3U3SA

The s-sad phased crystal structure of the ecto-domain of death receptor 6 (dr6)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
164
structure length
164
Chain Sequence
IGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S-SAD phasing study of death receptor 6 and its solution conformation revealed by SAXS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 21
total genus 26
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00020 TNFR_c6 TNFR/NGFR cysteine-rich region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3u3sA02
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3u3sA01
4KGQC 2X10A 4MXWR 3U3VA 1DU3A 3U3TA 4BK4A 4MSVB 5BNQR 3ME2R 2H9GR 3MHDD 4OD2S 1D4VA 1ZA3R 3ALQR 3QD6R 3K51B 4GIQR 3QO4A 1D0GR 2AW2B 5L36B 3IJ2X 3MBWA 4BK5A 4E4DR 4N90R 4KGGC 2HEYR 4I9XC 1TNRR 3ME4A 4M4PA 5CIRE 3TJEF 4J6GC 3QBQB 3WVTA 5IHLA 4RSUD 4YN0A 4FHQA 1JMAB 5DMJA 1FT4A 1SG1X 3U3PA 3U3QA 4M4RA 3U3SA 3URFZ 3X3FA 1EXTA 1NCFA 3MI8D 3BUKC 3THMF 3FL7A 2UWIA 2HEVR
chains in the Genus database with same CATH superfamily
2E4YA 4KGQC 2X10A 4MXWR 3U3VA 1DU3A 3U3TA 4BK4A 4MSVB 2E4WA 3ME2R 5BNQR 2H9GR 3MHDD 4OD2S 1D4VA 1ZA3R 3ALQR 3QD6R 3K51B 4GIQR 3QO4A 1D0GR 2AW2B 5L36B 3IJ2X 3MBWA 4BK5A 4E4DR 4N90R 2E4VA 4KGGC 2HEYR 4I9XC 1TNRR 3ME4A 4M4PA 5CIRE 3TJEF 4J6GC 3QBQB 2E4XA 3WVTA 5IHLA 4RSUD 4YN0A 4FHQA 1JMAB 5DMJA 1FT4A 1SG1X 3U3PA 3U3QA 4M4RA 3U3SA 3URFZ 3X3FA 1EXTA 1NCFA 3MI8D 2E4UA 3BUKC 3THMF 3FL7A 2QR6A 2UWIA 2HEVR
chains in the Genus database with same CATH topology
4KGQC 2X10A 4MXWR 3U3VA 1DU3A 3U3TA 4BK4A 4MSVB 5BNQR 3ME2R 2H9GR 3MHDD 4OD2S 1D4VA 1ZA3R 3ALQR 3QD6R 3K51B 4GIQR 3QO4A 1D0GR 2AW2B 5L36B 3IJ2X 3MBWA 4BK5A 4E4DR 4N90R 4KGGC 2HEYR 4I9XC 1TNRR 3ME4A 4M4PA 5CIRE 3TJEF 4J6GC 3QBQB 3WVTA 5IHLA 4RSUD 4YN0A 4FHQA 1JMAB 5DMJA 1FT4A 1SG1X 3U3PA 3U3QA 4M4RA 3U3SA 3URFZ 3X3FA 1EXTA 1NCFA 3MI8D 3BUKC 3THMF 3FL7A 2UWIA 2HEVR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGQ C;  2X10 A;  4MXW R;  3U3V A;  1DU3 A;  3U3T A;  4BK4 A;  4MSV B;  5BNQ R;  3ME2 R;  2H9G R;  3MHD D;  4OD2 S;  1D4V A;  1ZA3 R;  3ALQ R;  3QD6 R;  3K51 B;  4GIQ R;  3QO4 A;  1D0G R;  2AW2 B;  5L36 B;  3IJ2 X;  3MBW A;  4BK5 A;  4E4D R;  4N90 R;  4KGG C;  2HEY R;  4I9X C;  1TNR R;  3ME4 A;  4M4P A;  5CIR E;  3TJE F;  4J6G C;  3QBQ B;  3WVT A;  5IHL A;  4RSU D;  4YN0 A;  4FHQ A;  1JMA B;  5DMJ A;  1FT4 A;  1SG1 X;  3U3P A;  3U3Q A;  4M4R A;  3U3S A;  3URF Z;  3X3F A;  1EXT A;  1NCF A;  3MI8 D;  3BUK C;  3THM F;  3FL7 A;  2UWI A;  2HEV R; 
#chains in the Genus database with same CATH topology
 2E4Y A;  4KGQ C;  2X10 A;  4MXW R;  3U3V A;  1DU3 A;  3U3T A;  4BK4 A;  4MSV B;  2E4W A;  3ME2 R;  5BNQ R;  2H9G R;  3MHD D;  4OD2 S;  1D4V A;  1ZA3 R;  3ALQ R;  3QD6 R;  3K51 B;  4GIQ R;  3QO4 A;  1D0G R;  2AW2 B;  5L36 B;  3IJ2 X;  3MBW A;  4BK5 A;  4E4D R;  4N90 R;  2E4V A;  4KGG C;  2HEY R;  4I9X C;  1TNR R;  3ME4 A;  4M4P A;  5CIR E;  3TJE F;  4J6G C;  3QBQ B;  2E4X A;  3WVT A;  5IHL A;  4RSU D;  4YN0 A;  4FHQ A;  1JMA B;  5DMJ A;  1FT4 A;  1SG1 X;  3U3P A;  3U3Q A;  4M4R A;  3U3S A;  3URF Z;  3X3F A;  1EXT A;  1NCF A;  3MI8 D;  2E4U A;  3BUK C;  3THM F;  3FL7 A;  2QR6 A;  2UWI A;  2HEV R; 
#chains in the Genus database with same CATH homology
 4KGQ C;  2X10 A;  4MXW R;  3U3V A;  1DU3 A;  3U3T A;  4BK4 A;  4MSV B;  5BNQ R;  3ME2 R;  2H9G R;  3MHD D;  4OD2 S;  1D4V A;  1ZA3 R;  3ALQ R;  3QD6 R;  3K51 B;  4GIQ R;  3QO4 A;  1D0G R;  2AW2 B;  5L36 B;  3IJ2 X;  3MBW A;  4BK5 A;  4E4D R;  4N90 R;  4KGG C;  2HEY R;  4I9X C;  1TNR R;  3ME4 A;  4M4P A;  5CIR E;  3TJE F;  4J6G C;  3QBQ B;  3WVT A;  5IHL A;  4RSU D;  4YN0 A;  4FHQ A;  1JMA B;  5DMJ A;  1FT4 A;  1SG1 X;  3U3P A;  3U3Q A;  4M4R A;  3U3S A;  3URF Z;  3X3F A;  1EXT A;  1NCF A;  3MI8 D;  3BUK C;  3THM F;  3FL7 A;  2UWI A;  2HEV R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...