3U3WA

Crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
280
structure length
280
Chain Sequence
AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation mechanism of the PlcR virulence regulator by the quorum-sensing signal peptide PapR.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transcription activator/dna
molecule keywords Transcriptional activator PlcR protein
total genus 120
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3u3wA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u3wA02
4KBQA 4Z59A 2PUEA 4I6UA 2VYIA 4GYYA 3ZFWA 2HO1A 2LSVA 2LYRA 1POUA 2BNMA 5JJ6A 5G05J 3OQMA 2OFYA 4GCNA 4WNGA 1WETA 5AYWD 4I9EA 3S7JA 2WIUB 3CECA 2KCKA 3LYAA 2IU7A 4UI9J 2Y4TA 3LY8A 4IA8A 2EWTA 3URZA 3ZPJA 3CK7A 5HI7A 3ZHMA 3ZKCA 2LNIA 4G23A 1HZ4A 2JCGA 4Z5HA 3DNVB 1LQCA 4NQ0A 3MLFA 4GZ6A 2EF8A 2GZUA 4YBAA 3QDNA 4NRHB 4U0SA 4N2QA 1ZUGA 5EX3A 2A6CA 3CVPA 3OXGA 4YG1A 4X4BA 1RZSA 2EBYA 2KATA 1ELRA 4X4GA 3MV2B 5JJ7A 1XNFA 3RJVA 4X4FA 4GZ3A 4I2ZA 3OQNA 3SZ7A 2VSNA 2ICPA 4G26A 2ICTA 4UQZA 5EX0A 3QWWA 5D0OD 5KJMA 4F3VA 3BDNA 3OQOA 3LKUA 4F8DA 2J9QA 3QWGA 3MV3B 3B7HA 2KCLA 3BEEA 1JH9A 3K9IA 2IFUA 2WUSR 2UWJG 4LEUA 4N5CA 2LCVA 4MCXA 3D1NI 3UQ3A 4J1WA 4HOTA 2C0LA 2LYJA 2PUDA 3NF1A 3RU0A 3VK0A 4UI9C 5FT9A 5LCWC 1ZZ8A 3FWVA 4AIFA 4G24A 4J1XA 4I8TA 3IEGA 1YA0A 3IVPA 2WPVA 2Y4UA 5DIZA 3TAXA 4JCXA 2ONDA 4G1TA 5HQ8A 4JA7A 4AM9A 4KXKB 2OR1L 3VTXA 4X4DA 1ZZ7A 2PQNA 1LCCA 3SF4A 1WM5A 3FP3A 5M72A 2XCCA 3LFPA 1CQTA 2VSYA 3CV0A 3SCFA 5EKQD 2PUGA 3FYMA 2NC9A 2XI8A 1WAO1 2XEVA 4CDRA 3SCHA 5FZQA 2KCVA 4BT8A 3U4TA 1IYGA 1UXCA 4IVZA 4Z58A 3PXPA 3JXDL 2L49A 4G2VA 3GN5A 5ARGA 5K98B 1DW9A 2PUBA 4I6RA 3Q5MA 2O38A 2XGSA 3CLCA 1BDHA 3JXBC 3F6WA 5C1DA 1HF0A 2HR2A 3JYSA 3R9AB 3Q15A 1LLIA 4Z5CA 3QWVA 4N3CA 1ZS4A 1IC8A 2KC7A 3ZHIA 3KXAA 3G5GA 3GN5B 2IUOA 4W9RA 1PC2A 1PRVA 2IVBA 2LYPA 5KJNA 3S7DA 4Y6CA 5DBKA 4UQYA 3ZHEB 2KEKA 3CVQA 2KPJA 2HSGA 3GBFA 3KS2A 4WNEA 2I6HA 1WH6A 4IN3B 3OXFA 4O6FA 4H7YA 1E3OC 3ESKA 2FF4A 2VGYA 3OMTA 1KT0A 2PZIA 3QKYA 1IHGA 2C0MA 4MCTA 5BNWA 3QWPA 3ULQA 3QQ6A 3ZHEA 1KLXA 2FEZA 1HXIA 2GRLA 1ZPQA 2UY1A 2JVLA 4ME2A 1WH8A 1LCDA 2PUCA 2PUAA 4N39A 4I6TA 4AY6A 3RIBA 3FFLA 2PL2A 1OCTC 1NZNA 3OXLA 3U3WA 3AS8A 4YG4A 1NA3A 5G04J 2CSFA 4B94A 2XJ3A 1X57A 1UTXA 4PU7A 3ASGA 3EUSA 3CEQA 1JFSA 4H7XA 3LPZA 3QF3A 1P5QA 1CJGA 4U0UA 2AXZA 4JL0A 2FBNA 5FJYA 2AW6A 2AXUA 3BD1A 4J8EA 2R1JL 1QZ2A 4I2WA 3ASFA 2D5VA 4CGWA 3Q47B 1ZBPA 3KZ3A 2VGXB 4RG9A 1NA0A 3CKBA 4HOUA 4CGVA 2AXVA 2AVPA 3UUXA 1LMB3 4XI9A 4GHJA 1S7EA 1R69A 2XSDC 1JFTA 2DBAA 3ASHA 4G25A 1ADRA 4XI0A 2KEJA 4Y6WA 4WNFA 4U04A 4A1SA 4X4EA 2V5FA 3ASDA 1L1MA 2IV1A 1ZVVA 1AU7A 2VQ2A 3KD7A 3O48A 1ELWA 3GZ1A 5KJKA 4BTBA 1RPEL 5JJTA 2XPIA 4JQDA 4YNDA 3R1FA 4BTAA 4J8FA 3L1PA 4I9CA 4JA9A 2MHKA 3RZZA 2XGMA 2PE5A 3AS5A 1GT0C 1X2LA 4X4CA 3MEKA 2AUWA 3KJXA 4PU8A 2GRMA 3H5TA 3LY7A 3UPVA 3TRBA 3F52A 3TGOA 4UQXA 1ZZ9A 1Y7YA 2Q7FA 3JXCL 3E4BA 3QOUA 2HINA 3QYXA 4J8DA 1YSEA 4WNDA 4GCOA 3S7FA 2KEIA 4N2SA 5G04C 3VTYA 2OOEA 3N71A 4ABNA 4Z5DA 3SCGA 3PE4A 2H8RA 2R5SA 4UI9K 2HYZA 1B89A 5ARFA 3FMYA 5BW8C 3RO2A 5LCWJ 4BT9A 2LYSA 3GW4A 5D0QD 4BWRA 1QPZA 2BNNA 4Y42A 2LYQA 1XWRA 1VPWA 3LY9A 5A7DB 1PERL 3KAEA 3LISA 4FBIA 3HYMB 2JLBA 2UY1B 1B0NA 4X4IA 1JWLA 2LYKA 4U0ZA 1RIOA 5FTPA 1KT1A 3UFDA 1Y9QA 4KYOB 3MA5A 2MEZA 4GA1A 3PDNA 2E2EA 1RZRD 1QQBA 3ZN3A 3S8QA 4NDWA 2O49A 2B5AA 1BDIA 2GW1A 3Q4AB 4I1AA 3WXXA 3O9XA 1QP7A 2MQKA 2QFCA 1E96B 1NERA 1ZAYA 1W3BA 2YQ8A 1PRUA 4JHRA 1QP4A 3OP9A 3RKVA 1HH8A 4HOQA 1ZZ6A 2FJRA 1O4XA 3F51A 1QP0A 2C2LA 4YARA 4O8BA 2CROA 1A17A 4IWRA 2BUGA 3FYAA 4I17A 2L8NA 3HZIB 3MKRA 1ZU2A 3TG4A 3RO3A 2PUFA 2WQHA 3Q49B 4N3AA 1OSLA 4YVQC 1DWKA 2XCJA 2XCBA 1FCHA 3GZ2A 5KJLA 3BS3A 1WIZA 1NEQA 5G05C 3CK9A 1QQEA 1Y8MA 4RG6A 2VGXA 2LYLA 4X4HA 1RZRA 2P58C 3CKCA 4J0UA 4APOA 3CK8A 2LSUA 1OUVA 3CVLA 2PIJA 2L6JA 5FZSA 3S7BA 4WUYA 4FN3A 1QQAA 1SQ8A 3CROL 3GYZA 2BJCA 1ZZCA 2O4AA 4N3BA 4EQFA 2IVQA 5CCMA 2BNOA 4GYOA 2PPXA 4GYWA 1ZZBA 5A6CA 5BT1A 5CCLA 3PE3A 2R63A 1TJCA 4PU4C 2AWIA 2XGOA 3ZGQA 2FI7A 4HOSA 3G7DA 1UXDA 4AY5A 2IF4A 1EFAA 1PRAA 5FZRA 4OB4A 3CVNA 3TG5A 4XIFA 4YVOA 4GA2A 2IVGA 2XIUA 2PQRA 5A7LA 4PU3C 4GPKA 4GA0A 4HORA 3EDTB 4GZ5A 2KZ8A 4JCYA 1PNRA 2FO7A 4YG7B 4GQMA 1R63A 4U07A 5CHEE 3LCAA 3AS4A 2YHCA
chains in the Genus database with same CATH superfamily
4KBQA 4BX9A 2VYIA 4I6UA 4GYYA 3PRZA 5G05J 2OFYA 3LXUX 2VJ8A 1WG0A 3NZSA 5ENRD 4I9EA 3NXHA 1E7UA 2ETCA 3LYAA 2IU7A 3ZPJA 4GTOA 5ANLA 5HI7A 4G23A 3D9PA 3SQVA 4XZ4A 3GZDC 3MLFA 2EF8A 4YBAA 1LF8A 1MJ0A 4U0SA 1MX4A 2X3MA 2A6CA 3CVPA 4HB5A 2P9LG 3L13A 3RK6A 5G2NA 4F1PA 4X4BA 5GAHi 3FUIA 1SZAA 2LLVA 4LRZA 2VTBB 4X4FA 4HVBA 3SZ7A 2ICPA 2ICTA 4EZJA 3LVQE 5EX0A 3FUHA 3QWWA 3RRMB 1H6OA 4F3VA 4GTTA 2J9QA 3MV3B 3UT8A 3FUKA 2ZISA 4DX1A 2BF0X 2MXDA 3QK0A 3CVWA 2UWJG 4HI9A 4E85A 4IRUA 3SO8A 5FQ7A 3JQ0A 3SFZA 3SFXA 5LCWC 4ANWA 3CIAA 2X6KA 3HVEB 4J1XA 3R7RA 4LCTA 1YA0A 2WPVA 3TAXA 5DIZA 4JCXA 2ONDA 3I4GA 2WXIA 3ONLA 4KXKB 2OCCE 3GZCA 5G55A 2R2LA 2XQ0A 3SF4A 5M72A 2XCCA 3LFPA 1BI8B 5EKQD 5BXUA 2XI8A 4CDRA 3GZDA 1JCQA 5EYPF 3SCHA 3LJ3A 1O1RA 5AN8A 5DRYA 3L9TA 3PXPA 3Q78A 4ACLA 5ARGA 2EINE 5K98B 3C98A 4I6RA 2OVFA 2O38A 2XGSA 4TXQA 4OVVA 3JXBC 3L82A 4OVUA 3DSVA 2WXLA 2XXPA 3Q15A 1LLIA 2IO2C 1ZS4A 1IC8A 3ZHIA 4DX5D 4KVOA 3S2AA 1YMPA 4AEZC 4HRLA 3PNLB 4WWNA 3ZIMA 1MQSA 3CVQA 2KPJA 1WH6A 3OXFA 1E3OC 5AQ9A 2HM8A 3VLDA 4CT0A 3DWLG 3OMTA 4K5BA 2PZIA 3QKYA 1OWNA 1KLXA 2PXVA 3UM0A 2FEZA 2ZGGA 1HXIA 4U7EB 2X38A 3DM5A 4AOFA 4I6TA 4AY6A 3D9HA 1IQRA 5J90A 3ABME 3C3RA 5T8IA 2MRIA 2J7UA 1X5BA 4RVBA 3A9XA 4YDWA 2A5EA 1NA3A 1S63A 4MS6A 4PS7A 1DVPA 3V30A 1HG5A 3EUSA 3B13A 1NP7A 4C0MA 4H7XA 4NIKA 4HNAD 3HVEA 3ZW3A 3LJNA 4I2WA 3ASFA 