3U3MA

Crystal structure of human sult1a1 bound to pap and 3-cyano-7-hydroxycoumarin
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
289
structure length
289
Chain Sequence
TSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 103
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3mA00
2WJGA 4P4SB 1XXHB 4URZR 3KQUA 5AWFC 2JLYA 4PZZA 3L0PA 4B3FX 1CR4A 4WZAE 3HDTA 1KOFA 5EQTA 3RS7A 5L3SB 1MOZA 3MMPA 2ZRAA 2WKRA 2IYRA 2VIIA 4IFBA 1KAOA 4U7DA 3GJXC 4L5BA 4A15A 1YJ5A 4IW3B 1IXRC 4ZDKA 4LJ9A 4NU0A 4TTRA 2XTZA 4B3XA 5E3HA 2ZJ5A 2GILA 1W36D 1AIPA 721PA 2I4IA 1JXOA 1W5TA 2IYVA 5FL7A 1VG1A 5FTNA 1GRNA 1X8JA 2ZE7A 2ZRLA 1GTVA 1KSHA 2V3CC 3MWJA 2R6FA 3SQWA 1NJFA 3ZGXA 3SJAA 2W6JA 1W4BA 1SXJB 1N5LA 4EDHA 1R8SA 1JQLB 2KB0A 2J0UB 4IVQA 5F9HA 4XH9B 4ZDJA 2BJWA 3LY5A 1GSIA 3UANA 1KAGA 4GP6A 1P61B 2JJ2A 4TLAA 3A8TA 1N0VC 2MSDB 4EAQA 1T5LA 2ZUBA 1RRFA 4N1AA 5HPYB 3G0HA 4QJ5A 1E2MA 5JRZA 1A2KC 1U99A 4ZIRA 4ASUA 3VR2A 1E2JA 2J7PD 3BS4A 4Q4JA 4TN1A 2QT0A 4RD6A 4BLQA 3GLGB 4NCJA 2JLZA 3K9NA 5CIWA 3LD9A 2HCBA 3A4LA 2FEMA 4XTCS 3C7KA 1VG0B 4URUR 1JEDA 1D8TA 4DSTA 3OZXA 2HV8A 2JJ1D 3NBXX 1KO5A 1W1WA 5KDDA 2WAXA 2H92A 2Q3MA 1B23P 1XZQA 2XZPA 5BN4A 3THXA 4TL8A 1VTKA 2V1UA 1X86B 3NG1A 3BFVA 4MYCA 2A78A 2OBLA 1II0A 2BEJA 5C4MA 5BYJA 1KJWA 4Q9LA 2XOKA 3GJ3A 4JT4A 4KFTA 3ASZA 1T3SA 2VH5R 2ZVQX 1SXJD 3GCGA 3W90A 2BBOA 2ZROA 2IEZA 3CZPA 3HU2A 3NXSA 4O25A 4EJSC 1ZU5A 4I4LA 2Q6TA 3CRVA 3MGCA 3B85A 1D2EA 1O87A 4WVFA 3K9GA 4UNRA 2WWHA 1Z8FA 3K9HA 5KHOC 3QE0A 3LFUA 3DEFA 1E1RD 1OHHD 3JVUA 2AXNA 4PZLA 3AVOA 2GAOA 2J3EA 3THYB 4PO8A 5JZVA 2IL1A 4LGMA 3VR5A 3WRYC 4QBFA 1QF9A 1BS1A 2BWJA 3D7MA 1RYFA 2WPDD 3D8BA 2ZJ2A 2VP2A 3TK1A 1WBDA 1HT2E 5FL3A 1WF3A 4BEBA 5C1BA 1DELA 1NRJB 4OQNA 3ETLA 2A5DA 3GEIA 2UKDA 3LH5A 1IN5A 2NOAA 3K09A 2EWVA 4ZV4A 3GLGE 3K0EA 3OEED 1PVOA 2GZDA 2C2HA 2OBMA 1F48A 1YR9A 3BJIC 5EE9A 1I2MA 3KKOA 1EWRA 2GXQA 3THXB 1N6KA 2GK7A 4RKFA 4BFWA 1FZQA 4UNNA 2ZM5A 4TMKA 5AJWA 3U3JA 2ZRFA 2ZTSA 4KAXA 2QM7A 3K9LA 5C2JB 4NTZA 2CCJA 4G0NA 2OCYC 1S96A 1EFCA 2Z0MA 4PPQA 2CBZA 3AGPA 2J41A 3RS0A 3RRNA 4US2R 1CRQA 3CKLA 1KO1A 1CJKC 4TWZA 4KU4A 4V0LA 5D3MB 5AUPB 3NDBB 3OAAA 3LX5A 2XX3A 5GADl 3IHLA 3W8NA 1SZPA 1LTQA 1YZQA 2F1HA 1GAJA 3H86A 1DADA 3HR7A 3O8BA 3U4QB 2A9KA 3QXSA 4AG5A 3CLVA 1JNYA 5JS7A 4MDEA 2QEQA 5DE3A 3TR0A 3CF6R 5G40A 3AEZA 1YZUA 4P4UA 3TUIC 2IC5A 2ZR9A 3AP1A 3I5YA 1TNDA 2D2EA 1E9BA 2DWPA 1XWIA 1U0JA 1NY5A 3TMKA 2C96A 4DUGD 4UJ5A 4M0LA 3SFVA 4ZCIA 4DLYA 4LC1A 1EWQA 3AGQA 2NO9A 1AKYA 3M0EA 5J4VA 5KNDA 3HU3A 1GVNB 3PUVA 1TQ4A 3W3ZB 4EFNA 1MO4A 5FPTA 3DMDA 1CJUC 2JLSA 4LI0A 3WBKA 4W5JA 2ZITA 4LJ7A 2XNDD 1P9RA 3LW8A 3WRXC 5JMTA 2DPXA 4DSNA 5J4YA 2V8OA 1E3MA 1OE0A 3C41J 2JAQA 2J7KA 3WYGA 5AUNB 2IYLD 4FMDF 4BFXA 1S8FA 2OAQ1 4F4IA 2NZJA 1X1RA 1GILA 1E2LA 2D06A 4B3CA 1CTQA 5FPHA 1G16A 5FH9A 1J8MF 2QTFA 2ZRCA 4BPBA 4HAUA 4DEYA 4I1OA 1QHYA 2A5FA 2ZRKA 5F98A 5K8IA 3D31A 1P75A 5GJVC 3FMFA 3W6PA 3P32A 2F6RA 1R0XA 4UXIA 3RANA 3BE4A 4I99A 1QHHB 1UAAA 3D6TB 1EFUA 2ZYTX 5BW8A 1NIJA 3RRMA 1KGDA 2QY9A 3RS4A 1TX4B 4OK3A 1ELOA 4MYUA 1OH7A 4ZI3A 1JJ7A 1WQ1R 2WWWA 2ZI4A 5A4JA 4FIDA 4XWKA 4TL6A 1OFHA 1P7CA 2IYQA 2EFDB 4LYHA 1UPTA 4P33A 4XJXA 1N0UA 4B3DA 5TXGA 3TLXA 4DLTA 2JLUA 4DCVA 3TKLA 2B21A 2WJVA 1DAGA 4NL4H 5FOXA 3CIOA 4K81B 2JGNA 1TADA 621PA 3B9QA 2D7DA 1CS4C 1FX0B 1PUIA 4OJKA 1OXXK 4LBWA 3FMIA 5FBVB 4TMVA 3RRZA 3B9PA 4BFYA 1SVIA 3CRMA 2F1JA 1Q1EA 3O8DA 3SR0A 2IUTA 1E1QA 2VYFA 2F43B 3NEYA 3GFTA 3VFDA 1IQPA 4F7WA 1S3GA 4KFUA 4B6FA 5BN5A 4C0AC 1S9DA 2Q9CA 1DE0A 1ZM7A 2IWHA 3TAUA 2E9SA 2CLCX 1TAGA 1HUQA 1G41A 3EAQA 3LO5A 4O2LA 4AY2A 3LAWA 4A0HA 2CNWD 2REOA 3EG5A 2B6HA 5TY0A 2WSMA 2PMKA 1YZLA 3U60B 1OF1A 2NTYC 3U7GA 5JEEA 2X19A 4LHXA 2X1VA 1IBRA 1XCMA 1L2TA 4QJ3A 4US1R 1GDDA 1DG1G 1EK0A 4LRWA 2NMVA 2R9VA 2CCKA 1YR8A 3JZAA 4FXPA 2EU8A 2RGDA 3CX6A 4Z8XA 2NPFA 2FDCA 3K0SA 2HEIA 1LVGA 4KLNA 2O0JA 5IK2D 4JSTA 1RE0A 2WV9A 3PUYA 5EP1A 4TYWA 4C30A 2W2VA 4V0NA 1DS6A 3V9PA 4HAWA 4U02A 4Q9JA 4AKGA 3BB1A 4QHTA 3DO6A 2QAGC 3ZVRA 5DI9A 5A0FA 3QKRB 3VHXA 2QE7A 3TVDA 2PLRA 1QG2A 2ZSEA 1DAKA 2IK8A 3QF4B 3CZQA 4PQYA 3T34A 4LY6A 3RYTC 2QU8A 4A1FA 3CWQA 3SFZA 3WHKA 2JATA 4Q9KA 2H57A 2F43A 1MRSA 2QGNA 3BD9A 3IIKA 4HUQA 2DFNA 2F3TA 3L82B 2QQ0A 2CCGA 1G8FA 3UWKA 5GJCA 1E96A 3EZ2A 3Q8XB 4XIGS 2JLRA 3GJ5A 5KSZA 1CR1A 3PQCA 3T1OA 4RFSB 1W0KD 4PC1A 3RWOA 2OT3B 4N3NA 5FI0B 1P2TA 2WMNB 4L9SA 3L43A 1JBKA 3K0FB 3PEUA 3RSLA 4IOMA 4Q7KA 1ZIOA 1U8YA 2WM9B 4K46A 2EQBA 2ZI6A 3AP2A 5DISB 3U3KA 3VTKA 4UXHA 1JXMA 2QPTA 2I1QA 1NN0A 2AXPA 1U8ZA 4QM7A 4QBIA 2VSXA 3HR8A 3N2IA 3SYNA 4LCBA 2FX3A 4JLVA 4M1MA 1Z0KA 1RIFA 4PHHA 2FPMA 1IN4A 2JCSA 4OQXA 5TV2A 2KBFA 3PENA 2WHXA 4CEHA 5K8TA 3GD7A 4Q4AB 4ITRC 3F3YA 1Z0AA 2FSHA 1FTSA 2Z5FA 4EKDA 3SYKA 2OE2A 4QGHA 5CK4A 2FPLA 1OXUA 1QDEA 2OILA 3A1TA 3NIBA 4HEJA 3FPAA 2IYYA 2GCOB 3O8RA 3SE0A 1RJ9B 2ZR7A 1XTQA 4AYWA 4P31A 2WVJA 1OIWA 3RLFA 1GOTA 4LYFA 1T9HA 3M1IA 5EE1A 1SULA 2W6JD 4B47A 4L4UA 1GNPA 4PSAA 5AJYA 2BCGY 4HLUA 5J5CA 3REGA 3HYRA 