2AIRA 4YH1A 3QBEA 5LQSA 3Q7EA 3QMPA 3CG0A 4LYAA 1G41A 4EA9A 3O93A 5JVDF 4X92A 1CK4A 1V7ZA 4BNXA 3NBUA 1BE0A 3PEFA 4H6VA 3TL3A 1SXJD 1RXIA 5DE3A 2ZJBA 3FN4A 1N77A 4IZIA 4XVUA 1WZ2A 3S28A 1IZ9A 1D2EA 4I4TA 4MKZA 1NXSA 2ZUFA 2D1RA 3PDJA 4QPPA 3KBBA 3QRWA 5KVQA 1L7AA 1A8SA 2VRCA 2G63A 3CLTC 2PPVA 3MTBA 4C07A 1ZZGA 1XVVA 2R1TB 1ZI9A 3BF7A 1QFYA 4RH3A 3PQ5A 1ZGZA 2BCGY 2YIJA 4YEDA 4NYIR 1P19A 1U65A 4R1NA 4OX9Y 4RENA 4YALA 1ZN7A 1DLJA 1R4AA 1UBRS 1Z2OX 2IYQA 4AKTA 4HQLA 4Q7LA 1EB9A 1WB5A 2GK4A 3QYAA 3ZY5A 2UYQA 4OLJA 3KEOA 1MQ9A 1Y9ZA 1XCBA 2VPZA 3UQYS 2WG2A 5DP2A 4C0BA 4ZGBA 1CY2A 1XT6A 3SHOA 1AHIA 1F2TB 2O3RA 4ZPXA 1ISHA 2VQ6A 4G97A 2O8FA 2F59A 2ASVA 2RBEA 1BFUA 1JYSA 1UBNA 3IC5A 4XXHA 4ZQBA 5DBFA 1VL2A 2C7OA 5H4HA 1FMCA 4I9FA 2Q9AA 2W98A 4P4UA 1SBZA 2JK1A 2CFRA 1E1CA 4R2KA 1BVRA 5DCYA 1OREA 2JGLA 1R5NA 2IE0A 3S2EA 5KU7A 1J0DA 4MB0A 4CMEC 5IJ0B 5LQDA 3KHKA 3B8HA 1FDTA 3EZ7A 1KY3A 1RLMA 3MELA 3MTQA 2Z57A 3P8ZA 4OATA 1J0EA 3GAMA 1U7PA 2HN9A 4QLAA 1Y63A 3H2HA 3HNOA 4V0SA 4WESB 3LCJA 4EI2A 4ZYWA 3H9EO 3F9IA 4X3PA 1D2MA 4HBZA 4B7UA 3G0HA 4MJLA 2PCJA 3OZEA 3RM3A 3DTYA 4KUEA 4XPIA 5EIFA 3X1JA 5C37A 4CLHA 4QM6A 4DEVA 5FO0A 3MPUA 1EM8A 1K7EB 3GNLA 4L9WA 5L4NA 4I2VA 2QPLA 2G76A 1KEVA 1HSZA 2E55A 3I9JA 4CMAA 5UKDA 1C50A 3N2KB 3H5VA 1W4AA 2J5QA 3BCRA 3RS9A 1IK4A 4IIYA 3ODPA 4HGZA 3OT1B 3R09A 5BYBA 1B8OA 1MDBA 3R9KA 1RXWA 5D5HA 3KKEA 4K9LA 4YJFB 4R5MA 3QVGA 1K75A 2P2GA 1Y37A 1XCJA 1RFLA 3BJEA 1D5WA 1GGJA 1LPOA 4QDXA 3S68A 1ZICA 4BWFB 4IJ5A 2RHCA 2WF8A 2WV9A 2ZPUA 1XXHE 2ENUA 3R3ZA 4QYSA 2ERYA 2Y1DA 3LF2A 3QEMA 4EAQA 2BFAA 1T6YA 4NI5A 1XAIA 4BC1A 4RWZA 4GICA 3LX8A 3ML1A 5F2EA 3WG9A 2UUPA 4P80A 4F92B 3DEIA 3NATA 4UBKA 3EBOA 3RVJA 2M2IA 3M6LA 4IJWA 3TQQA 2ESRA 2EC5A 3NWPA 3NYIA 1R18A 2TRSB 2GYVA 2GCOB 2XXJA 3OQOA 1MJGM 1JBEA 1KZ4A 3AOEA 3V3KA 1IDOA 3L07A 1BXRA 1TVKB 4JKOA 1VMAA 4TQUS 2FUKA 4ZYZA 2XNJA 4CU2A 3SDBA 4MIEA 1NBWB 2X1HA 1GTVA 4I2NA 2JLRA 4ZHQB 2P90A 4OFZA 4J0DA 2WTBA 2EQBA 1KTVA 3JQAA 3C2QA 3FMGA 1F6WA 5IXSA 1X8LA 2C88A 4TL7A 1YR6A 1GL9B 3FJOA 1EP3B 2HDOA 4IVQA 1NNUA 1RYMA 3N6VA 1DTWA 3C3DA 3LX5A 4HATA 3UMVA 2WFAA 5F5NA 2LCFA 3ZQKA 3HUEA 4DLTA 3B3AA 5LJIA 3AVUA 2D2XA 2IEGA 1G7CA 2KI5A 5AW5A 3SSNA 1VDZA 1UBJS 4FGLA 5KJ1A 4DJDC 1NU6A 2DFLA 5F33A 5IK2A 1LWNA 1OZGA 5KNDH 1JQAA 4YDRA 3RT7A 3GX1A 1IQRA 5EJGA 3OCCA 3KNZA 3F6RA 3KOXA 3OAAA 2A9KA 2Y77A 1EIZA 4PWZA 