3U3RA

Crystal structure of d249g mutated human sult1a1 bound to pap and p-nitrophenol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMGHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 94
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u3rA00
3AQ4A 5J5CA 3QPUA 5KU1A 2RMKA 3WBKA 1Z6XA 2RGXA 4UNRA 3B9PA 1DE0A 4Q9KA 1DAKA 2W6JD 1AS3A 1HEIA 2ATXA 2EFEB 4IW3B 5KSPA 3W9YA 1DAEA 3U5ZB 4RFSB 4NYJR 1W2GA 4D0LB 2A5GA 2ZROA 4IOMA 3U44A 4YLGA 3AF4A 3EWAA 1GWNA 4KYUA 4EJSA 1G8GA 3T34A 4TYQA 3QF7A 4TSFD 3LAWA 4BPBA 3Q72A 1NMZA 5BN5A 1Q0UA 5FL7A 1J8YF 3FWYA 3CNLA 3SYNA 4JLPA 2GK7A 4NCNA 4B44A 1ZNZA 2PX0A 3LLMA 1N2CE 4Q48A 4PXAA 2CLDX 5JS8A 2JJ2D 2B92A 4KVGA 3L0OA 4TSFA 3KQHA 1WDTA 1Q44A 2IUSA 2FZLA 2FFAA 2X8AA 3B60A 3P4YA 4RD0A 4F4JA 2ZS8A 5JSZA 4C2TA 1DAFA 3R9XA 1EESA 1CR2A 5C4GB 2Q9CA 1P2UA 3K0FB 4Q1DA 1G8HA 1IBRA 1A2KC 2LKDA 2DBYA 3FGNA 3THWA 2REXB 1D9XA 1XD9A 1T0JB 1TF5A 4K81B 2QENA 4MRNA 1H8HA 1WQ1R 1E2KA 2P65A 3CO5A 1HV8A 3RWMB 2OCPA 3ECCA 4JL6A 6Q21A 4B3BA 3CH4B 1IN5A 3TW4A 2V54A 2GXAA 4NPHA 4HDCA 2YZ2A 1G8PA 2OUKA 3BFVA 5CIWA 1NY6A 1F2UA 4GT1A 2OLKA 1G3UA 3WXMA 2GCNA 1Z8FA 5A0FA 3VHXA 3KDSE 1VECA 1ZRHA 4RCZA 1P3JA 2JLSA 3CR7A 1ZMXA 4MKFA 1LW7A 4M1KA 3TW8B 1N6RA 4C7OB 2W6IA 1E9SA 1SVIA 2AHOA 1CULC 4YC7A 2BMEA 1W36C 3LWNA 3GLHE 2ZE5A 2BVNA 4IVPA 2OESA 4NCKA 1MV5A 1PUJA 2FWRA 3L82B 3OZXA 4NKRA 5IK2D 2QT1A 3OF5A 1XZPA 3F8TA 2IYXA 3LXRA 3SFZA 3CNNA 4UXIA 1HH4A 2BIFA 1A5TA 1GILA 3O8CA 1IY2A 3QXXA 1AN0A 5CIQA 3REFA 1H65A 4KFTA 2OILA 2CL6X 2F43A 5CYOA 3TR0A 2JLZA 2JLYA 2QGNA 4D2IA 4B3FX 1KSGA 4DJTA 4LJ5A 1J70A 2VEDA 3HYRA 4NCHA 4WVFA 3W6PA 1OW3B 3EWSA 2R9VA 4TLCA 2ZYUX 2GCOA 5FI0B 3IIKA 2IS1A 3IHWA 4QG7A 3CUEF 1LF0A 2WOJA 4Q01A 3VKHA 1QVAA 2B7CA 4TZ0A 1GSIA 3N2EA 2CHGA 821PA 2F43B 3GJ0A 4BFTA 2XNDD 4PAMA 2Q0HA 2Z5FA 4JBXA 4PSAA 3OFNA 4GOKA 4TYPA 5JEDA 4DLSA 1E96A 4A82A 3PR1A 4AD8A 2P6UA 4ZO4A 4JIMA 1XXHA 3HPQA 1JNYA 2GXSA 4IFEA 2ZRPA 1UJ2A 2FSHA 4QHTA 1LY1A 4FD2A 5AWFC 4GRAA 3ICEA 3MSXA 1S1CA 4MYTA 1TMKA 3BXZA 4Z51A 2R6AA 3GLFB 1OIXA 4LV5B 1Z0AA 3W5JA 1DS6A 3U3MA 3A1TA 1GITA 3UANA 3HYTA 1VYUA 1Z63A 2O8EA 4FMCF 5DI3B 2CVHA 5FFMA 4C0QC 3FHCB 2A2ZA 4MDEA 1B23P 1XX6A 4PHFA 1E2EA 1TPZA 1P5ZB 3SJAA 4A0FA 4A2WA 4ASUA 3OEEA 2QBYB 4LHVA 4QXAA 3TSOA 2O8DB 1NN5A 4HDQB 4LHWA 1YZQA 2H1LA 1N6HA 4Q1AA 1XPUA 5DLQC 3CRW1 4HAWA 1N6OA 4Q7JB 5DHAA 2AFIE 1U0HC 5FBQB 2CDNA 3SJCA 4ITRC 3K0AA 2OBNA 2PH1A 3ND8A 4JLDA 3LRPA 1WRBA 2IYYA 1OXSC 4IXMA 3PITA 1XEWY 1EG7A 5H1YA 2O8CB 1SXJD 4TYWA 4RFVA 4TWZA 3MWLA 2ZEJA 4XSHA 4XTCS 1P72A 4HAZA 4KITB 1E6CA 5IDVA 3AKYA 2W2XA 5P21A 1MH1A 2ZSAA 5KOYA 4OQNA 1KZGB 4JZKA 1E2PA 1W46A 5BYKA 4HUQB 5FTJA 3F0TA 3QVVA 3AH8A 2VTKA 4IDHA 1TEXA 5AK0A 3R8CA 3NBFA 2EWVA 3RVBA 5CB8A 1R5BA 1NIPA 2WKPA 1NP6A 3PUVA 3RRZA 1XTRA 1WP9A 1YRBA 2ZSDA 3VQTA 1FW6A 1XP8A 2ZRAA 5JEEA 1OIWA 2Q9AA 4JLNA 1KDRA 2EFDB 1CJUC 4DIDA 1W44A 3TRFA 1SVSA 3RDPA 2ZAMA 3QE0A 2DWOA 4LPSA 1CRQA 4Q4AB 1W2HA 4UKDA 4RFSA 1XEFA 4X8HA 2LCFA 4MYHA 2FDCA 4ZPXA 1NSTA 2GCOB 4B73A 4QKQA 4RVCA 3A4LA 4QHSA 2V7QD 3K9GA 4A8JB 3M6AA 5LPNA 4OHZA 1NBME 1OV4A 2AWOA 4QL3A 3KZ1E 4AYXA 2C96A 4NYMQ 1WBDA 4PQRA 1LNZA 3IO5A 1KY3A 5EE1A 5F3WB 4MITA 1TQ6A 3S1AA 4JJZA 3AVWA 2ZTSA 3MUFA 1KY2A 1BH2A 3K1JA 5E7JA 2R62A 2YWHA 1X8KA 1W4AA 2XITA 5DH9A 4X8MA 4C0JA 4LBVA 2IK8A 3QXJA 2GXQA 4P3YA 5IHPA 1F2UB 1GUAA 2F1JA 2GF9A 2IXFA 4EUNA 4B2PA 1XD8A 1OJLA 2WTUA 2GBLA 3EPJA 4LYFA 2RB4A 5CJ2A 5FR1A 4TZ6A 2OM2A 2GF0A 2ZI6A 1KAOA 2FX3A 4OHXA 4DCSA 4IDQA 5JCPA 4QNMA 3EA0A 4PO1A 3IBGA 5FTKA 4ABYA 1IN8A 2KE5A 4DCVA 2GETA 4MRSA 4XOIA 4JLBA 3SQXA 3GLHA 1TF2A 1GG2A 5C18A 3C5HA 3OESA 2OO7A 1TUEA 1ZW6A 1TX4B 2ZM5A 2IYUA 4URUR 1R8SA 2IEZA 2QP9X 2RGNC 4JVSB 2CE7A 4WZBE 2CHVA 5FOUA 3BB3A 1NI3A 2GA8A 5DIFA 2IF0A 1Z6GA 2WIAA 1U8ZA 2GAAA 5AJZA 4C0AC 1IN4A 1L4YA 2VP2A 2FNAA 5TB5A 3OEHD 5K8UA 1XTIA 1DO0A 2YNMA 5M04A 2HF8A 4FI3C 2VP9A 1SGWA 1XCPA 2C8VA 3TE6A 1TQ4A 3WYGA 1JBKA 2JA1A 4LBYA 4ASUD 1UEJA 4FMCB 4JVNA 1MO6A 2XTNA 1G5RA 5H70A 2WJVA 4Q4LA 1VCNA 2GJKA 1U2RA 1VG8A 2YWFA 4DDVA 1TEVA 1M2OB 2G88A 4HLUC 5F2EA 2MSCB 4C7OA 1G7SA 3AVQA 3RANA 3I4LA 1Q3HA 2JLVA 4B75A 1XMSA 1NRJB 1WMSA 2HLDD 4JLMA 3KTAA 4DLWA 1Q1QA 4GZMA 2XJ4A 3MWJA 1KMHA 1VHLA 3OIVA 3B1YA 2WAYA 5J4KA 2IS4A 4LJ6A 4PAOA 1U9IA 3H0KA 4Q21A 1FTSA 2EFCB 2BBTA 4G1UC 2ZRKA 5HCNA 4IDNA 3D31A 3ZGXA 3BD9A 3FB4A 1R0WA 2W83A 5L8VA 2EU8A 2N1BA 4BZXA 3M0EA 1AA9A 4TLDA 2PMDA 4PZYA 1G9XA 1JQJC 5BXQC 1J8MF 1W48A 1Z3IX 3TSZA 5JRZA 2IYWA 2SHKA 3H4MA 5H68A 3B8HA 3T5GA 4DLZA 4FCVA 2RCNA 4Q00A 2MMGA 4Q1BA 1G3MA 3GLGB 1G7RA 3TQFA 3D3QA 5FPSA 4W5JA 2C78A 4LZZA 4S35A 2ZR7A 3CPHA 2WWIA 2V1XA 2Z0MA 2EVWX 2IXGA 1JXMA 3UG7A 1IOZA 4PC3A 4L5BA 2YYZA 2V4ZA 4EQ6A 3MCAA 5LD2B 2IT1A 3CIOA 5JJLA 3RRMA 5JLJA 2DWQA 3H84A 3A6PC 3FMFA 4QNRA 4YMWA 1E4YA 1TQDA 2QEQA 3BH0A 3D8BA 4OHWA 1P61B 3NHAA 2ZUCA 4M2LA 2DFNA 1OPXA 3K0CC 2C77A 4BFXA 3MLEA 1FX0A 721PA 4N0EA 5E3HA 2CL7X 5SZHB 3I62A 1KO8A 4PR0A 1SKYB 2YHSA 1XTSA 2GILA 2TMKA 2MSDB 4C0SA 3KXLA 4RD3A 1P73A 4TLEA 