5FR2A 4DC9A 1OW3B 2JJ2D 4A0FA 1JQJC 2KE5A 4PX9A 4C7OB 2LKDA 1MABA 4IEEA 2WSSD 4OL0A 1ZNZA 3LV8A 2LWIA 2VSFA 1X3SA 4LPKA 2V4ZA 2ATXA 5D3QA 4ASUD 2J7PA 2ZR0A 1G21E 3QVUA 5UKDA 3OE7A 1TUIA 3I73A 3TIFA 2ZJOA 1Z0JA 4Q4LA 2GEVA 4CF7A 1OV4A 1Q22A 3KXLA 4US0R 3TGPA 1ZD8A 3H84A 2DY1A 2DR3A 3P1JA 2YC2C 3ZQJA 1Q3TA 3U7HB 4JL8A 4WZBE 3QY0A 1OXSC 1SVKA 2FFBA 4II7A 2GA8A 4EPXA 2JJ1A 1EX6A 2OLJA 5DH9A 1M2OB 4JLJA 4Q19A 1JJVA 2FFAA 1XCPA 3RABA 1W36B 1KK1A 4Q02A 5BQ5A 4BEJA 1KHTA 4CEIB 1HH4A 2QP9X 3BGWA 2ODNA 2DWOA 1LFDB 2RGBA 1EESA 1G8YA 1UKZA 1JAIA 2UVQA 4UXJA 4A8JB 4LJ5A 3SNHA 2QPOA 2HT6A 4KXFB 4RCYA 4U5XA 3MJRA 1SXJA 1UEJA 3B7GA 4PAMA 2AD5A 2ZJ8A 2WBLC 1W44A 4DWJA 4DHEA 5KO2A 2B8WA 1NVVR 2NO6A 1E2HA 4IVRA 1NMZA 1NBMD 1NY6A 3A4MA 2GZAA 3TQFA 2CXXA 3ICEA 1A4RA 3W34A 4GOXA 1NKTA 4DBLC 1CULC 4IDPA 3KQLA 2XZOA 1T0HB 4I1VA 1C1YA 4W7SA 1Z0IA 3NKVA 1R5OA 2WPDA 4A9AA 1WMSA 5DO9A 2GWHA 1KJZA 4DVGA 1RZ3A 5EP3A 4AK9A 5J47A 4QHYA 4V0ME 4JLKA 3NBZC 1YZNA 2ECKA 3RS2A 4D4MA 5HZKA 5EXPA 4FD2A 1UBEA 2REBA 2X2FA 2ZAOA 2HDNB 2ZANA 1ANKA 2YWGA 4JMPA 3OEEA 3MJHA 4MGKR 4MRRA 3UK6A 4B76A 1VYVA 2ATVA 4OHXA 2P0EA 3FHCB 4KYIB 5CDFA 3WBJA 2CL0X 1QHGA 2J46A 2GJ8A 3R8CA 2A30A 4CEIA 1F60A 2WOOA 1NLYA 1SKYB 4QNRA 1J90A 2EWWA 3A1WA 1U9IC 4H1UA 2JJ8A 2J45A 5HKKD 1OLOA 2OUKA 3D3QA 1N3BA 3PFIA 4M21A 3NVAA 1DAMA 1VHLA 2C95A 3KB2A 2PJZA 4KODA 5CLLA 4ARZA 1SHZA 4NCNA 2C9CA 1NI3A 4G5QA 4OQLA 4PPFA 4IRUB 4MDFA 2OAP1 3ZQ6A 3AVWA 3ADCA 3IEUA 4MYTA 2ORIA 1D9ZA 2JEOA 4X8LA 4C3ZA 1FMLA 4MYHA 5ANRB 3AF3A 4Q4HA 3T5GA 1FQKA 2R6AA 3IDQA 3U2QA 5E7JA 2ZETA 4P4SA 2V1XA 3RC8A 4HLDA 4A36A 3ZLJA 2BCJQ 5H68A 4CEJB 4LK2A 4HB4A 4DUGA 5L3SA 1Q21A 2H7VA 3EA0A 3QEJA 2V7QD 3MUFA 4DLUA 4NYJQ 5EJEA 4NYIQ 4RD2A 2BDTA 2IYXA 3QIAA 2XXAA 1A1VA 4OJQA 3EX7C 3RHFA 3UIEA 1VG8A 1ZNXA 3OIYA 4OI4A 4Q1CA 2O8DB 3THOA 1HT1E 2QSYA 2QP3A 3L0SA 3R9XA 1ZIPA 5JI2E 2IBMA 3GJ8A 2VRWA 2QTHA 5GJBA 2XTMA 2E87A 3RAPR 2AKYA 3BK7A 4OHWA 4R98A 4BRUA 2P5SA 2GJKA 4BWYA 1IM2A 3NHBA 4JL5A 4D2IA 4EJSB 5IF9A 4G3XA 1F2UB 5G3ZA 1OH6A 2VP6A 1ESMA 3KKQA 3L2OB 3CONA 4TMTA 5DYIA 4FCTA 4Q7MB 1XJQA 3GJ0A 4KO8A 1KDPA 3ZYCA 5LD2C 1WA5A 1IJEA 1G5TA 3MG9A 2PH1A 5CJ2A 5DNYB 5EZ5A 2J0QA 3L8YA 2RCNA 4AD8A 5JSZA 2FV8A 3GMTA 3NTUA 5L3QB 1FTNA 3ND9A 1N5IA 4M9QA 2C9OA 1N6PA 2QMUA 3SC3A 4M22A 1AQUA 4NMMA 1UBGA 3U7FB 3U3RA 4FMDB 3GLGA 1G7TA 5BWMA 3AF1A 1NN5A 1RYHA 2C98A 3L8ZA 4Q01A 3CH4B 4GMXA 2HYDA 3TJZA 2A3RA 2J9RA 3NHAA 2DWQA 4Q9HA 1FW6A 4RD0A 2F9MA 5SZJA 2AR7A 1ZC3A 3W9YA 4F4CA 2BMJA 3W5IA 1ZAKA 2BHRA 5EE0A 1OJLA 1LS1A 2FEOA 1OFIA 2GK6A 1RKBA 4ZPXA 2QQEA 1A2BA 4NCIA 3C5CA 4RZXA 4MRSA 4QL3A 4RVCA 5FPSA 1T0JB 5CYOA 1RVDA 3QUSA 3B8HA 5JLJA 1XD9A 1OH8A 1JALA 5HTKA 4Z1MA 3K70B 3IQXA 1IN6A 4WBSA 1E1QD 3FMOB 1S1MA 2IEYA 1Z6XA 3TW4A 3NC1C 3MWYW 3DM9B 4RKEA 5FOTA 2CJWA 5LPNA 1G8PA 2CNWA 4NYIR 3GLIB 1FUKA 5JSZB 5DSZA 1I4LD 4JS0A 2BM1A 3THYA 2K5UA 2ZI7A 3A37A 2PX3A 1M8PA 1XTSA 2X2EA 1NN3A 3TUZC 3VQTA 4DZZA 2FGJA 3ZVNA 4BRWA 1P60A 1Z22A 4DCTA 3OIVA 5CM8B 3EIQA 1AM4D 1R4AA 1T5IA 2VHTA 3N2EA 2CL6X 5JI3E 1WXQA 5FOUA 1F6BA 1W49A 2VHUA 2CLDX 5IK2A 1E0AA 3LA6A 4Q5IA 5CB6A 1A5TA 1VCOA 4XVRA 3KFXA 4WZ6A 1SQ5A 1E2PA 3U61B 5FUWA 3PUXA 2CHGA 5HE9A 3ZD6A 4DSOA 1YKSA 5FI1B 4CZ2A 2C99A 1LY1A 2GESA 3BAFA 2VBCA 3CRW1 4POAA 3GLFB 3AKEA 2TMKA 4OK5A 4C0SA 4EUNA 4B2PA 4BLSA 2ZRBA 4GOJA 5JFGA 1COWA 4YMUA 5CYPA 1ZUNB 5JHGB 3U3MA 1DAFA 4FCVA 4HSEA 1WBBA 2QL6A 1UJ2A 2IS6A 4KFRA 1RW4A 5FBLB 3U5ZB 1TL7C 4JLAA 4O0MA 5B58C 3THWA 1G9XA 5D3MA 2VL7A 3GLHA 1YQTA 3CR8A 2R8RA 1W0KA 4QOSA 4PQRA 4M1YA 3SHWA 1M74A 3UKDA 4DIDA 1KI4A 3VKGA 2V6JA 1XEWX 3SJZA 4G5SA 4IOLA 2CL7X 2NGRA 4TMWA 4EPYA 4G01B 1KY2A 4HAZA 1M34E 1OIVA 4K8OA 1QG4A 4HDOB 2JIZA 3H2YA 4X8OA 3BERA 2F3RA 3UMSA 5HCNA 2Y8EA 5G53C 5EXTA 2PMDA 1NBME 4IXMA 1HYQA 2AWNA 4X8MA 1XMJA 3ZVMA 4EQ6B 2FJUA 3SI7A 1U81A 1II8B 1CR2A 5JHHB 1Z28A 3AM1A 2PX0A 3DL0A 5J40A 2RHDA 3RC3A 1LF5A 3QKRA 2NQ2C 1VECA 4LBYA 4HAXA 2FG5A 2QP4A 1ZJ6A 4PHGA 3IPXA 3DM5A 1Z83A 2P6NA 2OO7A 2O52A 2O8BB 2G6BA 4C4PA 1UFQA 5KPJA 1LNZA 2OFWA 4HUQB 5DN6A 2F1RA 1AKEA 1R0ZA 4FN5A 4JBXA 3IBGA 5EXSA 3GLHB 1V43A 5CIQA 1G291 4NKRA 2O8EB 1K5GA 2QAJA 3HP1A 3WYFA 4LC0A 2WSSA 2PEZA 2WWIA 5JJIA 4JLDA 4BZQA 1MR3F 1T91A 2J87A 1HQCA 1E2KA 3OE7D 3BFXA 1U0HC 1S9HA 2QMHA 1KK0A 2OXCA 2ZPTX 4M1TA 5JWRA 5P21A 1XEXA 2OCBA 1HTWA 4MUAA 1OB5A 2D62A 2Q9AA 2DCUA 2D2FA 2WTUA 5AUQA 1OFUX 1XBTA 4A0RA 1W4AA 4PAOA 3WY9A 1JECA 2IYWA 5KNCA 5G3YA 4B33A 1UDWA 5CLQA 4TYYA 2HUPA 4IEIA 4L15A 3B13B 5C18A 3C14C 1II8A 1S0UA 3FKQA 2ORVA 2G3YA 3ZH9B 4OK6A 2GXAA 3K0AB 4ON9A 2I1VB 2W0MA 5J4KA 3FGNA 4TYQA 1FX0A 3WNDA 1LF0A 4LHWA 2QN6A 1CXZA 2E1RA 3OFND 1PLKA 2VHQA 1QVRA 1Z3IX 3EWSA 2ERXA 2O8BA 1GG2A 3EZ7A 4KYUA 1OH5A 4CT5A 4JJZA 3AVXA 2ZSBA 1QZXA 2F9LA 4M8NE 1E2QA 1CU1A 4MA4A 1NBMA 4JLBA 4XVQA 2VTKA 2JLQA 3LBHA 4HYYA 2H17A 3AQ4A 1KO7A 1YHNA 3CPEA 4R9UC 5AR1A 3ZZ0A 4EPWA 2ZXUA 3HPRA 4D6PA 4OHZA 1IN7A 2ODBA 4JVNA 2GCPA 2ZI3A 3AVTA 4C7OA 1O3YA 1U9IA 1SVOA 3RS3A 3WMFA 2OCPA 2O5VA 1G17A 3A58B 2X8AA 4TMXA 