3U3MA

Crystal structure of human sult1a1 bound to pap and 3-cyano-7-hydroxycoumarin
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
289
structure length
289
Chain Sequence
TSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 103
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3mA00
2AWNA 1F48A 4QNMA 2ZSFA 4A36A 2ZS7A 3IQXA 5FPHA 3GLHE 3ASZA 4RD4A 3HPQA 1RKBA 1XZPA 3T1TA 2JLSA 3BB4A 3H4MA 4J0QA 2GK6A 3RSLA 2W6ID 3TIFA 3CRVA 4NH0A 4MGKR 5HE8A 4M1WA 2WJGA 2YWGA 2IL1A 5EUMA 4O2RA 2ZRNA 4PR0A 2VP2A 5A4JA 4Q4HA 2JJ1D 1ZM7A 5J4KA 1J2JA 3ZVNA 1XD2A 1MO3A 4BLQA 5FPYA 1J8YF 4QGAA 4Q4AA 4JVNA 1G5TA 2JJ1A 3SQXA 5HZHA 3DM9B 2IF2A 4KVGA 1JAHA 1RVDA 4RKEA 1FW6A 4FW9A 1HH4A 2VBCA 1P2VA 4GMDA 5DN6A 2KBEA 4QM6A 3C7KA 4IFBA 4R98A 4RD1A 4ESVA 2HEIA 3PUWA 3T06B 4B3DA 3BB3A 4DCUA 3UIEA 1OFUX 1QHNA 5FL3A 1OH8A 4Q18A 2H8KA 2QMHA 2B21A 4DCVA 1E0KA 2DWPA 1M2OB 3BH0A 3D3QA 1DO2A 2A2ZA 1M34E 1ZM2A 3VR2A 2VHUA 2ZTSA 2CHGA 2AXPA 4QOSA 4RVCA 5H68A 4ILEA 3TE6A 2NO7A 1RRCA 2FDCA 2JLWA 3QF7A 2GXAA 2XB4A 3A4MA 2CLSA 4ESHA 5KNDA 3K09C 2PZGA 4Q5IA 2H17A 3RANA 3KDSE 4JBXA 3VKGA 2A5YB 5DHFA 4PC7A 2ZU6A 3PCRB 1QRAA 1G3UA 4OKSA 3SC3A 1EWRA 2E1RA 4TYQA 4A8JA 2WJVA 4QC2A 4ZDJA 3S1AB 4AG5A 1DTSA 4TT3D 3CKLA 2OEPA 3C4JA 2C96A 4BEJA 4HDCA 1KNXA 1K6MA 2XXAB 2OBMA 4OHWA 2G3YA 3CH4B 3NTUA 2R6DA 4M9SA 1AIPA 3G5UA 4UNRA 2PH1A 2G83A 2I3BA 5EJEA 4HAUA 3EPLA 1G7RA 4OQLA 1N25A 4PFSA 1IAQA 1Z6YA 2BEKA 5IF9A 3CIOA 1DPFA 2CK3A 4Q9LA 2RGXA 1UADA 3SHWA 4URZR 1WE2A 4I99A 1UKZA 1XB2A 1XEXA 5H70A 1QHHA 2ZJYA 5IDVA 1PUJA 4N3NA 3QXCA 4KODA 3I32A 5JHGB 3WYGA 2PLRA 5F9HA 4IVQA 4JLAA 1E0JA 4CT4B 5DN6D 1IN6A 2P5TB 2ZJBA 1I2MA 4M2LA 4V0MA 2PZFA 1V43A 2P6RA 1YJ5A 1ZD1A 3E70C 3U44B 1YR9A 3REFA 3ZJYA 4D81A 1J99A 2IUUA 1R2QA 3W34A 3CF6R 2WVJA 1WBBA 5L3SB 1E99A 2BM1A 4M9QA 1S9DA 3WHKA 1W36B 1UDXA 4EAQA 2HCBA 1E69A 4CGZA 1ZD8A 4YDHB 1E9BA 3V9PA 3VX4A 1FOEB 1KAGA 1ZMXA 3ZVLA 1KO5A 2IYSA 2DB3A 1M7GA 3ZZTA 1T9HA 3DDCA 2E87A 2PL3A 4KYIB 4PC3A 3RRNA 3SZRA 4LBWA 2YV5A 3QKUA 1GWNA 5HR5A 1MR3F 2YKGA 4IXNA 4NKRA 4KU4A 2OILA 2Q21A 4OI4A 3SOPA 4TL7A 4Q21A 4NYMQ 5JJKA 1QHIA 1JR3E 4LJ5A 1OXVA 4Z8YA 3SYLA 1T4GA 1XMIA 2JJ8A 3RNLA 1Q1QA 4DDUA 2IC5A 3REGA 3ADCA 5JJLA 5G3ZA 1Z6XA 4OJQA 3RWOA 4A82A 2XITA 3MGCA 1DO0A 3P1JA 3QKRA 5D3MB 1C4OA 2QBYB 3L2OB 3PVSA 1N6IA 4DLRA 2G77B 3OIYA 1AGPA 1TPZA 3U4QB 1G1MA 5K8IA 1E1QA 1OE0A 3RRYA 4H1UA 1TL7C 4QNRA 1BKDR 1ETUA 3F0TA 1E1QD 1Z47A 1SXJA 2FX3A 4C0SA 1R8SA 3GLGB 5G41A 2Z5FA 5TB5A 4M21A 3LFUA 3JVVA 4WA7A 3BXZA 2W0MA 3PXGA 1L4UA 1VG0B 2NPIA 4KSCA 2VH5R 5J5CA 4PQRA 4FWTA 1R10A 1UBCA 3X1WA 4DEYA 4CEIB 2BCGY 2VIIA 3KKMA 2X2FA 3AUYA 2PLFA 1RW4A 4KFTA 3T15A 3OIVA 4C7OB 1CULC 3RS2A 2HF8A 3KTAA 2VP4A 1E2NA 2IWRA 3V4FA 1F2UB 2ZRKA 4ZO4A 4ZCMA 5HCNA 5L3RA 3Q85A 3O8RA 1SVKA 4IVPA 4LV5B 2FGKA 2OLKA 1EFRA 3IUYA 1GRNA 1XTKA 1S9HA 3AP3A 1F6BA 3AP2A 1FMLA 4PSAA 4B3CA 2QGNA 4URVR 4HLUC 2F9LA 4X8OA 5DLQC 1IN7A 1Z29A 3SFVA 3CRQA 1I4TD 2OFWA 1Z0AA 2W6JD 5AUQA 5GJCA 4A2WA 4LHWA 5JWRA 4P4SA 3U3OA 2PEYA 1J90A 2GZHA 2ODWA 1Q44A 3B82A 2NQ2C 5FBRB 2VL7A 1DAKA 4TL6A 3FGNA 1FNMA 3QVVA 4HB3A 1U9IC 2IYZA 4MKIA 4W9MC 1OB5A 1CJMA 4QM7A 1Y3AA 2A5FA 3KFVA 3C16C 1W7AA 2ZRAA 3IEUA 2ZREA 4AI6A 4D0GA 3PEVA 4LGMA 1XTQA 1VCIA 1GRRA 2DWQA 2ASEA 1KDPA 3LNCA 2VHJA 4JBYA 3SJAA 2X2EA 2HLDA 5JZVA 5ELXA 2WJHA 5BW8A 1IHUA 3CB4A 3RRZA 3ADBA 1KI6B 1OIXA 1G18A 4RY2A 4LJYA 1R0WA 2AN9A 2QMUA 3BGWA 1E2GA 4AYXA 5EXSA 2ZYWX 4FMBB 1HUQA 4I1UA 2QUZA 4JLBA 2FFAA 2WKRA 4LYAA 3RRMA 4NCNA 1R8QA 1YHNA 2IHYA 5KDDA 1XTJA 1G3MA 3PV0A 2RCNA 1EX6A 2UZIR 4TSFA 2WIAA 2AL7A 2ANBA 2GDJA 2WJJA 1WXQA 4BECA 2XNDA 4D0LB 2UZ3A 1W46A 3U2QA 4KBGA 3ONWA 1OH5A 1SVOA 4RD6A 4M1MA 4H1VA 4JZKA 2AK3A 1E2QA 1M7HA 3NBZC 4TQAA 4AK9A 3PEWA 2JGNA 3SYKA 3QF4A 4LUCA 5JCPA 4PX9A 3R7WB 4GZMA 4OL0A 2VA8A 3AH8A 3PEUA 3UPUA 1FPMA 4AY2A 2W00A 4PSKA 2F43B 2HXYA 4HUQA 4PHHA 4PHGA 1W49A 1W4RA 1ESNA 4B43A 3SFZA 4CZ2A 2IYVA 2OG2A 4L16A 4YMWA 1N0UA 4Z51A 3G0HA 2QRNA 1IBRA 1KO8A 5FR1A 3TQCA 4DLXA 5KPJA 1VECA 2ZEJA 4QBGB 3E2IA 3LBIA 1XXHA 2ZI5A 2DCUA 2P67A 4C9BA 3LA6A 1JXMA 2F9MA 3BWDD 3C15C 1G7SA 4TLAA 3TVDA 1XPUA 1DAFA 2W2XA 4S35A 3FTQA 2O8CB 4LHYA 2TMKA 4UJ3A 3ZZUA 2SHKA 1NY6A 1RYHA 2XZOA 4TMXA 5P21A 1U9IA 5FTJA 2ZPTX 2OCPA 3IQWA 4TMTA 1Z0FA 1W2GA 3T1OA 4PAMA 4B2PA 2WKPA 3WMGA 1XJQA 1LY1A 2FZLA 2WHXA 5E7MA 1U0LA 1N2CE 3DEFA 1YRAA 2ZRHA 5JS7A 4FCTA 2D2EA 4YMVA 5JCZA 4JVLA 4PXAA 1TQ6A 4AD8A 2FNAA 1X8JA 5CYOA 1XTRA 4UNPA 3FMIA 5DYGA 4LJAA 2AK2A 4M4SA 1ZIOA 4UQOA 3VTKA 4HEJA 2EWVA 1XCGB 1FX0B 3AKCA 2IS1A 2QPOA 3P4YA 2GEDA 1R7RA 2GVDC 2YHSA 2YJTD 1NKTA 1E2MA 4P33A 4FN5A 5GVRA 4MKHA 1LS6A 3EX7C 4YLGA 1TADA 2F1RA 3AKDA 2R65A 1NIJA 4IKEA 2R9VA 4KXFB 1FP6A 2VLIA 3ND8A 1NJFA 2MSDB 4LX0A 3KQUA 2OO7A 2C04A 2C2HA 3KQLA 4Q7LA 3KJIA 4BRWA 3HWSA 3C5HA 5FOWA 5JS8A 1D9ZA 1ZUNB 2WWHA 3X2SA 4LYHA 4EUNA 4F93B 3K70D 3KQNA 3RLFA 2BBOA 3A6PC 2FSHA 2N46A 1ESMA 2QGZA 3I62A 3GLHA 1OHHA 3VKHA 3EWSA 8OHMA 3FMOB 3B1VA 4XD7A 5SZIA 1I4DD 3DMDA 2CNWD 3AF4A 3CLVA 4Q7KA 