2VYFA 3OE7A 4HLUA 2CVFA 221PA 2ODEA 4Q7KA 2GHIA 1KI9A 3RLFA 4PC6A 1QHYA 1IJEA 1D6JA 1H8HD 1XCMA 4G0NA 1AQYA 1LV7A 3X1ZA 4C0KA 4QM7A 4LOAA 1KJYA 4DDUA 3DMDA 2QY9A 1XTKA 3EZ6A 4B2LA 4NTZA 1KMQA 4UQOA 1Q21A 3AF1A 2KBFA 4ERNA 1UM8A 5BQ5A 4JS0A 3KQNA 2BEJA 1AIPA 4I1UA 3QXCA 5FL3A 3PJRA 5KHOC 1GOTA 4O3MA 1ZCAA 3RWOA 1F5NA 2ZYWX 2OFWA 2YVUA 3U4QB 4Q7MB 3U61B 2JGNA 5JSZB 4HAXA 1NLYA 2G0TA 1KDOA 2ASEA 5JJIA 2FEOA 4MRVA 5FOSA 2VHJA 5BWMA 3ZJYA 3A58B 1L4UA 2AXPA 4AG5A 2J0QA 2FFHA 2XTZA 3LA6A 1NG1A 2C9OA 4QRHA 3IBYA 2ZRMA 4Q4JA 1S2MA 1D2NA 2ZRFA 5EE0A 3RS5A 2R6FA 1Q1EA 4BQSA 4URWR 4LUCA 5J47A 5AUNB 2XJ9A 3GJ7A 4RY2A 2VO1A 3B5JA 3BERA 1KI4A 4LYJA 3RNLA 3MGCA 3NBYC 4LI0A 4XWOA 2HF9A 4B35A 4DIEA 1B0UA 1G19A 1Y63A 1IN7A 2I1VB 4TL8A 2NO0A 3OAAA 4XVRA 3GPLA 1CJKC 2F55A 1ZM4A 4MGYR 3LQRA 3TVTA 4MUBA 1EX6A 2ZJBA 1S3SA 1W1WA 2OFOA 1FUUA 4P4SB 5BW8A 4GZLA 2W00A 4YDHB 1FQKA 1XRJA 5JMTA 1G4AE 1TADA 1D8TA 1KIMA 3R7WA 3BB4A 1KKMA 4D0GA 3SHWA 3PVSA 3R9WA 3FKQA 3QPWA 1E2GA 3QXSA 1PLJA 2A5YB 4PHGA 5DGXA 5FL7D 2J9RA 3IEVA 4P33A 2OT3B 2P3SA 1VYVA 1II9A 3A37A 3IUYA 4Q4JB 3TR5A 1JEEA 4OYHA 3FE2A 2REBA 3BAFA 3F5FA 1A2BA 1J2JA 1ESNA 4FW9A 4V0OA 2WPDA 4ZIRB 5GVSA 1G291 3HDTA 1RPZA 2DR3A 4MRPA 3W6OA 3TUJC 3NH9A 1IHUA 3QQ5A 5EE3A 1OFUX 2H92A 4DUGA 5FI1B 1KOFA 3KKMA 3ICQB 3TLXA 4OBEA 1OIVA 1XJCA 1ELOA 4DLXA 5IF9A 4DB2A 1G64A 3RYTC 3ETLA 2D3WA 2GCPA 1E1RA 2HEIA 4Q18A 2XOKA 1LF5A 1L7VC 1ZUNB 2C9YA 1XPRA 4BRWA 3RC8A 2YOGA 3GLHB 2CCGA 2A7QA 2J87A 3L0IB 2RAPA 5FUWA 3W3ZB 1E4VA 1Z22A 5TV2A 4BEBA 2A9KA 3CONA 4R7ZA 2ZJ2A 1NVVQ 2PT5A 3NDPA 2CE2X 2IS6A 3LFUA 1TUIA 4HEJA 4BLPA 1R5OA 2WSSD 3QUSA 1W0KA 2J59A 1LB1B 3CX6A 4GPTA 5EXPA 1XEWX 1BYUA 1DBSA 3I3SR 4AG6A 4M1YA 2HT6A 3A36A 3L43A 5E4FA 1A1VA 4JSYA 1CR1A 2ORVA 1DVRA 4IJMA 4KLZA 3VU9A 4EPXA 1QHXA 1RVDA 2FG5A 5KDOA 2OV2A 2OCYC 4K46A 3HU1A 4MKHA 1KI6A 2QPTA 3I73A 2BDTA 4YMVA 5L3SA 1OE0A 4OKSA 4HZUA 3X1XA 3B1WA 4GBMA 2AWNA 3KKOA 2J41A 1IXZA 5AJXA 4Z1MA 4KODA 3LDAA 1YQTA 1EFRD 3DL0A 1W7AA 3T61A 2WZQA 1GRNA 4L15A 4Y0VA 5EP3A 3SEAA 4E5UA 3AP1A 2EFHB 2DWPA 1NBMA 2ANBA 3G5UA 3AVTA 5UKDA 1KZ7B 1KI1A 1KDPA 3P32A 1K6MA 2CEAA 2PCJA 4BFVA 4JLKA 1Z0IA 5SZJA 1KSFX 2NTYC 2P2LA 5BYJA 1EGAA 3TKLA 4HSEA 1KJZA 2WPDD 4ARZA 3NWJA 2NG1A 1BIFA 4DB4A 2UVQA 2FJUA 2OBLA 4D4JA 3SC3A 2XZLA 2WWYA 2ZI4A 2WJJA 1N5KA 1GTVA 4TYYA 3AUYA 4XSGA 1OFHA 1W49A 2BBOA 3GLFE 3MJRA 4MA4A 5KPDA 2WBLC 3BIFA 2F6RA 2HYIC 3ASZA 1ZIPA 4KU4A 3EPHA 2JIZD 3U7FB 4RKEA 4HUQA 1E0SA 1NJGA 4Q9HA 2ANCA 3RS4A 4V0LA 5L3SB 1YKSA 1J99A 1OXXK 5KNDA 1JB1A 1GL9B 2GJAA 2QRZA 4Q4HB 4AY2A 1CU1A 1KK0A 4F91B 3AEZA 2ZVPX 4ESHA 4BZQA 3WMFA 3KQLA 1VYTA 2J7KA 2ATVA 2C99A 2FSIA 5KDLA 2IHYA 5AR1A 1CJTC 2J0UA 3ZDQA 1FTNA 2J0SA 2RGGA 1QHHB 2RKOA 1R0ZA 4XD7D 1KNQA 1U94A 2BC9A 2FF7A 1DPFA 3IGFA 2ZQ5A 1ZD9A 2X19A 1QVRA 2PBRA 5KNBA 1R0YA 4M22A 2IL1A 5CLQA 4D26A 5F9HA 2QN6A 3BOSA 3C4JA 1H8EA 2ZANA 3LBIA 4Q1CA 4B2IA 1ZYUA 3SU8A 5JECA 2J45A 2HJVA 2J1LA 3BFXA 2KI5A 4JBWA 1UBGA 4LYHA 5KUTA 2XXAB 4XD7A 1W4BA 3WP1B 3M4YA 5L3QB 3E2IA 1WBBA 1L2TA 2O8FB 3EASA 2GJ9A 3UXMA 1M34E 3LH5A 2GEDA 3A8TA 5G40A 4QGFA 4WXRA 1U9IC 2GZHA 4PPQA 2IEYA 3HU3A 3X1WA 2F1RA 1U0LA 4DHEA 1NLZA 3ZD7A 3U7EB 2QGZA 5IRCD 3TGPA 1COWD 3P1JA 2NO6A 3AV0B 3RSLA 4OK3A 1JR6A 2XB2A 4NHOA 1YZLA 3MWKA 5KTYA 4C0BA 2VA8A 1R10A 1FP7A 2VF8A 1S9DA 2JIZA 2ZJ5A 1KI6B 1QHHA 2DB3A 2IF2A 2WWXA 1XXHE 2FV8A 5G41A 2RGNA 1G5TA 3RRNA 1SVOA 2JJ1D 3K53A 4DLTA 2YOFA 4YMUA 5DN6A 4L8GA 5JI3E 2IBMA 3IO3A 4CEHA 3TNFA 3VMFA 1ESMA 4PQYA 3AVOA 2HDNB 4HAYA 4KJZA 4Q03A 3SOPA 3L0PA 1XTJA 3CZQA 1T5LA 4HB4A 4HLDA 3Q8XB 2AKAB 1KO5A 3PFIA 1NSFA 1XPOA 3OIYA 1E2NA 1IONA 3HP1A 3GEHA 1SXJE 1JJVA 1OHHA 1D2MA 1CR0A 1J90A 4DCTA 2WHXA 4DLVA 2JCSA 2UZ3A 3DM9B 3PG5A 2QTHA 3TBKA 3QKRB 4A1FA 2HCBA 2J3EA 3VKWA 1M1YE 4QBHA 4QFMA 1NBMD 2FN4A 3I32A 2OFXA 4AC9A 3OEED 2EYQA 2O8CA 4B47A 3CPJB 2HT1A 4XVQA 4PSVA 4DEXA 3K9HA 1U8AA 2B8TA 3SYLA 2I1QA 1XEXB 1FL9A 4Z1MD 4DCNA 1UEIA 2KBEA 1QF9A 3GJ4A 3ZZUA 3GFOA 5HZHA 2WWFA 2QU8A 5CJPA 3AVYA 2IYRA 1NVUQ 4KXFB 3EZ9A 1HUQA 4FCTA 2V6IA 3IHLA 5E7IA 2A5DA 3QNUA 5AUOB 3HR7A 4B6FA 3TUIC 3ASYA 1AZTA 2GJSA 2CLCX 3KFXA 3FOZA 2H17A 1VG0B 2FFBA 4DDTA 2YJTD 1K5DA 4US1R 1CF4A 1KO4A 3QIAA 2F9MA 1E79A 4LGMA 3MWYW 1O3YA 4MQBA 4E07A 1FOEB 1XCGB 4V02A 4DSNA 1E3MA 1T8UA 2ZE6A 1N5JA 3CX8A 2GKSA 3HPRA 4DLUA 1E9DA 2XOKD 4I1SA 1SVWA 5JWOA 2BJWA 1EFHA 3SFVA 1NVVR 4EFMA 5EZ5A 3PEWA 3AM1A 2VQSA 5KSYA 2Q6TA 1X1RA 1HT2E 4IOKA 3EIEA 1N5LA 3GLIE 3NC1C 3EZFA 1Z06A 2WVJA 1XBTA 4IDOA 4PTLA 1LVGA 4WOPA 2XB4A 4M21A 2ORWA 3GEIA 1XJQA 2B8WA 1E1QD 4F38A 4L4UA 3GJ5A 2CCKA 4RKFA 4OQFA 2OE2A 1DG3A 4YXWD 1ZIOA 1D2EA 1ZP6A 2E1RA 3PUYA 2BKEA 3TSWA 1GNQA 4Q02A 2D7CA 2YC2C 2Z4SA 2ZR9A 3CWZA 4DZZA 2VLIA 4PC1A 2BM1A 121PA 1E99A 1XJ0A 4GDFA 2D74A 2IYSA 3O47A 4RD4A 5TVKA 5JWRA 4G01B 1IY1A 1NN0A 2QP4A 4DC9A 2AXNA 1QG2A 3P26A 3TVDA 1X8JA 2GNOA 2KB0A 2WWWA 3ADDA 2VF7A 4B3GA 1Z2AA 4KFSA 3DEFA 1NVXQ 5JRJA 4TL6A 1HE1C 3CNOA 1I4LD 4W9MC 3RHFA 1XNJA 2H5EA 3VR1A 1F3OA 3EA5A 2NOAA 3W5IA 