2DFTA 1W2HA 2RMKA 4GOKA 4OBEA 4UQOA 3K0CC 4I1UA 3WHLA 3KTAB 3SJCA 2ODWA 1XEXB 3O47A 1CLUA 3L0IB 4GSYA 4B71A 4GZMA 4KFSA 2ZE6A 1N6NA 2BBSA 3B1VA 3T35A 2WJJA 2RGCA 1T6NA 4BFZA 2QENA 3B2EA 1XX6A 5IT5A 1N5KA 1NJGA 3GEHA 2C77A 2BMDA 1G3RA 5GVSA 5BYKA 1VKJA 2VHJA 4NE2A 2ONJA 4KHZA 2WIBA 1ODFA 3ZIAA 1E9EA 3N70A 1F2TB 4PSKA 1E32A 5DLQC 1NG1A 2PT7A 5FBQB 1RRPA 2IYSA 1U90A 3CR7A 2YWEA 3KJIA 1A82A 1TMKA 4RZ3A 3FB4A 1JR3D 2P5TB 2BBWA 3CM0A 3QPUA 4FMBB 4Q21A 3VU9A 5HKKA 3KZ1E 3X2SA 5IDVA 2AL7A 2CHVA 2C03A 4A0GA 1GL6A 1GL9B 3P4XA 3JVVA 3UMFA 2HCJB 4MH0R 4D4KA 2UZIR 1LV7A 1OXVA 4IDOA 3OHMA 4YONB 2QAGA 2ZRNA 2QROA 3ND8A 1KDTA 2Z4SA 3LLMA 2FFHA 2RHMA 4IHQA 1G3UA 4OI2A 1XXHE 3FWYA 3X1WA 3OIUA 2VF7A 4TZ0A 3KTAA 3PUZA 4LSGA 2MSCB 2OG2A 2GVZC 2OM2A 3OESA 3Q3JB 2V7QA 1VDZA 2HXYA 4DLSA 1G8GA 3TAHA 4BQSA 3SJBA 4I81A 4PC2A 1WB9A 1F3OA 4B48A 1NLFA 4Q4AA 4BFSA 1DEKA 1G5RA 1XU4A 1E0JA 4YXWD 5KPDA 1E4VA 5DYGA 5JJLA 3EWAA 3LBNA 1XD2B 3CUEF 4BFUA 4P0TA 4PFSA 2GCOA 4CIDA 1DAHA 1F2TA 1SKQA 4WXPA 5DI3A 5K8UA 2ZYWX 3H0KA 3QBVA 5E7IA 2EFGA 4AKIA 4TLBA 1BH2A 2KI5A 4ACAA 1GP2A 4RD4A 4V03A 1PV4A 4PANA 1VCMA 2J0UA 3LVQE 5KDOA 2R6CA 2EYQA 3VNUA 1BMFD 1W47A 2JA1A 1EG7A 4QGAA 1ETUA 1P3JA 1KZ7B 3QBTA 4LJ8A 5CM9C 2QNRA 3MRSA 5TDHA 3AVUA 4XD7D 3T5DA 1T3LA 4OQFA 4A82A 1W2GA 3HWSA 4NCKA 4ZIRB 1PLJA 4L16A 2WKQA 1U2RA 4Q4JB 1UADA 4IOJA 4TMZA 3W6OA 1W36C 1Y63A 4CT4B 4H1VA 2Z83A 2GXSA 3QG1A 3MLEA 1H8HD 2VSOA 1N25A 3CWZA 3E2IA 2Q21A 1NN1A 4DCSA 4N0EA 3IQWA 3CNNA 5GVRA 2XXAB 3PUWA 2R6DA 1G64A 1WDTA 1NKSA 4Q1AA 3VAAA 2GNOA 4LJYA 3VR3A 4JL6A 1L8QA 1OKKD 1TQ6A 2FGKA 3SEAA 3BH7A 4BLPA 3SHFA 1VYTA 2IHYA 4YQFA 2XGJA 1VCIA 4RZ2A 1DVRA 3DPUA 4LYJA 2ZYVX 3B6EA 4KV9A 3J81k 2YOHA 5CB8A 4Z1MD 3ASYA 4A8JA 2ZS7A 2XSZD 3R9IA 1L4UA 2GF9A 2VP9A 4QBGB 1NMYA 1FL9A 1QRAA 4IDQA 4GPTA 5BN3A 2ZI5A 4UNQA 2H16A 4H9GA 2REXB 1FPMA 3TR5A 3FE2A 2YJTD 3BOSA 2ZU0C 1VG9B 1KI3A 1TF2A 3I4LA 2ZRIA 4OKSA 2JASA 3FFAA 4EFLA 3PV0A 5B2ZA 2WMOB 1LB1B 5FTJA 2IS2A 3Q7PA 4OHYA 2JLXA 5HZHA 1Z5ZA 2YOFA 3TBKA 2QRNA 3KQNA 2GJAA 2DYKA 4GNKA 1E98A 1DPFA 3V4RA 3WMGA 1E2IA 4IDNA 5F2EA 4GBMA 1MO6A 1OFTA 2H8KA 4FI3C 3BFKA 5LB2A 3QVVA 3CO5A 3VX3A 4DB2A 2P67A 1XTJA 1E0KA 1XPOA 1P9WA 2YV5A 3W3AA 3T1TA 1ZNWA 1E9SA 2WWGA 1ONBA 2ZJAA 4D80A 1ZC4A 3QNUA 1KSFX 4RSGA 2GRJA 4XOIA 3UPUA 2CDNA 1G18A 3A1VA 1W5SA 4PSVA 4QGGA 2JDIA 2OZEA 4EIWA 1COWD 4ZI2A 3QKUA 4QJ4A 5HR5A 4OYHA 821PA 4TL7A 3MAAC 4HZUB 3X1DA 3QF7A 1AGRA 5JCPA 5CK5A 2AHOA 3WMEA 2DB3A 1S4QA 4Y0VA 2WKPA 2HF8A 4RJLA 4A2WA 3OF5A 2NO1A 3ECCA 5TB5A 4BLTA 1R0YA 1E94E 1SXJE 4UNPA 4D0LB 4B3BA 2G9NA 5SZKB 2ZSAA 2XNSA 4BFTA 4PPGA 2RGGA 1TEXA 3ZZUA 2CVFA 2G0TA 1D9XA 2OESA 1T8TA 2A5YB 2V6IA 3KUCA 1YVDA 1JPJA 4CEJA 3FMPB 3FKSD 4TSFA 4M1SA 4JYBA 3R9WA 1OXTA 2P3SA 1E9CA 1M7BA 2RKOA 2JIZD 3I8SA 4PC7A 4TQAA 5KYKA 5FTKA 4ZCMA 5FUVA 1MV5A 3R7WA 1FMJA 4C0KA 4N0DA 1K5DA 1ZM4A 3BBPA 3NH6A 3K0CA 5G41A 4C0HA 2O8DA 2PZGA 1BIFA 1CBUA 2BKUA 4HB3A 4JLOA 3QG5A 4UJ3A 4B44A 4TLDA 2ZYUX 3P4YA 2O8FB 1Z08A 3H1TA 4GP7A 1NP6A 1XPUA 5EP4A 2R6GA 5SZHB 1SKYE 1CR0A 1FP7A 1G4UR 4AYXA 1GRRA 3GJ4A 4EJSA 4HAVA 1UEIA 1F2UA 1P9NA 4JVLA 5EE5B 3BRWD 6Q21A 3KXKA 4TL9A 3BB4A 3ZZTA 4HLQB 3DOEA 5DN6D 4C0QC 3T15A 3IGFA 1YZGA 4ERNA 3QJYA 2WZQA 4Y0AA 3THWB 1AQYA 1M1YE 2DFKB 2V54A 2N42A 3OIWA 2Z43A 1XEWY 1NNEA 4GZLA 2DHRA 1VIYA 4B2IA 2FPKA 3QXHA 2FSIA 1HEIA 3FYHA 1HQYE 2XJ9A 4M9ZA 1W7AA 3KDSE 4NP6A 4WA7A 1M7GA 1R7RA 2FSFA 4CYMA 1ZMXA 2AN9A 4BFVA 1M6NA 2F1IA 3KB1A 3PR1A 4C9BA 3TSWA 2QI9C 5GJWC 1XTRA 3SS8A 1VPLA 3EPJA 1KI6A 4XWOA 3B1WA 1BO6A 1VYUA 4IVPA 1AJEA 1LS6A 2LCFA 5E7MA 3R7WB 1N6LA 1UM8A 2VO1A 1S1CA 1J7KA 3VKHA 1E2NA 1ZNYA 3NWJA 1XTIA 4KBGA 4BASA 5AJXA 5JS8A 3PG5A 5KDLA 1MO3A 1SVWA 2QBYA 3T06B 1IAQA 3IIJA 4MGIR 2QUZA 3GFOA 4Z8YA 4LDJA 2FN4A 4L9WA 4D4LA 2ZE5A 1R8QA 4F38A 4M2LA 3A1SA 5FOVA 1Q3HA 3CB4A 3CPJB 4M9SA 2PCLA 3OFNA 4XSGA 1ZCAA 4D81A 4TT3A 4YDHB 2J0SA 4P4TA 1LW7A 1P73A 2CE2X 3AVVA 4A4DA 1N6RA 4KI0A 1ZVQA 4QBHA 2QPAA 2R2AA 3T61A 4B32A 5J4HA 3IIMA 4MQBA 2WWXA 5KSPA 3LXXA 3KUDA 2ZRPA 4DLRA 1MT0A 1MRNA 4DLZA 4QFMA 5JEDA 1G19A 2A2ZA 4AI6A 2CVHA 2AX4A 2IS4A 3VR6A 4A6PA 2CE7A 3KL4A 3EA5A 3GPLA 2YOGA 1KYIA 2HF9A 3R20A 1FQJA 4YMTA 2XTNA 1DG3A 1Z0DA 5AUOB 2AWOA 3MFYA 1XF9A 3DZ8A 2YWHA 1Z07A 2QGZA 4PO9A 3HJNA 2A5GA 1AZSC 2YWFA 3K09C 4PHTA 4AYTA 4BECA 4D0GA 3ZD7A 2FSGA 5DGXA 1XNJA 4YDSA 1U94A 3B1YA 2VHCA 1W46A 1MO5A 3EIEA 1QHXA 4QG7A 4S2EA 2W0SA 4P32A 1F5NA 1ZW6A 1KMHB 1NF3A 2QBYB 2RGNC 3KFVA 4PO1A 3C5HA 1K8RA 1RPZA 3ZS9A 1OSNA 2QMOA 3GLFA 4LHZA 3SZRA 2HLDD 3ZIAD 2IXGA 2IF2A 4S35A 3B82A 3IPYA 3Q5EA 2R44A 1VMAA 4CDGA 2N46A 3PIRA 3DHWC 1G7CA 1JR3A 1EFRA 4NZYA 4LJAA 1KKLA 3TVTA 2BMFA 1J99A 2LKCA 2OFXA 2FFQA 4NONA 1CJTC 1GWNA 3M6AA 1NVXQ 3DDCA 3LW7A 4KCGA 1E4YA 2BC9A 3KQHA 2ZIAA 4NCHA 2IF0A 4MRVA 2QRZA 4B75A 4RZUA 1EFTA 4F4JA 4E22A 1JI0A 2QT1A 2GJSA 3CX7A 2WIAA 1W0JD 3IILA 3K53A 3PITA 2ZU6A 4Q9IA 4ZKEA 4DB4A 3L0OA 2C78A 1RFLA 2YVUA 2CLSA 1FUUA 3Q5DA 4ZDWA 4NDZA 1IJFA 2FA9A 4D82A 4W5HA 3ZS8A 5FUYA 4LBZA 1J8YF 4LZZA 