2D5VA 3Q47B 2VGXB 4J7WA 4RG9A 3FTVA 4B8CB 4HOUA 2XZDG 4PS3A 3UIOC 1U2ZA 4CDMA 4XI9A 2A5UA 4KMOA 2DBAA 1ADRA 2OV8A 4Y6WA 2KEJA 3DSSA 2R05A 5LX8A 2IV1A 2VQ2A 3O48A 4A3VA 4GTPA 1UJKA 3GZ1A 3ONKA 4ILHB 3PNTB 3CVYA 4B0ZA 2X6JA 4TXPA 5CRVA 3CHSA 3F6QA 4BTAA 4BESA 4JA9A 3RZZA 2XGMA 3G2UA 4X4CA 3B7TA 3KJXA 3ME5A 3D9NA 2GRMA 3H5TA 3KSLA 4UUCA 3DXKG 1Y7YA 3AU5A 4DX7D 4EK9A 3E4BA 4DX2A 4IYPA 3W9FA 1YSEA 4WNDA 1O1SA 5G04C 3VTYA 1QNFA 1JCRA 5C2YA 3ZYQA 4Z5DA 2PXFA 3T8KA 3ZEFA 2ETBA 2H8RA 2R5SA 5BW8C 3RO2A 1B89A 3VLEA 3FMYA 4A3TA 2LUHA 4C48B 3GW4A 4BWRA 2F8YA 3IHVA 3QJZA 4LERA 3SGHA 1VPWA 4EECA 5A7DB 2RKKA 2UY1B 1OWOA 2VSOE 3ASNE 2LYKA 2LNMA 3UMVA 4DLQA 4KT6B 3NOGD 1QYMA 4B93B 3UT4A 3PDNA 1S0PA 3ZN3A 4HQDA 3ZU7B 3O4ZA 2GW1A 3KSQA 1PAQA 3G2WA 1E96B 3G0TA 3MX3A 1ZAYA 1AP7A 2YQ8A 1D9SA 3CHOA 4GMLA 3DXMG 2PXUA 1D8EA 2VSXE 3EU9A 3PE5A 3UIPC 4U8HA 4APFA 2RFAA 2L8NA 4FU3A 3VLFA 1ZU2A 2FFHA 2VGEA 3RAUA 1G3NB 3V2OA 3Q7AA 3FTUA 2IOLA 3MCXA 3GZ2A 4O1PA 3ZKJA 1H0AA 1EDUA 2LXLA 1Z3XA 1H6PA 2VGXA 1U2VG 3CQGB 1JUQA 4APOA 5KWDA 5IY5E 1OUVA 1YCSB 2PIJA 1ZB1A 3L22A 3DSWA 3IBEA 4XKCA 1UN8A 1TNBA 3BUAA 1OY3D 4WUYA 2F8XK 4N3BA 4Q94A 2IVQA 1DCEA 1TNOA 4GYOA 4GYWA 4OAVB 1ZZBA 3MYVA 5A6CA 1SW6A 2R63A 1TJCA 3PE3A 5E75A 2DWZA 4PU4C 4HI8A 1FT1A 1HO8A 2IQCA 3AG3E 3ABLE 5FZRA 2OEWA 3DPDA 3B7BA 5A7LA 4AP2A 5BXOA 3UM3A 1H2TC 3EDTB 2L6BA 1PNRA 2OEVA 3L6AA 4GQMA 3V31A 2LSVA 2LYRA 1POUA 4J8SA 2L0TB 3KEZA 3PUJA 1UJJA 4V3IA 3OQMA 3EUVA 4GCNA 1XGWA 1WETA 3FU6A 1RW2A 3ZYLA 4LNUD 2WIUB 3CECA 4UI9J 5HS0A 3LY8A 1E90A 4JPSA 2EWTA 4FP7A 3ZHMA 5B1AE 4NQ0A 1H6KA 3B95A 3LEWA 2VTBA 4NRHB 1ZUGA 4O1OA 3SBSA 2EBYA 3DPYA 1EPUA 4HS2A 1HS6A 2KM4A 3V79K 2ODRD 2GRPB 3FU0A 4I2ZA 2VSNA 3C3OA 2P9IG 3M9LA 2WXHA 5D0OD 3BDNA 1BI7B 4M7CA 1INZA 2WXNA 3QWGA 4UWFA 3B7HA 3BEEA 3ZRHA 4N5CA 5D66A 5LOZA 4GTQA 2LCVA 1N4QA 2H6FA 4XX5A 5BV0A 4EZKA 3D1NI 4N5QA 4L7TA 4J1WA 2C0LA 4ER6A 3X2QE 2PUDA 3TXNA 3I3NA 2L9BA 4RLYA 3NDBB 4UI9C 3QAQA 3IEGA 4I8TA 4BY6A 3IVPA 1TNYA 4G1TA 4AM9A 3U66A 3OKZA 1DNPA 2P9PG 5A23A 3VTXA 3TWUA 1ZZ7A 2PQNA 1LCCA 3FP3A 2DIWA 1L5JA 2KXPC 2ZU6B 2IONA 1N4SA 4GTMA 2L49A 3EIJA 3ENEA 2WXKA 3T5VA 3CLCA 3BG1B 1BDHA 2ZXWE 4K0RA 1OT8A 5C1DA 2XXQA 2HR2A 3JYSA 3R9AB 2HCNA 3EJNA 4N3CA 2KC7A 3JUIA 3KXAA 3G5GA 5ENNA 1SA5A 4W9RA 1PC2A 1TN8A 3L16A 3NROA 5CMYA 1N9AA 5KJNA 3S7DA 3TJPA 3ZHEB 5CEAA 3UM1A 3TWQA 1LD7A 1K8KG 4IN3B 2JQEA 4H7YA 3ESKA 4M3OA 5T3RA 1H2VC 2VGYA 2IU1A 1KT0A 1IHGA 2C0MA 3D9OA 5BNWA 3FH5A 1QB2A 3IXEA 1ZPQA 1MZCA 2UY1A 1WH8A 2L1PA 2PUAA 4ZFHA 3CLJA 5KNHD 3RIBA 1OCTC 2CFUA 4YG4A 4F53A 1TYQG 2LAIA 3FH8A 4B94A 1X57A 1K3ZD 3CEQA 4BX8A 4UWLA 3E34A 4CCAA 1JFSA 3R7QA 4F1SA 3PUKA 3AG4E 5AAOA 1NW3A 2AXZA 2FBNA 3QFIA 2YINA 3D9MA 5AJLA 1QZ2A 2EIJE 1NA0A 1LTXA 3EIQC 3NB2A 2AXVA 2AVPA 3UUXA 2XSDC 3AU4A 2XZTG 3AAAC 2E0IA 3LS8A 3ASDA 1L1MA 2ILRA 3TWVA 1ELWA 3A9ZA 2WXFA 5KJKA 4BTBA 1RPEL 5JJTA 3IV0A 4YNDA 1D8DA 3R1FA 2J4DA 1YYHA 1E8XA 2MHKA 4GAAA 1GT0C 3MEKA 1WDYA 5BUZA 3LY7A 3UPVA 3TRBA 3TFLA 4UQXA 1HU3A 2HINA 3QYXA 3HXEA 5BPPA 3P1UA 2HFZA 2FULA 3S7FA 2KEIA 4N2SA 3UM2A 4UWGA 3TELA 4MKTA 4GMRA 3SCGA 3EU5A 4UI9K 5AARA 1BU9A 4YDOA 1QPZA 3FU5A 2BNNA 3FTWA 2LYQA 3LY9A 2EIME 2M63A 5ENSD 3KAEA 4FBIA 3HYMB 3SNXA 3B7UX 5AIJA 1B0NA 4FLBA 1JWLA 2XRYA 5CEDB 4CDNA 1OCOE 1K1AA 3MA5A 2MEZA 1Q2ZA 2L0IA 1RZRD 3S8QA 2B5AA 3E37A 2ETAA 2H6GA 1BDIA 3Q4AB 3PVLA 3O9XA 1NL4A 1QP7A 1JWGA 1NERA 4JHRA 1QP4A 3RKVA 5JHBA 3PZDA 1EF1C 3SY2A 1SA4A 1O4XA 1FVFA 3F51A 3BU8A 1FPPA 1A17A 2C2LA 4NACA 4TUUA 3FYAA 2XEHA 3HZIB 4ATZD 2B0OE 4I43A 3TG4A 4JEUA 2X6HA 2R17C 3ZXSA 3LQXA 1OSLA 4N3AA 2XCJA 1DULA 3CHPA 1V54E 1KZOA 1WIZA 4K03A 4RG6A 1SZ9A 4JVSA 3D9JA 2LO6A 3MKQA 2F37A 3GYZA 3B7SA 2BJCA 2O4AA 4EQFA 2WXGA 1TNUA 3UT7A 4HOSA 3G7DA 4Q96A 2IF4A 4MRUA 1HF8A 5DTQA 4J6IA 4B89A 3TG5A 1KPSB 5FWQA 3LVRE 2PXKA 4GPKA 3HXDA 4GZ5A 4PS8A 5BV1A 2NYJA 4U07A 3UWPA 3AS4A 2I1JA 4Z59A 3ZFWA 3FTSA 1SQMA 5AQAA 3FY4A 1N54A 4IULA 5EIDA 4DI3A 5FQ4A 4E6HA 1FT2A 4IA8A 3URZA 1LD8A 3CK7A 3C72A 3ZKCA 5HKPA 2LNIA 3RRUA 2YNQA 3TXMA 2JCGA 4GMJA 3DNVB 3FEXA 2GZUA 3G2SA 4R7LA 4L2LA 3NZUA 1WY6A 3OXGA 4A63B 3FULA 4YG1A 4A55A 1OWLA 3ZUVB 1IKND 3MV2B 5JJ7A 1XNFA 5HRYA 3RJVA 4GZ3A 1A5EA 3OQNA 3P2BA 2EILE 1TN6A 2M4HA 3RSEG 1SVXA 3FUMA 2CHWA 4UWHA 3HIZA 1HQ1A 1N4PA 2EIKE 2Y3AA 3DSTA 3OQOA 4CRWA 4G11A 3CSTA 4ER5A 2GRQB 2J4BA 2KCLA 2BEDA 2IFUA 4LEUA 2HCSA 3SI5A 4P29A 4MCXA 4LSZE 3DRAA 3WG7E 4I1MA 2LYJA 1MX6A 3SBTB 2J49A 3L17A 3PEUB 3CHQA 3FWVA 4AIFA 4G24A 4ER3A 3GZSA 1BD8A 2Y4UA 2P9SG 2GGFA 2XPYA 5E76A 3KEAA 3PEVB 3IKOB 2OR1L 4GTSA 4RSYA 3SHFA 4X4DA 4ANVA 5KCMA 4EZIA 1CQTA 4KVMA 3SCFA 2PUGA 3FYMA 2NC9A 4YDEA 4JC8A 3DSUA 2RD0A 3E32A 3JQ1A 5FZQA 3JXIA 2KCVA 4BT8A 1IYGA 4IVZA 4Z58A 1JWFA 4TUMA 2BKGA 3JXDL 3E30A 4G2VA 5B3SE 2PUBA 1QBQA 2IEJA 3Q5MA 5EN5D 1DC2A 4WAFA 2I2OA 1HF0A 3EHNA 3TWRA 4JXTA 5DTMA 4PDXA 3DBSA 2PXPA 2I9CA 2QZAA 4L2YA 2IUOA 3J5PA 2MOWA 1PRVA 2IVBA 3SFYA 2DVWA 1MFQC 3L54A 1U3DA 5DBKA 4UQYA 3UI2A 3GBFA 2PM7A 3KL4A 2WXJA 2FF4A 2NSZA 2WQ6A 3PZ1A 5ITZF 3PZ3A 4ILGA 3QWPA 3ULQA 3ZHEA 4DUIA 4FJZA 1V55E 4MBGA 4AVXA 4GU5A 2GRLA 3FUFA 4ME2A 3NOCD 2PUCA 4N39A 4F6RD 3TWWA 4QQIA 2LAHA 3OAWA 2PL2A 1NZNA 3OXLA 5CERB 4EQZA 4EZLA 5G04J 2CSFA 4PU7A 4XKBA 4HRMB 4URKA 2DZNA 3SX0A 4GTRA 4JB8P 2DYSE 2J08A 3PH0C 1KZPA 3ZPXA 4U0UA 4JL0A 5FINA 5FJYA 4Q2JA 2AXUA 1NFIE 3BD1A 4J8EA 1MHQA 3OTNA 2R1JL 2WXRA 3KZ3A 3CKBA 4EHMA 2YHEA 4PUCA 4LG6A 1N95A 1S7EA 1R69A 1JFTA 2HE0A 5D2MC 1FVHA 4WWPA 4WNFA 5EIBE 3T8MA 1ZVVA 3KD7A 4J8YA 1EYHA 4L23A 3PREA 3APFA 2H6IA 2WB2A 4GTVA 4C0EA 2QC9A 4J8FA 4EBAA 4NURA 4I9CA 3QARA 1JCSA 2PE5A 3ASOE 4EPZA 2ZGDA 2AUWA 4PU8A 3ZXPA 3F52A 1ELKA 3TGOA 3JXCL 4J8DA 2XXAA 3DSXA 4GCOA 1Y6IA 2QY7A 1H19A 2P2CP 