4Z54A 4RD6A 3PUWA 4D81A 2BV3A 2ZPTX 4JSTA 5CM9C 2ZRNA 1KK2A 2GDJA 4GI7A 1ZNYA 3VU9B 4GL2A 5FTMA 5L3QA 2GVDC 1NF3A 3KJIA 4JLVA 4R9UC 5LB4A 1DAIA 1G8FA 5FTLA 3VNVA 5HPYB 1TL7C 1X86B 3UG6A 3KUDA 1E2IA 2GESA 3NBXX 4NYIR 4I1OA 4DVGA 1MKYA 2VSFA 4OI0A 1KYIA 1VHTA 2FPLA 1RYHA 1JR3A 3LW8A 1ZM7A 5JHHB 3NEJA 4O2LA 4WAUA 5C4MA 1Q20A 3L8ZA 1ZC4A 2NO1A 1T6NA 2AFHE 1I2DA 2W2TA 3AGQA 1I2MA 1JPJA 2W2VA 4BEJA 1ZD1A 2H18A 1FNNA 4M9SA 1YE8A 3QEJA 2BOVA 4US0R 2OBMA 4QBIA 5L3RA 1A4RA 4O0MA 5CB6A 1CTQA 2BMDA 1E0AA 4MUAA 2VHQA 3OHMA 4RD1A 2GXUA 4TMXA 1R6BX 3CM0A 4BFZA 4P4TA 2NQ2C 4PO9A 4ZDJA 1ZU4A 1VIAA 2WWHA 3I61A 3AVUA 2PCLA 1VIYA 2G83A 1UPTA 2A3RA 4B6EA 2WJYA 1FQJA 2RHDA 3B2EA 4HLQB 3UKDA 4GFDA 2FGKA 3KXKA 5DYIA 1SZPA 2XTMA 3CKLA 1YZUA 2ODWA 1GNRA 1KI7A 3K0FA 4JT2A 1ZBDA 2R6DA 3JZAA 5HE9A 3C7KA 1CKEA 4FIDA 1GAJA 5HR5A 1RJ9A 3M1IA 3Q9LA 2R2AA 1AJEA 3WY9A 2J5XA 5B57C 1NN1A 2QPOA 1QHIA 3OIWA 3OE7D 3T15A 5CDFA 2IW3A 4RZXA 1VTKA 5FBRB 1F2TA 2WOOA 1DELA 5CK5A 1G20E 1ZU5A 2JLUA 4IXNA 1OH8A 4WIAA 1M74A 2ZJZA 3C14C 3GJ3A 3DKPA 1UDWA 1UDXA 4RZ2A 4WBSA 2IWRA 5K8TA 3FMPB 1NJFA 1FMLA 2Q3HA 4JL5A 1AKEA 1EFCA 3K0SA 1AGRA 1OXTA 1I4DD 2X2FA 4XH9B 1AQUA 1T3LA 2PX3A 3U7HB 5KNCA 1CIPA 4AKHA 2BKUA 1E2FA 1Q1ZA 3JVVA 5TARA 1JALA 3W90A 1IN6A 2ODBA 3FHTA 1HQYE 5GJBA 2P6NA 3KJHA 2FMXA 4RD2A 4V0KA 2YC4C 1VMAA 3ZLJA 3LD9A 2ZAOA 4CYMA 2C2HA 1N0VC 2AR7A 5KSZA 1SKQA 2H16A 2QA5A 5DNYB 4TMWA 1R7RA 4FMDB 3VR2A 2Q3FA 2CK3D 1ZJ6A 2E87A 4B74A 5FBLB 1WCV1 2C5LA 2QMUA 3SJBA 4FCWA 4FN5A 1G8YA 3KJEA 3SZRA 4IOLA 3UATA 1EFRA 3UK6A 3QVUA 3C41J 3Q3JB 1Z0DA 2DY1A 3VR6A 3EPLA 2QQEA 5B2ZA 1ODFA 4IEEA 4AYWA 5FOXA 2IA5A 2BCJQ 3WNBA 4D6PA 1KI8A 4B71A 3B13B 2D62A 1E69A 5HKKD 1KO7A 1XTQA 4TT3D 4HB3A 3LNCA 4BLRA 4LHZA 3P4XA 5CM8B 2YINC 2PLFA 4B33A 2YV5A 3DO6A 1E2QA 1G4UR 4BFUA 1W0KD 4JKYA 4LC1A 4BFWA 3I1FA 3WBJA 4QHYA 4TLBA 5EUMA 3T1TA 4GMDA 2F1HA 4JLAA 1GL6A 2DYKA 4D82A 4Q9LA 4I81A 2REOA 1EWQA 4IDPA 1FPMA 1S8FA 1IXRC 1LS6A 2WMOB 4UXHA 3GMTA 1U98A 3CF2A 2ZU0C 3NHBA 2XXAA 3WP0A 3VFDA 5J4HA 2QBYA 1UF9A 1E1RD 1GNPA 3QG1A 1R2QA 1TQ2A 4LRWA 2F7SA 1D9ZA 1OFTA 2GK6A 2W58A 2ZI3A 5DI9A 4EPVA 5J4LA 2ZRHA 4DUGD 1KJWA 2DFKB 2P0EA 3ZZ0A 1GL7A 2QRNA 3U60B 1G6OA 4XIGS 4PC2A 2GWHA 4K8OA 1UKZA 1E32A 4YONB 4JLOA 4MYUA 4LV8B 4YMSA 3B85A 4WZ6A 3MJHA 2OHFA 5DISB 3GP8A 4ILEA 3KL4A 1F48A 4M8NE 3BFKA 1N3BA 1NKSA 3CH5A 4OK6A 1N0UA 4GOJA 2NZ8A 4TQAA 4FINA 4LV6A 2WKQA 3AKDA 3O8DA 2VHCA 4UNPA 4XTRA 4ZCLA 4YMTA 2G9NA 1XXHB 3KXIA 4I4LA 3CB4A 1NMYA 2O0KA 4S2EA 5FOWA 3LBHA 4AI6A 1JPNA 4DDWA 4YQFA 2W6ID 4HAVA 4UJ5A 1DADA 4TL9A 4ACBA 1ETUA 3NVAA 1QZXA 1LFDB 4OHYA 3U7GA 1DO2A 2QSYA 1N25A 1E2MA 3B9QA 4Q1FA 3KKNA 2X77A 4UNNA 1UKEA 5EJEA 4LJ7A 2PEZA 5HE8A 1OB2A 2J7PD 5D3MA 3LQQA 3ZIAD 3SDZA 2ONKA 4CEJB 1CEEA 2ZE7A 4LJ8A 3FTQA 4NL4H 3THOA 3WRXC 3DPUA 3X2SA 1E9BA 2D4HA 4B43A 4KVAA 4WXPA 1NVWQ 4KHZA 4TYNA 1JECA 4KSBA 3KKPA 1R4AA 1XF9A 4WZAE 1RRGA 5FBWB 4A6PA 1C4OA 3CR8A 521PA 1MRNA 2V7QA 1CS4C 1M6NA 4G5GA 2QMEA 2QE7D 3OIUA 3QOFA 1P2VA 4EFNA 1VKJA 1RIFA 2G3YA 3ZVNA 3CRQA 2PJRA 3FHOA 1SHZA 2JLQA 1ZC3A 4HZUB 5KPJA 1W4CA 2JDIA 4W5WA 4EJSC 2QTFA 1MO3A 4M53A 3J81k 2N46A 2V8OA 1O87A 4HB0A 2FSGA 2GZAA 1DAHA 1QHGA 3VX3A 1TNDA 1NN3A 3RS2A 1RRFA 1CJVC 4M9ZA 3T1VA 4TQ9A 2QQ0A 1MOZA 1U99A 3AP2A 1T91A 3PEVA 2XZOA 2C95A 2FE4A 3IDQA 3Q5EA 3Q7QA 4CVNA 3DZ8A 4G5QA 2NZJA 3D7MA 3V00A 3DMNA 1NKTA 1E1QA 2ZJAA 1KHTA 2HUPA 3SBDA 4D0NA 1E0KA 2ZSFA 4TQUS 1GKYA 1E98A 5A5GA 3P27A 4A0HA 2N42A 2AD5A 3NEYA 1P62B 4C4PA 2YOHA 1UBEA 3L0SA 4LX0A 3AP3A 1XWIA 4RCYA 3C15C 3EG5A 2VBCA 5FH9A 2VPPA 4NH0A 4EFLA 5EP2A 1AS2A 4Q1EA 4LJ9A 1HQCA 1KDTA 1CJMA 3QBVA 1RE0A 4HLCA 1W0JA 1RJ9B 1AK2A 5J4YA 4CF7A 4BLOA 2ZUDA 1LTQA 5JFGA 4OI4A 1P9RA 2Y8EA 3BB1A 2RHMA 3K9LA 1AZSC 4CIDA 4DSTA 4EPRA 1BKDR 1PLLA 3I5XA 5EXXA 2FFQA 3K9NA 5B58C 1BO6A 2OZEA 3QKTA 4FWIB 1RW4A 4FMBB 4D4MA 3ADCA 2WICA 1YZTA 2XX3A 2A78A 3CZPA 2PEYA 3EAQA 4BLSA 4M0LA 4R98A 4CT4B 3B1XA 5DO9A 2Z6VA 3NKVA 2NPFA 3FYHA 4C0LA 4JBYA 1D5CA 1Z2CA 1NIJA 2ZETA 1TAGA 1Z47A 3AGPA 3ONWA 3AF2A 4DBLC 4QGAA 4Q9IA 3WNCA 2D7DA 2H8KA 3E1SA 2KJQA 1M7BA 1E2JA 3W6NA 1T3HA 1ZD8A 4PQFA 1W4RA 3U3RA 1M7GA 1OXUA 2IXEA 2V1UA 2O0JA 2WV9A 4U00A 3I5YA 2AX4A 1Q12A 2HXYA 1GKUB 3ADKA 5EP1A 1K8RA 1YRAA 4BFSA 3WYFA 4LDJA 5TMPA 4W7SA 4BASA 4ZDKA 4PPFA 3ND9A 2O8BB 1KNXA 1VCMA 2EFGA 2WJGA 3WMEA 1NNEA 1YVDA 2ZE8A 3K09C 3VX4A 4ZCIA 5GJCA 1KSJA 2PMKA 1IAQA 4KSCA 3SS8A 4FXPA 1T9HA 1A82A 1OHHD 4Q47A 1NL3A 4D4KA 2CJWA 2ODNA 2XNDA 4LSGA 2HYDA 5G3ZA 2ORIA 3A1VA 3U44B 3BK7A 2FOLA 2X2EA 4H1UA 2AK2A 2QAGB 3NIBA 1KI3A 1S3GA 2J0VA 2WMNB 3DVLA 4B34A 5KDDA 4L9WA 5JS7A 3O8RA 5K8LA 1HA3A 1IM2A 2QAGC 1R0XA 1CBUA 4X8LA 4F4IA 2BCGY 2C03A 1SXJC 1E79D 3AVPA 3LXXA 5CK4A 4D80A 5HZKA 1C1YA 2O8EB 3I8XA 4EDHA 5DN6D 1Z28A 3V4RA 3KTAB 1RRPA 4PAQA 1IXSB 1P75A 1WB9A 5GVRA 1EXMA 2V3CC 4JVLA 1E2HA 4J0QA 1BYIA 3X1DA 3W8RA 2OEPA 4IVRA 1US8B 2PZEA 2H57A 3QJYA 3RS7A 1E9EA 1M7HA 1OKKD 1ZM2A 2QT0A 1T0HB 1JR3E 3ZVMA 4URVR 1GKIA 5G53C 5IK2A 1WF3A 1PZNA 2QUZA 1X1SA 2DFTA 