5FBLB 3CNOA 5GVSA 1JPNA 3NH9A 2V1UA 2Z4RA 3IKJA 4DDVA 2ZR0A 3QPUA 2YOHA 2ZJ5A 2LWIA 2ZRDA 1WRBA 2YYZA 4ARZB 1DADA 3K9GA 5EP1A 2OZEA 1S3SA 1KY2A 4JLVA 4ZIRA 1OJLA 2IW3A 1UBFA 4BQSA 1KJZA 4HB0A 4Q00A 1RFLA 3MCAA 1LVGA 4DBLC 4RJLA 4G5OA 3RS7A 1COWD 2I1VB 2NO0A 3IO5A 3KQHA 4C0QC 421PA 1ZVQA 4TL9A 1C1YA 2H18A 2V9PA 3R20A 1U81A 1Z2AA 4OK5A 4LHXA 4URUR 1SVSA 5FUWA 3OHMA 5CK5A 4CF7A 1GILA 2OAQ1 4HZUB 5G53C 2W83A 2WPDD 2A3RA 3FB4A 3CUEF 4TL8A 3T5GA 2EFEB 5IT5A 2ZU0C 2O8BB 4B3BA 3W90A 2G0NA 1OIVA 4NL4H 4MYHA 5BQ5A 4KCGA 1Z08A 1S3GA 4HUTA 1S8FA 2PCLA 2PEZA 2R2AA 2XOKD 3H0KA 5JWHA 3LDAA 4CEJB 1M74A 1WBDA 4P3YA 3B7GA 3Q5DA 1P3JA 3B8HA 4F38A 4BRUA 4DDWA 4Z54A 4TLBA 3TW4A 1G9XA 4KI0A 2RGCA 3GJ0A 5AUNB 1W36C 5LB4A 4B34A 3BBPA 5KUTA 5DH9A 3A1SA 1Z6GA 2XJ9A 1M1YE 1UEIA 4OHXA 2QP4A 1FMJA 2GXSA 1MKYA 5FUYA 2QZ4A 2Q9BA 2NO6A 1MO6A 1GKYA 4MGZR 2BCJQ 1N5JA 2QEQA 2J9RA 5DI3B 2NO9A 2B8WA 1IQPA 2IYTA 4JL6A 1AS0A 2ZYTX 2ZYUX 3QOFA 4AYTA 4U00A 3NEYA 1A5TA 2FSFA 3PENA 5ANRB 4L5BA 5EP3A 3K1JA 5FTKA 1E4VA 2WIBA 2CVHA 3VMFA 1L2TA 2GJSA 4ASUD 4JKYA 1EFTA 3T61A 3MLEA 1OYYA 1R5BA 1ZNZA 1NBME 4LBYA 4E07A 1D2MA 2P0EA 3L8YA 1TU3A 2QAGB 3K0EA 4RKFA 2GJKA 3K0FA 1YZUA 2GRJA 2QAGC 4CEHA 3LWNA 1YE8A 1JBKA 3X1ZA 3LVRE 4DXAA 3EIHA 4PO1A 3DL0A 3H1TA 2MMCA 1TNDA 2IYQA 2R62A 4LJ4A 4E03A 2O8EA 2AFHE 1Q1ZA 3HU2A 3FFBA 3W5IA 3D31A 1NN0A 1DE0A 2D74A 2B92A 5TVKA 3FVQA 1CRQA 4CEHB 1RZ3A 3K0FB 4YONB 3ICEA 2AWOA 1W47A 4JLOA 1Z63A 1G8YA 1WMSA 1X1SA 1CJVC 1UKYA 1KAOA 3OESA 2HUPA 4TN1A 1YR6A 2ZUCA 2NZ8A 3FMPB 3I8SA 4KITB 2VHTA 2ORWA 3WP1B 2EYUA 2ZE7A 5KSYA 2ZRMA 5LB2A 3KZ1E 5K8TA 4W5HA 1OFIA 2EU8A 3C8UA 1JAIA 1EG7A 1GL6A 1FZQA 3RABA 2FOLA 3QIAA 4GT1A 4L9WA 1QG4A 1GM5A 5KOYA 1ODFA 3EIQA 4TWZA 3W8RA 3NIBA 1VCNA 2CJWA 1BOFA 4V0KA 4TLEA 4OQMA 3SE0A 1V5WA 4BLSA 4BEBA 2O8DB 1XJCA 1FNNA 4KFSA 4L15A 2QE7A 2JAQA 2DFKB 1X86B 1N5IA 4B71A 4DVGA 5K8UA 1AS2A 2ERXA 1E9RA 1X3SA 1TAGA 1VHLA 3TLXA 3WNBA 4C0JA 3WMEA 1IY1A 4D82A 3U7HB 4V0ME 2BC9A 4YXWD 1Z8FA 2Q3MA 1CXZA 1DS6A 4GI7A 1U8ZA 1KI4A 1QZXA 1N3BA 2CLCX 4A2QA 3VR5A 3AGQA 2IYYA 4UXHA 3ND9A 4IDHA 4A1FA 4XSHA 4L9SA 2FE4A 3CRRA 1CR4A 4LJ9A 2O8BA 1G64A 3CBQA 5J4VA 2PMKA 3FKQA 4MRSA 5BN5A 2GF9A 4OHVA 1H8EA 1Z0JA 1OF1A 2IXFA 2O52A 1W36D 5GADl 3R8FA 3M0EA 3FHTA 3TUJC 3FOZA 1XEWY 4KAXA 3QKTA 1UPTA 5DE3A 2ZRBA 1XFAA 2FFHA 3TBKA 1GNQA 3NWJA 5CDFA 1E6CA 1EX7A 3DOEA 4B75A 2FPKA 4FCWA 1GTVA 1US8B 4EQ6A 3L8ZA 1GRQA 1J7KA 1MABA 4JLKA 4JSTA 4MH0R 4ARZA 3TUZC 1KSJA 1CR0A 1S0UA 3KUDA 1KKLA 4BLOA 2FSIA 1AA9A 4M1TA 4B2IA 2KB0A 4RFVA 3OEHD 3AVVA 4PZZA 1W0KA 4HATA 5FTLA 3O8BA 2F7SA 2CCKA 2QA5A 2F3RA 4KVAA 1LV7A 1E3MA 3GLHB 4QJ3A 3MFYA 3THXB 4GP6A 2RGDA 3HYTA 4YXWA 3SN6A 2O5VA 2P5SA 5C2JB 2D7CA 4Z8XA 2PJZA 3GLIA 3BFVA 4EPWA 3SR0A 2RAPA 3W6PA 2GCPA 1Q1BA 2ZVQX 1XRJA 1GZSA 3BFXA 2CBZA 5AR1A 1G3RA 1U90A 1N0VC 4URWR 3UWKA 3LV8A 4I1OA 1P62B 2HJVA 4GMXA 4BE7B 1XPOA 2MSCB 3OEED 3C5CA 3HR8A 4WW0A 2Q9CA 1EK0A 1PLKA 2BHRA 1E0SA 1TU4A 2X1VA 5CM8B 4U7DA 1H8ED 1FX0A 1TUEA 2F1HA 2FGJA 2O8DA 1JPJA 3WBJA 2HF9A 5JEEA 4AKEA 1VIAA 1G41A 1JEEA 2XAUA 4JIMA 1P72A 1NMYA 4XTCS 4DSNA 3B5JA 3RDPA 3GJ7A 4A2PA 1HE8B 1Z0IA 2QPTA 1I4LD 4GZLA 4QGGA 3FDIA 3I4LA 2XNSA 5KNBA 1EFUA 3FFAA 2F55A 4Y0VA 2DFLA 2F3TA 1Z06A 3CPJB 1JEDA 2CL7X 2PZEA 2ZS9A 1WDTA 2FZ4A 2JLRA 2XTNA 1D2EA 4G5GA 4Q48A 3NC1C 1E2PA 3DM5A 4LOAA 3M1IA 1T3SA 1PJRA 1C9KA 1KJWA 1KK0A 2GEVA 1AZTA 2OFXA 3AP1A 3GCGA 2ONKA 3OEHA 3CO5A 4XVQA 3QKSA 4TYWA 1AQUA 1DOAA 3FMFA 2EYQA 3B1ZA 2WWIA 4NPHA 4PC1A 5EXXA 4GPTA 1AQYA 4FCVA 4GL2A 4Q1AA 3CF0A 3F3YA 3TUIC 1OKKA 3P27A 2O8CA 2VSOA 2J0UB 2ZIAA 5IK2D 1MH1A 1Q3HA 2C78A 2QP3A 4LJ8A 2JCSA 4A9AA 3N2EA 5DIFA 1OKKD 3Q8XB 4IVRA 5DHAA 4DLTA 3K53A 1XXHB 4IOLA 2RGAA 3LBNA 4NTZA 5E3HA 4BGDA 3AVTA 4DUGA 2ODNA 4UKDA 5FTNA 5EE3A 4TYNA 3OE7D 4KYUA 1G5PA 3K0AB 4ZPXA 3GD7A 2ZRJA 4IOJA 2Q3HA 4URYR 1II0A 3WRYC 4DCSA 2C8VA 1XDBA 1OHHD 1XTIA 1P73A 1CJUC 1ZC3A 2F43A 2YNMA 4LJ6A 3UANA 4IEEA 4NHOA 5BYKA 3TQFA 3AEZA 3F8TA 1G19A 3NDPA 4K8OA 4TYYA 1KY3A 4DIDA 4HLUA 3P32A 5E7JA 1S1CA 4WOPA 2ZRGA 4A8JC 2FV8A 1NN3A 1X8LA 1OPXA 2KSQA 2ZITA 4Q19A 4XJXA 5HE9A 3WYAA 4MDEA 3K09A 3K70C 3M4YA 2C99A 2I4IA 4US2R 1KYIA 2ZRCA 3SJBA 3L0OA 3LXXA 3K70B 3K0AA 1J70A 3CNNA 2HCJB 1FL9A 1NVVQ 1DAHA 4PPNA 4ZDKA 3R9XA 1H8HD 2OFOA 4C0LA 3NG1A 2VYFA 5B30A 2NTYC 3QPVA 2REOA 4V02A 2VP9A 4S2EA 1UJ2A 4XH9B 1T8TA 2MMGA 5KDOA 1OH7A 2V3CC 3LLUA 2OE2A 1NLFA 1NI3A 5C18A 1JB1A 2J0UA 2W2VA 4TYPA 4DKXA 5IK2A 3VNUA 3ZVMA 2EWWA 3WXMA 1KK3A 4DDTA 4HZIA 1EWQA 2YC2C 5EUQB 2V1XA 4GNKA 1W4BA 5CB6A 4G5RA 1LTQA 1YZTA 4HI0E 1ELOA 1WCV1 2NO1A 4LRWA 4C0HA 4Z1MD 1AM4D 1OT3A 3QKSB 2OESA 4EPTA 2W2TA 2RGEA 4HAWA 1NVVR 3CPEA 3CH5A 3IIMA 1T0HB 4DLYA 4LC1A 4RZ2A 4A6XA 4OJKA 1ZINA 1JR6A 1VYTA 3VFDA 3ZS9A 2CHQA 1R0XA 1S2MA 5FBVB 2GAAA 4NCKA 3SU8A 2BVNA 2J3EA 6Q21A 1F3OA 4BFWA 5CITA 1N5KA 3T12A 1UAAA 4WZ6A 1KTVA 4M1SA 1XD9A 2V55B 5BN3A 4TQUS 4NCIA 4DC9A 4TZ6A 3N5CA 2QQEA 4LSGA 2ZUDA 3GFPA 4P4SB 2JIZD 3RC8A 3W6OA 3N2IA 3QENA 1NVUQ 4A0RA 1ZCAA 4OHZA 1R0ZA 1R6BX 