4U63A 3N71A 4AXHA 4ABNA 3PE4A 4U8VD 2PXBA 5T4YA 3EHQA 4GB9A 5LCWJ 2LYSA 5D0QD 4QFVA 4Y42A 2AJAA 1PERL 3FUJA 2JLBA 1RIOA 4FLHA 1KT1A 3FU3A 3UFDA 1Y9QA 2Y1LE 3FHEA 3DEPA 4KYOB 3U9WA 3RRNB 2QYUA 4JW1A 4ATGA 2E2EA 1Z5SC 2EQXA 1QQBA 2O49A 3VWSA 3TWTA 3IHYA 4DPRA 1HE8A 3Q7FA 4I6EA 1TJFA 3EHMA 5ENQD 5EILA 3OP9A 3NAWA 3NBNB 2IO3C 1ZZ6A 2KZTA 5FQ8A 4FC8A 5CBNA 2FJRA 1HX8A 3CVUA 1QP0A 3FUEA 3OWQA 4YARA 3AJIA 2CROA 1OXJA 4IWRA 3AG1E 2WXOA 1QZXA 3MKRA 4MLPA 3ESLA 4DI4A 3RO3A 4FJYA 2PUFA 2DYRE 3CSFA 3C5RA 4ER0A 4BERA 3FUNA 4YVQC 5KBAA 1DWKA 4EKGA 5KJLA 3BS3A 2J09A 4HXIA 2CG2A 5G05C 1Y8MA 2LYLA 4X4HA 2P58C 3CK8A 4HFGA 2P9UG 2LSUA 3B7RL 3SR4A 2L6JA 5FZSA 5CECB 3FDHA 3S7BA 4C9BB 4WWOA 1Z6TA 3QNKA 3ML8A 4HRNA 1ZZCA 4CT4A 3AG2E 1OWPA 2BNOA 5CRUA 1S70B 3T9KA 2QYJA 3GUUA 5BT1A 3U64A 2AWIA 3ZGQA 2FI7A 4DE9A 4AY5A 2DZOA 2PM6A 1N4RA 2V3CC 1X81A 5AQBA 3PS6A 4BFRA 4OB4A 3FTYA 1NI1A 4XIFA 3ZNGA 3HRAA 3UKUG 4FULA 3UTMA 4PU3C 4GA0A 2KZ8A 4JCYA 3MZLB 2CG3A 3LCAA 2V4HC 2YHCA 2PUEA 2HO1A 2BNMA 5JJ6A 2DCPA 2NXPA 4ZHBA 4WNGA 3CHMA 3MJWA 3I4RB 1E7VA 2LXMA 5AYWD 3S7JA 5LFAA 3HXBA 2KCKA 3Q79A 5CBOA 1K1BA 4PH4B 3ULYA 2Y4TA 2P9NG 3MEJA 3D9KA 1HZ4A 4Z5HA 1LQCA 3FUDA 1H2UA 3BQOA 4GZ6A 2OVBA 3QDNA 4N2QA 1N94A 5EX3A 1N0RA 4JD2G 2WXQA 4CYMD 4TXRA 3D3MA 1Z3YA 1RZSA 2KATA 2BKKB 1ELRA 4X4GA 2XHEA 4L1BA 4U8YD 2YBDA 3CVXA 4G26A 4Z68A 4UQZA 5DT2A 4OAUC 5KJMA 2R03A 2XS1A 3CGHA 3LKUA 4F8DA 1TNZA 4HBDA 1JH9A 3FH7A 3K9IA 4U95D 2WUSR 3FTZA 2PXQA 3L08A 4LNBA 4RQIA 3UQ3A 2KZTB 2JEKA 1IHBA 4HOTA 2PXTA 3UKRG 3NF1A 5DRTA 3RU0A 3VK0A 4BETA 2V5QC 5FT9A 1TN7A 3HXFA 1ZZ8A 4AV7A 4TV3A 2MYOA 4HLLA 4XEIG 5HQ8A 4BEPA 4JA7A 4A1GA 4HRAA 4JEHA 3G2VA 1IQUA 5KNGA 4ANXA 2B6CA 5AQ7A 4WVLA 1WM5A 2IOSA 2VSYA 3CV0A 1WAO1 2XEVA 3D9IA 4GZDA 4JHJA 2X6FA 3U4TA 4G8KA 1UXCA 4EBAG 5ENOD 3GN5A 1DW9A 4FADA 3MGBA 3TWXA 4ACKA 3UX4A 3F6WA 3JCKC 5ENTD 3Q75A 3QWVA 4Z5CA 5J08A 3GN5B 2J8SD 2LLWA 3I5PA 4BSXA 4DX6D 2LYPA 5GAGi 2A4ZA 2GRNB 4Y6CA 3ZYKA 1E8WA 2R59A 4I6GA 2KEKA 4LUNU 2HSGA 3KS2A 4JZYA 4WNEA 2I6HA 3C3QA 2F0YA 5EDSA 4O6FA 1PY1A 3Q9NC 4OBMA 3T5XA 4CEMA 4MCTA 3QQ6A 1N11A 5H7PA 2J7WA 1BLXB 1S64A 2VEOA 2JVLA 5DSXA 1LCDA 4K5CA 3FFLA 2R02A 3Q73A 2PXDA 3PZ2A 5B1BE 3U3WA 2FO1E 2XRZA 3AS8A 2WMNA 4L9PA 3PZ4A 1TR4A 4O60A 5ANRA 1UN9A 4CZ2D 2XJ3A 4GPMA 3ASGA 1UTXA 3CR3A 2PNNA 2XENA 3ISMC 4G8LA 1MX2A 3APDA 3E33A 3JXJA 3LPZA 3QF3A 3DEOA 1P5QA 4OYSA 1CJGA 2WQ7A 2V4LA 1VDYA 3ZVVA 2AW6A 2H6HA 2V0PA 4KZCA 4CGWA 2GROB 1ZBPA 1IXVA 2KBXA 4X8QA 2XS8A 4CGVA 3D9LA 2XPZA 1LMB3 3FTXA 4GHJA 3ASHA 4G25A 1UOHA 4ILIA 3R09A 2PXEA 4B8AA 2ZIRA 3EHRA 4XI0A 3UINC 3V2XA 4GZCA 4U04A 4A1SA 4X4EA 2V5FA 1O1TA 1O5MA 1AU7A 2XPIA 1U3CA 2RG8A 4LNGA 4ANUA 5AENA 4JQDA 1GW6A 2X6IA 2RFMA 3L1PA 3AS5A 1X2LA 5JHAA 4DRXE 3R9MA 3HDXA 3BG0B 3HHMA 1ZZ9A 2Q7FA 3QOUA 2XEEA 4XE0A 2Y0BG 5JUWA 3TL5A 5JA4D 2OOEA 2WVIA 1OWMA 3QC1A 5ARFA 2HYZA 1HG2A 3QOXA 4DE8A 3HXCA 4BT9A 1XWRA 5FQ6A 3CQCB 3LISA 4X4IA 4DLOA 4U0ZA 5FTPA 1JPLA 3LDZA 3ULEG 4FA6A 4GA1A 1N52A 4DJAA 3TEPA 4NDWA 4YDYA 2WMOA 5ENPD 3UXGA 2P9KG 3ML9A 4I1AA 3WXXA 3JUEA 2BTDA 1TEZA 1E8ZA 3TWSA 2MQKA 2QFCA 1OCCE 3CVVA 1MYOA 1W3BA 1PRUA 1E8YA 1HH8A 3HG0D 4HOQA 1N0QA 2CHXA 3APCA 4O8BA 2BUGA 4I17A 4DK5A 4K5AB 2JABA 4ER7A 3NZLA 2GRRB 2WQHA 3Q49B 4D10C 1BPOA 4Q69A 2XCBA 1FCHA 4JHKA 3MKQB 5AJDA 3ABKE 1NEQA 3ZYMA 3QOWA 3CK9A 1QQEA 1OCRE 1RZRA 3CKCA 4J0UA 4I1OB 2I1KA 1HFAA 3J5QB 5FIOA 4EKIA 1RZ4A 3CHRA 3CVLA 5DTRA 4F7AA 2CHZA 5LP0A 3A9YA 4FHJA 2J07A 4FN3A 1QQAA 1SQ8A 3CROL 1DCQA 3Q9UC 2WXMA 4AJWA 3W9GA 1OCZE 5CCMA 2PPXA 2CFZA 2WM9A 5CCLA 3FEYA 4HLEA 2XGOA 4UWKA 3QB2A 1UXDA 2WXPA 3NQPA 1EFAA 2IY0C 5JMND 1PRAA 3CVNA 4I6JA 5EYLA 4YVOA 1UW4B 2IVGA 2XIUA 1UG3A 4GA2A 2V8SE 2PQRA 4U96D 4HORA 3SD5A 5CMWA 4BSZB 4FHKA 2FO7A 2PXLA 4YG7B 2Y69E 4TRQA 1AWCB 2IJGX 1R63A 5CHEE 4KZ0A 3G2TA
chains in the Genus database with same CATH topology
4KBQA 4Z59A 4BX9A 2PUEA 4I6UA 2VYIA 4GYYA 3ZFWA 2HO1A 2LSVA 2LYRA 3FTSA 1POUA 2BNMA 3PRZA 4J8SA 2DCPA 2L0TB 3KEZA 5JJ6A 2NXPA 3PUJA 1UJJA 5G05J 4V3IA 1SQMA 3OQMA 2OFYA 4GCNA 4WNGA 3CHMA 3MJWA 3LXUX 1XGWA 1WETA 3FU6A 3ZYLA 2VJ8A 3I4RB 3NZSA 1E7VA 5AYWD 4I9EA 3FY4A 1E7UA 3S7JA 2WIUB 3CECA 1N54A 5LFAA 4IULA 2KCKA 3LYAA 2IU7A 4UI9J 4PH4B 2Y4TA 3LY8A 5FQ4A 1E90A 4DI3A 4E6HA 4IA8A 2EWTA 4JPSA 3URZA 4FP7A 5ANLA 3CK7A 3D9KA 5HI7A 3ZHMA 3ZKCA 3ZPJA 2LNIA 4G23A 3D9PA 3RRUA 2YNQA 4XZ4A 1HZ4A 3TXMA 2JCGA 4Z5HA 4GMJA 3DNVB 1LQCA 1H6KA 3FEXA 3FUDA 4NQ0A 3LEWA 2VTBA 1H2UA 3MLFA 4GZ6A 2EF8A 2GZUA 4YBAA 1LF8A 3SNXA 2OVBA 3QDNA 2X3MA 3G2SA 4NRHB 4R7LA 4U0SA 1ZUGA 4N2QA 4L2LA 5EX3A 2A6CA 1WY6A 3CVPA 3NZUA 3OXGA 3FULA 4YG1A 4A55A 2WXQA 3L13A 5G2NA 3RK6A 3SBSA 4X4BA 3FUIA 3D3MA 1Z3YA 1RZSA 2EBYA 2KATA 1SZAA 1OWLA 1EPUA 1ELRA 4X4GA 3MV2B 4HS2A 5JJ7A 1HS6A 2KM4A 1XNFA 2XHEA 4LRZA 4L1BA 2VTBB 3RJVA 4X4FA 3FU0A 4GZ3A 4I2ZA 3OQNA 3P2BA 3CVXA 4HVBA 3SZ7A 2VSNA 2ICPA 4G26A 2ICTA 4EZJA 4UQZA 2WXHA 3LVQE 5EX0A 3FUHA 3FUMA 2CHWA 3QWWA 4UWHA 3HIZA 5D0OD 2Y3AA 3RRMB 5KJMA 4F3VA 3CGHA 3BDNA 3OQOA 1INZA 3LKUA 4F8DA 4G11A 3CSTA 4CRWA 2J9QA 2WXNA 3QWGA 3MV3B 3UT8A 4UWFA 2J4BA 3B7HA 3FUKA 2KCLA 3BEEA 1JH9A 2BF0X 3FH7A 3K9IA 3ZRHA 3QK0A 3CVWA 2IFUA 2WUSR 2UWJG 4LEUA 4N5CA 4E85A 3FTZA 5LOZA 4P29A 4IRUA 3SI5A 2LCVA 4XX5A 4MCXA 5BV0A 3L08A 4EZKA 3D1NI 3UQ3A 2KZTB 2JEKA 3JQ0A 4I1MA 4L7TA 4J1WA 5FQ7A 3SFZA 2C0LA 4HOTA 2LYJA 2PUDA 3NF1A 3I3NA 2L9BA 3SBTB 3RU0A 3TXNA 3VK0A 4UI9C 2J49A 5FT9A 3QAQA 5LCWC 3L17A 3PEUB 3CHQA 1ZZ8A 4AV7A 3FWVA 4AIFA 3CIAA 2X6KA 3HVEB 4J1XA 4I8TA 3IEGA 4G24A 4LCTA 3R7RA 1YA0A 4BY6A 3GZSA 3IVPA 2WPVA 2Y4UA 4TV3A 5DIZA 4JCXA 2ONDA 4G1TA 3TAXA 5HQ8A 2GGFA 4JA7A 4AM9A 2XPYA 3I4GA 5E76A 3U66A 2WXIA 3ONLA 4KXKB 4A1GA 1DNPA 5G55A 5A23A 3PEVB 4JEHA 3IKOB 