3B6EA 2QPAA 1ZINA 3IKJA 4GMXA 3G0HA 1TF7A 2RH5A 3VTKA 1F60A 4H1VA 3KB2A 4MH0R 1N6IA 1CP2A 1S9HA 2WAXA 1E9RA 2ZVQX 1P2TA 3TAUA 3FFAA 3RS3A 3ZD6A 4Y0AA 2QE7A 5L3VA 3QKSB 1H8ED 5C2JB 2OCBA 5JWHA 3CF0A 3CRMA 4PC7A 3IIJA 1WXQA 1II0A 1WE2A 1G3IA 4OK5A 3R8FA 3QI2A 2ZU6A 2RGCA 1FMJA 1QHNA 2B7BA 2HXSA 1PJRA 2NIPA 2XSZD 4P0TA 4BFYA 2BWJA 3JZMA 5EZ6B 1AM4D 1I4TD 3PEUA 3EZ2A 2IYZA 1G41A 3QKRA 4PX9A 2JJ1A 4F92B 3VNUA 1DTSA 4Q19A 4DLRA 5H8WA 1GFIA 3W34A 3KJGA 4G5RA 4UNQA 3T12A 1FFHA 2J7PA 3ZIAA 1U0JA 1ZUIA 1F6BA 4DRZA 1UFQA 5CLLA 3SN6A 1QDEA 4NE2A 421PA 4Q4AA 3K70C 1KK3A 4PPNA 5JJKA 2DPXA 4TTRA 4PSKA 3SQWA 4JVMA 3IQXA 3RC3A 2ZRGA 1YZNA 2ZSEA 2QP3A 4ZIRA 4URXR 3EX7C 4HB2A 3N5CA 1VG1A 2QAJA 2VP4A 1IQPA 4LBZA 4JLJA 4JYCA 1X6VA 4Z8XA 2JDID 4POAA 3T5DA 1RRCA 2BHRA 4OL0A 3RABA 1W5SA 1OH5A 2OLJA 3DOFA 1A7JA 2Q9BA 4BWYA 4EPTA 2PL3A 4EPWA 1BMFA 2YWEA 3BH6A 1SXJB 4P4SA 5EXSA 2O8BA 4DXAA 4MKGA 3FMOB 3GLGE 4IOJA 2J0UB 2ZR0A 2QROA 4M4SA 3THXA 2BBSA 4QM6A 1XDBA 3V4FA 1VG9B 1KMHB 1OFIA 2W6JA 4O2RA 4PHTA 3F3YA 1E94E 1W47A 2J46A 3AKEA 4KAXA 2CL0X 1OH6A 4A9AA 1YR8A 3FPAA 1XEXA 5HTKA 3IPYA 3SI7A 3QPVA 2PZGA 2IWHA 1FNMA 1FZQA 2P67A 2QL6A 2VHUA 4HATA 1CR4A 1Z0KA 2WJIA 2GEVA 3SE0A 1ZM3A 1YR7A 4Q4HA 3T1QA 1Z6AA 3EPKA 3DM5A 3W8NA 4TTPA 4LY6A 3KB1A 1EK0A 4A8JC 1R5NA 3EXAA 1P60A 1SHKA 2JASA 1ZVQA 3A1SA 4OI1A 1CRPA 3BORA 3BRWD 2FSFA 3THWB 5LBIA 1YU9A 4A4DA 4BLQA 2ZS9A 2VH5R 3IQWA 621PA 4UXJA 2WSSA 1P9NA 4KO8A 2ZI5A 1AGPA 1SXJA 4B32A 5HKKA 2O5VA 5AJWA 2NO9A 1IY0A 3WHKA 3KQKA 1MRSA 3NH6A 1XD2A 1SVKA 4OI2A 1Z83A 3Q85A 1HT1E 4CGZA 2JEOA 1Z6TA 3LBNA 3PIRA 1W36B 2Z4RA 3GLGA 2FPMA 2FH5B 4PANA 1RKBA 3VR3A 2ZRBA 4H9GA 3QSYA 2CLSA 2RGEA 4NCIA 4ZDWA 2CXXA 4KI0A 1VCIA 2CNWA 2OCAA 5FPKA 3Q7PA 1XFAA 3UMSA 1RYFA 5A4JA 2ZXUA 5K8IA 4GNKA 4U7DA 3WMGA 4HYYA 1GP2A 1N6KA 4KYIB 3DHWC 4IHQA 1HYQA 1S4QA 3U6KA 3GJXC 3FMIA 3QY0A 3W3AA 3VR4A 5GJVC 3UWOA 4F7WA 4F93B 3PEYA 1OYWA 4US2R 3BC1A 4MRRA 4TMTA 1NG9A 2CBZA 4HDOB 3LVQE 2HJGA 2I4IA 3TQCA 4FWTA 4KBFA 4OHVA 3VAAA 4TMVA 3L8YA 2O8FA 3NG1A 3MD0A 4CEHB 1RZ3A 3I8SA 4A2QA 3NTUA 5FUYA 4MDFA 4V0ME 2ZRDA 4B3XA 3LX5A 4XJXA 1L8QA 1E0JA 4TT3A 2F1IA 1U81A 2V55B 3EIQA 1J7KA 4EPYA 1GRQA 3VR5A 3NDBB 3DZDA 1E2LA 2G0NA 2GAOA 2ERYA 5CITA 4NYIQ 4C3ZA 2VP5A 2HV8A 2WSMA 5TDHA 3OAAD 3A1WA 1P9WA 4ZI2A 4TN1A 2GRJA 4JT4A 3LVRE 1OLOA 1BOFA 4GSYA 5AUQA 4M1OA 1KGDA 2RGBA 4LJAA 3T1OA 1WA5A 2FGJA 2DHRA 3B78A 1W36D 4RSGA 1AS0A 2ZUBA 1F2TB 1OF1A 3GJ8A 3ZVRA 1SULA 1N6PA 1LS1A 1US8A 4M1WA 4LC0A 2R44A 1BMFD 1YR6A 3ZQ6A 1SVLA 1QRAA 3ADBA 2WKRA 2JLXA 2EYUA 2AK3A 3D6TB 4II7A 4OQLA 3R9IA 4CDGA 2C9CA 3THYB 5FR2A 5DSZA 3V9PA 2QMHA 4G5SA 1CLUA 4Q66C 2Q21A 3AVXA 1TU4A 4V03A 3BBPA 4LHXA 1U90A 2QORA 3B1ZA 2F3TA 2IYLD 5TY0A 1NY5A 4KBGA 5FOTA 1ZM9A 4C30A 2YKGA 4RZ3A 4QGGA 3THYA 2G1JA 4TTQA 1ZUHA 1DAGA 3NC0C 4E03A 4RZUA 4QBFA 2ZI7A 4XWAA 3FKSD 4Q5IA 3L2OB 2UKDA 2A5JA 4NZYA 2IYVA 4TL7A 2FZ4A 2VL7A 5DE3A 4GP6A 1CXZA 3ZQJA 2QNRA 3LV8A 1U8YA 5JI2E 3HWSA 2BEKA 1XU4A 3ZH9B 4ZI3A 2CCJA 3AB3A 3EZ7A 4U5XA 1G7CA 4JJKA 2NMVA 2IUUA 2D06A 1RC8A 1GM5A 1VPLA 3EC2A 2ZITA 4WW0A 4DSOA 1RFLA 3IIMA 2GBLC 4DWJA 4NP6A 3K70D 1MR3F 2GVZC 5DHFA 1X3SA 2ZJOA 1DG1G 3WNDA 4GP7A 3E5HA 4O25A 5EXTA 4QJ3A 4DCUA 5JCZA 2JJ2A 5JBQA 3K8YA 1V43A 1K5GA 2PT7A 4C2UA 1JI0A 5DYGA 4D25A 2OAQ1 2ZI9A 2V6JA 4BUJA 4G3XA 3LLUA 2ZJYA 2GZDA 2UZIR 2XGJA 4UJ3A 2IS2A 5EP4A 3EIHA 2ZRLA 3QENA 1T8TA 1MT0A 4UNSA 3SNHA 3H1TA 2AN9A 4KV9A 3PV0A 1Q3TA 1UBCA 1IJFA 2IYQA 5B64A 4A8JA 2FPKA 4DT1B 2ZJ8A 3GQBA 1JR3D 1DAMA 1JXOA 4A15A 4N0DA 1QG4A 1G7TA 4TMKA 1UKVY 3PENA 1YR9A 2OXCA 3MFYA 2ZIAA 3GFPA 1S1MA 2VIIA 2ZRCA 1HE8B 4ZV4A 4M9XA 2C98A 5AJVB 1MO4A 1G16A 4KFRA 4CW7A 1X8LA 2D2EA 3R7WB 3TAHA 1TTTA 1SQ5A 3QF4B 4NDZA 2ZRJA 4DT1A 4NYJQ 3LW7A 5SZIA 1OH7A 2QM7A 3CX7A 1YHNA 3GFTA 3HR8A 3I72A 5D3QA 3K70B 2JLWA 1OT3A 3E70C 1AKYA 3MAAC 3BS4A 4LPKA 4R2HA 1PLKA 1JQLB 5ELXA 1E2DA 2YWGA 2WM9B 4A92A 4WA7A 1EX7A 2W0MA 1QBKC 2NGRA 2QZ4A 3SR0A 3X1YA 3KQUA 1KO1A 3CPEA 3PUXA 4NCJA 4NMMA 2R8RA 4N3NA 3ZS8A 4W5HA 1G17A 2XAUA 1Z0JA 2CJWB 3TK1A 2NPIA 4Q7LA 1GRRA 2P5SA 1BS1A 4PZZA 4XVUA 2ZREA 1JAIA 1Z29A 2ERXA 5GJWC 2JAQA 4YXWA 3MG9A 4M1SA 5FUXA 3U3JA 2L0XA 2E9SA 5FTNA 3P20A 3H2YA 4JMPA 3N70A 1E9AA 4QJ5A 1XD2B 3O8BA 5C46F 4M1MA 2VP0A 1G1MA 4Q9JA 4BRUA 1DEKA 3U4QA 1E9FA 2CNWD 3U3OA 4NU0A 1G21E 4PO8A 2VRWA 3LO5A 4C0HA 2X1VA 3KKQA 4LWZA 5FBVB 2QSZA 2CMKA 4X8OA 1E9CA 4MGKR 2BM0A 4R71A 3PQCA 2JATA 1DARA 3RSOA 1KK1A 1Z6YA 1KKLA 3BGWA 1JEDA 2QI9C 4G5OA 3RRYA 2ZYVX 4P31A 4YDSA 4ON9A 4NYMR 4KCGA 4E09A 1UKYA 1FUKA 1G3QA 1JAHA 1GIAA 5DI3A 4M9QA 4BECA 4ARZB 4M1TA 3FVQA 3CRVA 4OJKA 1XMJA 1XMIA 4D4LA 3KFVA 4NBSA 1TU3A 4EJSB 3PCRB 4MYCA 4B48A 1Q22A 4KFUA 3WHLA 5ANRB 1MABB 2B21A 3G82C 3ZZTA 4AKGA 1Y3AA 4HAUA 4A2PA 1JJ7A 3NBZC 1ANKA 4PPGA 2DCUA 2HLDA 1ZCBA 5AUPB 3K0CA 3UMFA 4LK2A 1Q57A 2O8DA 2H7VA 1N6LA 4QOSA 1W5TA 4CEIB 4QC2A 4JL8A 2R65A 3HU2A 1Z0FA 1P2SA 2EW1A 4OQMA 3IPXA 3HJNA 4E22A 3LX8A 2LWIA 4NONA 2LKCA 1XMVA 4P4UA 4BE7B 3RAPR 3GJ6A 3AF0A 2OG2A 2JLRA 4GOXA 