3U3PA

The s-sad phased crystal structure of the ecto-domain of death receptor 6 (dr6)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
164
structure length
164
Chain Sequence
IGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S-SAD phasing study of death receptor 6 and its solution conformation revealed by SAXS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 21
total genus 27
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00020 TNFR_c6 TNFR/NGFR cysteine-rich region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3u3pA02
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3u3pA01
3ME4A 4KGGC 1D4VA 4YN0A 5IHLA 3ME2R 3X3FA 2X10A 2UWIA 4E4DR 1ZA3R 1EXTA 3ALQR 3QBQB 3U3VA 5DMJA 4N90R 4I9XC 4FHQA 3THMF 4RSUD 3MI8D 4OD2S 2AW2B 4MXWR 1FT4A 3U3PA 4BK5A 4M4PA 2HEVR 4BK4A 3URFZ 3MHDD 3IJ2X 2HEYR 3TJEF 4MSVB 3BUKC 1JMAB 1DU3A 3U3QA 1NCFA 3QO4A 4GIQR 4KGQC 5BNQR 3WVTA 3K51B 1TNRR 3FL7A 2H9GR 3MBWA 5CIRE 1SG1X 4M4RA 5L36B 4J6GC 3U3SA 1D0GR 3QD6R 3U3TA
chains in the Genus database with same CATH superfamily
3ME4A 4KGGC 1D4VA 4YN0A 5IHLA 3ME2R 3X3FA 2X10A 2UWIA 4E4DR 1ZA3R 1EXTA 3ALQR 3QBQB 3U3VA 5DMJA 4N90R 4I9XC 4FHQA 3THMF 4RSUD 3MI8D 4OD2S 2E4VA 2AW2B 2E4UA 1FT4A 2E4XA 4MXWR 3U3PA 4BK5A 2QR6A 2HEVR 4M4PA 4BK4A 3URFZ 2E4WA 3MHDD 2HEYR 3IJ2X 3TJEF 4MSVB 3BUKC 1JMAB 1DU3A 2E4YA 3U3QA 1NCFA 3QO4A 4GIQR 4KGQC 5BNQR 3WVTA 3K51B 1TNRR 3FL7A 2H9GR 3MBWA 5CIRE 1SG1X 4M4RA 5L36B 4J6GC 3U3SA 1D0GR 3QD6R 3U3TA
chains in the Genus database with same CATH topology
3ME4A 4KGGC 1D4VA 4YN0A 5IHLA 3ME2R 3X3FA 2X10A 2UWIA 4E4DR 1ZA3R 1EXTA 3ALQR 3QBQB 3U3VA 5DMJA 4N90R 4I9XC 4FHQA 3THMF 4RSUD 3MI8D 4OD2S 2AW2B 4MXWR 1FT4A 3U3PA 4BK5A 4M4PA 2HEVR 4BK4A 3URFZ 3MHDD 3IJ2X 2HEYR 3TJEF 4MSVB 3BUKC 1JMAB 1DU3A 3U3QA 1NCFA 3QO4A 4GIQR 4KGQC 5BNQR 3WVTA 3K51B 1TNRR 3FL7A 2H9GR 3MBWA 5CIRE 1SG1X 4M4RA 5L36B 4J6GC 3U3SA 1D0GR 3QD6R 3U3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ME4 A;  4KGG C;  1D4V A;  4YN0 A;  5IHL A;  3ME2 R;  3X3F A;  2X10 A;  2UWI A;  4E4D R;  1ZA3 R;  1EXT A;  3ALQ R;  3QBQ B;  3U3V A;  5DMJ A;  4N90 R;  4I9X C;  4FHQ A;  3THM F;  4RSU D;  3MI8 D;  4OD2 S;  2AW2 B;  4MXW R;  1FT4 A;  3U3P A;  4BK5 A;  4M4P A;  2HEV R;  4BK4 A;  3URF Z;  3MHD D;  3IJ2 X;  2HEY R;  3TJE F;  4MSV B;  3BUK C;  1JMA B;  1DU3 A;  3U3Q A;  1NCF A;  3QO4 A;  4GIQ R;  4KGQ C;  5BNQ R;  3WVT A;  3K51 B;  1TNR R;  3FL7 A;  2H9G R;  3MBW A;  5CIR E;  1SG1 X;  4M4R A;  5L36 B;  4J6G C;  3U3S A;  1D0G R;  3QD6 R;  3U3T A; 
#chains in the Genus database with same CATH topology
 3ME4 A;  4KGG C;  1D4V A;  4YN0 A;  5IHL A;  3ME2 R;  3X3F A;  2X10 A;  2UWI A;  4E4D R;  1ZA3 R;  1EXT A;  3ALQ R;  3QBQ B;  3U3V A;  5DMJ A;  4N90 R;  4I9X C;  4FHQ A;  3THM F;  4RSU D;  3MI8 D;  4OD2 S;  2E4V A;  2AW2 B;  2E4U A;  1FT4 A;  2E4X A;  4MXW R;  3U3P A;  4BK5 A;  2QR6 A;  2HEV R;  4M4P A;  4BK4 A;  3URF Z;  2E4W A;  3MHD D;  2HEY R;  3IJ2 X;  3TJE F;  4MSV B;  3BUK C;  1JMA B;  1DU3 A;  2E4Y A;  3U3Q A;  1NCF A;  3QO4 A;  4GIQ R;  4KGQ C;  5BNQ R;  3WVT A;  3K51 B;  1TNR R;  3FL7 A;  2H9G R;  3MBW A;  5CIR E;  1SG1 X;  4M4R A;  5L36 B;  4J6G C;  3U3S A;  1D0G R;  3QD6 R;  3U3T A; 
#chains in the Genus database with same CATH homology
 3ME4 A;  4KGG C;  1D4V A;  4YN0 A;  5IHL A;  3ME2 R;  3X3F A;  2X10 A;  2UWI A;  4E4D R;  1ZA3 R;  1EXT A;  3ALQ R;  3QBQ B;  3U3V A;  5DMJ A;  4N90 R;  4I9X C;  4FHQ A;  3THM F;  4RSU D;  3MI8 D;  4OD2 S;  2AW2 B;  4MXW R;  1FT4 A;  3U3P A;  4BK5 A;  4M4P A;  2HEV R;  4BK4 A;  3URF Z;  3MHD D;  3IJ2 X;  2HEY R;  3TJE F;  4MSV B;  3BUK C;  1JMA B;  1DU3 A;  3U3Q A;  1NCF A;  3QO4 A;  4GIQ R;  4KGQ C;  5BNQ R;  3WVT A;  3K51 B;  1TNR R;  3FL7 A;  2H9G R;  3MBW A;  5CIR E;  1SG1 X;  4M4R A;  5L36 B;  4J6G C;  3U3S A;  1D0G R;  3QD6 R;  3U3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...