2OR1L 4RSYA 3VTXA 3G2VA 3SHFA 4X4DA 1IQUA 4ANVA 1ZZ7A 4ANXA 2PQNA 1LCCA 2XQ0A 3SF4A 1WM5A 2IOSA 3FP3A 2DIWA 5KCMA 2XCCA 3LFPA 5M72A 1CQTA 2VSYA 3CV0A 4KVMA 3SCFA 5EKQD 2PUGA 3FYMA 2NC9A 2XI8A 1L5JA 1WAO1 2XEVA 4JC8A 3D9IA 4CDRA 2RD0A 3JQ1A 3SCHA 5FZQA 2KCVA 4GZDA 4BT8A 4JHJA 2X6FA 2ZU6B 3LJ3A 3U4TA 1IYGA 2IONA 1UXCA 4EBAG 4IVZA 4Z58A 1JWFA 3PXPA 3JXDL 2L49A 3EIJA 4G2VA 4ACLA 3GN5A 5ARGA 5K98B 1DW9A 3C98A 4FADA 2PUBA 3ENEA 4I6RA 2OVFA 2WXKA 3MGBA 3Q5MA 4ACKA 3T5VA 2O38A 2XGSA 3CLCA 4OVVA 3BG1B 3UX4A 1BDHA 3JXBC 4K0RA 4OVUA 4WAFA 3F6WA 2I2OA 1HF0A 5C1DA 3JCKC 3EHNA 2HR2A 2WXLA 3JYSA 3R9AB 3Q15A 4JXTA 1LLIA 4Z5CA 3QWVA 3EJNA 4N3CA 1ZS4A 4PDXA 1IC8A 2KC7A 3ZHIA 3KXAA 3DBSA 3G5GA 3JUIA 5ENNA 5J08A 2I9CA 4L2YA 4KVOA 3GN5B 2IUOA 3S2AA 4AEZC 3PNLB 4W9RA 1PC2A 4WWNA 3I5PA 3L16A 4BSXA 2MOWA 5CMYA 1PRVA 2IVBA 3ZIMA 2LYPA 2A4ZA 5KJNA 3L54A 3S7DA 1U3DA 4Y6CA 4UQYA 5DBKA 1E8WA 2R59A 4I6GA 1MQSA 2KEKA 4LUNU 3CVQA 3TJPA 3ZHEB 2KPJA 2HSGA 3GBFA 3KS2A 2PM7A 4JZYA 4WNEA 2I6HA 1WH6A 4IN3B 2WXJA 3OXFA 4O6FA 4H7YA 1E3OC 3ESKA 5EDSA 4M3OA 5T3RA 2FF4A 1H2VC 2HM8A 1PY1A 2VGYA 3VLDA 4CT0A 2NSZA 3OMTA 2IU1A 1KT0A 2PZIA 3T5XA 2WQ6A 3QKYA 4ILGA 1IHGA 2C0MA 4MCTA 3D9OA 4KMOA 4CEMA 5BNWA 3QWPA 1OWNA 3ULQA 3QQ6A 3FH5A 3ZHEA 1KLXA 2FEZA 4FJZA 1HXIA 4AVXA 4GU5A 2GRLA 1ZPQA 2UY1A 2X38A 3FUFA 2JVLA 4ME2A 1WH8A 3ZYKA 1LCDA 2PUCA 2PUAA 4N39A 3CLJA 4AOFA 4I6TA 4AY6A 3RIBA 3FFLA 2LAHA 1IQRA 3OAWA 5J90A 2PL2A 1OCTC 1NZNA 2CFUA 3OXLA 3U3WA 5T8IA 2MRIA 1X5BA 4RVBA 2XRZA 3AS8A 4YG4A 4F53A 1NA3A 2WMNA 4MS6A 4EZLA 2LAIA 5G04J 2CSFA 5ANRA 3FH8A 4B94A 1UN9A 1DVPA 4PS7A 2XJ3A 5AIJA 1X57A 1UTXA 4PU7A 3ASGA 3CR3A 1HG5A 3EUSA 4XKBA 4URKA 3CEQA 4BX8A 3B13A 4UWLA 1NP7A 4C0MA 4CCAA 3APDA 1JFSA 4H7XA 3R7QA 4F1SA 4ANWA 3LPZA 2J08A 3PH0C 3PUKA 3QF3A 1P5QA 4OYSA 1CJGA 4U0UA 2WQ7A 2V4LA 2AXZA 3HVEA 1VDYA 2FBNA 4JL0A 3ZVVA 5FJYA 2AW6A 2YINA 3ZW3A 2AXUA 3BD1A 4J8EA 3D9MA 1MHQA 2V0PA 3OTNA 5AJLA 2R1JL 1QZ2A 2WXRA 3ASFA 4I2WA 4KZCA 2D5VA 4CGWA 3Q47B 1ZBPA 3KZ3A 2VGXB 4RG9A 1NA0A 3EIQC 3CKBA 3FTVA 4B8CB 4HOUA 4CGVA 3D9LA 2YHEA 4PUCA 4PS3A 2XPZA 2AXVA 2AVPA 3UUXA 1LMB3 4XI9A 4CDMA 2A5UA 4GHJA 1S7EA 1R69A 2XSDC 1JFTA 2DBAA 3ASHA 3FTXA 4G25A 3AU4A 4ILIA 1ADRA 1FVHA 4WWPA 4B8AA 2E0IA 2OV8A 4XI0A 2KEJA 4Y6WA 4GZCA 3LS8A 4U04A 4WNFA 4A1SA 4X4EA 2V5FA 3ASDA 1L1MA 2IV1A 3T8MA 5LX8A 1ZVVA 1AU7A 2VQ2A 3KD7A 1EYHA 3O48A 4A3VA 2ILRA 4L23A 1ELWA 1UJKA 2WXFA 3GZ1A 3ONKA 4BTBA 3PREA 3APFA 4ILHB 1RPEL 5JJTA 5KJKA 2XPIA 1U3CA 3PNTB 2RG8A 2WB2A 3IV0A 4ANUA 3CVYA 5AENA 4B0ZA 2X6JA 4JQDA 3CHSA 1GW6A 2X6IA 4YNDA 3R1FA 4BTAA 4C0EA 4J8FA 4EBAA 3L1PA 2J4DA 4NURA 4I9CA 3QARA 1E8XA 2MHKA 4JA9A 3RZZA 2XGMA 2PE5A 4GAAA 3AS5A 1GT0C 1X2LA 4X4CA 3G2UA 3B7TA 4EPZA 5JHAA 3MEKA 2AUWA 3HDXA 3KJXA 3BG0B 4PU8A 5BUZA 3D9NA 2GRMA 3H5TA 3LY7A 3UPVA 3TRBA 3HHMA 3F52A 1ELKA 4UQXA 3TGOA 1ZZ9A 1Y7YA 1HU3A 3AU5A 2Q7FA 3JXCL 3E4BA 3QOUA 2HINA 3QYXA 4J8DA 5BPPA 4IYPA 1YSEA 4WNDA 3P1UA 4GCOA 1Y6IA 4XE0A 2FULA 3S7FA 2KEIA 4N2SA 3TL5A 2QY7A 5G04C 3VTYA 1QNFA 1H19A 2OOEA 2WVIA 4U63A 4UWGA 3N71A 1OWMA 5C2YA 4MKTA 4AXHA 3ZYQA 4ABNA 4Z5DA 3ZEFA 3QC1A 3SCGA 3PE4A 2H8RA 2R5SA 4UI9K 2HYZA 1B89A 5ARFA 3FMYA 5BW8C 1HG2A 5T4YA 3RO2A 4A3TA 4GB9A 5LCWJ 4BT9A 2LYSA 3GW4A 5D0QD 4BWRA 1QPZA 4QFVA 3FU5A 3IHVA 2BNNA 3QJZA 3FTWA 4LERA 4Y42A 3SGHA 2LYQA 1XWRA 1VPWA 5FQ6A 3LY9A 4EECA 2M63A 5A7DB 1PERL 3CQCB 3FUJA 3LISA 4FBIA 3HYMB 3KAEA 2JLBA 3B7UX 2UY1B 1B0NA 1OWOA 4X4IA 1JWLA 2VSOE 2XRYA 2LYKA 4FLBA 4U0ZA 4DLOA 1RIOA 5FTPA 4FLHA 1KT1A 1JPLA 3FU3A 3UFDA 3LDZA 4CDNA 1Y9QA 3FHEA 3U9WA 4KYOB 3UMVA 4DLQA 3MA5A 3RRNB 4JW1A 4KT6B 2MEZA 2L0IA 4FA6A 3UT4A 4GA1A 3PDNA 4ATGA 2E2EA 1N52A 4DJAA 1RZRD 2EQXA 1QQBA 1S0PA 3S8QA 3ZN3A 4NDWA 2O49A 2B5AA 2WMOA 1BDIA 2GW1A 3O4ZA 3Q4AB 3PVLA 3ML9A 3IHYA 4I1AA 4DPRA 1PAQA 1HE8A 3WXXA 1TEZA 3O9XA 2BTDA 3G2WA 1QP7A 1JWGA 4I6EA 1E8ZA 1TJFA 2MQKA 2QFCA 3EHMA 1E96B 3MX3A 1NERA 1ZAYA 1W3BA 3CVVA 2YQ8A 3VLEA 1PRUA 3CHOA 4JHRA 1QP4A 3OP9A 1E8YA 3PZDA 3RKVA 5JHBA 1HH8A 4GMLA 1EF1C 4HOQA 2KZTA 1ZZ6A 5FQ8A 4FC8A 2VSXE 2FJRA 1HX8A 2CHXA 1O4XA 1FVFA 3APCA 3F51A 4U8HA 3CVUA 1QP0A 3FUEA 4APFA 2C2LA 4YARA 4O8BA 2CROA 1A17A 4IWRA 2BUGA 4NACA 3FYAA 4I17A 4TUUA 4DK5A 2L8NA 3HZIB 4FU3A 2WXOA 3MKRA 3VLFA 1ZU2A 4MLPA 3ESLA 4I43A 3TG4A 4DI4A 3RO3A 4FJYA 4JEUA 2PUFA 3CSFA 2X6HA 2R17C 2WQHA 3FUNA 3ZXSA 3Q49B 3FTUA 1OSLA 4N3AA 4YVQC 1DWKA 4D10C 2XCJA 1BPOA 4Q69A 2XCBA 1FCHA 2IOLA 3CHPA 3MCXA 3GZ2A 4JHKA 5KJLA 3MKQB 3BS3A 2J09A 4HXIA 1H0AA 1EDUA 1WIZA 4K03A 5AJDA 1NEQA 3ZYMA 2CG2A 5G05C 1Z3XA 3CK9A 1QQEA 1Y8MA 4RG6A 2VGXA 1SZ9A 2LYLA 4X4HA 1RZRA 1JUQA 2P58C 3CKCA 3CQGB 4JVSA 4J0UA 4APOA 4I1OB 2I1KA 3CK8A 4HFGA 1HFAA 3D9JA 2LSUA 3CHRA 1OUVA 3B7RL 3CVLA 4F7AA 2PIJA 3L22A 2CHZA 5LP0A 2L6JA 5FZSA 2LO6A 3MKQA 3IBEA 4FHJA 2J07A 4XKCA 1UN8A 3FDHA 3S7BA 4C9BB 4WUYA 4FN3A 4WWOA 1QQAA 1SQ8A 3CROL 1Z6TA 3QNKA 3GYZA 3B7SA 3ML8A 2BJCA 1ZZCA 2O4AA 4N3BA 4CT4A 4EQFA 2IVQA 2WXMA 1OWPA 2WXGA 4Q94A 4AJWA 5CCMA 2BNOA 4GYOA 2PPXA 4GYWA 2CFZA 1ZZBA 3MYVA 5A6CA 5BT1A 2WM9A 5CCLA 3FEYA 3PE3A 2R63A 1TJCA 4HLEA 5E75A 3UT7A 4PU4C 2AWIA 3U64A 2XGOA 4UWKA 2FI7A 1HO8A 3ZGQA 4HOSA 3G7DA 3QB2A 1UXDA 2PM6A 4Q96A 2IF4A 4AY5A 2WXPA 2IQCA 4MRUA 3NQPA 1EFAA 1HF8A 1PRAA 5FZRA 3PS6A 4J6IA 4OB4A 4BFRA 3CVNA 3TG5A 4B89A 3FTYA 4I6JA 4XIFA 4YVOA 1UW4B 2IVGA 2XIUA 1UG3A 3DPDA 4GA2A 5FWQA 2V8SE 3LVRE 2PQRA 5A7LA 4FULA 4AP2A 4PU3C 4GPKA 4GA0A 4HORA 1H2TC 3SD5A 3EDTB 4GZ5A 2KZ8A 4PS8A 5BV1A 5CMWA 4JCYA 1PNRA 4FHKA 2FO7A 3L6AA 3MZLB 4YG7B 4GQMA 4TRQA 2IJGX 1R63A 4U07A 5CHEE 2CG3A 4KZ0A 3LCAA 3AS4A 2I1JA 2YHCA 3G2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBQ A;  4Z59 A;  2PUE A;  4I6U A;  2VYI A;  4GYY A;  3ZFW A;  