3ADDA 1SGWA 1XZQA 2AXNA 2CMKA 4N0EA 4WIAA 4IOKA 1RRGA 4R9UC 1ONBA 3HJNA 3IEVA 4NYJR 3NBYC 4PPQA 4F91B 4ZV4A 3K0CC 4JJKA 1G8PA 3ZZ0A 3GLIB 4RZUA 4RD2A 2QL6A 2YOFA 4NBSA 3VR1A 5SZHB 4NYMR 3AGPA 3THXA 5FI1B 2RMKA 3KQKA 1W2HA 2CVFA 3OIUA 2R44A 2DYKA 2OT3B 3KB2A 5J47A 3X1DA 2EVWX 1ZU4A 4BWYA 4C7OA 4LWZA 4MRPA 2E9SA 1UKVY 4GDFA 1OXSC 4EPYA 2WTUA 3A37A 4Z1MA 4N1AA 4CEIA 4KO8A 3T1VA 5EP4A 3U5ZB 1JI0A 1WA5A 2V6IA 4AWXA 2FFBA 5BYJA 2BMEA 2XX3A 4NYJQ 2GXQA 3MWKA 1TEVA 3RVBA 4B73A 1PZNA 4IEIA 5KPDA 1MABB 3R9WA 1US8A 2KE5A 2YINC 4AIIA 4EQ6B 4E09A 5K8LA 4Q47A 3VR4A 5KU1A 2FPLA 5M04A 4W5WA 3CM0A 4XVRA 4OK3A 2IS6A 5EZ6B 3AKEA 4B44A 1H65A 4G1UC 3NDBB 3AVXA 1XNJA 3DMNA 4M9XA 4ZI2A 1KNQA 1UDWA 2ZAOA 5TXGA 2AX4A 5FFMA 2IA5A 3SS8A 2GF0A 3QQ5A 5LD2B 3FKSD 4BLPA 4CVNA 4EFMA 2DFTA 3OAAD 3QBVA 5D3MA 4IFEA 4EFLA 2W6IA 1ZNYA 4P31A 5DGXA 2GAOA 3IBYA 2RGGA 3OAAA 1S1MA 2QNRA 2GCNA 3IDQA 3TMKA 5KNCA 1CKEA 4HDQB 1J8MF 4KLNA 1E2IA 3AVPA 4LPSA 3ZDQA 4XD7D 2BKUA 3MJRA 1ZD9A 1BMFD 2ZANA 5CJ2A 3AVOA 4TTQA 3PEYA 5EZ5A 1G8GA 5AK0A 4ZKEA 2VP5A 4DLWA 2QG6A 3B13B 2CCJA 2V54A 3QXHA 1E4YA 2VRWA 3SDZA 4Q66C 2AR7A 2WMOB 2WV9A 4QJ5A 1QG2A 4X8LA 5IHPA 2CJWB 3ETLA 5FL7A 1W5TA 4UNSA 1COWA 4BUJA 1N6KA 3TSZA 1PLLA 5JFGA 3U3MA 3AF1A 4PC6A 2QTFA 1KSHA 4NCHA 2GXUA 5AWFC 4EPXA 3J81k 3PUYA 1ZYUA 5FTMA 2H57A 2ZRPA 3P20A 5L3SA 4LBVA 1VYUA 3KXKA 1UM8A 5KSZA 5JWOA 1VMAA 1AGRA 4TMZA 4RCZA 5FR2A 4A0FA 3U44A 3EC2A 3WMFA 3GP8A 5EE0A 1XXHE 4KV9A 1E2EA 2XOKA 3TW8B 5JI3E 1SHKA 3DPUA 3K8YA 4PHFA 2Q3FA 2VEDA 5FOXA 3UMSA 2ZRIA 3EARA 4PANA 3PQCA 2QM7A 1E9DA 4M22A 3RS0A 3CZQA 1G4AE 4B3GA 4DJTA 4M8NE 2O8EB 4UXIA 3MAAC 5CYPA 4NE2A 5EE5B 1N6HA 3GJ3A 3PG5A 1LNZA 2C5LA 4BASA 2AHOA 1ZRHA 3NBXX 4D0NA 4C0AC 4FMCB 4M1YA 2QAGA 2XZLA 2GJ9A 2J46A 3QNUA 4MUBA 2PJRA 2XEXA 4QBFA 2VF8A 2QRZA 2IEZA 5TMPA 3S1AA 1PUIA 1WP9A 3GJ8A 1FTNA 3LVQE 4A8JB 4XWOA 1G21E 2B8TA 1ZCBA 2EQBA 3P4XA 1A4RA 3I92A 2CXXA 4M0LA 2ZSBA 4HB4A 4AYWA 1GVNB 1NRJB 1JQJC 1XMSA 1BS1A 2BV3A 3HU1A 1HEIA 4YMTA 2ZSAA 1GIAA 4KBFA 5DYIA 1W0JD 5DI3A 4HLCA 1XBTA 2IT1A 1UKEA 1YU9A 2NPFA 1RIFA 4GBMA 1Q20A 2REXB 2BBTA 4BFXA 2ZJAA 4PAOA 1XX6A 3AKYA 4DSUA 4GSYA 1TQ2A 1QDEA 4Q9IA 1T3HA 2GETA 3CX8A 5KYKA 2ZJ8A 1L8QA 1KDRA 3IILA 1ZC4A 3NC0C 1RRFA 4MRVA 4BLRA 4B33A 1NMZA 1KK2A 3CR7A 2XTZA 2REBA 3CW2A 3FHCB 4ZDIA 1T6NA 2ZI4A 4CEJA 2JLVA 1KI3A 1ZUIA 1XD2B 2QU8A 4B47A 5FBQB 5IRCD 5HZKA 4Q4HB 1A2BA 1ZAKA 3FE2A 1KI1A 3SNHA 1CEEA 3KKNA 1XEFA 4NONA 1YZQA 3ECCA 3NEJA 1X8KA 5J4HA 4ZCIA 4G5SA 3TR0A 2ZR9A 2FG5A 3RAPR 4HZUA 1W1WA 1Z6TA 2YVUA 5C46F 2CEAA 1M8PA 3KKPA 1B0UA 1IXRC 1G6HA 3BAFA 1LF5A 3GQBA 2Y8EA 1SHZA 2HYIC 4UNQA 2AFIE 1M6NA 1DAMA 1OW3B 3AF3A 5FOVA 1DEKA 1Z5ZA 2F1IA 2QI9C 2VHCA 2IEYA 2QY9A 4QKQA 3CWQA 4ZIRB 1U0HC 2OCAA 3LAWA 3MWLA 2WAYA 5DSZA 2A9KA 4G01B 1W44A 4XWAA 4ASUA 5CB8A 1P6XA 2G0TA 1OV4A 1QHYA 3AVWA 2ZAMA 1DAEA 2AD5A 3T1QA 1EESA 3OIWA 3W3ZB 1DELA 1SKYB 4ZDWA 3L0IB 2GJAA 4B3FX 3KKQA 4IDQA 5J4YA 2ATXA 4MKGA 3LO5A 4MUAA 3TKLA 2QORA 2OUKA 1VDZA 2WSMA 3W8NA 3SQWA 5L8VA 1GL9B 1OIWA 2D7DA 3CNLA 2CE7A 3SJZA 5C4MA 2X19A 1E2FA 1VG8A 2DPXA 2BJWA 4R2IA 3NHAA 1E2DA 2BEJA 4DB2A 4BLTA 4US1R 2BWJA 1WQ1R 4B2LA 3WRXC 2AD1A 5FH9A 2GHIA 3BIFA 5BN4A 3EA0A 4TQ9A 2O0JA 4EFNA 1AKYA 3LQRA 1VHTA 1YZNA 5EXTA 1LFDB 4FMDF 1G20E 3HPRA 4X8HA 5JJIA 4D6PA 4YQFA 1VTKA 1JR3A 3MSXA 3Q72A 4RFSA 1T91A 2FF7A 2OSBA 5LD2C 1ZM3A 2NGRA 4Q9HA 1T5LA 3IHLA 4XTRA 4XVUA 3RS4A 5FPSA 5HPYB 4AKIA 2C03A 4WXPA 3SYNA 1Q1EA 1EFHA 3ZD7A 4N0DA 1P4SA 4JLMA 2GZDA 4AC9A 3PR1A 3WNCA 1G16A 2A5JA 2BMFA 4LHZA 2B7BA 2ZUBA 2XTMA 4RZ3A 5F2EA 4ZI3A 4CDGA 1XD8A 1YZLA 2IUSA 2VP6A 3MD0A 1QHGA 2X8AA 1U94A 5A5GA 5BXQC 4DLZA 5JECA 4TTRA 3BC1A 5C4GB 2XGJA 3BB1A 3I5XA 4BFYA 1FFHA 2ZSDA 2GNOA 4P4TA 4K81B 2JDID 3FHOA 4XWKA 1E2KA 1N0WA 2OXCA 3LLMA 3RC3A 1E0AA 3C14C 1MO4A 2JEOA 2ORIA 5AJZA 1HY3A 4E22A 2R6FA 4B48A 1E9EA 4Q4JB 2UKDA 1SVLA 1DG1G 1T5IA 2C9OA 3NH6A 1HV8A 1O3YA 3OZXA 2JA1A 4LV6A 4OQNA 4D80A 3TK1A 2FA9A 3MRSA 1BYUA 4XIGS 1F2TB 4ACAA 4B32A 4V0LA 4B3XA 5FUVA 5HCIA 2C9YA 2GJ8A 3TVTA 4Q7JB 1NKSA 2B7CA 4JSYA 2WZQA 2CLDX 2Q0HA 1ZM4A 3X1YA 1NG9A 4HUQB 1S4QA 1E2LA 1KMHA 5DO9A 2QM8A 5EXPA 3PIRA 1JNYA 1G4UR 4GP7A 2CL0X 1KOFA 2J1LA 3R7WA 3EZFA 5BWMA 3FYHA 3QF4B 2ZQ5A 2FFQA 4PPFA 1IY0A 4DWJA 4C30A 1IN8A 1XMJA 2VHQA 1W0KD 2PMDA 3PUZA 3KFXA 2CDNA 1NSFA 4JLNA 2ORVA 2YOGA 1VG1A 2ZI3A 2G9NA 4IRUB 4R2HA 2A5DA 4TMVA 3A1UA 3I1FA 4M1KA 4MGIR 3GMTA 2GZAA 4H9GA 3ZD6A 3EW9A 3O8DA 2BKEA 4V0OA 1E9FA 4DSOA 1GL7A 2J5XA 4FINA 4Q1FA 4BFTA 3NKVA 1Z83A 1Q3TA 2OAP1 4LYJA 2OHFA 4Q1CA 1E1RD 2J59A 1D6JA 3DKPA 3FKSA 4UXJA 3ZLJA 4JMPA 1ZU5A 2QENA 1P7CA 2RGNC 1TQ4A 4FMCF 1E1RA 3SBEA 4IXMA 2WSSD 1KI6A 1ZNXA 5AUPB 3EPJA 2XB2A 3LQQA 3E5HA 2GILA 4LCBA 3UXMA 2H1LA 1CJKC 4IW3B 4P32A 1Q22A 4Q9JA 2WWWA 1ANKA 1Z3IX 3H86A 4P4UA 4EJSC 1D8TA 2P3SA 2VP0A 2GKSA 4CRWB 3TR5A 1XMVA 3QVUA 3FWYA 4EJSB 4QBIA 1E9CA 2FH5B 1HQCA 1P9RA 2QSYA 2ZXUA 3VNVA 1KI7A 1GAJA 2IS2A 5TDHA 3NBFA 3ZS8A 2WWYA 3TNFA 2R6AA 4JT4A 3VU9A 3QPWA 1W4AA 3AM1A 2QT0A 4C3ZA 5CIWA 3BS4A 