4AWXA 3SQXA 2NIPA 4KSCA 3SYLA 4XVUA 5FUXA 3AF4A 2GHIA 2IS1A 3LWNA 3A1UA 3WXMA 4PXAA 1SVLA 1AK2A 2Q3HA 5JRJA 1KTVA 1N5JA 1E2DA 1KMHA 4PAQA 2VP5A 4YXWA 2IW3A 5DHFA 4G5GA 4EPVA 1UBFA 2ANBA 3LRPA 2D4HA 2OFOA 3SU8A 1UDXA 5TARA 3A36A 1RJ9A 2ZRHA 2J1LA 5KTYA 2XITA 2DBYA 1GRQA 1PZNA 2J5XA 2NO0A 4G1UC 3UG6A 4F91B 2WWYA 3UXMA 3P27A 4PTLA 4AKEA 4XWAA 2O0HA 1ZM2A 2WJYA 2ZJYA 2QTVB 4DDWA 1HE8B 1JB1A 4DRZA 3VX4A 3LX8A 3NDPA 1WCV1 1BMFA 3AH8A 1VHTA 4M1OA 1KIMA 4UKDA 3GLIE 2IYTA 4WOPA 3IBYA 1EGAA 1MABB 1C4OA 4XD7A 4ABYA 2W58A 5CDFE 2ZSDA 2RGXA 3I62A 1ZRHA 3DOFA 1E79A 1NVWQ 1ZBDA 3V4FA 1KI9A 1Z2AA 1ZUHA 2KJQA 4HB2A 1I4DD 2RGNA 2VF8A 3TSZA 3I61A 1H8HA 3IUYA 5IRCD 2VPPA 3IO5A 3A6PC 3TH5A 3AKCA 1DO0A 1CJMA 4DT1B 1KO8A 521PA 1DBSA 3UMRA 3SOPA 1P6XA 4MGZR 1N2CE 1E99A 2FNAA 1OKKA 4LV6A 4HDQB 1NMXA 5KU1A 3KXIA 4DCUA 4E5UA 2ZVPX 1JR6A 1G1MA 4FW9A 4AURA 1Z6AA 2EW1A 2OBNA 5DI3B 5FBWB 3UG7A 3NBYC 3WNCA 4FMCB 1JEEA 2XSZA 1IY0A 1GIAA 4B74A 4MITA 2WOJA 2P2LA 2PJRA 4KLZA 3RS5A 5E4FA 3EPKA 5ELXA 5FTLA 1XTKA 3CRRA 3AUYA 2EFEB 2DFLA 2V55B 4KJZA 3TW8B 4KVGA 5TMPA 3K8YA 1XJ0A 4QNMA 2OSBA 1Q12A 1QBKC 3C16C 3TQCA 1L4YA 2P6RA 1P2SA 2IXEA 5TVKA 4MRPA 1KDOA 5JECA 2IUUA 3WP1B 3LNCA 4U00A 1Z6TA 1I2DA 1ZP6A 4DKXA 1TF5A 2HJVA 5F9FA 1TUEA 4DJTA 3F5FA 1KNXA 1FNMA 4MRNA 4LJ6A 1U0LA 2IXFA 2GEUA 3DMNA 3I5XA 1GFIA 4GT1A 2ERYA 2GZHA 2G88A 1WRBA 4DT1A 4KVAA 4RFVA 2QORA 2D7CA 4DLXA 2PLFA 3F8TA 3X1ZA 2C9YA 1CEEA 2HT1A 4Z54A 3X1YA 1US8A 4XSHA 5SZIA 1XZPA 3QOFA 4TQ9A 1KK3A 1Z47A 2W6IA 1G7SA 2D74A 4YC7A 1DARA 4GMDA 1D2NA 4A2QA 5H1YA 5F3WB 2P65A 4GL2A 3MWLA 4G5RA 1G7RA 5H8WA 4D26A 2Q9BA 1XDBA 3I32A 2XEXA 3ZVLA 4B3GA 1GITA 1SVMA 3PEWA 2PZFA 3TUJC 1DAIA 2PT5A 2JDID 1YE8A 4FCWA 5L8VA 3ADDA 1NSFA 1SGWA 4FINA 4R2IA 3VU9B 2W2TA 4OHVA 4M1KA 2PL3A 1Y3AA 4BUJA 4BGDA 3UWOA 2YYZA 2CK3A 4ARZB 2VLIA 5FOSA 1H65A 3SBEA 4LBVA 1G3MA 3EPLA 5JBQA 2RGEA 5LD2B 4B73A 1UKYA 3ZDQA 3C4JA 5JJKA 1G6OA 1KY3A 3BWDD 3KJEA 1P4SA 3UATA 1R0WA 1NIPA 4WW0A 1T3HA 1Q44A 3N5CA 3M4YA 4F93B 5JCZA 1BOFA 1IONA 1TQDA 5FR1A 3BH0A 2PBRA 4B35A 4TTPA 4LOAA 1R5BA 3PJRA 1TU4A 1OPXA 1Z6GA 3U6BA 3FKSA 3E5HA 2ZUCA 4TSFD 1JAHA 3I1FA 3MCAA 4JVSB 4HDCA 1TEVA 2FMXA 2WJHA 1ZUIA 5DHAA 1G3IA 3HU1A 1RRGA 4QXAA 2NPIA 4W5WA 5J4LA 4R71A 3ADBA 4V02A 1XD2A 2ODEA 1Z2CA 3CNLA 3Q85A 2ZEJA 4Q47A 2OXRA 3KJGA 4JVMA 4MUBA 4OQMA 4DDVA 2AK2A 2D3WA 3NEJA 1SXJC 3CBQA 4HZUA 4RD3A 3T1QA 1KZGB 1NG9A 3NC0C 3E70C 4URWR 1CRPA 4Q1BA 2GETA 4CVNA 2B8TA 1CKEA 1N0WA 2MSEB 4QRHA 2HYIC 4QKQA 4CW7A 5LB4A 3QKSA 3S1AA 5B57C 1H8EA 4JJKA 2HJGA 2BM0A 3AF2A 3EIHA 2KSQA 3LLUA 3MWKA 4MKHA 1NVUQ 3CPHA 4JBYA 3O8CA 1EX7A 3AV0B 2BMEA 4YMVA 2B7CA 3GJ7A 3QXCA 1OT3A 4URVR 4Q7LA 1OYYA 1CJVC 3VMFA 1G4AE 1GKUB 2IWRA 3PVSA 4OI0A 3SBDA 3Q7QA 2AFHE 1KMQA 2ZQ5A 1TTTA 1W4CA 2O8CB 1KO4A 3I8XA 4JYCA 1XPRA 2O8FA 4E07A 1RRCA 2ASEA 2ZS9A 3FHTA 3WP0A 4PZYA 1HA3A 1MH1A 4C0BA 2NO7A 2KBEA 2G83A 1Z06A 3V00A 3FOZA 1UF9A 1HV8A 1E2FA 1PJRA 1KKMA 4HLUC 2AFIE 2GBLC 2GXUA 2WWFA 4TT3D 3JZMA 3EW9A 5AK0A 3RNLA 4I1SA 3OEHD 5BXQC 4DDTA 5CJPA 3AUXA 3EC2A 2BVNA 3FHOA 1E9FA 3W6NA 4LJ4A 4LHYA 3MD0A 3EARA 3TE6A 2CJWB 1KK2A 4Q1DA 1TQ2A 1VIAA 3LVRE 3GLIA 3QQ5A 1Q20A 2VA8A 3F0TA 3TNFA 1KI2A 2EFHB 4A8JC 3U4QA 2QMEA 5KUTA 2YNMA 3FFBA 2MMCA 3QKSB 4HAYA 1KSGA 4PQFA 4YMWA 2SHKA 3I72A 2FE4A 2XAUA 4X8HA 1OYWA 1E9AA 2XJ4A 3AP3A 3CRQA 5C4GB 2OEPA 1E9DA 3FTQA 3LQQA 1XD8A 3BIFA 2BJVA 3CF0A 3K1JA 3EC1A 4CGZA 3NBFA 4JKIA 5FOWA 1SVSA 1C9KA 2BOVA 2ZJZA 4DXAA 5KOYA 2CMKA 1PUJA 3LXRA 1UKVY 3KKPA 2GVDC 2O8CA 3G82C 3C8UA 3C15C 4ESHA 2A7QA 4EFMA 1YZTA 4IDHA 1P72A 4JLNA 4MKFA 2HLDA 5FL7D 5KSYA 3ICQB 1E0SA 5M04A 4PC3A 5FPYA 3G5UA 3RWMB 3MSXA 5KSOA 2QSZA 1HY3A 1P2UA 1W48A 5EUMA 3IEVA 4JBWA 1EFRD 5IHPA 1TPZA 2EYUA 1NSTA 4D0NA 3GLFE 3VHLB 3TRFA 2PCJA 2Z6VA 5A5GA 3K70C 1ZD1A 4ESVA 1KSJA 2CEAA 3AVPA 2WAYA 2G1JA 2OV2A 2PZEA 2YINC 5L3QA 1Q1BA 4HB0A 4KBFA 4DEXA 1GZSA 2FZLA 1W4RA 2G77B 4GDFA 5EE3A 2L0XA 4LV5B 1W0JA 4TQUS 1NVVQ 3I92A 1IOZA 2N1BA 2ZRJA 4NBSA 4W9MC 2W2XA 3DZDA 1XFAA 1U98A 2G1KA 5EZ6B 2C8VA 4AC9A 1MKYA 2W83A 4EPRA 1ZM9A 2VEDA 2VP4A 3PEVA 4J0QA 2JLWA 4Z51A 1SHKA 1D5CA 3I3SR 4FMCF 1DTSA 4NH0A 2F7SA 4DIEA 2NG1A 3CNOA 4Q1EA 1FFHA 3GFPA 5KNBA 3U44B 4HATA 2ZUDA 1HURA 2VQSA 5FFMA 3EZ9A 4Q7JB 4A92A 2ZAMA 4RCZA 1E9RA 3GEEA 4HLCA 4O2RA 1DOAA 1WP9A 1GNQA 2C5LA 2XOKD 1HE1C 4JSYA 4IJMA 2RGAA 4M1WA 1ZU4A 4Q1FA 3PEYA 4A2PA 4MGYR 4ZDIA 3W5JA 1GL7A 4JIMA 2AD1A 4R2HA 1Z63A 2BEKA 2H18A 1DAEA 4TLEA 3EPHA 2BBTA 2MMGA 5AJZA 2YC4C 1N6OA 1AS3A 2ZJBA 4BLRA 4ZO4A 1P62B 2V9PA 2ZS8A 1E1RA 1OHHA 1QVAA 4PPNA 1CP2A 2RAPA 4URYR 4UNSA 2QZ4A 4LHVA 5HCIA 3T1VA 2FZ4A 2ZRDA 2X77A 5FTMA 2ZRMA 3RRYA 2GF0A 1E79D 4MKGA 1ZCBA 4NPHA 3P20A 4BZXA 1KI6B 4QC2A 3SDZA 4XTRA 1YZKA 2IYZA 2FF7A 4TYPA 1EFHA 3AVYA 1G6HA 1G8HA 2IT1A 3QPVA 3B78A 2ONKA 1Q1QA 3QKTA 3U44A 1QHIA 1WE2A 2B92A 3EZFA 3FVQA 2H5EA 4RD1A 4YLGA 1I4TD 4PR0A 2FH5B 3KQKA 1G20E 4JT2A 2YHSA 4TYNA 4GI7A 2P6UA 4YMSA 4DLVA 1XB2A 1E69A 2ZE8A 3R8FA 1RC8A 3VR4A 3QF4A 1K6MA 1CF4A 4IFEA 1GKIA 2NZ8A 3KX2A 1Z0FA 