2HO1 A;  2LSV A;  2LYR A;  1POU A;  2BNM A;  5JJ6 A;  5G05 J;  3OQM A;  2OFY A;  4GCN A;  4WNG A;  1WET A;  5AYW D;  4I9E A;  3S7J A;  2WIU B;  3CEC A;  2KCK A;  3LYA A;  2IU7 A;  4UI9 J;  2Y4T A;  3LY8 A;  4IA8 A;  2EWT A;  3URZ A;  3ZPJ A;  3CK7 A;  5HI7 A;  3ZHM A;  3ZKC A;  2LNI A;  4G23 A;  1HZ4 A;  2JCG A;  4Z5H A;  3DNV B;  1LQC A;  4NQ0 A;  3MLF A;  4GZ6 A;  2EF8 A;  2GZU A;  4YBA A;  3QDN A;  4NRH B;  4U0S A;  4N2Q A;  1ZUG A;  5EX3 A;  2A6C A;  3CVP A;  3OXG A;  4YG1 A;  4X4B A;  1RZS A;  2EBY A;  2KAT A;  1ELR A;  4X4G A;  3MV2 B;  5JJ7 A;  1XNF A;  3RJV A;  4X4F A;  4GZ3 A;  4I2Z A;  3OQN A;  3SZ7 A;  2VSN A;  2ICP A;  4G26 A;  2ICT A;  4UQZ A;  5EX0 A;  3QWW A;  5D0O D;  5KJM A;  4F3V A;  3BDN A;  3OQO A;  3LKU A;  4F8D A;  2J9Q A;  3QWG A;  3MV3 B;  3B7H A;  2KCL A;  3BEE A;  1JH9 A;  3K9I A;  2IFU A;  2WUS R;  2UWJ G;  4LEU A;  4N5C A;  2LCV A;  4MCX A;  3D1N I;  3UQ3 A;  4J1W A;  4HOT A;  2C0L A;  2LYJ A;  2PUD A;  3NF1 A;  3RU0 A;  3VK0 A;  4UI9 C;  5FT9 A;  5LCW C;  1ZZ8 A;  3FWV A;  4AIF A;  4G24 A;  4J1X A;  4I8T A;  3IEG A;  1YA0 A;  3IVP A;  2WPV A;  2Y4U A;  5DIZ A;  3TAX A;  4JCX A;  2OND A;  4G1T A;  5HQ8 A;  4JA7 A;  4AM9 A;  4KXK B;  2OR1 L;  3VTX A;  4X4D A;  1ZZ7 A;  2PQN A;  1LCC A;  3SF4 A;  1WM5 A;  3FP3 A;  5M72 A;  2XCC A;  3LFP A;  1CQT A;  2VSY A;  3CV0 A;  3SCF A;  5EKQ D;  2PUG A;  3FYM A;  2NC9 A;  2XI8 A;  1WAO 1;  2XEV A;  4CDR A;  3SCH A;  5FZQ A;  2KCV A;  4BT8 A;  3U4T A;  1IYG A;  1UXC A;  4IVZ A;  4Z58 A;  3PXP A;  3JXD L;  2L49 A;  4G2V A;  3GN5 A;  5ARG A;  5K98 B;  1DW9 A;  2PUB A;  4I6R A;  3Q5M A;  2O38 A;  2XGS A;  3CLC A;  1BDH A;  3JXB C;  3F6W A;  5C1D A;  1HF0 A;  2HR2 A;  3JYS A;  3R9A B;  3Q15 A;  1LLI A;  4Z5C A;  3QWV A;  4N3C A;  1ZS4 A;  1IC8 A;  2KC7 A;  3ZHI A;  3KXA A;  3G5G A;  3GN5 B;  2IUO A;  4W9R A;  1PC2 A;  1PRV A;  2IVB A;  2LYP A;  5KJN A;  3S7D A;  4Y6C A;  5DBK A;  4UQY A;  3ZHE B;  2KEK A;  3CVQ A;  2KPJ A;  2HSG A;  3GBF A;  3KS2 A;  4WNE A;  2I6H A;  1WH6 A;  4IN3 B;  3OXF A;  4O6F A;  4H7Y A;  1E3O C;  3ESK A;  2FF4 A;  2VGY A;  3OMT A;  1KT0 A;  2PZI A;  3QKY A;  1IHG A;  2C0M A;  4MCT A;  5BNW A;  3QWP A;  3ULQ A;  3QQ6 A;  3ZHE A;  1KLX A;  2FEZ A;  1HXI A;  2GRL A;  1ZPQ A;  2UY1 A;  2JVL A;  4ME2 A;  1WH8 A;  1LCD A;  2PUC A;  2PUA A;  4N39 A;  4I6T A;  4AY6 A;  3RIB A;  3FFL A;  2PL2 A;  1OCT C;  1NZN A;  3OXL A;  3U3W A;  3AS8 A;  4YG4 A;  1NA3 A;  5G04 J;  2CSF A;  4B94 A;  2XJ3 A;  1X57 A;  1UTX A;  4PU7 A;  3ASG A;  3EUS A;  3CEQ A;  1JFS A;  4H7X A;  3LPZ A;  3QF3 A;  1P5Q A;  1CJG A;  4U0U A;  2AXZ A;  4JL0 A;  2FBN A;  5FJY A;  2AW6 A;  2AXU A;  3BD1 A;  4J8E A;  2R1J L;  1QZ2 A;  4I2W A;  3ASF A;  2D5V A;  4CGW A;  3Q47 B;  1ZBP A;  3KZ3 A;  2VGX B;  4RG9 A;  1NA0 A;  3CKB A;  4HOU A;  4CGV A;  2AXV A;  2AVP A;  3UUX A;  1LMB 3;  4XI9 A;  4GHJ A;  1S7E A;  1R69 A;  2XSD C;  1JFT A;  2DBA A;  3ASH A;  4G25 A;  1ADR A;  4XI0 A;  2KEJ A;  4Y6W A;  4WNF A;  4U04 A;  4A1S A;  4X4E A;  2V5F A;  3ASD A;  1L1M A;  2IV1 A;  1ZVV A;  1AU7 A;  2VQ2 A;  3KD7 A;  3O48 A;  1ELW A;  3GZ1 A;  5KJK A;  4BTB A;  1RPE L;  5JJT A;  2XPI A;  4JQD A;  4YND A;  3R1F A;  4BTA A;  4J8F A;  3L1P A;  4I9C A;  4JA9 A;  2MHK A;  3RZZ A;  2XGM A;  2PE5 A;  3AS5 A;  1GT0 C;  1X2L A;  4X4C A;  3MEK A;  2AUW A;  3KJX A;  4PU8 A;  2GRM A;  3H5T A;  3LY7 A;  3UPV A;  3TRB A;  3F52 A;  3TGO A;  4UQX A;  1ZZ9 A;  1Y7Y A;  2Q7F A;  3JXC L;  3E4B A;  3QOU A;  2HIN A;  3QYX A;  4J8D A;  1YSE A;  4WND A;  4GCO A;  3S7F A;  2KEI A;  4N2S A;  5G04 C;  3VTY A;  2OOE A;  3N71 A;  4ABN A;  4Z5D A;  3SCG A;  3PE4 A;  2H8R A;  2R5S A;  4UI9 K;  2HYZ A;  1B89 A;  5ARF A;  3FMY A;  5BW8 C;  3RO2 A;  5LCW J;  4BT9 A;  2LYS A;  3GW4 A;  5D0Q D;  4BWR A;  1QPZ A;  2BNN A;  4Y42 A;  2LYQ A;  1XWR A;  1VPW A;  3LY9 A;  5A7D B;  1PER L;  3KAE A;  3LIS A;  4FBI A;  3HYM B;  2JLB A;  2UY1 B;  1B0N A;  4X4I A;  1JWL A;  2LYK A;  4U0Z A;  1RIO A;  5FTP A;  1KT1 A;  3UFD A;  1Y9Q A;  4KYO B;  3MA5 A;  2MEZ A;  4GA1 A;  3PDN A;  2E2E A;  1RZR D;  1QQB A;  3ZN3 A;  3S8Q A;  4NDW A;  2O49 A;  2B5A A;  1BDI A;  2GW1 A;  3Q4A B;  4I1A A;  3WXX A;  3O9X A;  1QP7 A;  2MQK A;  2QFC A;  1E96 B;  1NER A;  1ZAY A;  1W3B A;  2YQ8 A;  1PRU A;  4JHR A;  1QP4 A;  3OP9 A;  3RKV A;  1HH8 A;  4HOQ A;  1ZZ6 A;  2FJR A;  1O4X A;  3F51 A;  1QP0 A;  2C2L A;  4YAR A;  4O8B A;  2CRO A;  1A17 A;  4IWR A;  2BUG A;  3FYA A;  4I17 A;  2L8N A;  3HZI B;  3MKR A;  1ZU2 A;  3TG4 A;  3RO3 A;  2PUF A;  2WQH A;  3Q49 B;  4N3A A;  1OSL A;  4YVQ C;  1DWK A;  2XCJ A;  2XCB A;  1FCH A;  3GZ2 A;  5KJL A;  3BS3 A;  1WIZ A;  1NEQ A;  5G05 C;  3CK9 A;  1QQE A;  1Y8M A;  4RG6 A;  2VGX A;  2LYL A;  4X4H A;  1RZR A;  2P58 C;  3CKC A;  4J0U A;  4APO A;  3CK8 A;  2LSU A;  1OUV A;  3CVL A;  2PIJ A;  2L6J A;  5FZS A;  3S7B A;  4WUY A;  4FN3 A;  1QQA A;  1SQ8 A;  3CRO L;  3GYZ A;  2BJC A;  1ZZC A;  2O4A A;  4N3B A;  4EQF A;  2IVQ A;  5CCM A;  2BNO A;  4GYO A;  2PPX A;  4GYW A;  1ZZB A;  5A6C A;  5BT1 A;  5CCL A;  3PE3 A;  2R63 A;  1TJC A;  4PU4 C;  2AWI A;  2XGO A;  3ZGQ A;  2FI7 A;  4HOS A;  3G7D A;  1UXD A;  4AY5 A;  2IF4 A;  1EFA A;  1PRA A;  5FZR A;  4OB4 A;  3CVN A;  3TG5 A;  4XIF A;  4YVO A;  4GA2 A;  2IVG A;  2XIU A;  2PQR A;  5A7L A;  4PU3 C;  4GPK A;  4GA0 A;  4HOR A;  3EDT B;  4GZ5 A;  2KZ8 A;  4JCY A;  1PNR A;  2FO7 A;  4YG7 B;  4GQM A;  1R63 A;  4U07 A;  5CHE E;  3LCA A;  3AS4 A;  2YHC A; 
#chains in the Genus database with same CATH topology