4WVFA 3CWZA 5HKKA 3EZ9A 1PV4A 5SZKB 3AF0A 1EXMA 1YR8A 2QT1A 2H16A 5KSOA 2NIPA 3GLFE 2RGBA 1GKUB 1AKEA 1D9XA 3GFTA 5J40A 4Y0AA 4DLSA 4TTPA 3W5JA 4HAXA 2L0XA 1TF5A 3RYTC 2QROA 1NNEA 2WWXA 1II9A 5CM9C 1K8RA 1T0JB 4CYMA 1F2UA 3QBTA 3ZIAD 1Z07A 2N1BA 4PHTA 1KSFX 2FMXA 1N6OA 2Z83A 3V00A 3KTAB 4PAQA 2ZS8A 3U3RA 5JHHB 3BH6A 1SKYE 1N6NA 3THYA 2VF7A 1ZJ6A 4Q1DA 1ZNWA 4O2LA 1QHXA 2GTPA 4QJ4A 2NZJA 1E32A 3UG7A 1KI8A 3Q9LA 4ON9A 1RJ9A 1E96A 2JLXA 1Q57A 1TEXA 5JLJA 1NBMD 2C9CA 4KFUA 4Q1BA 4JYCA 4DLVA 5L3VA 3GLGA 3E1SA 1SXJB 3WP0A 5LPNA 1MRNA 2QPAA 1OXUA 1TUIA 3KXLA 4TLCA 3AV0B 3GPLA 2D62A 4DSTA 1NN5A 1DAGA 3K9LA 3VHLB 5B58C 1IJEA 2WOJA 3QE0A 3QXJA 3U4QA 4MYCA 5FI0B 2FPMA 2PT7A 3KKOA 2QBYA 1DARA 3QKRB 1L7VC 4M9ZA 5CJPA 4MRRA 721PA 1DG3A 1W0JA 3BFKA 3K0CA 3AVYA 1G7TA 1P9WA 1WB9A 2O8FB 2JLQA 4TLDA 1NF3A 2OM2A 1H8HA 5JRJA 1TQDA 4RD3A 1XJ0A 4Q1EA 2ZVPX 2IHBA 2NG1A 2H5EA 4LJ7A 4IJMA 4OI2A 5LBIA 3EA5A 3EZ7A 4UJ5A 4NMMA 2WJIA 4EIWA 2J41A 3GLFA 2ERYA 3I61A 2OXRA 1NSTA 5J4LA 4RCYA 1OYWA 4L8GA 4OYHA 4IDPA 3JVUA 4Q02A 2XSZD 1FQKA 3KX2A 1Z0DA 5FPKA 2A78A 4ITRC 3B60A 3KXIA 3PFIA 2BDTA 3MG9A 2JIZA 1WF3A 5EQTA 1A1VA 2Z43A 4G0NA 4B6FA 4QFMA 3IBGA 2XZPA 4NP6A 3QEOA 3WY9A 5FOUA 2Q9AA 3ZQ6A 3IO3A 1U8YA 5GJBA 3U61B 1U99A 4QHTA 3UK6A 3LX5A 1G3IA 4C2UA 4JVMA 4QRHA 4DZZA 4RD0A 3UMFA 2G1KA 3WBKA 2V7QD 3THOA 2KWIA 2IUTA 5EP2A 4LC0A 1AK2A 1YVDA 5HTKA 5F3WB 3EPKA 4G5QA 3AB3A 4PO8A 2BJVA 1OXTA 1QHHB 1TF7A 3G82C 3LY5A 4DLUA 4HYYA 1XEXB 3KJEA 1HURA 2OV2A 1A2KC 1GNRA 2EFHB 1GKIA 2IBMA 3LW7A 1G7CA 4PZYA 3CRW1 1E2JA 2RGNA 1N6LA 2FEOA 2XXAA 1JQLB 4GOKA 3K0SA 3Q7QA 3U3JA 2IK8A 2RH5A 4F7WA 2QAJA 3IPYA 1K5DA 3DZ8A 3TSWA 2BIFA 2RKOA 1NVXQ 1KI2A 4D2IA 2A5GA 1T3LA 4F4JA 2JASA 2G6BA 3B1YA 2A7QA 4U02A 4A0HA 3OFND 5C1BA 3EIEA 1ZP6A 2QSZA 2IYRA 5KHOC 4GOXA 1XCMA 1SULA 3W9YA 1IXZA 2P2LA 1SVMA 4PQYA 4D4KA 1T8UA 2QTVB 4IDNA 3Q5EA 2HXSA 1G5RA 1HA3A 2VPPA 4F4CA 1YKSA 4B76A 4EKDA 2PT5A 2GBLA 1P61B 2DWOA 4TMWA 4URXR 4NYIQ 4JVSB 2DY1A 4JJZA 3X1XA 221PA 3V4RA 1CIPA 2D4HA 2J45A 4TT3A 1FUUA 1G8HA 5FOTA 4JYBA 3EASA 3A58B 3AQ4A 4HLDA 4YMSA 3U6KA 1QVAA 4Q4AB 1IXSB 821PA 1L4YA 3Q3JB 1NMXA 2PX0A 3HYRA 4BZQA 2MSEB 2ZI9A 1P2TA 4DIEA 3NXSA 2PX3A 2WWGA 1CU1A 4OQFA 4Q7MB 2K5UA 5E95A 2ONJA 4PTLA 4FD2A 4R71A 1P5ZB 5G40A 1AZSC 1II8A 1M7BA 5EE1A 1JXOA 4F4IA 1ZIPA 4LV8B 2YWEA 2GCOA 5JSZB 3DOFA 2IS4A 1E9AA 5E7IA 2W58A 4DHEA 3GEIA 4U5XA 4QHYA 5FL7D 1G291 2EFCB 2CE2X 3UG6A 1QBKC 4D26A 1NG1A 1R5NA 2WPDA 3B6EA 5E4FA 3D7MA 3I72A 5EE9A 2GCOB 2ZSEA 5JSZA 3NVAA 3EWAA 2H7VA 1YR7A 2QN6A 1GITA 1Q12A 1II8B 4D4LA 3F5FA 5F9FA 1VCOA 3AVQA 3SBDA 4HDOB 4B74A 1AJEA 4ABYA 2DHRA 4HSEA 2ZETA 4NDZA 4BZXA 1NL3A 5DISB 3EG5A 4C0KA 4AKHA 2QTHA 4I1SA 1HT2E 1U2RA 1XPRA 2J0VA 4LZZA 4ACBA 1KZ7B 4BFUA 2JLZA 1TF2A 2HT1A 3AVUA 1LF0A 2OCBA 3U6BA 1N6PA 3ZH9B 1SVWA 1HQYE 3T5DA 2ANCA 4CW7A 4WZBE 5JMTA 4AKGA 1W4CA 2BMJA 4ERNA 2RHMA 4LYFA 4BFZA 2R6GA 2O0KA 4F92B 2HV8A 1A7JA 1GSIA 4V03A 3QXSA 1G17A 1VIYA 3TSOA 1YZGA 1Z28A 2D06A 3C41J 2GESA 1IY2A 1NVWQ 3BORA 4GFDA 1NLYA 4I4LA 3TAHA 4O3MA 3THWA 2JLUA 1K5GA 1D2NA 3OEEA 1GUAA 2JATA 4JT2A 1KO1A 1SXJD 2LKDA 2V6JA 5L3QB 1Z2CA 4HAYA 4A6PA 4YMUA 2KBFA 1QF9A 1UBGA 3DVLA 1DAIA 3DO6A 2IYLD 2ZRFA 1A82A 1CR1A 3CR8A 3NHBA 4JLPA 3RWMB 4AURA 1VKJA 4MYUA 3I5YA 5GJWC 4E5UA 1Q21A 1TMKA 1FTSA 4AG6A 4MKFA 1TTTA 1VPLA 2CHVA 2V8OA 4MDFA 1E2HA 121PA 2QMEA 4PSVA 1CP2A 2C95A 2WKQA 3U7EB 4QHSA 4LDJA 2B6HA 2ODEA 4M53A 3QEJA 1DBSA 4PC2A 1GG2A 5FBWB 3DKVA 3VR3A 1LB1B 4NCJA 3A1WA 5H8WA 4IDOA 5CIQA 1HT1E 3HDTA 4NZYA 4V0NA 2QQ0A 1FP7A 1GNPA 3KJGA 4C4PA 1XEWX 5FPTA 2IYUA 5AJVB 1XP8A 3GJ5A 2YWFA 3EC1A 1SVIA 2C77A 1FUKA 3TAUA 1P75A 1F5NA 4WZAE 4A15A 1HYQA 2WAXA 1N5LA 4EDHA 4MYTA 4LI0A 521PA 4HB2A 4A0GA 4BZPA 2RB4A 3VAAA 3P26A 3QG5A 3CF2A 1N6RA 3ZIAA 2DR3A 2QP9X 1XU4A 1R4AA 2VO1A 3OF5A 3VQTA 4BPBA 3OE7A 4OQXA 1HE1C 3ZQJA 3GJ4A 4TZ0A 2R8RA 5DNYB 2KI5A 2ZE5A 3KL4A 4FMDB 4WBSA 4CT5A 2Z6VA 5CLLA 4FI3C 2W6JA 4W7SA 3LXRA 3GEEA 2IF0A 3M6AA 4TMKA 2QE7D 1NP6A 4LPKA 1X1RA 3VKWA 3CPHA 1BH2A 2X77A 3AF2A 2LCFA 3I8XA 4HAZA 1AN0A 5TY0A 1NBMA 4EPRA 3ICQB 3EZ2A 2Z4SA 3GLFB 5KDLA 1JECA 3VX3A 2ODBA 3LBHA 1P2UA 2OBLA 4HLQB 5SZJA 2W0SA 621PA 2JJ2A 2D2FA 2C98A 1R5OA 3RS3A 1P60A 2ZJ2A 5AJYA 2HLDD 1ZM9A 1XF9A 1XTSA 3SI7A 4Q01A 2JJ2D 1IOZA 3TJZA 1BO6A 2P6NA 1XWIA 2PBRA 4X8MA 2ATVA 2F6RA 2WWFA 3T35A 3WYFA 5JI2E 3K9HA 3N70A 2O8FA 3A1VA 4K46A 3BH7A 4PZLA 2WM9B 4I1VA 1QVRA 2IWHA 2OBNA 3GEHA 3W3AA 1JR3D 1MT0A 1KGDA 3A4NA 1KI9A 1GFIA 3RS5A 1SKQA 2OLJA 3WNDA 2AKAB 1I2DA 3ADKA 1SXJE 4JKIA 4MA4A 3VHXA 4DT1B 3O47A 2HYDA 1SZPA 4TSFD 4KFRA 5JBQA 1KK1A 2QMOA 2GK7A 3KUCA 1ZBDA 2ZYVX 1B23P 1GP2A 3GLIE 1BIFA 1KMQA 1NN1A 3RSOA 2BM0A 3QJYA 4R7ZA 2XSZA 4OI1A 1RJ9B 3BE4A 2P65A 4KJZA 2Z0MA 2VQSA 3L0PA 4FWIB 4QGHA 3ZYCA 4BFSA 1PVOA 1KDOA 3BJIC 1O87A 4QBHA 4XSGA 2CK3D 5D3QA 4YDSA 3THYB 5UKDA 1E9SA 1RRPA 3UKDA 1W48A 5DI9A 1NY5A 2YC4C 2ZI7A 4GRAA 2IYWA 2DFNA 4JBWA 5AUOB 4OI0A 3EXAA 1U8AA 2ZJOA 2ECKA 2ZROA 2WICA 4M1OA 4PPGA 2BBSA 2J0QA 3U7GA 3RHFA 2FN4A 1VCMA 