5EUQB 1GVNB 1II8A 5FPTA 1ZNWA 3U3KA 4IEIA 3ZYCA 1UADA 5KSOA 1C9KA 3B82A 1YZKA 1N6NA 4URZR 3I92A 2F3RA 4AK9A 3BH7A 4V0NA 1VDZA 5LDDC 1EWRA 3OEHA 2Q3MA 3JVUA 5IT5A 3VHLB 4L16A 5EE5B 4A6XA 3GD7A 1T5IA 3CWQA 5JHGB 1ZNXA 2NO7A 3A4NA 3BJIC 4RJLA 1UAAA 4ZDIA 3UWKA 3SYKA 5LD2C 2O52A 3DDCA 2JJ8A 4ZKDA 1ZAKA 3KX2A 4LYAA 2P6RA 3U6BA 1R8QA 1KSHA 4HUTA 2IC5A 3RS0A 2IUTA 2G77B 4LJYA 2R6GA 1MO5A 1G18A 1NLFA 2GTPA 2KSQA 4AKEA 4IRUB 2QG6A 2ZRIA 3NXSA 1NMXA 4EAQA 2IHBA 3FKSA 4PHHA 4OJQA 3AKCA 3CW2A 5HCIA 5KO2A 3T35A 5KYKA 2BJVA 4BLTA 4I1VA 4C9BA 4AIIA 2HCJB 1T4GA 4MGIR 3Q5DA 3ZS9A 1COWA 2OAP1 3BWDD 3A1UA 1OYYA 5SZKB 5TXGA 2FA9A 2G6BA 3REGA 5GADl 2XNSA 5EQTA 1G5PA 3KUCA 3C5CA 1FX0B 4P32A 2IX3A 4TMZA 2K5UA 4AWXA 3THXB 1UBFA 2P5TB 1G6HA 3U2QA 1PV4A 3S1AB 3QF4A 3CRRA 4JYBA 2XSZA 3C8UA 3QG5A 1S0UA 1EFUA 2I3BA 2MSEB 3IEUA 4ZKEA 1T3SA 3SJZA 4CEIA 1P6XA 4CEJA 1QHSA 2VP6A 4L9SA 2KWIA 4URYR 3TUZC 1Z08A 4QJ4A 3AF3A 5D3MB 2AL7A 2ECKA 2ZSBA 4PFSA 2Z43A 1Z5ZA 3EARA 1KTVA 5AJYA 3ZVLA 4EIWA 3SHFA 3B7GA 2Z83A 2EQBA 2BMJA 3LY5A 1Z07A 4V0MA 3N2IA 2XEXA 2VSXA 4B76A 4N1AA 4LBWA 2XZPA 4Z8YA 3MRSA 2QTVB 4PZLA 2WIBA 4I99A 1OSNA 3H86A 1PUIA 1MABA 2C04A 1FP6A 3FFBA 4R2IA 3GLIA 5FPYA 2DFLA 5E7MA 4ZCMA 2O0HA 4DLYA 4AKIA 2AKYA 5FPHA 2QAGA 2OXRA 1YZGA 2BMFA 5BN3A 2D2FA 1OKKA 3VKGA 5B30A 1G3RA 4FMDF 1KAGA 3SBEA 3GEEA 4LJ4A 4ACAA 4BZPA 4ESVA 4U02A 2WWGA 3UMRA 4XWKA 1OB5A 1XZQA 3T06B 5BN4A 2FEMA 1P7CA 3IILA 3K09A 4OQXA 4QBGB 1PVOA 2OSBA 2V9PA 3TIFA 3A4MA 2QMOA 3GLIB 4F4CA 3TMKA 3QBTA 3B1VA 3QKUA 3DOEA 3QKSA 1YJ5A 4HZIA 3TJZA 3UIEA 5C1BA 1XB2A 5J4VA 2PZFA 2AD1A 3CLVA 4MKIA 5FUVA 4BGDA 2PLRA 3GLFA 5CDFE 1HY3A 2RGDA 1KI2A 3BE4A 4DKXA 2R6CA 1Q1BA 3FDIA 1HTWA 1M8PA 1N5IA 1VCOA 3OFND 2RGAA 2ONJA 1V5WA 5F98A 3EC1A 4IFBA 2ZS7A 3DKVA 4EKDA 3QEOA 2QM8A 2VHTA 5LB2A 5EE9A 1N0WA 5JZVA 1SKYE 2CK3A 3R20A 2GEUA 3C16C 2VSOA 3CBQA 2A5FA 5CYPA 3EW9A 5E95A 2BBWA 2GJ8A 4LHYA 4HI0E 4B3CA 3K0AB 1GDDA 4QGHA 4IKEA 2F9LA 1SVMA 3AUXA 4DEYA 4AYTA 1II8B 3K0EA 4TLAA 1ONBA 4A36A 2MMCA 5G3YA 3MMPA 2IYTA 1GZSA 2WJHA 3PXGA 5J40A 3WYAA 4AURA 3AVVA 2B6HA 4IVQA 2FU5C 4LCBA 2EWWA 2A30A 2CHQA 4CT5A 1HURA 2PJZA 3QXHA 3GCGA 4MGZR 8OHMA 1S96A 2G1KA 5F9FA 3TH5A 1DOAA 4CZ2A 5FOVA 1OXVA 4JKIA 4B3DA 4DSUA 3CF6R 4EQ6B 3UPUA 4A0RA 3WRYC 1W0JD 4A0GA 4CRWB 2ZYTX 3PUZA 2W0SA 1P4SA 1EFTA 4KLNA
chains in the Genus database with same CATH superfamily
2F3UA 1E4OA 3QPUA 4MWDA 4MR8B 3WBKA 4KZKA 3V34A 5J9FA 4JEMA 1BVHA 3WKDA 3BMXA 5TMEA 2Q2NA 2OPBA 2E4XA 2W6JD 1PF7E 3STWA 1AS3A 3NASA 3RF7A 1LTHR 4F2GA 5M5BA 1DAEA 2ZUFA 2OZVA 4MP3A 4RFSB 4M49A 2CKMA 5EEHA 1OUMA 4UTVA 3TXYA 5HWSA 4U9UA 2GK3A 4OMCA 4KP7A 2IXDA 3SC4A 3UA3A 1Z37A 1LBIA 3FWNA 5ENDA 4R5HA 1RXIA 1P2DA 4C7MA 1RWNA 3ENKA 3Q72A 4GXRA 5EPUA 5FL7A 3MC1A 4RNCA 2JI8A 4NSNA 3CNLA 3EUEA 3HLYA 1FDIA 1GPNA 4LGVA 4P5EA 4AO8A 5IJZA 3AETB 3QUAA 1PG5A 4ZVQA 1ZZEA 3NWPA 2PX0A 3OOWA 1NGSA 2J09A 3DFFA 3GRPA 1V3VA 4LYDA 1QYWA 1XNGA 2R96A 3R6TA 4IGAA 4Q48A 3FTPA 1YQXA 2CFOA 5BQ3A 4OJTA 2JJ2D 1I1NA 3Q3EA 5A4DA 1QFJA 2P35A 4Y2TA 3OKPA 2AI2A 4ZA2A 3UBMA 3KEGA 4KVGA 4TSFA 4DV1B 1UFKA 1WM1A 3R3YA 2IUSA 1TDJA 4BZZA 2EWMA 3D8TA 1VE7A 4NFSA 1T43A 4ARSA 2XRZA 1AK9A 2ZS8A 2EOAA 2WHPB 3ZVKA 5AVXA 1H94A 4MUMA 1CR2A 4UEWA 1HMYA 1DSSG 3BHMA 2H0AA 3K0FB 1IBRA 3ZEIA 1WD7A 1PNQA 1FNSA 2P91A 3G88A 1Q6ZA 1YMVA 4K81B 2QENA 2WAOA 3TEFA 4F3KA 5I8WA 5LLDA 1SBHA 1H8HA 2I2BA 1E2KA 2P65A 4RENA 5DHUA 2YBEA 2EFJA 1NHGA 3NUQA 1EBBA 4JL6A 4QQRA 4QUIA 5AH0A 1NONA 4BVHA 2GXAA 4NPHA 4Z53A 3LYHA 4S1WA 5KYUA 1G8PA 2OUKA 3CLRC 5BW4A 6LDHA 3ZU2A 1ML4A 2VDUE 5U4QA 1P81A 2P2SA 1QX4A 4IXDA 5CNKA 2PX5A 4DC1A 3VHXA 4IG4A 3NIGB 1E7WA 1NKVA 4N76A 2J9YB 3ZTYA 1P3JA 1SBCA 2JLSA 3N28A 3M4NA 4K05A 3U1VA 4M1KA 1W29A 5FQNA 3RJTA 2DFVA 1ZR2A 2CD7A 4YC7A 4PSUA 4KK4A 5AIBA 2FN8A 3IA7A 1BA3A 4JI7B 1P6QA 3GVHA 4EK9A 4NCKA 2KW5A 3KR1A 5TMBA 4Z5XA 5IK2D 4B40A 1CSEE 4E5SA 1OI7A 1WY5A 3DYBA 4F4FA 3LXRA 3NHRA 4LN1A 5HIMA 3IEXA 3WAGA 3FFWA 2D4AA 2ECOA 3O8CA 3AEUA 1IY2A 4HH1A 3REFA 5F77A 1CUHA 2MYTA 4F3NA 4GC5A 1IQRA 4KFTA 4Y2YA 4MPRA 4AUEA 5CYOA 2F43A 4KN8A 4V1CA 4EG7A 5JNSA 3QWFA 5EIAA 3AOEA 3FCYA 2QVLA 4L8VA 1OROA 2ZUUA 3HL4A 3HYRA 3N6XA 3W6PA 3EWSA 4UFNA 3MXOA 1U9ZA 2AJBA 4NDAA 1V4NA 4AMVA 2ZT6A 5AHKA 4HQKA 5BR7A 5CBPA 5K6AA 1MJGM 4FE7A 3D3KA 1M2HA 1YKFA 2O3TA 3FYTA 2RAUA 3IIKA 4AJ1A 5CDUA 1YD7A 4XR9A 5CYFA 5ETJA 1U63A 2E6KA 2FUCA 4TGLA 3LWBA 3LQ1A 1G4HA 4L08A 3VKHA 1QVAA 1FFGA 2B7CA 4XB2A 3N2EA 3C3AA 821PA 5EY5B 9LDBA 1L1QA 1JDZA 1A8SA 1L7XA 1DT3A 4PAMA 3Q40A 1DAOA 4PSAA 1J5XA 1XFDA 3BXOA 4UU0A 3PQEA 1H1LA 1BJTA 1SFRA 1SU7A 2BMAA 2IDKA 4M46A 4O63O 4DLSA 4UCQA 4EELA 2HNKA 2WYUA 2YIJA 4QATA 4F8YA 5JVDB 3JQ7B 3GZTB 2P90A 1FLAA 1LCIA 1WXEA 3A6GA 4KL8S 3HO1A 4CM7A 2FSPA 1JNYA 1WPGA 3MYYA 2GXSA 3F49S 4IFEA 1UK7A 1UJ2A 2FSHA 4QHTA 4YRKA 4J0EA 1JA1A 1FP1D 1VLQA 4UNIA 5B53A 4F72A 3KSAC 2UUOA 2R85A 4ME6A 5AWFC 1P7YA 1C9NA 5B55A 4I5FA 4R9VA 3LWDA 3GVCA 4BAGA 2P3OA 3DE4X 3KOOA 3Q98A 4XJTA 4N9QA 1JEOA 1GD1O 1OIXA 2VWPA 3U3MA 3M3DA 