3E1SA 3SN6A 4Q03A 3FDIA 4B34A 1L7VC 3ADKA 4AIIA 4P3YA 2QG6A 3CX8A 1ESNA 1BYUA 2JLVA 4OI1A 1T8UA 3A4NA 3ONWA 2QA5A 4TLCA 2XB2A 5LBIA 1U8AA 3IKJA 3REFA 1II9A 4ILEA 1KI7A 1G5PA 3HYTA 3TSOA 2J59A 3OAAD 3X1XA 4DDUA 3KKNA 1IY2A 1Z6YA 4RFSA 1KJYA 2HXSA 2GTPA 4V0OA 2GBLA 5AJVB 3DKVA 5B64A 2GKSA 5B30A 3K0FA 3DKPA 4A6XA 2OLKA 3AVQA 4TZ6A 3GQBA 4C0JA 3GP8A 1QHHA 4L8GA 1AZTA 4KITB 1XMVA 4LWZA 1JPNA 2ZRGA 1E6CA 2AKAB 5DIFA 2GJ9A 3QPWA 4TTQA 1FNNA 4DCNA 1EXMA 3H4MA 4ACBA 4DLWA 4AKHA 1XJCA 1ZYUA 2GCNA 2R65A 3BORA 3EASA 2ORWA 5C46F 2XZLA 4CEHB 4KSBA 1P5ZB 2EFCB 3DVLA 3BB3A 3VNVA 3WYAA 1GKYA 3GLHE 1AGPA 4EQ6A 3T12A 2W6ID 1D2MA 1ZINA 4E09A 2F55A 5K8LA 5E95A 2ZSFA 4BE7B 3QXJA 2XNDA 2IHBA 2AK3A 1V5WA 1KNQA 3BXZA 2IX3A 1VCNA 1FOEB 3LBIA 1N6HA 3CW2A 1IY1A 1GM5A 3WNBA 4JKYA 4E03A 4B6EA 1YR6A 221PA 2OHFA 3CH5A 2W00A 3B5JA 2CK3D 1GNRA 2CHQA 3IO3A 2IYUA 2C04A 1YRBA 1GUAA 2VP0A 1YU9A 1KI1A 4URXR 3RVBA 2I3BA 3LQRA 2IUSA 2O8EA 2ZI9A 4C2TA 1QHSA 3HPQA 3NH9A 3CF2A 5LDDC 2QAGB 4WAUA 2J0VA 2RB4A 1KI8A 4IKEA 4JZKA 4PC6A 2KWIA 1E2GA 1BKDR 2GAAA 1AS2A 1P2VA 3AKYA 4HI0E 4Q00A 4LX0A 1X6VA 3QENA 2OCAA 3U3OA 2BIFA 1XRJA 3BC1A 4M53A 5JWHA 1UBCA 4LYAA 4QGFA 4LUCA 3PCRB 2UZ3A 1X8KA 1XEFA 1UKEA 3U7EB 1US8B 3KKMA 3AKDA 4ZKDA 1A7JA 1TU3A 3QXXA 2O0KA 4Q48A 2XB4A 3K0AA 1AS0A 4C0LA 1TF7A 4PHFA 1AA9A 3IHWA 1FP6A 2EVWX 1J70A 3PXGA 5FBRB 4JLPA 3W8RA 4LPSA 2WICA 4ZCLA 1N6IA 4R7ZA 1OIXA 1KDRA 4AG6A 4NHOA 1J2JA 1Q1ZA 3B60A 3RDPA 1IN8A 1S2MA 5EP2A 3B1ZA 421PA 4D25A 1ZM3A 1CIPA 5CITA 1R5NA 3KJHA 3EZ6A 4JLMA 1G3QA 4HUTA 5FPKA 4QM6A 1E2EA 4BZPA 2GDJA 2YZ2A 4DSUA 1JR3E 2G0NA 1NLZA 2B7BA 5JWOA 2QM8A 4HZIA 1H8ED 2GEDA 3GJ6A 4FWTA 3Q72A 4NYMQ 3QSYA 5L3RA 1XXHA 2IA5A 3EXAA 1YR7A 2RH5A 4NYJR 2BKEA 4WXRA 4GRAA 1T4GA 4GFDA 3VKWA 5EUQB 1R10A 3AF0A 4WIAA 2Q3FA 2R62A 1NL3A 4RY2A 2FWRA 1XMSA 1YRAA 3B1XA 1D6JA 1ZD9A 2A5JA 5HE8A 1IXZA 1IXSB 3QI2A 1B0UA 4EPTA 4LV8B 5EXXA 1IHUA 4V0KA 1Q57A 1BYIA 1X1SA 4FWIB 1XP8A 2YKGA 4G5OA 1DO2A 2Q0HA 4Q66C 4V0MA 4F92B 5L3VA 2QE7D 4MKIA 1AN0A 2Z4RA 2WJIA 3K70D 4IXNA 1OB2A 1S3SA 2BV3A 3OEHA 1PLLA 4D4JA 1X8LA 2PEYA 3RSOA 1R6BX 2ZREA 4CRWB 3QEOA 3VR1A 1QHNA 4Q18A 4O3MA 3Q9LA 4C2UA 121PA 4QHSA 1Z29A 1M7HA 3BH6A 4M9XA 5H70A 1XCGB 2FOLA 3P26A 3LDAA 1Q0UA 2H1LA 4BLOA 8OHMA 3AB3A 3U6KA 4M4SA 1XMIA 1R2QA 3S1AB 4B2LA 4B43A 4Q4HB 4IOKA 3ZJYA 2ANCA 4NYMR 2FU5C
chains in the Genus database with same CATH superfamily
1SUSA 3KQUA 2DBVO 3O94A 1XZEA 2BEWA 4B3FX 1Z34A 1KOFA 1KQOA 3UMMA 4IBOA 5JH7A 2V4MA 4F2GA 1H05A 3T3PB 4LF8B 4F04A 2DCMA 2GHQA 2ZRAA 5KTNA 3V34A 3VSCA 1UC8A 3GCZA 2DKNA 2QW1A 2MU1A 2WD7A 3GRUA 4MPJA 4TS1A 1RAGA 3K6JA 4UEOA 2A9JA 2XMRA 3RSFA 4BB9A 4B8YA 4BZZA 1M2OA 4LJ9A 4E51A 4TTRA 5CRIA 2H54A 2XTZA 3CH7A 4YP5A 2GILA 2AF3C 4IICA 2I4IA 4IRXA 1JXOA 1ZA2A 1Y6JA 3MGKA 4BE9A 2BHSA 4RPCA 3WLAA 5HQ3B 3KEOA 2ZRLA 4BGEA 1G66A 1GTVA 4K6FA 5AOVA 2V3CC 3LQYA 1NJFA 3EGXA 1PYGA 2QOEA 3I04M 2W6JA 5CA1B 4EDHA 1ST3A 2J0UB 5J2TB 3IMEA 1EHCA 2QN8A 3JS5A 3KWMA 3NS7A 2FEPA 1H2HA 4MWDA 1GSIA 2OZLB 3UANA 4Y1RB 3R5SA 4O4LB 3ZDRA 2IOHA 2X8JA 1P61B 3V1UA 4F1JA 4XDHA 5I5EA 3IT2A 5LP6A 2VN8A 1UODA 1NJ2A 1O4WA 1PR9A 2CNLA 4HDAA 4CLEA 3HUEA 3GMDA 2OMEA 2BKXA 3PQ2A 2O9JA 3UH1A 3ODPA 1ZKMA 5EZYA 5JRZA 1EVQA 4Z99A 4LWOA 4R8VA 3BS4A 1J8DA 1ECPA 1X0XA 1YZHA 3IQGX 4BLQA 1V8PA 2WE7A 3H7AA 1YTLA 4NCJA 5JMOA 4ZCTA 2O4UX 3EEFA 3MJEA 2QZZA 2Y92A 4X20A 4XTCS 4HBGA 3C7KA 4OXYA 4BB5A 3CJRA 5ER9A 3L04A 3PC8A 3G8AA 3IP6A 4HHEA 1V8ZA 5CA0B 2RIRA 1JEDA 5I8ZA 4P6VF 1TVMA 4G63A 2XMPA 3JQQA 3LSTA 5TC4A 5IBPA 2VCEA 1T1IA 1NQXA 2WAXA 1E7QA 2H92A 2W90A 4HQ6A 4NBTA 4BXOA 4DY6A 2XZPA 3IERA 4JLUA 3ICCA 4MP6A 2GFIA 3OCYA 4K6MA 1VTKA 5DRYA 5MDHA 3DE0X 3L4EA 2J08A 2A9PA 1V16A 3GJ3A 4JT4A 3HTXA 1WKVA 2HSZA 5JS1A 3ASZA 3Q1KA 2ZVQX 4H1TA 2QVGA 1A5BB 2QDKA 4QGBA 1JIUA 2EERA 2BBOA 1ZESA 2ZAIA 3B6MA 5HRAA 4FYWA 1IC6A 2H31A 4EJSC 1QIKA 3JQGB 2XOEA 3MGCA 5FYQA 2I8CA 4DCPA 1XJWA 1XTVA 1Z8FA 2C2MA 3R6DA 4CKWA 2UXBB 3DEFA 1OHHD 2ONYA 3JVUA 1IPFA 4NVRA 4NV1A 3VVMA 4D57A 2A4MA 2WAOA 4M3NA 2BJHA 2RK4A 3SSAA 5JCOA 1QAQA 1GGMA 4ALKA 5CB4B 2BGRA 3OFVA 3QLVA 5JXHA 5DBGA 3N6VA 3L7JA 3KWJA 3L8CA 1LDNA 3B52X 3D8BA 3QIVA 1CFZA 3S6JA 3TK1A 2P4QA 3EUFA 2AI1A 5FL3A 1FB5A 1JDPA 4BL5A 4BEBA 2XUPA 2C8KA 4GG1A 2MYUA 4G97A 4BWGA 4OQNA 4LQCA 2P3LA 1T3GA 1TM4E 4HF7A 4QXQA 3GEIA 4B0PA 3E2PA 1KJ9A 2PUTA 2R85A 4B4OA 2BGNA 5IWAB 2NOAA 1C29B 1W25A 1HRDA 3K09A 3OOYA 4HZGA 4ND8A 3OEED 4NG5A 5C7LO 4XIJA 3GLGE 3PR3A 1F48A 2O2XA 1CJBA 5IAEA 1IEVA 1I2MA 1EWRA 5ELMA 2A0UA 1NLUA 2FMKA 2NXJA 2QYTA 2MCFA 4TMKA 2XRMA 2ZTSA 3MUNA 1DJPA 1G8SA 2AOWA 4QXMA 2UVPA 1JDSA 5C2JB 4P4GA 3Q3EA 3VYTB 1XCBA 4G0NA 1S96A 3D3NA 3JATB 2GS9A 4NDNE 2UYOA 3CUVA 4G85A 2PKCA 3OSZA 4ZT6A 3TX6A 4Q4CA 1CRQA 3WHPA 1KO1A 1O54A 4V0LA 3KYDB 5D3MB 5AK5A 5AUPB 4MJ3A 5A0VA 2R1UA 3IHLA 1YZQA 1CY6A 1FJHA 4MWSA 3P4UA 4NU8X 2P1RA 3LBAA 1MQ9A 1DADA 1BA2A 3O8BA 3KPUA 2IHUA 5T4EA 4H08A 3EVGA 4C2BA 2VVTA 4LHEA 5JAUA 1UMBB 1G20B 3DT8A 3VKUA 2F4NA 2AJTA 1R15A 2ZJ0A 3ICWA 5JS7A 2W6ZA 2QEQA 