 4KBQ A;  4BX9 A;  2VYI A;  4I6U A;  4GYY A;  3PRZ A;  5G05 J;  2OFY A;  3LXU X;  2VJ8 A;  1WG0 A;  3NZS A;  5ENR D;  4I9E A;  3NXH A;  1E7U A;  2ETC A;  3LYA A;  2IU7 A;  3ZPJ A;  4GTO A;  5ANL A;  5HI7 A;  4G23 A;  3D9P A;  3SQV A;  4XZ4 A;  3GZD C;  3MLF A;  2EF8 A;  4YBA A;  1LF8 A;  1MJ0 A;  4U0S A;  1MX4 A;  2X3M A;  2A6C A;  3CVP A;  4HB5 A;  2P9L G;  3L13 A;  3RK6 A;  5G2N A;  4F1P A;  4X4B A;  5GAH i;  3FUI A;  1SZA A;  2LLV A;  4LRZ A;  2VTB B;  4X4F A;  4HVB A;  3SZ7 A;  2ICP A;  2ICT A;  4EZJ A;  3LVQ E;  5EX0 A;  3FUH A;  3QWW A;  3RRM B;  1H6O A;  4F3V A;  4GTT A;  2J9Q A;  3MV3 B;  3UT8 A;  3FUK A;  2ZIS A;  4DX1 A;  2BF0 X;  2MXD A;  3QK0 A;  3CVW A;  2UWJ G;  4HI9 A;  4E85 A;  4IRU A;  3SO8 A;  5FQ7 A;  3JQ0 A;  3SFZ A;  3SFX A;  5LCW C;  4ANW A;  3CIA A;  2X6K A;  3HVE B;  4J1X A;  3R7R A;  4LCT A;  1YA0 A;  2WPV A;  3TAX A;  5DIZ A;  4JCX A;  2OND A;  3I4G A;  2WXI A;  3ONL A;  4KXK B;  2OCC E;  3GZC A;  5G55 A;  2R2L A;  2XQ0 A;  3SF4 A;  5M72 A;  2XCC A;  3LFP A;  1BI8 B;  5EKQ D;  5BXU A;  2XI8 A;  4CDR A;  3GZD A;  1JCQ A;  5EYP F;  3SCH A;  3LJ3 A;  1O1R A;  5AN8 A;  5DRY A;  3L9T A;  3PXP A;  3Q78 A;  4ACL A;  5ARG A;  2EIN E;  5K98 B;  3C98 A;  4I6R A;  2OVF A;  2O38 A;  2XGS A;  4TXQ A;  4OVV A;  3JXB C;  3L82 A;  4OVU A;  3DSV A;  2WXL A;  2XXP A;  3Q15 A;  1LLI A;  2IO2 C;  1ZS4 A;  1IC8 A;  3ZHI A;  4DX5 D;  4KVO A;  3S2A A;  1YMP A;  4AEZ C;  4HRL A;  3PNL B;  4WWN A;  3ZIM A;  1MQS A;  3CVQ A;  2KPJ A;  1WH6 A;  3OXF A;  1E3O C;  5AQ9 A;  2HM8 A;  3VLD A;  4CT0 A;  3DWL G;  3OMT A;  4K5B A;  2PZI A;  3QKY A;  1OWN A;  1KLX A;  2PXV A;  3UM0 A;  2FEZ A;  2ZGG A;  1HXI A;  4U7E B;  2X38 A;  3DM5 A;  4AOF A;  4I6T A;  4AY6 A;  3D9H A;  1IQR A;  5J90 A;  3ABM E;  3C3R A;  5T8I A;  2MRI A;  2J7U A;  1X5B A;  4RVB A;  3A9X A;  4YDW A;  2A5E A;  1NA3 A;  1S63 A;  4MS6 A;  4PS7 A;  1DVP A;  3V30 A;  1HG5 A;  3EUS A;  3B13 A;  1NP7 A;  4C0M A;  4H7X A;  4NIK A;  4HNA D;  3HVE A;  3ZW3 A;  3LJN A;  4I2W A;  3ASF A;  2D5V A;  3Q47 B;  2VGX B;  4J7W A;  4RG9 A;  3FTV A;  4B8C B;  4HOU A;  2XZD G;  4PS3 A;  3UIO C;  1U2Z A;  4CDM A;  4XI9 A;  2A5U A;  4KMO A;  2DBA A;  1ADR A;  2OV8 A;  4Y6W A;  2KEJ A;  3DSS A;  2R05 A;  5LX8 A;  2IV1 A;  2VQ2 A;  3O48 A;  4A3V A;  4GTP A;  1UJK A;  3GZ1 A;  3ONK A;  4ILH B;  3PNT B;  3CVY A;  4B0Z A;  2X6J A;  4TXP A;  5CRV A;  3CHS A;  3F6Q A;  4BTA A;  4BES A;  4JA9 A;  3RZZ A;  2XGM A;  3G2U A;  4X4C A;  3B7T A;  3KJX A;  3ME5 A;  3D9N A;  2GRM A;  3H5T A;  3KSL A;  4UUC A;  3DXK G;  1Y7Y A;  3AU5 A;  4DX7 D;  4EK9 A;  3E4B A;  4DX2 A;  4IYP A;  3W9F A;  1YSE A;  4WND A;  1O1S A;  5G04 C;  3VTY A;  1QNF A;  1JCR A;  5C2Y A;  3ZYQ A;  4Z5D A;  2PXF A;  3T8K A;  3ZEF A;  2ETB A;  2H8R A;  2R5S A;  5BW8 C;  3RO2 A;  1B89 A;  3VLE A;  3FMY A;  4A3T A;  2LUH A;  4C48 B;  3GW4 A;  4BWR A;  2F8Y A;  3IHV A;  3QJZ A;  4LER A;  3SGH A;  1VPW A;  4EEC A;  5A7D B;  2RKK A;  2UY1 B;  1OWO A;  2VSO E;  3ASN E;  2LYK A;  2LNM A;  3UMV A;  4DLQ A;  4KT6 B;  3NOG D;  1QYM A;  4B93 B;  3UT4 A;  3PDN A;  1S0P A;  3ZN3 A;  4HQD A;  3ZU7 B;  3O4Z A;  2GW1 A;  3KSQ A;  1PAQ A;  3G2W A;  1E96 B;  3G0T A;  3MX3 A;  1ZAY A;  1AP7 A;  2YQ8 A;  1D9S A;  3CHO A;  4GML A;  3DXM G;  2PXU A;  1D8E A;  2VSX E;  3EU9 A;  3PE5 A;  3UIP C;  4U8H A;  4APF A;  2RFA A;  2L8N A;  4FU3 A;  3VLF A;  1ZU2 A;  2FFH A;  2VGE A;  3RAU A;  1G3N B;  3V2O A;  3Q7A A;  3FTU A;  2IOL A;  3MCX A;  3GZ2 A;  4O1P A;  3ZKJ A;  1H0A A;  1EDU A;  2LXL A;  1Z3X A;  1H6P A;  2VGX A;  1U2V G;  3CQG B;  1JUQ A;  4APO A;  5KWD A;  5IY5 E;  1OUV A;  1YCS B;  2PIJ A;  1ZB1 A;  3L22 A;  3DSW A;  3IBE A;  4XKC A;  1UN8 A;  1TNB A;  3BUA A;  1OY3 D;  4WUY A;  2F8X K;  4N3B A;  4Q94 A;  2IVQ A;  1DCE A;  1TNO A;  4GYO A;  4GYW A;  4OAV B;  1ZZB A;  3MYV A;  5A6C A;  1SW6 A;  2R63 A;  1TJC A;  3PE3 A;  5E75 A;  2DWZ A;  4PU4 C;  4HI8 A;  1FT1 A;  1HO8 A;  2IQC A;  3AG3 E;  3ABL E;  5FZR A;  2OEW A;  3DPD A;  3B7B A;  5A7L A;  4AP2 A;  5BXO A;  3UM3 A;  1H2T C;  3EDT B;  2L6B A;  1PNR A;  2OEV A;  3L6A A;  4GQM A;  3V31 A;  2LSV A;  2LYR A;  1POU A;  4J8S A;  2L0T B;  3KEZ A;  3PUJ A;  1UJJ A;  4V3I A;  3OQM A;  3EUV A;  4GCN A;  1XGW A;  1WET A;  3FU6 A;  1RW2 A;  3ZYL A;  4LNU D;  2WIU B;  3CEC A;  4UI9 J;  5HS0 A;  3LY8 A;  1E90 A;  4JPS A;  2EWT A;  4FP7 A;  3ZHM A;  5B1A E;  4NQ0 A;  1H6K A;  3B95 A;  3LEW A;  2VTB A;  4NRH B;  1ZUG A;  4O1O A;  3SBS A;  2EBY A;  3DPY A;  1EPU A;  4HS2 A;  1HS6 A;  2KM4 A;  3V79 K;  2ODR D;  2GRP B;  3FU0 A;  4I2Z A;  2VSN A;  3C3O A;  2P9I G;  3M9L A;  2WXH A;  5D0O D;  3BDN A;  1BI7 B;  4M7C A;  1INZ A;  2WXN A;  3QWG A;  4UWF A;  3B7H A;  3BEE A;  3ZRH A;  4N5C A;  5D66 A;  5LOZ A;  4GTQ A;  2LCV A;  1N4Q A;  2H6F A;  4XX5 A;  5BV0 A;  4EZK A;  3D1N I;  4N5Q A;  4L7T A;  4J1W A;  2C0L A;  4ER6 A;  3X2Q E;  2PUD A;  3TXN A;  3I3N A;  2L9B A;  4RLY A;  3NDB B;  4UI9 C;  3QAQ A;  3IEG A;  4I8T A;  4BY6 A;  3IVP A;  1TNY A;  4G1T A;  4AM9 A;  3U66 A;  3OKZ A;  1DNP A;  2P9P G;  5A23 A;  3VTX A;  3TWU A;  1ZZ7 A;  2PQN A;  1LCC A;  3FP3 A;  2DIW A;  1L5J A;  2KXP C;  2ZU6 B;  2ION A;  1N4S A;  4GTM A;  2L49 A;  3EIJ A;  3ENE A;  2WXK A;  3T5V A;  3CLC A;  3BG1 B;  1BDH A;  2ZXW E;  4K0R A;  1OT8 A;  5C1D A;  2XXQ A;  2HR2 A;  3JYS A;  3R9A B;  2HCN A;  3EJN A;  4N3C A;  2KC7 A;  3JUI A;  3KXA A;  3G5G A;  5ENN A;  1SA5 A;  4W9R A;  1PC2 A;  1TN8 A;  3L16 A;  3NRO A;  5CMY A;  1N9A A;  5KJN A;  3S7D A;  3TJP A;  3ZHE B;  5CEA A;  3UM1 A;  3TWQ A;  1LD7 A;  1K8K G;  4IN3 B;  2JQE A;  4H7Y A;  3ESK A;  4M3O A;  5T3R A;  1H2V C;  2VGY A;  2IU1 A;  1KT0 A;  1IHG A;  2C0M A;  3D9O A;  5BNW A;  3FH5 A;  1QB2 A;  3IXE A;  1ZPQ A;  1MZC A;  2UY1 