2JDIA 5JRZA 4WXRA 4D4JA 5TV2A 4ZKDA 2WBLC 3GFOA 3A36A 3L82B 3ZVRA 4Q03A 3PITA 4O25A 5CDFE 3TGPA 1VYVA 4NYIR 4POAA 1JJVA 4D25A 3LW8A 3L0SA 4OHYA 1KJYA 1IM2A 2G88A 3DHWC 3QI2A 2FJUA 1AS3A 5H1YA 1KZGB 4L4UA 3MMPA 1YRBA 1EFCA 1UEJA 3IPXA 1S96A 3VU9B 1F60A 1KO4A 2XJ4A 1CF4A 1KIMA 2HJGA 3UWOA 4QGFA 2XNDD 3IIJA 1NLZA 2GEUA 3QG1A 3QSYA 3A1TA 4DCNA 2FWRA 2GWHA 1G8FA 1LS1A 2HDNB 2GBLC 1NJGA 4D4MA 1DVRA 1OSNA 4UNNA 1E79D 1OFTA 5CK4A 1Q0UA 3TRFA 4EJSA 2GVZC 2KJQA 4II7A 2VSFA 5HKKD 3U60B 3HR7A 4WAUA 3LH5A 1U0JA 1X6VA 2BMDA 4DT1A 1E79A 4P0TA 4RSGA 2LKCA 3MJHA 1OB2A 5TARA 4QXAA 5F98A 3OFNA 2ZE8A 3AUXA 4C0BA 3MWYW 2NMVA 4B35A 4G3XA 3B9PA 2J7PD 1E98A 4W5JA 1Z22A 4DCTA 2OCYC 4LHVA 2Q6TA 4JS0A 4CIDA 1CR2A 4RZXA 3SHFA 4B6EA 3PUXA 2J7KA 5FUXA 2DBYA 3I3SR 4DUGD 2ZRLA 3K9NA 5B57C 1G3QA 5KSPA 2HT6A 1CBUA 4FXPA 1XCPA 4IHQA 1P2SA 1JJ7A 3BD9A 1GOTA 2CNWA 3H2YA 3SEAA 1FQJA 3KJHA 4LY6A 1MO5A 2EFDB 2ZI6A 1BMFA 2WSSA 1IONA 3SJCA 4A4DA 3UATA 4HAVA 3I73A 2BOVA 2EW1A 4JL5A 4OK6A 4KHZA 5AJWA 3HU3A 1IJFA 3B1WA 3R9IA 1UF9A 1IN5A 3D8BA 4Q4LA 1Z6AA 1R0YA 2R6CA 1KMHB 3A8TA 4LBZA 2CCGA 5FOSA 1JALA 1UBEA 1W5SA 3EAQA 2I1QA 3H84A 1LW7A 4O0MA 3PJRA 3CX6A 3QXXA 4GOJA 3UMRA 1ZUHA 1CRPA 1MOZA 1PLJA 4OBEA 1F2TA 3BK7A 1EFRD 1TX4B 2ZE6A 2RHDA 3IHWA 5GJVC 3JZMA 4YC7A 1BYIA 3MUFA 1D5CA 3HP1A 3L43A 4JLJA 2J7PA 1GDDA 2AKYA 5B2ZA 4Q4JA 4ZCLA 2NOAA 1UFQA 3IGFA 2JLYA 3DZDA 5B64A 3CRMA 4PQFA 5KTYA 1YZKA 1E94E 5A0FA 3EPHA 1KSGA 4QL3A 2ZM5A 2FEMA 2GA8A 1OXXK 3QUSA 4Q9KA 3LRPA 3U7FB 3B9QA 2BBWA 2WJYA 4I81A 1OFHA 1KKMA 2IYXA 2A30A 3BRWD 2V4ZA 3CONA 5CLQA 2P6UA 1NIPA 4DB4A 1RE0A 2O0HA 4JLDA 2WMNB 4IOMA 1OH6A 4NU0A 3VR6A 5KO2A 1KO7A 3KB1A 5LDDC 2WOOA 4MQBA 2D3WA 3ASYA 3TH5A 3CX7A 2G1JA 1CTQA 3D6TB 3EZ6A 4PO9A 2N42A 1RPZA 2YZ2A 3LX8A 1RC8A 4RFSB 1MRSA 2VSXA 4FIDA 3Q7PA 1U98A 3WHLA 5L3QA 4MGYR 4A92A 3PUVA 3THWB 3U3KA 2J87A 2V7QA 5AJXA 3BERA 2IXEA 1CJTC 1MV5A 3LD9A 3IIKA 4BFVA 3GJ6A 4JL8A 2FSGA 3MWJA 4C2TA 3B78A 1EGAA 2VTKA 3GLGE 2J0SA 1OLOA 4MRNA 1YQTA 2H92A 3B1XA 1VG9B 3B2EA 4QG7A 2YWHA 2EFGA 1SQ5A 5JEDA 1CS4C 2CL6X 1CLUA 1SXJC 2IXGA 3QY0A 3A4LA 3R8CA 3T34A 3GJXC 1P9NA 3B85A 4EPVA 2UVQA 1G6OA 4DEXA 1Z0KA 2ZJZA 3JZAA 3W6NA 2F1JA 1ZW6A 3ZGXA 4MITA 3BOSA 1QHSA 1KDTA 4KSBA 4XOIA 2IX3A 4US0R 1KHTA 1IN4A 2ZR7A 2PCJA 1RYFA 3FPAA 4LK2A 2FU5C 3CZPA 1Y63A 3O8CA 5G3YA 4KLZA 4DRZA 1HTWA
chains in the Genus database with same CATH superfamily
2FRDC 1AKRA 4RIHA 1F48A 3LZCA 3OG9A 1JEYA 4PF1A 3WWPA 2ZS7A 4WJZA 4NVRA 2FP3A 1CZRA 1IPFA 1HM5A 1Y33E 3D5EA 5E8JA 3PTLA 3X2FA 3ABIA 4H0NA 3BB4A 2UVPA 1NTRA 2GK6A 4IKPA 2F90A 3F7NA 1OTYA 1BD4A 3I6ZA 2HHLA 2E4AA 5DWQA 3R4CA 3CRVA 4HYEA 1PSWA 3A3PA 3L0DA 2GD0A 2J4DA 2YWGA 1PGQA 1LC0A 3QU7A 4KPEC 5KNCD 4O2RA 1RJWA 3PUIA 5IYZA 2YIVX 3WL4A 2H31A 1TCUA 2VP2A 4E11A 1CT9A 1O96B 3G49A 3GRZA 4Q4HA 4UCWA 5CPFA 2JJ1D 1PD1A 4JROA 1J2JA 2Y67A 3DONA 4RTRA 2NTVA 4M0KA 1J9EA 3TNYA 2IHKA 1FCJA 2Z08A 1HOXA 4QGAA 4JVNA 4MQEA 1THTA 2ZWVA 3JYPA 1RYYA 4D74A 1MZPA 5HZHA 3DM9B 1IEQA 1M66A 2IF2A 3AU9A 3N0VA 1ZUWA 4G8JA 1FMFA 1FW6A 3HHEA 3LUHA 1J56A 1HH4A 1QO0A 4GMDA 4I9HA 1N2OA 3KIPA 1IVYA 5CXUA 4QM6A 4R98A 4AECA 1UKCA 2ES4A 4X3CA 4B3DA 4ENQA 3BB3A 3I2HA 1OFUX 1O89A 1LPNA 3HYLA 1VKNA 3QVWA 3KHKA 1M2OB 3BH0A 3D3QA 3N2GB 2A2ZA 2VHUA 3CSDA 4G0UA 3ZDAA 1K08A 2QAIA 4XGQA 4C2AA 4EGAA 5LZ7A 5F1KA 2JLWA 3QF7A 1PBNA 1T0IA 1SQFA 1KBZA 2CLSA 4ESHA 1IWBB 3KDAA 3RANA 5IM4A 4JBXA 1HRKA 3HB9A 3NPMA 4GX0A 5DHFA 4RHEA 4HWKA 3PCRB 3T1YB 3SC3A 4EGSA 1Q3KA 4NC9A 1RBQA 3CTMA 1WETA 2HPVA 4AG5A 5TR9A 1JQ3A 3CKLA 2IZ6A 4MEJA 5H0IA 3T3DA 2G08A 2PUWA 4LKRA 3PL5A 4U6SA 3F8SA 3OQPA 4JR2A 2WQ7A 1TAUA 1KNXA 1K6MA 2I87A 2K4MA 2GKGA 3CH4B 2R6DA 2YVLA 1AIPA 4UNRA 2JFUA 4INAA 4DW8A 2H51A 2I3BA 1XLWA 2WF8A 3FYTA 5I7WA 3EPLA 3UMYA 1C81A 4IUCS 1KPGA 4ZYTA 3GOQA 3TMYA 1KEEA 1SEPA 2CK3A 1U7TA 2PR2A 4LXXA 4Q9LA 1JUDA 1U6KA 4URZR 5CT6A 1UKZA 1XEXA 3ZDEA 2GCEA 5KSWB 3LDUA 1MW8X 3VPAA 2H5JA 3GA5A 3JXEA 3TQHA 3K9CA 2FDRA 2PKQP 1I3NA 1X87A 2DU8A 2PLRA 3LG2A 3MCWA 4I50B 1U8EA 5H81A 1H5QA 2ZJ6A 1E0JA 2PV0A 3WO0A 1DDGA 1PEAA 4B4OA 4ZICA 3RFFA 5JCJA 3BRQA 4DWWA 3VV2A 1MDBA 1Z62A 4V0MA 4Z0HO 3BQMB 2P6RA 1T2VA 4DLPA 3E70C 1WZ2A 3U44B 1YR9A 3EMKA 1IMJA 1JKJB 3REFA 1ZK2A 4LA4A 5HUHA 1MB3A 2IUUA 5B7GA 1UP4A 2OHJA 4MVJE 4RVGA 3BULA 3CF6R 2H3HA 1E99A 2NTEA 1TT5A 1GNTA 4X45A 4ZEMA 1XU9A 1KY5A 1M1YB 4XUDA 3TI7A 1SHTX 5KQSA 1LH0A 3JALB 3HN7A 2QV0A 4HEA1 1E69A 5AIBA 1ZD8A 4GEKA 2F8MA 3UV7A 2YW2A 2UUAB 3HDYA 2H59A 3DZKA 1FOEB 1NURA 3OI7A 3P9YA 3ZVLA 4KI7A 1IEXA 4GKBA 4JB8A 2QL7A 1BN6A 1UODA 3GBSA 2DB3A 3BUSA 3R2JA 3DDCA 3FVWA 3E7WA 4HNAB 1C7ZA 4MW7A 4NAUA 3SZRA 5JRDS 2IOYA 4JV5B 5KQGA 3IP7A 1DT5A 4J3JA 5HR5A 2XCLA 2YKGA 4KPFC 1I5EA 3TOSA 3EEQA 1JVSA 2Q21A 2GSDA 1QO9A 3I6YA 3WVNA 2IP2A 4M88A 4XLZA 3RADC 1LSUA 1K97A 2WZDA 4ND8A 4TL7A 4BRZA 1V3QE 4IIGA 1LRJA 3PKZA 2X3FA 4KQHA 4R31A 3TB6A 5JJKA 2A0UA 4O4HF 1K68A 1RPNA 1WKCA 3WTBA 4IILA 1H0RA 4O2BB 4Z8YA 1ZHHA 1PR9A 5IEBA 3SYLA 4CFYA 1ZVJA 2QUHA 1JFFB 3DMFA 4TKUB 4EHJA 1POWA 3L46A 