4UTNA 2VPQA 3V4LA 3A7DA 1EHYA 2BAGA 1YZUA 4I14A 1KY4A 2JI4A 2ZR9A 4RMNA 4YREA 3TUIC 2PSSA 1TNDA 3GK3A 1E9BA 1WXEA 3PEEA 2J4CA 1XWIA 2OGSA 4HGNA 5EZYF 3E22B 2C96A 4DUGD 4ZCIA 4M0LA 4WCVA 4DLYA 1EWQA 3AGQA 1P18A 4FVTA 3HDYA 1BMTA 1U9CA 3KV3O 4D74A 4XR4A 3VUFA 2PQMA 3M0EA 1A7AA 3DOJA 5TF4A 5KNDA 5KYUA 1GVNB 4R5MA 2GUGA 1ENPA 2VJCA 5B6PA 3HXLA 4PV7A 3JAWA 2C9BA 1LJ8A 2JLSA 3DMDA 3WBKA 4Y6OA 2YUTA 1QFXA 3TL3A 5EPUA 5ISMA 1FFYA 1NXWA 4W5JA 3SIRA 4D0RA 4LJ7A 4MVWA 4KGZA 3JSXA 2OGZA 3LW8A 4HH3C 4XGRA 1EWYA 5JMTA 4OMCA 1Z7BA 1G0OA 1RR6A 3H5AA 4GNRA 4CLOA 1Y7HA 2E82A 4Q6WA 1IAVA 5AESA 4EI9A 2JAQA 2J7KA 3WYGA 4LRSB 4RJJA 1YA6A 1I30A 5AUNB 2AUMA 4I46A 1F0KA 2E89A 4FE4A 1S8FA 5DHUA 3OZCA 2W4QA 1TZKA 1X1RA 4XLLA 1UKBA 1M67A 1UBUS 3LUJA 3WQBA 4B3CA 2QQFA 1P19A 1E63A 5DMHA 1CTQA 1P7YA 3EXIA 5FH9A 1J8MF 2QTFA 2PD4A 2ZRCA 3A9TA 4BPBA 1U31A 3EFOA 3CWCA 1TW2A 3F8WA 4QLOA 4N7MA 4U2DA 4D0SA 1RPTA 3KR1A 3EIFA 3W9BA 3IB3A 4LS3A 2GFHA 4RDCA 3ORRA 3R75A 4UXIA 3RANA 3WA6A 3BE4A 4BLVA 3E8MA 5ERGB 4DCOA 3L7CA 1JKIA 2B2NA 2FZKA 3WMWA 3K35A 4P54A 3VA7A 2AEMA 3D6TB 3PI7A 1GQQA 1WPGA 4K9LA 2ZYTX 3E8SA 3RRMA 3OO0A 1KGDA 5FFFA 1NOIA 5HF9A 1P2FA 3LP6A 1OH7A 4MYUA 2D2IA 4YLEA 5ICCA 3FDJA 1M2KA 4WESA 1WQ1R 4KR9A 2D0IA 2WWWA 2ZI4A 4OFBA 5K0FA 4FIDA 4PWZA 3DDOA 4TL6A 2C7BA 2EFDB 3PS9A 4FTWA 1V3TA 5BV7A 4F1WA 2NSLA 2AR9A 1TJ4A 4GC9A 4UE3S 1RWOA 4X61A 1TDJA 4GMKA 3ROKA 1T15A 4CM4B 1WEKA 1DX6A 1OGYA 4DCVA 1DQRA 1LDGA 1DAGA 2B21A 3FF1A 2QRHA 1RYDA 2VDKB 3CIOA 4XIIA 4RZQA 1UBMS 3B9QA 4FILA 4K1XA 1FX0B 1ZOOA 3GUYA 3SYRA 2C5BA 5K45A 4B7AA 1QG6A 3CNEA 1Z4OA 3WQQA 4BFYA 1Y6GA 3DMFA 2RGWA 3F71A 2D6FA 1X94A 3G9UA 1KMNA 3SR0A 3D0RA 3DZHA 1E1QA 1PR0A 2F43B 3A6FA 3NEYA 3ZX5A 3GFTA 1IQPA 3DE5X 3VR4H 1VI6A 3IA7A 4GGMX 2XBLA 4G5FA 1S9DA 5T3YA 3JQ8A 1OFVA 2ID7A 1HUQA 3DAOA 1QCCA 3EG5A 4J1NA 5DSTA 4KGDA 2GTHA 1KU0A 2Q5JA 2WSMA 1YZLA 5F7OA 4P4NA 1T26A 4C5AA 1CZOA 1QNLA 2ACKA 2JH8A 3QE3A 1DBVO 1H2BA 2Z3VA 3R8XA 3WRVA 2FMUA 4EUEA 1TTQB 4LY9A 5DPMA 1IBRA 2CKMA 2Y4OA 4WXHA 4D3XA 1ZGCA 4RWEA 4NBWA 4US1R 4JJFA 4M7RA 1KBOA 1RAEA 2DUUA 3BSFA 4LRWA 5K4AA 4BWFB 3F74A 2RGDA 3CX6A 1ODIA 2Z1NA 4H6XA 4HS9A 5IBRA 2FDCA 1L1EA 2A6PA 3NUGA 1H5QA 2P2ZA 4F11A 3BCRA 2WK1A 5IC6A 3SWWA 2FX2A 4WLEA 3I9LA 4QOGA 4V0NA 6REQB 4PN3A 4HAWA 2WIJA 2QIPA 1MU0A 4B80A 4POOA 4ARCA 1IN1A 1ZKDA 2J09A 3N0VA 4P7GA 3L5OA 3ZVRA 4BJHB 5DI9A 1PJ3A 2YFQA 4RKRA 4HL6A 2Z2IA 2OZPA 3PYLA 3VHXA 3BA1A 2PLRA 2ZSEA 1RJDA 2IGTA 2IK8A 3QF4B 4WN9A 4N5DA 3HJGA 2Y0PA 1UJ6A 3VKVA 1FE8A 3MEQA 4Q9KA 3LOQA 2H57A 3TQHA 3VC7A 1L8OA 1SO8A 4HUQA 2I8LA 5AVKA 4AIRA 3L82B 8ATCA 1FRFS 2QQ0A 1AUXA 4EHIA 5IANA 3A11A 1W35A 1SU4A 3UWKA 3Q8XB 1CR1A 1EM8B 1X70A 2J0EA 3F7MA 4MB2A 3BXHA 3IUNA 4RFSB 3OLXA 5FI0B 1KQNA 4I50B 4PYRA 1JBKA 3I1IA 3DC2A 1YQGA 1QTNA 3NM4A 3PEUA 3RSLA 2FWMX 3GYBA 4MVYA 4U39A 1U0NA 2ZI6A 3AP2A 3DDNA 1O9GA 2QLNA 4O4IA 4ZT7A 4EYQA 2JVKA 4S3MA 3AHEA 3WYNA 2I1QA 2JL1A 2MR5A 3L49A 1VJTA 3FDXA 4JZYA 2AXPA 3NWPA 1BWPA 2P9FA 2WB2A 5CX1B 3HR8A 3D4NA 3KT6A 1IATA 1BQ3A 4F72A 3AR3A 1J1ZA 1Z5UA 3PNMA 5K09A 2OAEA 4OQXA 4K7JA 4XDGA 3PENA 4P7KA 4ZWNA 4CEHA 1T35A 5F2OA 5K8TA 3ZGYA 1ADGA 4DWVA 4ITRC 5GM1A 1FTSA 1JG1A 3UT6A 3NT5A 4QGHA 4A6EA 2VH1A 1C1DB 1SK9A 3MPOA 1RYNA 1EJBA 1UK6A 3MJ4A 4HEJA 1U2QA 2YQZA 2I29A 3THSA 2RGRA 4TSRA 3K4HA 4KBYA 1J9ZA 4G4GA 1WCWA 3GGPA 4L4SA 4AYWA 3WLIA 5C9ZA 1OIWA 1GOTA 1MJFA 3PL1A 5BOVA 1ZEMA 3JWHA 4CV0A 2AOTA 5AKZA 1MVNA 4B47A 4L4UA 2QTVA 1GNPA 4PSAA 4U7TB 1P0CA 3V7WA 2CXPA 2FPSA 3PNPA 1NWCA 3LGAA 4DIFA 5ALRA 2FPXA 4LY3A 4OJTA 1WPXA 4DC9A 4NWIA 1JQJC 1OXBB 5JAMA 5BT8A 3ZV6A 2WSSD 4YACA 3UKJA 2JI8A 3VTZA 2VSFA 4LPKA 4RC9A 5DLPA 4EH1A 5ESXA 3VR2D 3WRXA 2ZR0A 1G21E 1X3LA 3QMVA 4XARA 3OE7A 1TUIA 4QUJA 4TTJA 2VRNA 4GOND 5ALNA 2GEVA 1DI0A 3FGZA 1Q22A 1TM3E 2WIKA 4QUIA 4WLOA 4CF7A 3L0CA 4FX5A 4QNRA 5MGBA 2VUSA 1ZD8A 3TNYA 3WKCA 3G6KA 1ZK2A 2NAFA 2OL4A 3B20A 3EGVA 5IABA 2DR3A 4FBLA 5TPWA 2QJWA 2YC2C 4MQFB 2B34A 3TRDA 4F0JA 1GU1A 3GPBA 1Q3TA 1RXCA 4MRMA 2BGMA 3BRCA 1SHTX 1OXSC 2FFBA 2GEJA 4M9UA 2JJ1A 4E7PA 3G0IA 1KJNA 3EHEA 4BV9A 3R5JA 5DH9A 1XRSB 4JLJA 2O7QA 1U7ZA 4GI2A 2JGFA 1R8YA 4Q19A 5K2MA 3IL2A 1BX0A 3U3XA 1XCPA 3RABA 1YCHA 1W36B 1BHO1 2PWZA 1KK1A 4J49A 1M1XB 2NUBA 3NM6B 4ZU6X 4B4VA 1JU9A 3NTRA 4QYMA 5JY1A 4HOYA 1HH4A 1T3ZA 1U2SA 3BGWA 3K2IA 2RGBA 4NICA 5DGCA 4TV8F 3L40A 3C8HA 1OLSA 1JAIA 1H0HA 3T4UA 3INGA 4EI8A 1O8CA 2QPOA 3DTVD 1RWKA 2HT6A 4JYMA 4YUXA 2NT4A 2X5OA 2ZJ8A 2VHYA 3V8EA 4DHEA 3FNFA 3SQNA 1O8BA 4HPJB 1DXHA 2EKBA 1P0IA 2EGHA 1XQXA 3A4MA 3R3SA 1G55A 3W4JA 2AS0A 2MINB 4BMPB 4I8IA 5DWQA 2CXXA 5LA6A 4E33A 3TLEA 3O7MA 2HR1A 1X87A 4HYQA 4TZKA 2ZXFA 2IE0A 1B73A 1X19A 2BUAA 3EGEA 3H1BA 5AI0A 4IDPA 4C22A 2AUNA 2XZOA 3DE1X 4XVCA 4AL4A 3UB4A 2IH2A 5LUBA 1R4ZA 2R1ZA 4W7SA 3LQ4A 2OCLA 4MUGA 2M6LA 1Z0IA 2OXEA 1KDVA 1N5OX 3NFRA 1DX4A 5JBNA 2NM0A 2GWHA 1RXIA 2ICAA 3F49S 5EP3A 5JAHA 4JI2B 4LRYA 1JHVA 4LAFA 4CMHA 1YZNA 3VH4A 1LSUA 4RY0A 3L8MA 2O2CA 1SR8A 1KE1A 3ZCSA 3FJYA 4HNRA 1EA5A 3JVEA 1KYVA 3MJHA 1G1AA 