1YA6A 5ENZA 1GITA 4ZT2A 4F5ZA 5JDCA 1KJIA 1Z63A 3Q6IA 3CC8A 4FMCF 1X3LA 4YALA 4GI5A 3QX3A 1QYCA 2CHFA 2RIRA 3NBQA 2CVHA 4LC9A 4P34A 1R6DA 2A2ZA 1E2EA 1X9HA 3DLTA 3QELA 4A2WA 1NBWB 4GE3A 2C0PA 4MLPA 4TUYB 5CH8A 4EVIA 2AC7A 2OCGA 2PX8A 3M49A 1G0NA 3OOHA 4HNAA 4MW4A 3TXXA 2VSNA 1EEHA 3F3KA 4ZV9A 4RM2A 1MRZA 2R7LA 2AW3A 2W6QA 3AR6A 3COZA 1C9JA 1U0HC 3P9RA 3L8DA 3JQ8B 3O0TA 4C29A 4Q3NA 4C4YA 3FGZA 5BN5B 4HRYA 2IYYA 3FVVA 3VZRA 3ZWDA 3ZXYA 2ZK7A 4R8RA 1JLSA 1DZ3A 2AHRA 3IP9A 5G0UA 1YXMA 4MQUA 5THXA 3MN1A 4RL6A 4TYWA 1O4VA 4RFVA 5T5QA 4FFOA 4OLFA 4TWZA 4DLTA 3QYAA 4I8IA 3F3SA 3QE4A 1E6CA 3OF2A 1N2XA 1N2ZA 5KNCD 3FHJA 5IDVA 3AKYA 3SF0A 4XVCA 5MF6A 3GUYA 2W2XA 1EVYA 3OPYB 1XHFA 3KHTA 3ETEA 3F47A 4OQNA 4QSMA 2RHLA 1JLRA 3AI3A 4JZKA 2TSYB 4X85A 2FR0A 1IVSA 1U11A 2WEKA 3K5WA 4QYSA 1IK4A 1Y7TA 5BYKA 1X1AA 1FA9A 2BEUB 2VTKA 1TEXA 2EWVA 4YRCA 3RVBA 4YFVA 3IIEA 1EX9A 1R5BA 4NENB 1KMNA 4PWZA 1UC5B 3ZWMA 3BK2A 3VPHA 1U5AA 1Y6ZA 3ZHSA 4GX2A 3RYCA 1YRLA 2ZRAA 1MC4A 2WT8A 4JLNA 2VDLB 4BLWA 1CJUC 3DXXA 1A88A 2Z9CA 1TZ2A 1NPYA 1Z0SA 2XNJA 1W44A 4IDBA 1TTHA 4GYJA 1BC5A 1JBQA 3L05A 4TXMA 1GT6A 4NESA 4EY8A 3E9DA 5J23A 4QT4A 4P8RA 3PRJA 4B4OA 3LT4A 3QE0A 2DWOA 4LZAA 2ORED 4H31A 4Q4AB 2NU8A 1M9NA 1ESDA 4JWTA 4RFSA 4Y9DA 2X15A 1XEFA 4X8HA 1OLXA 4GKAA 1PCXA 1YZ3A 5MGBA 1SHLA 3HJAA 3A4LA 5ADVA 3WNZA 1HYBA 1XDUA 2EIXA 2UV8A 3E9MA 3FRIA 4W9NA 2FQXA 1L7OA 2JIMA 5LP1A 1NBME 1OV4A 3FZYA 2AWOA 1HYHA 1WMDA 2C96A 3KKEA 2VK2A 1WZNA 2CJXA 3R5JA 4NYMQ 4HBZA 1KY3A 4RTKA 3KPWA 1R4NB 2JBHA 4BPRA 5G1OA 3WLPA 3PEEA 4IWYA 1U3FA 1WAMA 2G80A 2AQIA 2HKIA 1O95A 3MUFA 1U02A 1YZYA 3EF0A 2VXBA 4TLLB 3VZCA 1XDGA 5D6NA 1K92A 2DFDA 2CLMB 4OXKA 1JMKC 3IELA 4Y6LA 3OZTA 2Q1WA 1GQ2A 4OHRA 5KINB 4KGVA 5KWIA 4X5OA 5A3VA 2X4IA 4ZAYA 2J85A 3U6KA 1JHMA 2IXFA 3SD7A 1AGYA 4IIJA 4K6OA 2GBLA 2QJOA 3G9XA 1T9CA 3V8EA 1H85A 1XZNA 3LCUA 1RJFA 3HC7A 5DASA 1NXTA 2ID8A 4DCSA 5DM4A 2R6ZA 3ZHQA 3BF8A 2A0UA 4WEQA 5JCPA 1UUFA 3KQPA 5G4LA 2AZ4A 2WZDA 2FPPA 4PO1A 2P3QA 4QODA 4ABYA 3CY6A 1YRHA 4KDEA 3VNBA 2GETA 4DCVA 2B36A 3WLRA 3G8YA 3PDWA 1AQ6A 2O6LA 1NBEA 1GG2A 1TF2A 1Y42X 3FPKA 3GLHA 3K35A 4UULA 1XSEA 5C18A 3OESA 4U7FA 1U2GA 1DDOA 1JWAB 1RLIA 1X9GA 3EYWA 5AKEA 3V2IA 2G76A 4RL4A 3FNQA 2Z3VA 5LA6A 4Z7NB 4LK3A 2XBMA 1OLUA 2IEZA 2QP9X 3GLUA 1JT2A 4WZBE 4ZPJA 5DT9A 5BSRA 3GDWA 3UEOA 3HDHA 4KQKA 3F6PA 1JLHA 3V7WA 3JXEA 5HP4A 1BFUA 1UMDA 5EZQA 1QR6A 2WIAA 3O4FA 4FKBA 4ISCA 4B4DA 2B1JA 1L4YA 3HCEA 3QE2A 4R3NA 4B87A 1Q91A 4C0AC 3OEHD 5K8UA 1XTIA 2WFAA 3UB2A 1Q7EA 1SGWA 5LKAA 2C8VA 1YVEI 4LRXA 4WMLA 1FS4A 4NG5A 4ZVUA 2OK7A 4FMCB 3NOOA 1MO6A 1T29A 3AWDA 3NHJA 4K9MA 1Z9BA 4OEHA 1W88B 4Q4LA 1VCNA 1N78A 3IA2A 2BFCB 4DDVA 2JW5A 1CUIA 3R7SA 1O6ZA 1THZA 1VI6A 5CX4A 3DVSX 2HSJA 1T4DA 3NYIA 3CA8A 1OXBB 4IPTA 3PXDA 2I65A 1V8BA 3BZWA 4TSRA 5K03A 1Q3HA 2XDAA 4IYJA 3QMWA 2YXEA 2JLVA 3GBSA 3ZHTA 2J5QA 4N0PA 4G8JA 1Q11A 2HMUA 2G1PA 1XCJA 3N8KA 2BF7A 5K3BA 5JQGA 2IUFA 1VHLA 1WSBA 2HADA 2WAYA 4F84A 1HMPA 1DQSA 4LJ6A 4YK7A 3P9XA 2HIHA 2I6UA 4B7CA 1IBMB 2EFCB 2BBTA 2NTNA 3QW2A 3BE8A 3DOOA 2XCOA 4KHPB 4R68A 1DINA 4MMYB 1JHXA 2EJCA 2NU6B 5FWDA 4CV0A 3DL2A 1R0WA 3R0IA 3L0ZA 5L8VA 1M0WA 2EU8A 1JJIA 4KBYA 4TLMB 4BZXA 3L8EA 3M0EA 1AA9A 2P75A 2PMDA 2WU1A 4YCDA 4BWFB 1GGJA 1JQ5A 2HIAA 4JIGA 4DW8A 5ICMA 5JXWA 2PYDA 3H4MA 4CE6A 4BGEA 4X93A 2EATA 1G3MA 4N5LA 4K3UA 5H9VA 2DG2A 3LUJA 3E3OA 3TEMA 2WQZA 2XECA 4JYMA 1YUBA 5KSWB 3QE9Y 4J29A 4R7TA 3Q3HA 4RV4A 2JZNA 3CPHA 3SZGA 4BNGA 1V6AA 1M2WA 2WWIA 1QV7A 4N6OA 2V1XA 3RROA 2YCBA 3OI7A 1T36B 1HEUA 3FPHA 2VRCD 1RI2A 2FP4B 4HWGA 1IOZA 1I3CA 2RBKA 2Y66A 3A9UA 4PC3A 4X63A 2JGJA 3NPAA 4EQ6A 3S1SA 4CWAA 1V3TA 2FPGA 1UP4A 3BHJA 3D1LA 4NG4A 3EG9A 3RRMA 4DKJA 2FSUA 1LVUA 4WKNA 1Z4MA 4MW9A 4QQNA 1VC2A 4QUGA 3FLEA 1ECFA 3VZBA 2EGHA 2UU9B 4MOWA 1E59A 5GONF 4HS9A 3BH0A 4OHWA 5EKDA 1X0VA 1P61B 5CT5A 4L4XA 3VGPA 4M2LA 4DDHA 1TM4E 2X1MA 4L3VA 2PS9A 1U4OA 2FQ1A 2XZDA 4JUBA 3GQVA 5DBOA 4AJJA 4D1YA 5CEJA 3T95A 4N0EA 3A28A 1FSPA 4GGMX 1PL7A 5AI5A 4PR0A 4LNHA 5IP5A 3E2PA 1K63A 1XTSA 2ZKIA 4RHYA 2IY7A 1P44A 2H1CA 3JSAA 5FA6A 1PEYA 4CMAA 1Y3DE 1B3BA 4IUBS 2MSDB 4DMUB 4YPVA 1XEAA 1I3LA 4Y2HA 1ORDA 1BE8A 1Q14A 1O6GA 1YB4A 3EDOA 4H7IA 3OE7A 4HLUA 2P9GA 1X7YA 1R4MA 3PD7A 3O8OA 4WTOA 1IPEA 1EGMB 4S04A 1KI9A 2BRUA 3FOBA 1P1KA 2ECPA 4RE5A 4JY7A 1QHYA 1D6JA 2NVBA 2RC5A 4G0NA 1SCKA 4PZ0A 4PY2A 3TOZA 3TQQA 3X1ZA 3C48A 4WXEA 3WWZA 4QM7A 4LOAA 2CDCA 1KJYA 3E0QA 4P6VF 4DDUA 5IVKA 2VH2A 2GCEA 1E1LA 3PNKA 2FWNA 1KMQA 3DBLA 4NTZA 1PHPA 4UQOA 4X6LA 4EB3A 1YO6A 2CZQA 2WILA 3PQ3A 1YK1A 3A32A 4UCFA 3R5FA 5EFZA 3K1YA 4ZEMA 1IM5A 3ZXXA 2JGLA 4JS0A 3KQNA 1UWKA 2Z9BA 3NWOA 4REOA 4X3OA 3NOQA 1A1SA 1U7WA 1EQUA 1GOTA 1QRRA 3T5PA 2HLPA 1KS2A 2WRZA 3F9CA 1FFEA 3HG7A 5DLPA 4JENA 2OFWA 2H08A 5EC8A 1DBVO 2B4YA 3D1VA 4BKQA 5JSZB 4G6ZA 1WMFA 1ISRA 1EINA 5LR6A 4MRVA 2P79A 4BQFA 3IE2A 3R24A 3NHLA 3DMHA 4D3XA 3FJ1A 3T9AA 2W7TA 1W2WB 1EFVA 3N0RA 4XAQA 3ZHOA 2AXPA 4QUBA 5FQOA 3DE5X 3JQRA 3GEPA 4FT4A 4D8XA 1NG1A 2Q5EA 4DV2B 2X9LA 