A;  1WH8 A;  2L1P A;  2PUA A;  4ZFH A;  3CLJ A;  5KNH D;  3RIB A;  1OCT C;  2CFU A;  4YG4 A;  4F53 A;  1TYQ G;  2LAI A;  3FH8 A;  4B94 A;  1X57 A;  1K3Z D;  3CEQ A;  4BX8 A;  4UWL A;  3E34 A;  4CCA A;  1JFS A;  3R7Q A;  4F1S A;  3PUK A;  3AG4 E;  5AAO A;  1NW3 A;  2AXZ A;  2FBN A;  3QFI A;  2YIN A;  3D9M A;  5AJL A;  1QZ2 A;  2EIJ E;  1NA0 A;  1LTX A;  3EIQ C;  3NB2 A;  2AXV A;  2AVP A;  3UUX A;  2XSD C;  3AU4 A;  2XZT G;  3AAA C;  2E0I A;  3LS8 A;  3ASD A;  1L1M A;  2ILR A;  3TWV A;  1ELW A;  3A9Z A;  2WXF A;  5KJK A;  4BTB A;  1RPE L;  5JJT A;  3IV0 A;  4YND A;  1D8D A;  3R1F A;  2J4D A;  1YYH A;  1E8X A;  2MHK A;  4GAA A;  1GT0 C;  3MEK A;  1WDY A;  5BUZ A;  3LY7 A;  3UPV A;  3TRB A;  3TFL A;  4UQX A;  1HU3 A;  2HIN A;  3QYX A;  3HXE A;  5BPP A;  3P1U A;  2HFZ A;  2FUL A;  3S7F A;  2KEI A;  4N2S A;  3UM2 A;  4UWG A;  3TEL A;  4MKT A;  4GMR A;  3SCG A;  3EU5 A;  4UI9 K;  5AAR A;  1BU9 A;  4YDO A;  1QPZ A;  3FU5 A;  2BNN A;  3FTW A;  2LYQ A;  3LY9 A;  2EIM E;  2M63 A;  5ENS D;  3KAE A;  4FBI A;  3HYM B;  3SNX A;  3B7U X;  5AIJ A;  1B0N A;  4FLB A;  1JWL A;  2XRY A;  5CED B;  4CDN A;  1OCO E;  1K1A A;  3MA5 A;  2MEZ A;  1Q2Z A;  2L0I A;  1RZR D;  3S8Q A;  2B5A A;  3E37 A;  2ETA A;  2H6G A;  1BDI A;  3Q4A B;  3PVL A;  3O9X A;  1NL4 A;  1QP7 A;  1JWG A;  1NER A;  4JHR A;  1QP4 A;  3RKV A;  5JHB A;  3PZD A;  1EF1 C;  3SY2 A;  1SA4 A;  1O4X A;  1FVF A;  3F51 A;  3BU8 A;  1FPP A;  1A17 A;  2C2L A;  4NAC A;  4TUU A;  3FYA A;  2XEH A;  3HZI B;  4ATZ D;  2B0O E;  4I43 A;  3TG4 A;  4JEU A;  2X6H A;  2R17 C;  3ZXS A;  3LQX A;  1OSL A;  4N3A A;  2XCJ A;  1DUL A;  3CHP A;  1V54 E;  1KZO A;  1WIZ A;  4K03 A;  4RG6 A;  1SZ9 A;  4JVS A;  3D9J A;  2LO6 A;  3MKQ A;  2F37 A;  3GYZ A;  3B7S A;  2BJC A;  2O4A A;  4EQF A;  2WXG A;  1TNU A;  3UT7 A;  4HOS A;  3G7D A;  4Q96 A;  2IF4 A;  4MRU A;  1HF8 A;  5DTQ A;  4J6I A;  4B89 A;  3TG5 A;  1KPS B;  5FWQ A;  3LVR E;  2PXK A;  4GPK A;  3HXD A;  4GZ5 A;  4PS8 A;  5BV1 A;  2NYJ A;  4U07 A;  3UWP A;  3AS4 A;  2I1J A;  4Z59 A;  3ZFW A;  3FTS A;  1SQM A;  5AQA A;  3FY4 A;  1N54 A;  4IUL A;  5EID A;  4DI3 A;  5FQ4 A;  4E6H A;  1FT2 A;  4IA8 A;  3URZ A;  1LD8 A;  3CK7 A;  3C72 A;  3ZKC A;  5HKP A;  2LNI A;  3RRU A;  2YNQ A;  3TXM A;  2JCG A;  4GMJ A;  3DNV B;  3FEX A;  2GZU A;  3G2S A;  4R7L A;  4L2L A;  3NZU A;  1WY6 A;  3OXG A;  4A63 B;  3FUL A;  4YG1 A;  4A55 A;  1OWL A;  3ZUV B;  1IKN D;  3MV2 B;  5JJ7 A;  1XNF A;  5HRY A;  3RJV A;  4GZ3 A;  1A5E A;  3OQN A;  3P2B A;  2EIL E;  1TN6 A;  2M4H A;  3RSE G;  1SVX A;  3FUM A;  2CHW A;  4UWH A;  3HIZ A;  1HQ1 A;  1N4P A;  2EIK E;  2Y3A A;  3DST A;  3OQO A;  4CRW A;  4G11 A;  3CST A;  4ER5 A;  2GRQ B;  2J4B A;  2KCL A;  2BED A;  2IFU A;  4LEU A;  2HCS A;  3SI5 A;  4P29 A;  4MCX A;  4LSZ E;  3DRA A;  3WG7 E;  4I1M A;  2LYJ A;  1MX6 A;  3SBT B;  2J49 A;  3L17 A;  3PEU B;  3CHQ A;  3FWV A;  4AIF A;  4G24 A;  4ER3 A;  3GZS A;  1BD8 A;  2Y4U A;  2P9S G;  2GGF A;  2XPY A;  5E76 A;  3KEA A;  3PEV B;  3IKO B;  2OR1 L;  4GTS A;  4RSY A;  3SHF A;  4X4D A;  4ANV A;  5KCM A;  4EZI A;  1CQT A;  4KVM A;  3SCF A;  2PUG A;  3FYM A;  2NC9 A;  4YDE A;  4JC8 A;  3DSU A;  2RD0 A;  3E32 A;  3JQ1 A;  5FZQ A;  3JXI A;  2KCV A;  4BT8 A;  1IYG A;  4IVZ A;  4Z58 A;  1JWF A;  4TUM A;  2BKG A;  3JXD L;  3E30 A;  4G2V A;  5B3S E;  2PUB A;  1QBQ A;  2IEJ A;  3Q5M A;  5EN5 D;  1DC2 A;  4WAF A;  2I2O A;  1HF0 A;  3EHN A;  3TWR A;  4JXT A;  5DTM A;  4PDX A;  3DBS A;  2PXP A;  2I9C A;  2QZA A;  4L2Y A;  2IUO A;  3J5P A;  2MOW A;  1PRV A;  2IVB A;  3SFY A;  2DVW A;  1MFQ C;  3L54 A;  1U3D A;  5DBK A;  4UQY A;  3UI2 A;  3GBF A;  2PM7 A;  3KL4 A;  2WXJ A;  2FF4 A;  2NSZ A;  2WQ6 A;  3PZ1 A;  5ITZ F;  3PZ3 A;  4ILG A;  3QWP A;  3ULQ A;  3ZHE A;  4DUI A;  4FJZ A;  1V55 E;  4MBG A;  4AVX A;  4GU5 A;  2GRL A;  3FUF A;  4ME2 A;  3NOC D;  2PUC A;  4N39 A;  4F6R D;  3TWW A;  4QQI A;  2LAH A;  3OAW A;  2PL2 A;  1NZN A;  3OXL A;  5CER B;  4EQZ A;  4EZL A;  5G04 J;  2CSF A;  4PU7 A;  4XKB A;  4HRM B;  4URK A;  2DZN A;  3SX0 A;  4GTR A;  4JB8 P;  2DYS E;  2J08 A;  3PH0 C;  1KZP A;  3ZPX A;  4U0U A;  4JL0 A;  5FIN A;  5FJY A;  4Q2J A;  2AXU A;  1NFI E;  3BD1 A;  4J8E A;  1MHQ A;  3OTN A;  2R1J L;  2WXR A;  3KZ3 A;  3CKB A;  4EHM A;  2YHE A;  4PUC A;  4LG6 A;  1N95 A;  1S7E A;  1R69 A;  1JFT A;  2HE0 A;  5D2M C;  1FVH A;  4WWP A;  4WNF A;  5EIB E;  3T8M A;  1ZVV A;  3KD7 A;  4J8Y A;  1EYH A;  4L23 A;  3PRE A;  3APF A;  2H6I A;  2WB2 A;  4GTV A;  4C0E A;  2QC9 A;  4J8F A;  4EBA A;  4NUR A;  4I9C A;  3QAR A;  1JCS A;  2PE5 A;  3ASO E;  4EPZ A;  2ZGD A;  2AUW A;  4PU8 A;  3ZXP A;  3F52 A;  1ELK A;  3TGO A;  3JXC L;  4J8D A;  2XXA A;  3DSX A;  4GCO A;  1Y6I A;  2QY7 A;  1H19 A;  2P2C P;  4U63 A;  3N71 A;  4AXH A;  4ABN A;  3PE4 A;  4U8V D;  2PXB A;  5T4Y A;  3EHQ A;  4GB9 A;  5LCW J;  2LYS A;  5D0Q D;  4QFV A;  4Y42 A;  2AJA A;  1PER L;  3FUJ A;  2JLB A;  1RIO A;  4FLH A;  1KT1 A;  3FU3 A;  3UFD A;  1Y9Q A;  2Y1L E;  3FHE A;  3DEP A;  4KYO B;  3U9W A;  3RRN B;  2QYU A;  4JW1 A;  4ATG A;  2E2E A;  1Z5S C;  2EQX A;  1QQB A;  2O49 A;  3VWS A;  3TWT A;  3IHY A;  4DPR A;  1HE8 A;  3Q7F A;  4I6E A;  1TJF A;  3EHM A;  5ENQ D;  5EIL A;  3OP9 A;  3NAW A;  3NBN B;  2IO3 C;  1ZZ6 A;  2KZT A;  5FQ8 A;  4FC8 A;  5CBN A;  2FJR A;  1HX8 A;  3CVU A;  1QP0 A;  3FUE A;  3OWQ A;  4YAR A;  3AJI A;  2CRO A;  1OXJ A;  4IWR A;  3AG1 E;  2WXO A;  1QZX A;  3MKR A;  4MLP A;  3ESL A;  4DI4 A;  3RO3 A;  4FJY A;  2PUF A;  2DYR E;  3CSF A;  3C5R A;  4ER0 A;  4BER A;  3FUN A;  4YVQ C;  5KBA A;  1DWK A;  4EKG A;  5KJL A;  3BS3 A;  2J09 A;  4HXI A;  2CG2 A;  5G05 C;  1Y8M