5JNTA 4YO7A 3F3MA 4IXDA 4RVUA 3UK6A 1P0FA 4ZFNA 2P0EA 1JUDA 3O38A 3FHCB 5KNDH 2FMHA 4DNQA 2QWXA 3LF2A 2FUKA 3LPMA 5CDFA 5U1PA 1CQWA 3UY4A 4BMOB 2GJ8A 3DG9A 1OLUB 4CWAA 3S8MA 1F60A 3HBLA 3ZDZB 3AIIA 5KQLA 3KD2A 5JG7A 2NYAA 2C0CA 2EWWA 1ZVJA 1VB5A 1GL3A 1GCOA 1DKRA 3A1WA 3BMNA 3LVFO 1U02A 3NQ41 2W2NA 3KOXA 5E1DA 4ZAVA 5B3JA 1I9GA 3W1VA 5KWEA 3ETGA 2IZ7A 3PFIA 3D59A 4M21A 1DAMA 1K7YA 1K9SA 1JX6A 1SUDA 3KB2A 4ARZA 4FR0A 4FYXA 4F2HA 3HCCA 4F96A 1Y80A 5J2TF 1ZUWA 1KYTA 3ABIA 1AGXA 4G5QA 4NQZA 2B9EA 4OQLA 4YAWA 4IYRA 1T5OA 4J8PA 1L9KA 1MNAA 2OAP1 3WWCA 4MV7A 3ZQ6A 1YQEA 2E4YA 3IEUA 1N92A 1P8AA 1WAMA 3AFMA 3ANNA 3EZGA 4G5HA 4X8LA 4KE9A 3VYSB 3W6UA 2GLTA 3O0TA 3VPSA 4Q4HA 4RVFA 1UANA 1JDZA 1VJDA 4COOA 2ZUWA 3U2QA 2X4LA 3FGOA 2V1XA 3H5TA 4P4SA 3DEYX 4HLDA 4JI5B 2FLWA 4HX5A 4EVIA 1E64A 5H68A 4Y2QA 4J4TA 1Y3FE 5AKHA 4R54A 4UE2A 3O9MA 4LK2A 1EAYA 3BWMA 3D4IA 4MKRA 5TJHA 5D01A 1AA6A 1OLXB 2X0IA 2VWQA 4IDDA 1V7QA 4OJQA 5GGXA 4E7OA 3EX7C 1SCNE 4R41A 3TB4A 2WMYA 1YBHA 3O8LA 3REQB 2C4TA 2FRVA 4K2AA 2YMQA 3BXGA 5AKXA 5AOCA 2ZM5A 2AHRA 2CWWA 1L7XA 2JH3A 2RC6A 1ZH6A 3L0SA 1T24A 4UOQA 5CCBA 3R9XA 2CJFA 2CBXA 2IBMA 1P39A 4UHBA 4F85A 3RM3A 4Z9YA 2XWJI 5GJBA 1P2DA 2XTMA 2G76A 3O4IA 2JIOA 4FFDA 1LKZA 3U9SA 1X1EA 3HV0A 3KLOA 4D2IA 1RT9A 4BKMA 4FEEA 4EJSB 5IF9A 4KR6A 4G3XA 4HNVA 3O90A 1XZLA 3T7EA 1J9GA 3LYHA 4NAVA 3LVBA 2PKQO 2I71A 3KKQA 1UIRA 1DKUA 2RDMA 1KFEB 2G7ZA 4FCTA 2ACVA 4BO1A 3TLMA 2XUIA 4L7VA 2Q07A 2ZBEA 5CXSA 4PW0A 3KUUA 1JEOA 1LRKA 1WA5A 2OZLA 3C3YA 3EQ7A 3QWAA 2IH5A 3L8GA 1ADFA 16PKA 1IJEA 1G5TA 3KJNA 5H81A 5CJ2A 1YFJA 2LDXA 4JC8A 3F6SA 3OEWA 3N8GA 1YJCA 1YDWA 2V7BA 3GMTA 3ND9A 4Z0PA 3PRJA 3TINA 3KOZA 1QR6A 1HDYA 2HLPA 1W9MA 2V6GA 2HJSA 2ZJFA 4Y6GB 3T1HB 4NMMA 5KAMA 2ZM6B 2H1VA 5AKEA 3R3YA 4CV2A 5JALA 3U7FB 3U3RA 1ZG3A 2P8JA 3HI4A 4FMDB 3EA4A 3C3XA 3U9TA 3UWPA 5BN1A 4Z86A 2V7PA 3A32A 4IILA 4C7KA 2BFPA 3L8ZA 4Q01A 3W4IA 4W8OA 3AJ9A 4TKVA 3NHAA 1E66A 4RVSA 3GROA 4Q9HA 4CM8B 1RJEA 1H9AA 3FPGA 2PSDA 2AR7A 3HYCA 1CQZA 4NARA 4U7WA 2BMJA 4NBNA 2ESRA 1Z73A 1BFUA 1L5FA 3L7KA 4OP3A 1DUIA 4LC9A 3GEPA 4H3KB 4HPXB 2GK6A 3EDOA 4NK4A 1DTEA 5AXCA 2QQEA 3H9BA 3RC1A 3TOVA 5FLKA 3C5CA 1JJIA 2ZJ3A 2FPWA 4PAWA 2C20A 4KB5A 3Q1LA 4V1CA 4NRDA 1RVDA 4CJXA 5HZMA 1F7UA 1WDMA 1LRJA 1T4BA 4RA6A 2WW8A 2Z8ZA 5JLJA 1XD9A 4NV3A 4AXBA 1OH8A 1JALA 5BNFA 3K70B 3L8HA 2D5IA 2NV0A 1KPGA 1HFWA 2GARA 3ZHRA 4YPVA 2G07A 2VHWA 3MS4A 3G2HA 2AMFA 1S1MA 1DX9A 2IEYA 3OBIA 4LWPA 4Z49A 1QLJA 4QQKA 5B4VA 2DP4E 4L3OA 5FOTA 3F6RA 2XA9A 1R00A 1SD2A 1L4GA 1WKBA 2CNWA 3N75A 4LCJA 3ZWDA 2BELA 1GPLA 1FUKA 2C4WA 3H5RA 2JD1A 4GPIB 1RKUA 1PR3A 2WWRA 3PA6A 1ESCA 5DSZA 5BPFA 3J7TA 4KXQA 1XMOB 4L4RA 2RJNA 3AOEA 1XTSA 2Q3JA 4HNAA 1QOZA 2AJBA 3BIOA 4BRWA 4ZD6A 4NZNA 4DCTA 3V8PA 2FTKE 2ATCA 5DNDA 3RC7A 4LOJA 5I47A 2Q6OA 5JQWA 3TCXB 5K20A 1V71A 1F6BA 1NVDA 3H42B 5IK2A 1M8GA 4RD2A 2I2BA 3AUTA 1ECLA 1SUBA 1OILA 3BMOB 1JZTA 1KFKB 3CSUA 1L5OA 3KFXA 4L72A 4WZ6A 5C8ZA 3MSCA 5FUWA 5JMPA 1GARA 2CVPA 3U13A 4GIBA 4YA6A 5HE9A 5A4AA 1YKSA 1UWKA 3G9XA 4XRRA 5CVEA 4CZ2A 1Z4QA 1JAYA 1TEZA 4YRZA 1UK8A 2Y0DA 1E59A 4OK5A 2AQHA 4UHKA 4EUNA 4J6EA 4QTYA 4B2PA 4GOJA 5JFGA 1E3IA 1QGUB 1COWA 3DMTA 5A7HA 3PRHA 2R84A 3RTDA 1UCFA 1QFYA 3EWIA 1DAFA 4ZODA 7GPBA 4XB2A 3QOXA 2ZCJA 2QD5A 3OPNA 2B4QA 1UJ2A 5B3KA 1XNRB 4KFRA 4OXXA 3TZBA 1N4AA 1ZK4A 3OQJA 1GKLA 1PL6A 1CUGA 4RVNA 1GSHA 2EIXA 1NKVA 2IDZA 3MYRA 1G9XA 1G9SA 2QZPA 3CEAA 2HBRA 3HE3A 2VAWA 2VJYA 2R8RA 4QOSA 1QGAA 5DKFA 2X1HA 4PQRA 1I94B 2FP4A 5B58T 2B1QA 3DQPA 3SSOA 2C5GA 3VKGA 3QPDA 2HSDA 2PZMA 2BFNA 4LVCA 3KDAA 1A9XA 4OXNA 4IJVA 4RJTA 3AETB 4AZ0B 1SVNA 3TZQA 1UT5A 3SJZA 5I48A 3ZNNA 2X6QA 4HMPA 1ZJJA 1OAKA 2NGRA 1KIAA 3TLJA 4TMWA 4RKQA 4BV2A 2I7XA 3KT0A 3NOXA 4G01B 1KY2A 4P2BA 4FJ0A 4HAZA 1OIVA 3HB5X 1ZMBA 1VFNA 4J0HA 1SBNE 4X8OA 1YOBA 5MFPA 2CGEA 3UMVA 5G53C 2EOAA 3DEAA 5J2UB 2DQYA 1NBME 4B4UA 2J9XB 5EUCA 5AP9A 4X8MA 1VJCA 2DHDA 2GPSA 4FJ2A 2FJUA 3D8HA 3IE2A 3MBOA 4LTMA 1II8B 8MHTA 1BXGA 1DIRA 1GPDG 4GWLA 5WRFA 4HVCA 5JHHB 3IP3A 1R8JA 2RHDA 4KLCA 5IT4A 4GPAA 3FOBA 1ZJ6A 2ZK7A 2NV2B 2ECPA 1IL0A 2FK8A 3KFLA 1MB4A 1VXOA 4PFJA 5CTAA 4RX1A 3TTUA 3F7OA 5GY7A 2O52A 3BRWA 4J3NA 1SAYA 1HNWB 2WU8A 2O8BB 5KPJA 2V3VA 1LNZA 3DWGA 2YW9A 1NXXA 3G59A 3PXUA 3IESA 4OLAA 3M70A 1AKEA 5B6IA 4FN5A 3EXIB 5EXSA 4KXWA 1YWGO 2BP7A 3MLAA 4N5NA 4NKRA 2H07A 2Q6VA 4NU6A 5D6NA 3PDUA 1RYMA 4GKJB 3V46A 4M0PA 1L7BA 3FPCA 4BEVA 4FNGA 1Y37A 2WT4A 3IDZA 3DVQX 3B3QA 4PZPA 1MR3F 2D1RA 1HQCA 2P9YA 4O63O 4BOYA 3JVIA 3UV6A 3ONEA 2QMHA 4KWIA 3EIXA 4LZLA 2IOFA 3M4XA 3PDCA 4QULA 3BXOA 4BZWA 2Q1UA 5JASA 5JWRA 1X1CA 1AHHA 2DCUA 3C1UA 2WTUA 2WLTA 4P5DA 1LC0A 1J97A 4U1RA 4XX0B 1XBTA 4G26A 4Q34A 2NZVG 3V1KA 3W8EA 2YN4A 4II3A 5IDWA 3OM9A 4ZQBA 4B33A 3D7NA 4E1VA 1UDWA 2YQ5A 1WHSB 4ZGBA 4G4JA 1MLDA 4BCDA 5E0OA 1S0UA 3BVPA 4G0YA 2Q2QA 2G3YA 3ZH9B 1SU7A 5FFNA 4UOEA 3K0AB 2GO7A 3QH4A 5FWNA 4EM6A 2XRZA 5I6DA 4OU5A 1JIXA 2LGJA 4GSLA 1COZA 2X0DA 5JPDA 3Q3HA 2JZNA 1CXZA 1ISMA 2E1RA 2AXEA 3OFND 4HGZA 4GXQA 4QUBA 