4PAGA 4LW8A 1C7QA 2EBFX 2JAUA 2FW0A 3EXHA 5JQWA 2JIRA 3PPXA 5AW8A 3F2VA 5HGXA 1JHYA 5LQUA 3GJ7A 3ND7A 2J67A 3UQZA 1VLZA 2IHNA 4RLHA 3O9MA 5JNVA 4BBJA 2YFKA 2XHEA 5B7GA 3ELDA 1MC8A 1NR7A 4LYJA 5J2UF 4CJXA 4DR1B 2YJNA 3H4TA 3IMEA 3WHIA 3MGCA 3BILA 3OETA 1WB6A 4JITA 1ZS9A 4NY1A 4D41A 3RYIA 1F14A 4PR3A 3EWNA 2XUIA 2W8BA 1XAIA 3EXIA 5JY6A 4W5WA 4AUNA 5TQ0A 4CCYB 5L6LB 2I4NA 2ZKLA 4MX8A 1JTFA 5CA0B 2CVOA 4BE4A 2AI3A 4P86A 5DWQA 4IMPA 5EWJA 3ZDAA 4IH9A 5I7OA 3E4CA 4HXGA 1W1WA 2P4QA 5KJ6A 2OFOA 1NNSA 4RCVA 4UAJA 2IKQA 2HJRA 2W00A 3PYMA 4KQIA 1FQKA 4RIGA 4GPEA 2HW8A 4YRIA 3HWWA 2P78A 4RHEA 4C3VA 4IDEA 4LEIA 2NTEA 3R41A 1EE1A 3WLMA 3DVAB 1FRVA 2P30A 3FKQA 4RY9A 3HDJA 1PLJA 4PHGA 5JXIA 3IEVA 4HEA6 5REQA 2W6ZA 3A37A 2XVMA 1L5HA 3TR5A 1YF3A 3QEKA 4IXWA 3ZX5A 2HXGA 2HA7A 4ZIRB 4PYKA 2VRNA 1DT5A 3E5RA 3IP3A 3HDTA 3HHPA 1JB9A 1VSQA 1HWYA 2IEBA 2X8BA 2XUZA 4MRPA 5JW6A 1A8HA 4R40A 4NBVA 3VVLA 3W6OA 1KVTA 5IG2A 4RJKA 1D07A 2YVKA 5EE3A 1GADO 4DUGA 2YCLA 3KKMA 4JVOA 5FI1B 5TQVA 1ADFA 4E5DA 1OIVA 3OZ7A 1ELOA 5AJHA 1N5RA 3BA1A 3BD8A 2D3WA 1E1RA 2IPOA 3O74A 3REQA 2RFLA 4L4RA 3TCXB 4CIYA 5JFTA 3U5TA 3JAKA 4M7RA 2O06A 1O4WA 1ZCFA 2C29D 1E5DA 2NUTB 4IJWA 5B1YA 2J87A 4PBTA 2RAPA 3CEPB 4DLLA 5HF6A 2CVZA 2DERA 3VBCA 3JQAA 5TV2A 2WJ4A 3I9FA 1R8YA 2NUPB 3LI2A 4R7ZA 1JSZA 3NDPA 2EP7A 2IS6A 2CDBA 1GA6A 4HEJA 4BLPA 2WSSD 2A9RA 3QUSA 5BW6B 1SK8A 1AQJA 1NJ5A 5DTEA 2UXBB 5DBGA 5FLKA 1GTSA 1VE1A 3LBAA 3REQB 2W2LA 5TC4A 4AG6A 2J9GA 2VQDA 5CLGA 4ZTZB 4DYDA 1QZ3A 4OFZA 3H1FA 4JSYA 2W6MA 1SWVA 2ORVA 4KLZA 4M54A 4IJMA 1VSVA 5EJAA 1CY7A 1T9DA 3VU9A 1QHXA 4EPXA 2VN8A 4N5HX 4BGIA 2OV2A 4K46A 4ZYWA 4JSRA 1EWYA 4JJ8A 3RUFA 3ZWCA 4DJAA 2QPTA 3M6MD 2OZLB 4RUKA 2W8ZA 4OKSA 1TB4A 3K5PA 5H82A 4EP1A 3KKOA 4Z1MA 2J41A 2PH3A 3H9JA 4BNWA 1M1NB 2WF8A 4KODA 1MEJA 1WW2A 1QVZA 1YQTA 2EGGA 2P68A 1W7AA 3UAVA 3OIFA 5EP3A 4BX0A 4E5UA 3N53A 4L27A 4D3FA 3TW8A 2DWPA 5HRCA 3H0CA 1H2AS 3G5UA 5LQNA 5EWLB 1FFWA 3QVXA 4D9GA 4DYVA 1KZ7B 5TIIA 2SICE 4WUTA 3R5TA 1YUMA 3ROEA 1FTGA 3T3DA 4BFVA 4AMGA 1Z0IA 2V9ZA 4J1QA 2I3AA 5SZJA 5BPFA 5JNLA 1KJZA 1M54A 1GTRA 4M8KA 1MHPA 5T6BA 1C1XB 1ZCJA 2WINI 3JYNA 3SC3A 2ZUEA 1BMDA 2ZI4A 4EA7A 3GB9A 2GD2A 4CL8A 2R8XA 1M1UA 2Q8PA 2CNOA 2BGGA 4ZV7A 5KPDA 2OHHA 2WBLC 1PGJA 2F6RA 3U0BA 4M9CA 5G02A 2JIZD 4YRLA 4HQ6A 3Q8MA 1C81A 3GGDA 2YV4A 4HUQA 3TZKA 2BMWA 4GX0A 2AOXA 2ANCA 2I8AA 3L7KA 4R2LA 3RBAA 4OXXA 5KU7A 3PWSA 2LV8A 1RFGE 1YKSA 3KHKA 1MAVA 1Q0TA 2R8OA 3D2LA 1JB1A 3VTAA 3OHSX 2F9FA 4MEJA 1ZCZA 2R86A 1N7IA 1YDFA 3HB5X 3AZQA 4UHJA 1UFRA 4YLEA 4ESHA 4AB1A 4QGSA 4IM7A 3T3GA 3RIGA 1VYTA 2FMHA 1A9YA 2EZ4A 2J7KA 3AJ8A 2IHYA 3EZXA 1CJTC 2J0UA 3JWEA 4MVJP 4TWBA 5ED0A 1VJRA 1H6CA 3HM2A 5JPIA 1LXCA 4BO5A 1VBFA 1D1QA 4OSEA 4QUKA 1GRVA 5ILGA 3G1UA 4S1NA 1PN3A 2N75A 3OPXA 3C3CA 4XD7D 5THKA 1KNQA 1U94A 3IDAA 3L9XA 4ZI7B 1ECGA 3QXGA 4Z3DA 2JEZA 2PPLA 3DNPA 1JG2A 4AY5A 2OXTA 1GEGA 5JE8A 5KNBA 4M22A 2A35A 5CLQA 4D26A 3WDSA 1YV9A 3EGWA 1WMEA 3NEAA 4FK8A 4Q1CA 4WN9B 2DC1A 2PUHA 2R1ZA 2H63A 4F12A 4FT2A 4FGUA 2J45A 2J1LA 1GTG1 2JC3A 3F5SA 1UBGA 2XXAB 2FG7C 1JNXX 5G0VA 1FFDA 1DLJA 3K2EA 1JHPA 1Z4NA 3M4YA 1WBBA 1HZZC 1A4UA 1F8YA 2O8FB 2GJ9A 4GQBA 2MDTA 4P7GA 3DDZX 4UTOA 4C4TA 1YL7A 1XAGA 1M8KA 3LH5A 3CSUA 2MR6A 3HUTA 5FUBA 1NJ6A 2DH5A 3O1IC 4WXRA 1U9IC 4PXYA 2R84A 5FXMA 4YUVA 4JC5A 4KIWA 3BEDA 4PPQA 2XQKA 3DF7A 2QVGA 1U0LA 1UINA 3G2OA 2WVGA 4YAEA 3FTEA 5KNDD 1B26A 1COWD 3H75A 4PGFA 3EDRA 3TXAA 1DWOA 3AV0B 4JBNA 4R3WA 3ZDEA 4E70A 1UJNA 3I23A 3MUEA 2FDXA 4NHOA 1QB7A 3I04A 1YZLA 3MWKA 1I80A 2VAWA 4C0BA 1ADYA 1P45A 3N2KB 4Z7OB 1S9DA 2JS7A 2JIZA 4TUYF 2ZJ5A 5FIUA 3ZDZB 2YICA 3KB6A 4AX4A 4RSMA 4CU5A 4MJLA 5DNUA 1CYDA 2WWXA 1XXHE 3E0XA 1H2EA 1SVOA 3HO8A 3S0JA 2XF8A 3BRQA 3U4DA 5DN6A 4RHUA 3MMSA 3IO3A 4I2NA 3BD6A 3TNFA 4PQYA 2VHEA 3H1GA 4HAYA 3ZDYB 2IGTA 4KJZA 4B80A 2O8EA 2CHUA 1EXDA 1LQ2A 3MJTA 4HB4A 4WLNA 4POOA 1WY7A 4NBLA 2AKAB 5LMNB 3PFIA 4LXTA 1NSFA 3FDXA 3G2MA 3RSZA 1U3WA 2QI9F 1XPOA 4LJRA 1L0BA 1EK1A 5DTIA 1JJVA 2FPOA 2QN9A 3IP5A 2QJFA 3PPYA 3VUEA 2E37A 2EIHA 2VHVA 3AHGA 3W6UA 4BBZA 1LLQA 2JCSA 2UZ3A 1WOYA 3DM9B 3P9ZA 5HFNA 3TBKA 5K6RA 1T3TA 4A1FA 4WDQA 4YR7A 3R4CA 1XO1A 1X8XA 2J3EA 3VKWA 2D13A 2FN4A 2Q6LA 3I32A 4A3SA 2Q41A 4OXYA 4MUXA 2WHPA 1SXGA 3OEED 1D2GA 4U7WA 1Q6YA 3T7AA 4PSVA 1CRWG 4I9GA 5HILA 1JEYB 2I6GA 1T6XA 1XEXB 3OM9A 3UJ8A 1FL9A 2C3PA 4Z1MD 3UBTA 2BE7A 3PFGA 3RASA 2PXCA 1QF9A 4XWGA 4D74A 3A4IA 1O96B 4WI1A 3W1VA 1DJQA 2PTGA 1Z7BA 1ONNA 1SHUX 1SXIA 2H51A 1ZSNA 2GBPA 2P7IA 2WWFA 4QOEA 4RGQA 3F3MA 3OLYA 3L4BC 3K72B 4UMDA 1JEAA 2IOHA 3GD5A 3ZQ4A 1G2OA 2YHIB 3KYBA 4ENSA 3KLMX 2JGEA 1JVNA 4CQLB 1JKIA 1JVSA 2SKEA 2PV0A 3K6SA 4RPLA 2ES4A 3DT6A 3H7AA 1ADJA 2HJSA 2I87A 5AUOB 4IVNA 5D1HA 2GJSA 3N75A 4A73A 1XK6A 2CLCX 3OY2A 4BRZA 2GO7A 2HAEA 3TZLA 3ROZA 5JNWA 1U8TA 1BEUB 1EVQA 3IOEA 4IRMA 1NATA 4KXXA 2ZXEA 3FUTA 4MV5A 1Q0ZA 4F2DA 4UTNA 1RT9A 3RHTA 1QP4A 4MQBA 3PRKE 4B6OA 1E1NA 1OAKA 2I6QA 1N57A 1VZ3A 4K2AA 2QU7A 5H5JA 1E3MA 1T8UA 4X7RA 1YS9A 1ISFA 4ZVVA 3QUCA 4DMLA 