1PU2A 2ZYGA 3JZFA 3UAXA 1KO7A 4E22A 5ICCA 2YVUA 4BLOA 1MIHA 3WFIA 4B3XA 2WAMA 3D6AA 1ORRA 3QK7A 1P2DA 4BL5A 1I3CA 4M4SA 2WF7A 2HO5A 5AKIA 2M98A 2DEUA 3Q6NA 4JDPA 1XQXA 2CVFA 1H3FA 2ADFA 2V6BA 4M0UA 4YI5A 3WGUA 4AY2A 4KAAA 2RH9B 4WKOA 3FBGA 5JXIA 3NASA 3BFXA 1DZ3A 1VLVA 2H92A 3RVOA 1QE0A 2X15A 2XBLA 1JVBA 2IY7A 2CE2X 3IE0A 1XN4A 3ORFA 4KAXA 3L8GA 4PPFA 2O3JA 4NS4A 4B3HA 3IIKA 3N8IA 3FSGA 3GLHA 3AFMA 3NTLA 1DC5A 3RSSA 4NOKA 3T06B 4D8UA 1N6HA 4YYZA 4G0MA 3TGWA 4DLZA 2CCKA 3HADA 3ZNQA 1T9GS 3LJKA 4EGFA 1T8WA 3ICEA 2BRUA 2ZRBA 3BHNA 3KFLA 3Q8MA 1H2YA 1GVNB 2I9PA 3A37A 2HNKA 4J29A 1AZSC 4QQKA 2FXIA 3ZE1B 4G23A 3C7TA 5LOVF 2C5BA 4DJAA 1SXJE 3AG6A 2C0CA 3OLCX 3VR5D 5C5EA 4R2MA 1Z2NX 2PX2A 2CLHB 3QE4A 3DFZA 1CQJB 1J2JA 2Z4RA 1TVCA 4FLFA 1QVWA 1TEVA 1U2SA 1ORWA 2P6OA 4XM1A 5BO5A 4IHQA 1V5WA 3D6TB 5I9BA 3IJEB 1NVWQ 4ARZA 5LWQA 4UE3S 4LS3A 1AN0A 3E9CA 3PF8A 5AKYA 2VAMA 3PD0A 1EUCB 3E9RA 5HM8A 1AUQA 3CX4A 4QWMA 1XA0A 2QTCA 3QA3E 2I8CA 4DEXA 3RSOA 3HXLA 1C4WA 4K6KA 1IOZA 1UDAA 2CMHA 1JA1A 4FW9A 2JI8A 4Q24A 4K05A 1RRCA 4ENTA 4U5QA 1ZHHA 4RD1A 3N0RA 5DLYA 3CRVA 3L18A 4I1IA 4E14A 1ECPA 2TECE 3K9HA 1S2LA 4O4JB 1KMMA 2FJPA 3ETHA 5IC5A 2IBMA 3CR8A 3KO8A 4JGBA 3UGQA 3VYRB 3WRYA 1Y4DE 1TK3A 1WP9A 2EX4A 3QEKA 4S1WA 3P2JA 4MAFA 4OQZA 5TB5A 3U4HA 3KTOA 5CGQB 2CCJA 1OLUB 1YKGA 2C3PA 4RVOA 3I1YA 4FWTA 2DHCA 4KO4S 1FFYA 1XMJA 2BEUA 1JLLA 4E5VA 1P0IA 4OLAA 1EEHA 2XTAA 5SZJA 1HEIA 3FROA 4X3CA 3A9SA 2LIVA 3NHSA 1G8HA 1GLGA 1QNLA 2D1QA 3EXFA 2I91A 4EGAA 1MO6A 4GDFA 2BZSA 2PMBA 1W88A 4R1UA 4BEWA 3CNEA 5LQMA 2EKPA 3RROA 1JWAB 5EHZA 1CG6A 1P4JA 3C7AA 4BX9A 4RKQA 3WNZA 5LQKA 3WYGA 3AM1A 2C8JA 4B9EA 1FE8A 1GARA 2M6LA 1ULSA 4ENSA 1XRNA 4KW7A 5BVGB 5ADVA 4L0MA 1ONSA 3QLUC 5C34B 2H7VA 3PT9A 1ZRMA 3DMYA 3SR3A 4PG6A 3O1LA 1BRTA 1T5TA 1P9WA 4P3OA 1C7RA 4TSRA 4I5DA 5KNDD 3MAGA 1U1DA 2C2YA 2EWWA 2WM8A 4RZSA 2ST1A 1R6XA 1M8JA 5A7GA 2W2NA 1P62B 3HB1A 1TEHA 3H0CA 4CCYA 1Z35A 1B8NA 3SM3A 3F71A 4LJAA 3MUNA 1ADCA 1IRIA 3ISVA 3RSHA 3IA2A 5FTMA 1GN9A 4BNYA 3GGGA 1NUPA 2GYUA 1GAWA 3K71B 1E4EB 1Z16A 2J09A 1KAQA 1MX3A 1OFUA 1O89A 3KKNA 1IJBA 3LO5A 1RWNA 1SCQA 4U0JA 3PHJA 4PC2A 3BN3A 1HY3A 3PPIA 4N48A 3H1FA 2HCTA 4UUAA 4CT0A 3EXIA 5KREA 1P6QA 2WSLA 2NG1A 5KYVA 4BLQA 1PNOA 1LBHA 5B58C 1PVVA 5GM1A 3ZI0A 3FGPA 1CJKC 2Z8YM 4OB7A 1EFVB 1NOJA 1KZHA 3W79A 2HWXA 2Q4EA 4XCQA 4IIBA 3I01M 3TFWA 4EATA 3A31A 3HC7A 1N6PA