3REGA 3ADCA 1EDOA 1O95D 1EVZA 3LUPA 2VYND 3GEBA 3IUJA 4OJQA 1YFLA 4OH7A 4MUYA 5JZOA 4TV9B 2JJYA 3C74A 1N2ZA 3EUFA 2AXEA 4Y1FA 5EXDA 3C3KA 3MGCA 2JIPA 4L4XA 4AQYB 1FJ2A 5EYPA 2FXIA 2W8ZA 1CZLA 4FFDA 4GAEA 3PVSA 1QLJA 1JHPA 4R01A 5AESA 3PT9A 1OA0A 1UZLA 2PH7A 3QTBA 3JQ6A 4ECAA 1HE2A 2V6MA 3U4QB 1QS0B 3MELA 1E1QA 1FSPA 3PIIA 1ADBA 1BKDR 3IQIX 1ETUA 1K2VN 4OPMA 3ZHVA 4NPCA 1TAQA 1CRLA 1TB4A 5ENVA 4YHHB 4N4AA 4N7RA 4YCSA 5C7YA 4JR1A 4QGBA 1JG1A 1Z47A 1W4LA 1SXJA 1MOQA 4X7PA 3SX4A 1R8SA 5FBHA 3ZBQA 4C0SA 3GLGB 5G41A 2HREA 3C7TA 4HDNB 2OLEA 4G9GA 1RABA 2D2XA 4BX8A 1PWEA 3BXZA 3PXGA 3IT1A 2ZCJA 5B3AA 2RC6A 1MMFB 1TGYA 1R10A 2G71A 3GGJA 1BOOA 3ROTA 1UMCA 4DEYA 1YRLA 4CEIB 2BCGY 1FP1D 1TLTA 4H3SA 4OJTA 1ISGA 3LT0A 3PNVA 4D4HA 3KKMA 2X2FA 4ICIA 4IXDA 4J1TC 4RS4A 2IZ0A 3DDSA 3ZTWA 4AMUA 9GPBA 5BMVF 1CE8B 1KFKB 3O4HA 5DJ5A 3RS2A 3I09A 3M4JA 2GH1A 2SNIE 3BM5A 3IAXA 4PLGA 3TLZA 2FF5A 3W5UA 3WL5A 5LOVF 5HRUA 3ONEA 4ND7A 1U4NA 1OLXB 4M0CA 1GUZA 4UBMA 1ZEMA 2R7LA 4BEVA 5HEKA 5HCNA 2C4NA 2JI7A 5G1OA 3O9MA 5LZ9A 4M7WA 4DIKA 2OLKA 3VH4A 2BH2A 3D2CA 1V96A 1VQ1A 5FJJA 3WKBA 5JXIA 4NAHA 1NX9A 1USUA 2RH9B 1A04A 1ZN8A 1NWCA 2HC9A 4K2HA 4B3CA 1FMLA 3H3JA 4U63A 4V0RA 3ETJA 4NFYA 4B8ZA 4LDQA 3M2PA 3O83A 4X8OA 4YP6A 4C6TA 3DAHA 3SFVA 4PLCA 3DOUA 5KTTA 1I4TD 2JVKA 2A8YA 1Z0AA 1KBOA 2SBTA 2W6JD 3AR3A 3DJFA 1G98A 3EWNA 4FILA 3VSBA 4ZGGA 1RRMA 3L1HA 4OP1A 2HRZA 2Z2JA 1NRIA 2PEYA 3U3OA 5F64A 2J4FA 2PWBA 3C3JA 3B82A 4I9GA 2NQ2C 3A6FA 3SIPA 4CODB 4DGQA 4G0WA 4XJSA 4HRXA 3Q41A 4JR0A 3QOYA 3CGGA 5FXMA 2WUDA 2IYZA 4Q3NA 4FYJA 4W9MC 2WKWA 3MJEA 1WMDA 2OFFA 4EY4A 2DUNA 1E9VA 1Z3CA 3ODPA 4GKVA 3C16C 4ZGWA 1I7PA 2Y9PB 1W7AA 2OUIA 2KHZA 4Q9AA 3HUTA 3IEUA 1DQZA 1TAHA 5U4XA 2QLTA 3ISTA 4KQIA 4ZT3A 3T4UA 4LGMA 5JU6A 2GZ3A 4N39A 2O7VA 3M3DA 3ESYA 4FYMA 1B73A 2VHJA 3KTFA 4JBYA 1HFKA 2WU1A 5ELXA 3VKVA 1J06A 1RQLA 3PFWO 2HHJA 2WJHA 1CHDA 1ZMOA 2HRBA 3STTA 2DETA 3LBAA 2FMKA 1OIXA 4OLHA 2QZZA 3RUEA 4XLTA 1RWVA 4M0UA 4CN8A 1J0BA 1XZMA 1SPBS 2DSNA 4XQ9A 5IJWA 1OWLA 5L4NA 4D46A 1ESDA 4OU5A 4Y6QA 4V1CA 3C2QA 3Q8KA 3FRJA 4QDKA 1VSBA 1JSLA 1MPTA 2R2GA 3OZBA 5K2OA 1RNLA 4CF6A 1H5UA 1HUQA 2WE8A 3RIYA 2XNHA 4FGKA 3V2UA 3MW8A 3IQEA 2BF7A 2FFAA 4NE7A 4D9JA 5DX1A 5IC4A 1OBCA 1YHNA 4FSXA 1DJLA 3MA0A 3R9XB 1IM5A 3PV0A 3QUBA 1AZWA 1B15A 1Y8RB 2GWRA 3I52A 2WIAA 2AL7A 1EDEA 2ZIXA 4H35A 3SC2B 4BN5A 1O6CA 3N0TA 4CF4A 3GBPA 1G21A 1D6MA 4BECA 3WK9A 3JD0A 1L5RA 5DHQA 4JX9A 1SVOA 4RD6A 2SKDA 3ZI0A 4ZTZB 3HUFA 4EY8A 1K4MA 2GYUA 5AVKA 4H1VA 2L18A 2H2HA 4JZKA 3NBZC 4RVDA 4AK9A 4LUCA 5LQCA 1P0MA 3AUAA 3GJYA 2VQFB 2ZTVA 4QTUB 3AH8A 4QJIA 1MB9A 5J2UB 3O31A 1KIAA 3UHJA 4C07A 1SU4A 4C7JA 4AY2A 2HXYA 3R7FA 4IKOA 4BVGA 4KO3S 4ZCRA 4CMIA 1EUYA 2ONYA 2I0FA 3H9JA 4YMWA 5J5AA 1O95C 2FUG6 4CG0A 2ST1A 2NLOA 4HDSA 4W8GA 1FVHA 4E4RA 1M8FA 2B2NA 1RAHA 2BFFB 1NVDA 3TQCA 2W2LD 3L7JA 1YQ9A 4NZPA 2APJA 4QULA 2XWJI 1XXHA 2JFBA 2ZI5A 4NBKA 3OOYA 4R8LA 3H11B 2G8NA 3VR5H 1QIMA 5JJBA 1J5XA 1UDCA 3P9NA 3C15C 3R0JA 4H1HA 4TLAA 3WA7A 5L9AA 4MK4A 4NDNE 4LMRA 4TKVB 1NGSA 2O8CB 4WZZA 2C58A 4LHYA 4CJXA 3B3FA 1SD2A 4XQEA 3ZZUA 3H7AA 1P1RA 2SHKA 2J3JA 2VATA 4UCQA 4RKYA 1ZJJA 4EO9A 4JP2A 3OU2A 3OZUA 4RFLA 4TMXA 1PS9A 1SJ9A 1U9IA 1V5EA 1Z4LA 4U6QA 1FTGA 2GZ2A 2QRVB 4PFQA 1QDLB 1OJ7A 1FFAA 3HFSA 1JHZA 1W2GA 4TMTA 3T1OA 2JW5A 1EGMB 4BX2A 5KYWB 3G2HA 3IQZA 2NYVA 3KSBC 3D3KA 3WX0A 1N4DA 2OMEA 3HWX1 4OREX 2WHXA 2C4TA 3CUKA 5E7MA 3KEOA 1P7ZA 1ZA2A 1SH7A 1L5HA 3A6DA 3WGNA 5EJ8A 3DEFA 2TMGA 2AR9A 4MV9A 2WC1A 4WGGA 5JS7A 2VWQA 4FCTA 3GDGA 4OHRA 4DQLA 1U8FO 3MB5A 5JCZA 1J39A 1JLMA 1JIIA 2FNAA 4UNPA 4EF4A 3CN7A 3IP6A 5C1DA 3EODA 3HXQA 4M4SA 1ZIOA 4TV8A 2E4VA 1E6LA 1K8ZB 2PSSA 3E82A 1PTKA 4QUIA 1FX0B 3TB4A 3ZQUA 6LDHA 5AVSA 2O3QA 2WWVD 5EWLB 2IS1A 5DZSA 3E8MA 4FN5A 4JI0B 5BN4B 4CL2A 1FDSA 1FSSA 4YJGA 2F1RA 2ISQA 2R9VA 3AY0A 2W8BB 3DCYA 3THSA 2XNCA 1NJFA 4R83A 1PE0A 1YFJA 3AB7A 4S1WA 2Q5QA 1BRTA 2F2TA 2QN7A 3RUPA 4F6RA 4Q7LA 3AJRA 4E5VA 2P5YA 3KJIA 3QA9A 3HWSA 2Y1KA 1D9ZA 3X2SA 3I9LA 5BSRA 3K70D 1QGAA 3A6PC 2RKWA 4O5AA 1ESMA 3HXLA 4P82A 3GLHA 2FSVC 1HE4A 1Q2UA 1NVEA 1TVCA 3EWSA 3MJFA 3QSGA 4MI9A 3TZLA 8OHMA 3PU6A 2P8SA 2QVGA 1YVRA 3F6EX 2WFAA 1E3JA 3IDOA 4X65B 1OBOA 2CNWD 3ENZA 3CLVA 3H8JA 4Q7KA 1XZGA 4RNDB 1ZXXA 1E66A 1JPNA 2NZXA 4YV7A 2HWXA 2Z4RA 3CF4A 5CM2Z 5LJIA 3QPUA 4IP0A 4C4XA 4R1OA 1WRBA 2G04A 1MTZA 2ERCA 2YYZA 3WZLA 2JF0A 4ARZB 4MEAA 3K9GA 4BCCA 2WHEA 2OZEA 3AI7A 5AOVA 3ZXUB 1KY2A 3JQBA 1OJLA 1H69A 1YIOA 3DOIA 2UYQA 1E3LA 4WESB 4Q3BA 2OPHA 4AJ1A 3D8TA 3MCAA 4UZSA 4G5OA 3OWXA 1COWD 2I1VB 4NOMA 4IXTA 1OFGA 5IMBA 3RS7A 4WKBA 4FWBA 4FGZA 421PA 4ZYUA 1NV9A 2BEVB 4QIHA 8ABPA 3ELWA 1DTWA 4K5QA 1YZ3A 4OK5A 4URUR 5ALSA 1SVSA 4ESEA 5C7OO 4PZPA 4QARA 1GILA 2IHUA 1P5RA 5AICA 3FB4A 1TCCA 3QVXA 2EFEB 4CUZA 2IU4A 5BN5B 1RDFA 1BVHA 2AUTA 1E0DA 4S05A 1E4OA 1L7OA 1TVEA 3ETEA 4NIMA 4NL4H 5BQ5A 3RHSA 1HNXB 2FPGA 2KPOA 4V0SA 1CDZA 4X95A 2H5LA 5DWDA 5TMEA 4UREA 1HXHA 2FEPA 3QW2A 2R2AA 4MW1A 4EVIA 2QHXA 1C4KA 2PLNA 5IZ4A 1Y5IA 1WBDA 4F0JA 