4CMHA 2GKSA 1ZI6A 1VHJA 3HPRA 3JD2A 5HTOA 2RIPA 1VL5A 1E1CB 1SVWA 2X6QA 3RNOA 4LDAA 4F06A 4HGOA 4OGWA 1LI7A 5EZ5A 2X3UA 4FYKA 3AR8A 3EQ7A 2IHZA 4CKBA 5JBNA 3ACBA 1EDEA 3WRWA 4QICA 2HQBA 1MW8X 3NC1C 1JDPA 3F98A 3LT1A 2HK7A 3LDFA 4D9CA 4PTLA 2JKYA 1LVGA 4NWIA 4WOPA 4G0XA 1CETA 3VC3A 3GVIA 3D4NA 3E7DA 4RM3A 3PFNA 4RKFA 3G68A 2VPYA 1V96A 4EG6A 4JXKA 4Y9RA 1NVBA 2OE2A 3N39C 4YXWD 1D2EA 4R0MA 1Z68A 2B78A 3TSWA 3MQ4A 4ESEA 3K8OE 4Y18A 2TRSB 1AVTA 1GUFA 2YC2C 2ADFA 3CWZA 3I0NA 1JI3A 2DPMA 4PICA 3TAXA 4DFDA 4DZZA 1CUGA 1E99A 1NQAO 4WECA 4GDFA 4U3JB 2D74A 3EUFA 4RD4A 4L6CA 1DLIA 1DMRA 2GTIA 3KV1A 4G01B 1IY1A 3TL2A 2QP4A 4O29A 3P26A 1OBCA 3A1DA 1A5ZA 1Z45A 4WJKB 4B3GA 5ALVA 4EGQA 4URHA 4I50A 3ZXSA 3EUAA 4BQQA 3QWIA 4DANA 1VLHA 1RWXA 3EA5A 4N18A 3SFTA 1KFCB 2Y0EA 4L4ZA 4RD6A 2BV3A 2F59A 3JVEA 2GDJA 2GD1O 1EBUA 2IIVA 5FFFA 5EQFA 1RDFA 2XIQA 3L5OA 4GBGA 4GLJA 3PZBA 1NF3A 3KJIA 1L4NA 5LB4A 3K9CA 2QRVA 5FTLA 5IC5A 4MR7A 1UK8A 3VNVA 4ZCSA 4C6TA 4COOA 1IB0A 1TL7C 3WK5A 4OH1A 2C2ZA 1G60A 3GRUA 3TTUA 3UG6A 2GEBA 2GESA 1Z15A 5IT0A 4R01A 2C2GA 2NV0A 3GWZA 1E5VA 2AEMA 4DVGA 3Q1KA 4BJ3A 3NOVA 2DCMA 4CMGA 4EF6A 4IIVA 4AMUA 1H2BA 1L7EA 2QVZX 4ZANA 4A0QA 4DA4A 4DCPA 3GN2A 1ZC4A 2C4VA 1TEZA 2ZJ3A 3OPNA 2DHEA 5P8WA 1I2DA 3AGQA 1C8BA 2D3TA 3DDWA 1VB3A 4BNUA 1YE8A 4HDKA 4QASA 5C0OE 1P2FA 1QF7A 2WTAA 3H2SA 3FKJA 4RGVA 4LJLA 2IPLA 1NI4B 3C24A 1MXFA 1XRPA 1CNMA 3F71A 2BMDA 1AX9A 1SCUA 2GEJA 2D2VA 5DB4A 1ZMTA 4ZO9A 3UMCA 1T15A 1KORA 5C5DA 4J0FA 1UZNA 4P53A 2ALJA 2QVYX 5JY1A 2VHQA 2XUPA 3OHMA 3EXHC 1DJOA 3DLCA 2WHQA 4MPJA 4RD1A 3VPDA 1DKMA 3NRCA 1E9VA 1VP9A 4WOKA 1T4MA 4P4TA 1DXQA 2X7JA 3RRFA 2ICAA 3AVUA 3VXKA 2XWBF 4CHGA 2DUNA 1X92A 1UPTA 3N9IA 4G25A 4B6EA 2N9UA 5A0VA 2I6FA 2BPOA 3DLAA 2P5YA 3QWBA 4G84A 3AV3A 4MGEA 1FQJA 4JXXA 1XWFA 3E3AA 1L9XA 1LI5A 1B6RA 3LUDA 3L7BA 4HLQB 3HJHA 5AHRA 4C7VA 2FKAA 3OZCA 2XTMA 1LKZA 2ODWA 3CKLA 4ARCA 5EJ4A 1GNRA 1WQ3A 3K0FA 3RW9A 3KP1A 5HE9A 3IBCA 1QGOA 3VH4A 3WS7A 1C29B 3ZGYA 3C7KA 1B8NA 2D7JA 3USES 4BN0A 4F46A 6REQA 2XWJI 4FIDA 1QP7A 3JATB 4GLBA 2Q3DA 5CXQA 1YULA 3Q9LA 1G98A 2R2AA 4GI3A 5J1SB 2P11A 3GAFA 5J2TF 5MGNA 3OPYA 3IV7A 3HUUA 3N1UA 3FX2A 2C2OA 3OIWA 4Y8VA 3OE7D 2UUAB 4MVJH 5BRAA 3K6KA 4KWCA 1LVHA 3DW3X 4DQKA 3Q9UA 4X84A 2ZM6B 3MLAA 1NR5A 2O3UA 3BSFA 1R1DA 2NXWA 3GCXA 6PFKA 3UHPA 3DEIA 3DKPA 4RZ2A 2PWBA 1ENYA 1YNOA 1K89A 3LM8A 4N03A 1QPBA 5CLFA 2QSUA 3EHEA 1QQ7A 2R5WA 4Q12A 2WYIA 1OXTA 3N3BC 1Z16A 2FJ0A 4BJHB 4YRRA 4EQZA 2HSZA 4RULA 4NQZA 4E4RA 1EYZA 2OY0A 5EHGA 2JFFA 4IYRA 3IP8A 7ABPA 1FIUA 3D2BA 5L7TA 3W90A 1JALA 5DW3A 7AT1A 3K8ZA 5DGDA 4RIIA 1U3TA 4IS3A 5AI9A 1M34A 4TVKA 2NQTA 4PGAA 4GH5A 1HQYE 5K8CA 5JZOA 3OZRA 3NAGA 2YC4C 3RG8A 1OJ7A 3GRZA 2P69A 5DRTA 2BDEA 3UMJA 5E3JA 3UGKA 5BMOA 1O6FA 1V5FA 3ZBUA 4CYMA 1SR8A 3SHTA 1BWQA 4TMWA 4C7XA 5DNYB 1R7RA 2WJ6A 2Q3FA 3HY3A 2XCTB 3D1JA 3UTCA 4CKCA 4WKOA 3SJUA 2AQHA 3DXYA 4E0BA 4RTSA 3GXBA 4TKMA 2QIOA 4IOLA 5K3AA 2YFYA 3QUQA 3WGVA 4QTZA 3IOMA 5ADWA 3QVUA 3SVTA 3CLKA 2DY1A 1JKJA 3T3OA 4BNDA 1ODFA 3L7DA 4XPIA 1FU7A 3H17A 4P0PB 1E6UA 2CZGA 3PI6A 5CT8A 4D6PA 5CG1A 3KYCA 1A97A 1KI8A 1Y1QA 4A0SA 4PHCA 4QRIA 1ZEJA 4ZCRA 2WVHA 3AUTA 3NYWA 5KVQA 1E61A 1G59A 2BZ1A 1S8NA 4XIYA 1Y5NA 1E7YA 5GINE 3MILA 2J3HA 3WADA 4BLRA 2WU0A 1QE3A 5LQJA 3P4XA 2A8YA 4HQFA 4A5OA 2PLFA 3WG9A 4V1CI 1HDXA 1ZO8A 5K0SA 4J03A 1GYQA 2YV5A 2J31A 4AP6A 1E2QA 3JQ9C 1G4UR 4BFUA 1M67A 2I80A 5IWAB 1W0KD 4LC1A 1YHZA 3WBJA 3T1TA 2FEXA 4U8GA 2D5AA 4GMDA 2DYKA 2Q4BA 4GS5A 3IE0A 2HU7A 2HSEA 4UQPA 5IJ9A 1V8PA 4BIMA 5CLJA 1NVTA 5ERYA 1I8TA 1KEKA 5HSGA 1U2DA 3GLRA 3TCNA 4UOQA 4ALJA 4EHJA 4MCHA 5A4IS 3CJTA 1BXGB 1RQ7A 3P9NA 1ONSA 1OV6A 1QYVA 3C6BA 1U5BA 3TO5A 4NV3A 3OCCA 5K0FA 3Q3IA 4J07A 1F20A 1R27A 4LRWA 2YWBA 5DXAA 5FCDA 1F5SA 1OFTA 2RI1A 2ZI3A 5E1BA 3L6DA 2LIVA 4ND7A 1YB1A 3KNZA 2QRNA 1N2IA 3IULA 3KSZO 1HSZA 4XIGS 2GWHA 2HHCA 2NPOA 1E32A 3H1EA 5ELMA 4MUHA 4JLOA 5FPPA 1QKIA 5E38A 3B85A 3CW8X 1BDJA 1HQDA 3ET5A 3IC5A 2VPZA 1E3WA 1F48A 2VKQA 4M8NE 1YFLA 1N3BA 1KEUA 3CH5A 1H5QA 4P3KA 1NPDA 1N0UA 4K6FA 4Y1EA 2EW2A 3ED1A 1EVJA 1JHUA 2WKQA 3O8DA 1GTZA 2P41A 4YMTA 1ZJJA 2SKDA 3WICA 4JZYA 3DWFA 1XDSA 3B1KA 1RJGA 2IP4A 3RUPA 1U28C 2RH8A 1GN9A 2G08A 3V4VB 3ZCXA 3ANXA 2W6ID 4CI0B 3K73O 1VBNA 1YHYA 3CLUD 5LYJA 3CEAA 3E8MA 1MTZA 3QFRA 4LYGA 4NABA 4ACBA 4JYAB 1ETUA 4B7XA 2QRQA 3TLKA 3U4CA 1LFDB 5AOBA 1VXRA 4OHYA 4ZRDA 3IEMA 1A3CA 3U7GA 1ZMBA 4YBZA 3TQOA 1V5GA 3NAMA 4EI8A 3I2FA 4DLNA 4Q1FA 5IAEA 3O82A 5KEIA 1OB2A 1UJ6A 3FNFA 5D3MA 1DCKA 2O7SA 4YLYA 2HFJA 3CZ4A 4CEJB 1Z3CA 4AMBA 2HA6A 2ZE7A 4LJ8A 4NL4H 3WRXC 5CBKA 4F85A 3X2SA 3HVHA 3Q3GE 2D4HA 3PDIB 4PLZA 1PTKA 5EQDA 1JECA 4P7FA 3ORHA 1JQKA 2RG7A 3KKPA 1S7CA 1A5BB 3S2SA 1XF9A 2QLJA 4WZAE 5FBWB 4RTRA 1DC5A 1M66A 1FUIA 3IAFA 3TSYA 1D2AA 5KC8A 4YH1A 2E7ZA 2OAEA 3C7CB 2VDMB 2H1SA 3J7AC 2V03A 1ECJA 3GVXA 3WL7A 4ZZ0A 1JFFA 1YCDA 4G5GA 2Y3IA 3HCPA 2QE7D 2NAPA 1P2VA 3QOFA 2FWPA 5CD1A 5ES3A 1RIFA 1PGPA 4D3SA 1MX3A 1EFPB 2PJRA 5JYEA 2E5LB 1WZ2A 4OHBA 5DP2A 4NZMA 3K2I