2VHQA 4AY5A 1J8QA 1Z3IX 3EWSA 3DD1A 4XDZA 2ERXA 5AM2A 4L50A 5BQ3A 3KQOA 2C92A 5HOQA 1TAHA 3W78A 4BKRA 2NO5A 1OH5A 4CT5A 3ZYZA 4CI9A 2QF7A 3FNQA 3DP9A 4ZQHA 1MC8A 2R1TB 3HBNA 3ZE1B 1PJ2A 4JLBA 4M9RA 2VTKA 4KO4S 3ZZ0A 2I62A 3ZCTA 3CPEA 1YHNA 3QU2A 4J4HA 1GZ6A 5KJ6A 1ZIYA 4D6PA 5LXTB 1IN7A 2ODBA 1QPBA 4Y1EA 2ZI3A 3K0KA 4IEFB 3WL4A 3AVTA 1SVOA 3RS3A 3WMFA 2OCPA 4TMXA 2FR8C 1QUEA 3QHPA 3GUCA 2RMKA 2OBFA 2YYYA 2X9QA 4OBEA 2HF2A 3OCZA 1L5VA 1XI2A 1KERA 4QD3A 3O9ZA 5HJEA 3KTAB 5JAPA 4PG7A 4BATA 4YI3A 3HB9A 4A16A 1DUSA 1JHQA 4KQ9A 3OHSX 4KFSA 2FPPB 1MRZA 4GE3A 2ZE6A 5KJEA 1AD2A 4OQDA 1K89A 1HLDA 1N6NA 1NVAA 3B1VA 3UJAA 1E6MA 1P0QA 1JFFB 1XA3A 3TNDA 3WI7A 5C51B 4DV3B 1N5KA 3CUUA 2C77A 3H2SA 2BMDA 3Q7EA 4YR9A 4W1PA 2ZULA 3QQPA 3DPIA 3PVZA 1C3OB 1T3TA 4C29A 2QX6A 4OD0A 1L4MA 1QLWA 2QN2A 4RK4A 3UAOA 3ZIAA 1E9EA 3HG7A 5ADUS 1H69A 5KYXB 2JJYA 3A4YA 3UFXA 1TAQA 1IWOA 1FRZA 5FBQB 3UJ7A 2AYXA 5C8YA 3PEFA 1A82A 3DSRA 1TMKA 4FOSA 3OU6A 2BBWA 2HIAA 4GW3A 4R8RA 5KI6A 5HKKA 2NU6A 3AYZB 1D1SA 5IN5A 4MV1A 2EAUA 2C03A 3VPHA 3P2IA 1M5UA 4MH0R 1H4TA 2UZIR 1I14A 2X76A 1LV7A 3FIUA 3NBKA 4GMFA 2HJHA 4K9RA 5G1OA 2X3UA 3GXOA 5C4IA 2Q4RA 4TV9F 4FHGA 3ROZA 4IIJF 4XM1A 5A7FA 4G9GA 1GD1O 1EFVA 1GRCA 1XNHA 1YQ9A 1HNZB 2RHMA 4OI2A 4JI0B 3AI2A 1XXHE 3BTOA 2W9XA 2XUFA 1LI5A 1XQ9A 3DE4X 3FWYA 3GLKA 3HXTA 3HWX1 3X1WA 4PBSA 4YRIA 1OREA 2MTBA 3PUZA 4HRVA 3TE7A 4YHHB 2E18A 4IZOA 3TQTA 1Q7CA 2PY6A 2OM2A 5EJ5A 5JH7B 4WBNA 5FBKA 2V7QA 2E7ZA 1VDZA 4UHDA 2DJIA 1UBOS 2R8OA 4DLSA 1X1AA 3TAHA 3RTBA 3SC6A 4YP1A 3ZI4A 1X7XA 3ENVA 4I81A 4PC2A 3AONB 1JA0A 3LO8A 4RAQA 3AEUA 3SJBA 4YP0A 1NLFA 2O1EA 1G5RA 5EIFA 2VTBA 1E0JA 1NRIA 2K4MA 5IJWA 3TFOA 4HXGA 3W04A 1E4VA 3LL4A 3CZRA 4F56A 3TR6A 4PSDA 2PGNA 3M6XA 1RRVA 2G71A 1F2TA 2EV9A 2W6PA 4R3WA 4QYTA 4ND6A 3UAZA 2ZYWX 3H0KA 2DUWA 3A1FA 1J09A 1QGZA 3LI2A 4WZAB 2ZIWB 4TMYA 3ACBA 2Z09A 2AOTB 3QWIA 4ACAA 2Y4NA 4ND4A 4XCVA 3NT2A 2VJPA 2J0UA 3LVQE 4EB0A 5KDOA 3RSQA 1WPQA 3KE9A 2Y1GA 3E9NA 4U2FA 4CQMB 2W8BA 1EG7A 4FS8A 2G5GX 3G5LA 1H9CA 1JLHA 2B83A 4R1MA 3AVUA 1URPA 4XM0A 4XD7D 4RL4A 1FTQA 3DLCA 1UWLA 3SZLA 1J1IA 3D8UA 3M1YA 1L1FA 1T3LA 4XE5A 3IIEA 1W2GA 2HNAA 5IVDA 5FX2A 1HLGA 2RARA 3ONNA 3FCSB 2GRUA 2IXAA 3QNWA 4J16C 1ISFA 3IDAA 3PNQA 2P9EA 1HYBA 1N0IA 3N2ZB 3OZEA 4IOJA 4X3CA 1Y63A 2FSUA 3IHKA 4RKYA 3PSAA 4CT4B 5TQ0B 2GXSA 2M9MA 4IGEA 5AO9A 4UFNA 1JSCA 4H4CA 1B14A 1N25A 1C4XA 1NN1A 4DCSA 2I67A 3CTMA 3NTXA 4MQFA 3CNNA 4GWKA 3MD9A 2OUIA 2XXAB 4J90A 2IV7A 2NUAB 2Y6VA 4LJYA 4JUAA 3P7MA 4JL6A 1GFZA 5KSWB 4B9AA 1GDHA 2FGKA 2IKSA 1BDBA 3RT9A 2C5HA 4MK4A 3SEAA 5AXDA 4L6CA 1VYTA 2X3YA 4LZNA 3SHFA 4BLPA 4YQFA 5IKXA 1E1MA 3LUFA 2HLHA 3QEAZ 1EDZA 1NW3A 2YV4A 2G5CA 2WM8A 4HUJA 2VWHA 2XD4A 3B6EA 4LYJA 2VNHA 1AKTA 1BEUB 4FBGA 3ZKAA 4B6JA 1M54A 4Z1MD 1PZFA 2IELA 1CEYA 1J0CA 3R3VA 1L5QA 4Y2VA 4ZMBA 2A8YA 4QBGB 1NMYA 4MMXB 4Q3OA 3BFPA 1S02A 4UNQA 1Y4SA 4P2GA 3TR5A 3HSYA 3FRHA 2XVZA 3CCCA 4AZVA 3FE2A 2YJTD 1O95A 4X1KA 1KHHA 2ZU0C 3JTEA 4HXYA 3ITKA 3FTPA 1TF2A 3I4LA 4Q4DA 4ZVSA 2NTVA 5LCXA 1J39A 1TW3A 4HN9A 4S1WA 3WGQA 4YCMA 3CVXA 2IHNA 1P31A 2FUG6 1H6AA 3RGGA 2QVLA 3BD8A 3NT4A 1LDEA 4NK5A 1Y8QA 3OTIA 1CEXA 1NM5C 4IIJA 4BQNA 5D87A 5BVHA 2JLXA 2JEZA 2ZB3A 3G2PA 2OOSA 4GYYA 2YOFA 3GEDA 2QRNA 4B46A 2GJAA 4E88A 1CDDA 4QYXA 4I5EA 3M3DA 1U8EA 1B15A 4E31A 5JXIA 3C3WA 4YCAA 3X44A 4YJ3F 4IDNA 4L02A 5F2EA 5TPZA 1MO6A 2GA9A 3FF4A 1CY7A 4KX5A 3D3WA 3D6VA 3J81A 3RAFC 4I1RA 3AWIA 4Y1FA 4AF7A 5JC8A 1CUCA 1BNCA 2P67A 1HDEA 2FMTA 1XPOA 3C3EA 2XE8A 1QHFA 3H16A 1OR8A 3NBUA 1JZSA 2ZJAA 4DTCA 1Y8CA 3EUWA 4RSGA 5JNLA 3OX1A 2GRJA 4QOFA 4ND7A 4YPFA 1YH3A 2G40A 3A1VA 1W5SA 4EIWA 3B3GA 5K6AC 4K05A 5HR5A 3MWDA 4TS4A 1KYWA 2BZGA 1IEXA 3DTYA 4O59O 2PE5A 5CK5A 4UTVA 2DB3A 4II2A 2YVKA 3D6FA 4P82A 1I3MA 4K26A 1E6WA 2PFKA 4A2WA 3IODA 3O83A 5TB5A 4AJIA 1DWQA 1C30A 2YRXA 1R0YA 3TRKA 3UICA 5FF9A 2CLEB 2ECFA 2GHRA 4D0LB 4B3BA 2G9NA 3M2TA 3DDUA 3HKBA 5LYJB 1HNXB 3LKDA 2DEUA 1UMBA 3MN1A 3DDSA 1E62A 3M3HA 1WQ4A 2QRLA 4BFTA 4PPGA 3HCBA 3AB7A 4FYYA 2XVYA 2C61A 1OA1A 2VUTA 2A5YB 3W1EA 1PGNA 2QAIA 1W87A 3DYBA 3PX2A 1YVDA 3Q3GE 3S28A 3UW1A 4KUHA 1C1HA 1CZKA 3WWYA 3FKSD 5E2AA 3C2QA 3O75A 3R9WA 1OXTA 4IDEA 1E9CA 1IVNA 5CGZA 3SQDA 4NFSA 3NIDB 5AKGA 3EDCA 4ZCMA 1F06A 3DF9A 4MUXA 3DOIA 3QLVC 5G41A 3O21A 4C0HA 5HZGA 4DGSA 1BIFA 2QZSA 1W59A 2GNPA 2BKUA 2O2YA 3EGOA 4OSEA 4TLDA 4C01A 3LPDA 3ZK9A 1EVEA 3H1TA 3LGSA 1NHGA 3PPIA 4GP7A 1NP6A 4JJ4A 1IMOA 1R9NA 3PKJA 1SKAA 2AFVA 5EP4A 5F78A 3VVBA 4S04A 3T7TA 3GJTA 3U0BA 4MNTA 1LDMA 4Y9TA 5K3FA 1WW2A 4EJSA 3F6CA 5DLEA 1P9NA 5I7SA 4B7XA 3WWDA 4IRMA 1M2NA 2LXNA 4TL9A 6Q21A 3DTVB 4R2KA 1SQ6A 5TT0A 1QQAA 2NUPB 5DN6D 1SUPA 1E4OA 3BDVA 3R3XA 2WU3A 4IO1A 3HJHA 3TLZA 1YZGA 2ZTMA 3OOWA 4HWRA 4P80A 4Y0AA 4ERNA 1YB6A 3B3FA 3WL5A 3CLSD 5CBPA 3BICA 3ACCA 2FSPA 4Y2TA 3KKZA 2I2WA 2JIQA 2FPKA 3I9MA 2XZDA 1PG0A 5CJJA 4M9ZA 3H2KA 4YV0A 3LCMA 3NNDA 1M7GA 2FSFA 4QBTA 1ZMXA 4XRGA 4BFVA 4FXOA 4YMIA 1M6NA 4C9BA 1W6UA 2EHJA 5ECGC 4GI1A 1U5CA 1NZJA 2CJYA 2NV6A 1KI6A 3DL7