1PV2A 1BA3A 3MT7A 4P3YA 3CLTD 3Q5DA 3JAWB 1CR6A 1W88A 3C8MA 1KL7A 1A95A 2X76A 1P3JA 3OO0A 3PNBA 4CKCB 4C43A 2P2SA 3PPYA 3TW4A 2F3PA 1G9XA 3VO9A 4B7AA 2RGCA 1GNSA 2GUWA 3GJ0A 4IWNA 3WGLA 5J63A 3BBPA 3ACBA 3TZ6A 4QEKA 3OZDA 4QEZA 5DH9A 2FK8A 5KUTA 1IXYA 1WKBA 1Z6GA 2XJ9A 2XW6A 4IH1A 4WINA 1BVUA 3GGOA 4GLLA 5JSQA 4KNWA 5E1MA 3U37A 5I7HA 4LYGA 3W4KA 2CXRA 3D1LA 3LWBA 1YS7A 3KAKA 1GPWB 2QZ4A 2R4QA 4YO8A 1GKYA 1DKOA 1UXIA 2IYEA 5JSYA 4HNVA 1N5JA 1WCYA 1Y81A 2QEQA 1HDOA 2J6IA 5DI3B 4PE5B 3DBHB 2VBFA 2LDXA 3D0QA 3BK2A 5FIUA 5EZSA 2AE1A 1ISRA 1PGPA 1JTFA 1AS0A 2ZYTX 2XVAA 2ZYUX 2VJPA 2A9QA 3GVIA 1YBHA 4U00A 4BKQA 4M98A 3LUFA 1A5TA 5EP3A 4INZA 3K1JA 2WIBA 2GFHA 4MUXA 3VMFA 3L6BA 4JIGA 3TINA 3ZD9A 2XUKA 5J23A 1YDMA 1A9XB 1TW2A 2YZMA 2EDAA 2RG1A 3MLEA 1ZNZA 1LI4A 1OWPA 4WN9B 1ENOA 1NC3A 1XL1A 4UHCA 1YRHA 2OD9A 1TU3A 4OAQA 4R1NA 1H2YA 1QOPB 4R84A 4WTOA 4XASA 3NBKA 1O1YA 1JHDA 3Q7SA 1FFBA 3MQ4A 2V3VA 4OLJA 2QAGC 4FZRA 1D07A 3PFBA 5FRDA 1JBKA 5ALKA 4EG7A 3LVRE 1VGQA 3HYNA 3HVRA 1M72A 4WNAB 1GYPA 1GPMA 1LSJA 1NQ5A 4CMCA 3R75A 2IHNA 2DWCA 2ID8A 3HU2A 1VC2A 4KRYA 3TIGA 1LQ2A 2GYVA 4Q1VA 1GPH1 1QGDA 2D74A 3A7DA 3ZV6A 1A9TA 2FSSA 5TVKA 4CLRB 3TX6A 4UQLA 2TECE 2E4UA 4L7VA 4FGSA 1W47A 4HNSA 2BCEA 4XFKA 1WMSA 5ALRA 1UKYA 5ABPA 1GZ4A 1UAGA 3C3EA 3CLRC 1KJNA 1SXPA 2B9EA 1SK9A 1YR6A 2OZPA 3RWBA 3WJ1A 1YIDA 5KOJA 3LIIA 3E4DA 3JX9A 2C4WA 2P40A 4FS3A 4GXQA 4QD3A 1JEOA 8MHTA 2XWPA 4H1WA 4W5HA 1YULA 3C8UA 1USWA 1BWSA 1IZ7A 3GIWA 1QRUA 3T3OA 1QZTA 1SBTA 1RAIA 3EDQA 4BVLA 5LXTA 3RABA 1N3IA 4O08A 2VQEB 3NVMB 2ZCVA 2Q3BA 3OH8A 2CBGA 3R74A 5DEOA 3HKBA 4RIFA 4E3ZA 1TLFA 3FTNA 4O2AB 5T6MA 3MFQA 4ND1A 3UBMA 2I4OA 2XLCA 4OYLA 5DIZA 4IUYA 4A27A 4PNZA 4PV7A 1XZIA 4NBUA 2QE7A 1V2GA 2JAQA 1JDSA 4L57A 1N5IA 3H1AA 2VAPA 3H9CA 4B71A 2WJPA 3ITKA 4E7PA 3QFHA 5K8UA 1JAXA 1R37A 5CLIA 3B5IA 4IQ8A 5H9WA 2WMYA 1OROA 3WNBA 4JODA 3WMEA 2HR1A 1M83A 4JOBA 2FLWA 2NX2A 1NPYA 1ISSA 1O0SA 2CXPA 1GG9A 2YJZA 3V4RA 4JD5A 4ZU6X 1BFDA 2OHIA 3EISA 1REQB 5T8KC 3V7NA 2O2YA 2AG0A 3AHGA 5DFAA 4Q4CA 5IWCA 4LFBB 4PQGA 2JGFA 1X92A 2CMGA 2HNAA 2C2OA 5M7EA 1L4NA 3MT0A 4JQCA 3IAHA 4R4JA 1MLDA 4PINA 3CRRA 1HNZB 2B6NA 1CR4A 2PZBA 8GPBA 4LJ9A 2BI4A 2J30A 2VHEA 1RJDA 1G64A 1QIKA 2VXCA 3RSSA 3WWEA 6ABPA 1AN9A 1R6AA 3LECA 2GF9A 1C3OB 4ZC8A 3KELA 3UFBA 1TGVA 1Z0JA 3E3OA 3PYLA 2Y68A 1E7QA 3ICOA 1HDYA 1NVBA 3U3ZA 1LU9A 5GADl 4HQFA 3M0EA 3FHTA 2ORED 3FOZA 2B8EA 3LK7A 2VNJA 3Q8WA 5BQPA 1PFQA 3VR2D 4HR7A 3RK1A 4O29A 1XFAA 3LCCA 1HR0B 1GNQA 2NVBA 1URPA 4QE3A 1E6CA 3HMQA 1XYYA 2IXTA 4B75A 3U5TA 2FPKA 3NTOA 1CZOA 5JDIA 2BEUA 3GBVA 1OLUA 1WXWA 2VDOB 2DX7A 1GRQA 1J7KA 1YRYE 4JSTA 4MH0R 2G70A 1RXYA 4KYTA 4EY7A 4U7HA 5HRAA 3BTVA 3KUDA 3HNPA 1LBHA 1A5ZA 1AA9A 2FSIA 3FUVA 3NJ4A 4UULA 5A0TA 2KB0A 5D5HA 5AKXA 3AVVA 1CIJA 3C6BA 1W0KA 4DBLE 1OC2A 4HATA 4Z4HA 5KX5A 5CIYA 3BWYA 1GGFA 1K5PA 4D8WA 3QIVA 4D9HA 3KU1A 1EM8A 1ADGA 2CLKB 2F3RA 4G0YA 4KVAA 3A9SA 4F4DA 1AKMA 1I6MA 1Q5PA 3FVTA 3L40A 4H0FA 4UE3S 2D0OB 2P2YA 4NZ9A 2O5VA 2VAVA 3OPNA 5C51B 3RIEA 3WQQA 3GLIA 4DFDA 4FOSA 4W6QA 4EPWA 4AG3A 4LGYA 4V2UA 3T7CA 3VC7A 1AK9A 2ENWA 3AFGA 4BHTA 1Z7EA 1GY8A 1H3FA 1N0VC 3LV8A 1FS5A 1LUAA 4FC7A 2CL5A 3D02A 3ZI4A 1LJUA 2FW0A 1CY7A 4WW0A 4DZRA 4YT2A 1V5IA 2Q9CA 1XCJA 2QG9A 3IPAA 1SEVA 3QVMA 1E0SA 4DV4B 1GEGA 2X1VA 1H8ED 4BNDB 1TUEA 2FGJA 1V26A 2JGKA 2NVWA 3MTEA 5ULLA 4YTEA 5JEEA 3JU3A 1UWLA 4YUZA 3H17A 5A5DA 1CVLA 1K88A 4MV6A 2XAUA 4XTCS 5TEVA 4BP1A 5B4VA 4WWHA 3SSMA 3B5JA 1SXQA 3QVOA 2OV8A 4G0VA 1QE3A 4KUEA 1HETA 2VT6A 5I8WA 5ER9A 4CM1A 1H42A 1VL8A 3DL2A 4XGNA 2XNSA 5HA5A 3QMMA 5KNBA 3FFAA 3O5AA 5IT4A 3I76A 3Q98A 5HG0A 3T7KA 4AX8A 2AJCA 3IIIA 2JLRA 2FZ4A 2XTNA 4BO3A 4Q48A 5IWAB 1QCCA 1U7WA 2QVBA 4KQGA 2C00A 3W5SA 3U4GA 2E21A 3ANMA 1SUPA 3JQPA 4UDXX 1UZMA 4RA6B 3C48A 4D9CA 1Y6GA 4XDYA 3GCGA 1V9LA 1U4SA 2I66A 4QU8A 3G1WA 3CO5A 4R5MA 3QKSA 1H6DA 1WOYA 2AS0A 3B1ZA 1TJ4A 3MWDB 2B1JA 3ZNPA 1HOTA 2H1HA 1JU3A 1S7CA 4EEKA 5DRYA 2VNSA 4GPTA 4X44A 4CGYA 3DOOA 3F3YA 4LJRA 3TUIC 3S1SA 4Z4IA 4GL2A 1SOAA 3OP4A 3UW3A 1OKKA 3KR0A 3B48A 3L8GA 4DMCA 2FWMX 2ZIAA 2QNIA 2M1ZA 2CLOB 4PAGA 1SB8A 3EG9A 2FE1A 1FRZA 4MUNA 5F2OA 3Q8XB 4JJ4A 3ZGNA 2ZBEA 3KAJA 2B4AA 5CT5A 1HEUA 4ZVRA 1EWYA 3R5XA 4DUGA 2O3TA 4O4LA 1CUHA 1JXAA 1Z7BA 3FAKA 5TMBA 1G5PA 3I4CA 5YASA 2AG5A 4CM8A 3KWFA 1X7YA 2ZRJA 4JUIA 2Q3HA 4DCSA 2C8VA 2ISCA 3PHCA 5JROA 2PX6A 1RI2A 1I0LA 3GFBA 4EPRA 3WIDA 1CJUC 1ZC3A 2F9FA 4OMUA 1C1XA 2NUAB 4MGHA 5FTWA 3TQFA 2VJNA 2X6RA 3K2BA 8ATCA 1G19A 3BGVA 3LYUA 4TYYA 1QJ4A 4RKWA 4DIDA 1EG2A 3P32A 3PQ4A 3DQPA 3TSCA 2D0PB 2LR0A 4NU6A 1NLMA 3U56A 2ZRGA 4A8JC 2RGWA 1ZK4A 3NV7A 2Z6QA 2R96A 3WLFA 2HWYA 3OWHA 4O4IB 4YAOA 1C1XB 2DKNA 2KSQA 1WUTA 2LCIA 2WAOA 1UC8A 5I4CA 3N75A 3ZHZA 3W2FA 4DY4A 2FTKE 1RTTA 4H18A 2ZRCA 3L0OA 1RIIA 4QDZA 4ZFNA 1J70A 1SCAA 4UXJA 5T64A 3E0XA 4XYEA 3LPDA 3T3PB 5EIXA 4PPNA 2OFOA 1BVYF 2WPNA 3DEKA 1FU8A 2X22A 3MJVA 1CIVA 3JV7A 3RKUA 1L4MA 2LCQA 5BUZA 1H94A 4CG3A 5KDOA 3IERA 2BEWB 3PGXA 2XOEA 4KQ2A 5DTRA 5ECWA 1BJKA 1XZHA 2Q6OA 2J0UA 3CG0A 2W2VA 3EXIB 1RQXA 1FYDA 4FQ8A 1VJ0A 2Q5CA 4LECA 2EWWA 2OAGA 2E6UX 3K15A 2VDQB 4HGPA 3UJHA 4DDTA 5B12A 2WEKA 5EUQB 3CC8A 3NTXA 1WW3A 1W4BA 3T6KA 3MBKA 4OJMX 4G5RA 1BG6A 1I33A 3RYIB 1SFRA 2HFJA 1AM4D 1YKGA 3QKSB 4QG3A 2VXYA 1VXOA 2ARKA 2RGEA 3CPEA 4C04A 3CH5A 4RA6A 3WDMA 5A4IS 4DLYA 4RZ2A 1LDEA 2VDLB 4A6XA 3F6RA 4CG1A 1ZINA 1JR6A 1VYTA 4AZ3B 2CHQA 1S2MA 3RVRA 1AKUA 4XIYA 3TE7A 3ZDFA 1RACA 1ST3A 2Q2OA 4D0SA 1PS0A 2R1TA 4MARA 1QZ3A 4D3DA 3T12A 2HCFA 4JDPA 1SBQA 3G0GA 3PVZA 1SCKA 2WYIA 1PZGA 1XL0A 3NBUA 1PL8A 1EDDA 4NCIA 1I13A 3U48A 3W9SA 1DRWA 4U9IS 1YC5A 4LSGA 4P4SB 2IX9A 3GFPA 1VPWA 4LE1A 3V8NA 4IX1A 2JIZD 2XDWA 3RC8A 4ZYYA 3VZSA 3TNLA 3BE8A 1DOZA 4F9TA 3AM4A 1C9NA 1NVUQ 4FDMA 4XIIA 4AMVA 2CHEA 2BSXA 3EF3A 1XVLA 3KZCA 3UMCA 1ZCAA 2ID9A 3G8AA 3I5MA 4Q3DA 4OHZA 4D43A 1KTIA 1A8PA 1SGWA 2A4KA 1XZQA 4NK5A 2WG0A 3ADDA 5F77A 2E4XA 1ONBA 3IEVA 4NYJR 2XA1A 5CBPB 4ZV4A 3CNBA 1WDMA 3VYRB 4J1NA 1UXJA 1J25A 5IZCC 1T9GS 3GLIB 2QL6A 3QFFA 4YRJA 1GTJ1 5ESWA 3AC0A 3VR1A 1HDXA 4D7AA 3AGPA 3MTAA 4EKEA 3X3HA 3OIUA 3KB2A 4C7OA 1F7VA 4ALMA 3IDAA 3R3XA 3M7IA 3KEQA 1UKVY 1DL5A 3LLVA 4J0GA 3D0RA 1G0OA 5AHRA 2VRNA 2ZLBA 5E3JA 3T1VA 4BNMA 4BMYA 3DE1X 4FZ5A 1NR7A 1JI0A 1VBNA 1WA5A 5CGZA 4ADSG 2FFBA 4DBZA 1THMA 4RMGA 4IEIA 2OM6A 2SKCA 4AZ0B 4PYJA 3RROA 5CDHA 2C1ZA 1US8A 4EQ6B 5HYVA 2EBFX 5JV5A 1DMRA 5BVHB 5HX7A 2O2SA 1GG8A 2XDQB 3CM0A 2IS6A 4MXDA 1NQTA 3ZWOA 4G1UC 2IW1A 3NDBB 3T5AA 2A35A 3UT5A 3GJSA 3DMNA 4B7ZA 3CURA 5D1NA 4ZZ3A 5JG7A 5TXGA 1LWNA 2AX4A 1NYLA 2VQ3A 2YYSA 1CHNA 3FZNA 3HZZA 3BJRA 1FTQA 4GQAA 4Q6WA 5FFMA 4Q24A 2IA5A 2ZUFA 4M8KA 4ZARA 3QQ5A 2EBUA 2OWEA 2WIJA 5LD2B 1XKXA 3FKSD 1C3OA 4EFMA 5D3MA 1I0IA 4IFEA 1QGED 3V33A 5DGXA 3MWGA 5EUBA 3V8PA 3L07A 2FMIA 2JI8A 3W9UA 2CWWA 4KK3A 3OQOA 3OAAA 3RSGA 1IB6A 2GCNA 3QLVC 2PZJA 3T9AA 3TMKA 3U4IA 3SSNA 4GKAA 1E2IA 1BKYA 1K7SN 4YR7A 1QPZA 2BKUA 3MJRA 3Q0TA 5DBGA 5CJ2A 3HM9A 3NGLA 1NVTA 2QR3A 4MB6A 3U39A 4CTKA 4IDCA 1U5AA 5AK0A 3GX1A 1RWXA 3PXDA 3Q3IA 4ZKEA 2PSDA 4EGCB 3K3PA 1ZDMA 1Z2DA 4N5HX 4ZHQB 1QLWA 2CCJA 3BEDA 3UUGA 1RTKA 3RT7A 3MS2A 4FBLA 2VRWA 3SD7A 3FCCA 4BBAA 2IY7A 4BO0A 2WV9A 1O6BA 1YL6A 4X8LA 1AGYA 5DOZA 2CJWB 1P0CA 5DNEA 1U63A 1G2IA 3ET4A 4XKJA 4BUJA 1GLVA 4MPTA 2AXQA 1PLLA 2ZQZA 4OBXA 1YB6A 3AF1A 1CQJB 4KDCA 4F2GA 5BV1A 5CCEA 3SZGA 1T9ZA 3G17A 4J16C 4G4SP 1ZPDA 1GGHA 4NCHA 3FAZA 3NAQA 1KOLA 4IHJF 2H57A 2ZRPA 1M6VB 2VC2B 3DMHA 1RVV1 5A7GA 5L3SA 2I6TA 1VYUA 2JI4A 2O6LA 3OLWA 4FFBB 3NHYA 4DV7B 5JWOA 5L45A 1AGRA 5FR2A 2D1QA 5IYZF 4A0FA 1XDGA 2DPGA 2EF0A 2RDMA 4IQ0A 3ZJUA 2G36A 2XVXA 2MR5A 5EE0A 4XIFA 3BCUA 1L5GB 1E2EA 1CY0A 2XOKA 3H4VA 3PE4A 3DPUA 3K8YA 4PHFA 4RV4A 1MEJA 1UBRS 5D87A 4IMIB 1M67A 3AOGA 5EINA 4PANA 1CP3A 3EK2A 3WKEA 1MFZA 5T41A 4CLRA 2GD1O 1E9DA 2VDPB 5E0KB 3CZQA 4ILKA 3OURA 4EO7A 2QV7A 2R8XA 4FD3A 4DJTA 4B3GA 3ND7A 2AMVA 5C5CA 4D9KA 2B98A 2O8EB 1WHTA 1NJSA 1U3DA 3GA0A 1ULSA 5CYPA 4CIYA 1HL7A 2DHQA 4MZXA 4UUOA 4E30A 1LNQA 1U0GA 2HF7A 2ICAA 4JI2B 2Q6KA 2NW6A 2ZAGA 3PG5A 4PX2A 5AI8A 2QLMA 5T4EA 1Z34A 4OF4A 4BASA 1T35A 3MT9A 2YCLA 4TYMA 2R79A 4FMCB 3RC1A 1GTL1 4QPDA 3GNQA 4MUBA 2PJRA 1XZJA 3HBMA 3A2MA 1HT3A 4N8SA 1N57A 3S1AA 1PUIA 5C32A 1WP9A 3IEKA 4B4DA 3TTXA 2EQBA 3ZX4A 2DJIA 3NP9A 5JS1A 4MUKA 5JANA 4M0LA 3H3FA 4IVNA 3TLMA 1R0CA 3RFTA 5GWXA 3HL4A 3NBMA 1GVNB 1ZN2A 3HXMA 2DH6A 4BLVA 4UW9A 4JP1A 1MGOA 3ZUPA 1LSSA 2XADA 2M32A 4II3A 5DYIA 5SYMA 5CB4A 2JCXA 3PQDA 1YUNA 1DIBA 4WFQA 1JAZA 3VPXA 1QB8A 5I4KA 2PL1A 2MINB 1RIFA 2P0YA 3EDMA 1EZZA 5IULC 1S2GA 1XRQA 4E14A 1AQNA 3PEFA 4ZVLA 2R68A 2VCHA 1HMPA 1WW2A 4K9QA 5AXBA 2GAJA 1N34B 1T3HA 5KYKA 5E0OA 2ZJ8A 2JLAA 4DGSA 4WKCA 1L8QA 4DXDA 2HQBA 3MPOA 5K8VA 3IILA 3SX0A 1ZC4A 4JEUA 3EY9A 3PD1A 1Z4NA 3OTWA 4MVJM 3VUEA 3HCNA 4B33A 4CMHA 5LOVB 1AQLA 1KK2A 3JAWA 4RL4A 3FHCB 4B82A 1T6NA 4GPEA 1MC5A 1OZHA 1NZJA 4OB7A 5AVTA 4HH4A 1ZUIA 4LDPA 1H2ZA 4XSVA 3RVKA 1I6LA 1RWWA 2BFMA 4PXSA 1OR8A 3LFTA 1H4VB 2FPGB 2D59A 4ZCPA 4F71A 3QJGA 2ZB4A 4I55B 2W4IA 4IR7A 4P2GA 1CEEA 1IOVA 1XEFA 3UQZA 1P1KA 1EQUA 4MKRA 5J4HA 1GGMA 1GEEA 1ZRMA 4ZCIA 3TR0A 4DMHA 4F8YA 2CSUA 3NAZA 2FG5A 1WG8A 2YVUA 2PS9A 1Y1RA 1M8PA 1QRDA 3R5JA 1RM4A 3EA4A 3KYDA 1IXRC 4M1EA 4R3WA 5CFOA 5KWVA 1X14A 3D6HA 2VTBB 2TS1A 3E48A 3GRPA 3QPBA 3N6XA 2CD7A 1SHZA 5ES3A 2I29A 4AQ7A 2HI0A 4TKMA 1K9SA 1M6NA 1V16B 3CLTC 3VUFA 2HMUA 1NQUA 2IEYA 3T3NA 4DIBA 1FDTA 2YNMD 1Y6ZA 3FPSA 2IH2A 4KX5A 4Q05A 2A9KA 1XZNA 4XWAA 5AKJA 4R0VA 4ASUA 5CB8A 1RLUA 3S2FA 1NBAA 1QHYA 1T5BA 4UVIA 1ESCA 2ZAMA 5ALGA 3TAXA 4A3SA 1NOKA 1CYEA 3OIWA 2PJDA 3ACCA 4ZDWA 2GJAA 4M9CA 4Q12A 5J4YA 3HZOA 5HW0A 2OHOA 4HRYA 3DZBA 4TN5A 5L8VA 4O4HB 3V55A 1GL9B 3TQRA 1AUPA 3C1UA 4CNQA 4RK7A 1YK1A 1ZI6A 5CU7A 5BSMA 3OQIA 2AUMA 3CNLA 3ISJA 4R1PA 1MEEA 2FSUA 3GYGA 1E2FA 1M2VA 2G25A 3IP1A 2DPXA 4M8SA 1FIUA 1GADO 2BJWA 4R2IA 2B4YA 3NHAA 4ZXPA 4B8YA 2BEJA 2WSIA 4KOAA 4PONA 4C05A 5KYUB 4DB2A 1JQ5A 2P9YA 4US1R 3WAKA 2W8BA 4QUHA 4ZT6A 5JAQA 4QUKA 3CCCA 3WRXC 2O4UX 1QP8A 1ZIXA 3BIFA 4JBLA 3B9BA 2O0JA 1N7IA 4CCYA 1AKYA 4EFN