A;  2LYL A;  4X4H A;  2P58 C;  3CK8 A;  4HFG A;  2P9U G;  2LSU A;  3B7R L;  3SR4 A;  2L6J A;  5FZS A;  5CEC B;  3FDH A;  3S7B A;  4C9B B;  4WWO A;  1Z6T A;  3QNK A;  3ML8 A;  4HRN A;  1ZZC A;  4CT4 A;  3AG2 E;  1OWP A;  2BNO A;  5CRU A;  1S70 B;  3T9K A;  2QYJ A;  3GUU A;  5BT1 A;  3U64 A;  2AWI A;  3ZGQ A;  2FI7 A;  4DE9 A;  4AY5 A;  2DZO A;  2PM6 A;  1N4R A;  2V3C C;  1X81 A;  5AQB A;  3PS6 A;  4BFR A;  4OB4 A;  3FTY A;  1NI1 A;  4XIF A;  3ZNG A;  3HRA A;  3UKU G;  4FUL A;  3UTM A;  4PU3 C;  4GA0 A;  2KZ8 A;  4JCY A;  3MZL B;  2CG3 A;  3LCA A;  2V4H C;  2YHC A;  2PUE A;  2HO1 A;  2BNM A;  5JJ6 A;  2DCP A;  2NXP A;  4ZHB A;  4WNG A;  3CHM A;  3MJW A;  3I4R B;  1E7V A;  2LXM A;  5AYW D;  3S7J A;  5LFA A;  3HXB A;  2KCK A;  3Q79 A;  5CBO A;  1K1B A;  4PH4 B;  3ULY A;  2Y4T A;  2P9N G;  3MEJ A;  3D9K A;  1HZ4 A;  4Z5H A;  1LQC A;  3FUD A;  1H2U A;  3BQO A;  4GZ6 A;  2OVB A;  3QDN A;  4N2Q A;  1N94 A;  5EX3 A;  1N0R A;  4JD2 G;  2WXQ A;  4CYM D;  4TXR A;  3D3M A;  1Z3Y A;  1RZS A;  2KAT A;  2BKK B;  1ELR A;  4X4G A;  2XHE A;  4L1B A;  4U8Y D;  2YBD A;  3CVX A;  4G26 A;  4Z68 A;  4UQZ A;  5DT2 A;  4OAU C;  5KJM A;  2R03 A;  2XS1 A;  3CGH A;  3LKU A;  4F8D A;  1TNZ A;  4HBD A;  1JH9 A;  3FH7 A;  3K9I A;  4U95 D;  2WUS R;  3FTZ A;  2PXQ A;  3L08 A;  4LNB A;  4RQI A;  3UQ3 A;  2KZT B;  2JEK A;  1IHB A;  4HOT A;  2PXT A;  3UKR G;  3NF1 A;  5DRT A;  3RU0 A;  3VK0 A;  4BET A;  2V5Q C;  5FT9 A;  1TN7 A;  3HXF A;  1ZZ8 A;  4AV7 A;  4TV3 A;  2MYO A;  4HLL A;  4XEI G;  5HQ8 A;  4BEP A;  4JA7 A;  4A1G A;  4HRA A;  4JEH A;  3G2V A;  1IQU A;  5KNG A;  4ANX A;  2B6C A;  5AQ7 A;  4WVL A;  1WM5 A;  2IOS A;  2VSY A;  3CV0 A;  1WAO 1;  2XEV A;  3D9I A;  4GZD A;  4JHJ A;  2X6F A;  3U4T A;  4G8K A;  1UXC A;  4EBA G;  5ENO D;  3GN5 A;  1DW9 A;  4FAD A;  3MGB A;  3TWX A;  4ACK A;  3UX4 A;  3F6W A;  3JCK C;  5ENT D;  3Q75 A;  3QWV A;  4Z5C A;  5J08 A;  3GN5 B;  2J8S D;  2LLW A;  3I5P A;  4BSX A;  4DX6 D;  2LYP A;  5GAG i;  2A4Z A;  2GRN B;  4Y6C A;  3ZYK A;  1E8W A;  2R59 A;  4I6G A;  2KEK A;  4LUN U;  2HSG A;  3KS2 A;  4JZY A;  4WNE A;  2I6H A;  3C3Q A;  2F0Y A;  5EDS A;  4O6F A;  1PY1 A;  3Q9N C;  4OBM A;  3T5X A;  4CEM A;  4MCT A;  3QQ6 A;  1N11 A;  5H7P A;  2J7W A;  1BLX B;  1S64 A;  2VEO A;  2JVL A;  5DSX A;  1LCD A;  4K5C A;  3FFL A;  2R02 A;  3Q73 A;  2PXD A;  3PZ2 A;  5B1B E;  3U3W A;  2FO1 E;  2XRZ A;  3AS8 A;  2WMN A;  4L9P A;  3PZ4 A;  1TR4 A;  4O60 A;  5ANR A;  1UN9 A;  4CZ2 D;  2XJ3 A;  4GPM A;  3ASG A;  1UTX A;  3CR3 A;  2PNN A;  2XEN A;  3ISM C;  4G8L A;  1MX2 A;  3APD A;  3E33 A;  3JXJ A;  3LPZ A;  3QF3 A;  3DEO A;  1P5Q A;  4OYS A;  1CJG A;  2WQ7 A;  2V4L A;  1VDY A;  3ZVV A;  2AW6 A;  2H6H A;  2V0P A;  4KZC A;  4CGW A;  2GRO B;  1ZBP A;  1IXV A;  2KBX A;  4X8Q A;  2XS8 A;  4CGV A;  3D9L A;  2XPZ A;  1LMB 3;  3FTX A;  4GHJ A;  3ASH A;  4G25 A;  1UOH A;  4ILI A;  3R09 A;  2PXE A;  4B8A A;  2ZIR A;  3EHR A;  4XI0 A;  3UIN C;  3V2X A;  4GZC A;  4U04 A;  4A1S A;  4X4E A;  2V5F A;  1O1T A;  1O5M A;  1AU7 A;  2XPI A;  1U3C A;  2RG8 A;  4LNG A;  4ANU A;  5AEN A;  4JQD A;  1GW6 A;  2X6I A;  2RFM A;  3L1P A;  3AS5 A;  1X2L A;  5JHA A;  4DRX E;  3R9M A;  3HDX A;  3BG0 B;  3HHM A;  1ZZ9 A;  2Q7F A;  3QOU A;  2XEE A;  4XE0 A;  2Y0B G;  5JUW A;  3TL5 A;  5JA4 D;  2OOE A;  2WVI A;  1OWM A;  3QC1 A;  5ARF A;  2HYZ A;  1HG2 A;  3QOX A;  4DE8 A;  3HXC A;  4BT9 A;  1XWR A;  5FQ6 A;  3CQC B;  3LIS A;  4X4I A;  4DLO A;  4U0Z A;  5FTP A;  1JPL A;  3LDZ A;  3ULE G;  4FA6 A;  4GA1 A;  1N52 A;  4DJA A;  3TEP A;  4NDW A;  4YDY A;  2WMO A;  5ENP D;  3UXG A;  2P9K G;  3ML9 A;  4I1A A;  3WXX A;  3JUE A;  2BTD A;  1TEZ A;  1E8Z A;  3TWS A;  2MQK A;  2QFC A;  1OCC E;  3CVV A;  1MYO A;  1W3B A;  1PRU A;  1E8Y A;  1HH8 A;  3HG0 D;  4HOQ A;  1N0Q A;  2CHX A;  3APC A;  4O8B A;  2BUG A;  4I17 A;  4DK5 A;  4K5A B;  2JAB A;  4ER7 A;  3NZL A;  2GRR B;  2WQH A;  3Q49 B;  4D10 C;  1BPO A;  4Q69 A;  2XCB A;  1FCH A;  4JHK A;  3MKQ B;  5AJD A;  3ABK E;  1NEQ A;  3ZYM A;  3QOW A;  3CK9 A;  1QQE A;  1OCR E;  1RZR A;  3CKC A;  4J0U A;  4I1O B;  2I1K A;  1HFA A;  3J5Q B;  5FIO A;  4EKI A;  1RZ4 A;  3CHR A;  3CVL A;  5DTR A;  4F7A A;  2CHZ A;  5LP0 A;  3A9Y A;  4FHJ A;  2J07 A;  4FN3 A;  1QQA A;  1SQ8 A;  3CRO L;  1DCQ A;  3Q9U C;  2WXM A;  4AJW A;  3W9G A;  1OCZ E;  5CCM A;  2PPX A;  2CFZ A;  2WM9 A;  5CCL A;  3FEY A;  4HLE A;  2XGO A;  4UWK A;  3QB2 A;  1UXD A;  2WXP A;  3NQP A;  1EFA A;  2IY0 C;  5JMN D;  1PRA A;  3CVN A;  4I6J A;  5EYL A;  4YVO A;  1UW4 B;  2IVG A;  2XIU A;  1UG3 A;  4GA2 A;  2V8S E;  2PQR A;  4U96 D;  4HOR A;  3SD5 A;  5CMW A;  4BSZ B;  4FHK A;  2FO7 A;  2PXL A;  4YG7 B;  2Y69 E;  4TRQ A;  1AWC B;  2IJG X;  1R63 A;  5CHE E;  4KZ0 A;  3G2T A; 
#chains in the Genus database with same CATH homology
 4KBQ A;  4Z59 A;  4BX9 A;  2PUE A;  4I6U A;  2VYI A;  4GYY A;  3ZFW A;  2HO1 A;  2LSV A;  2LYR A;  3FTS A;  1POU A;  2BNM A;  3PRZ A;  4J8S A;  2DCP A;  2L0T B;  3KEZ A;  5JJ6 A;  2NXP A;  3PUJ A;  1UJJ A;  5G05 J;  4V3I A;  1SQM A;  3OQM A;  2OFY A;  4GCN A;  4WNG A;  3CHM A;  3MJW A;  3LXU X;  1XGW A;  1WET A;  3FU6 A;  3ZYL A;  2VJ8 A;  3I4R B;  3NZS A;  1E7V A;  5AYW D;  4I9E A;  3FY4 A;  1E7U A;  3S7J A;  2WIU B;  3CEC A;  1N54 A;  5LFA A;  4IUL A;  2KCK A;  3LYA A;  2IU7 A;  4UI9 J;  4PH4 B;  2Y4T A;  3LY8 A;  5FQ4 A;  1E90 A;  4DI3 A;  4E6H A;  4IA8 A;  2EWT A;  4JPS A;  3URZ A;  4FP7 A;  5ANL A;  3CK7 A;  3D9K A;  5HI7 A;  3ZHM A;  3ZKC A;  3ZPJ A;  2LNI A;  4G23 A;  3D9P A;  3RRU A;  2YNQ A;  4XZ4 A;  1HZ4 A;  3TXM A;  2JCG A;  4Z5H A;  4GMJ A;  3DNV B;  1LQC A;  1H6K A;  3FEX A;  3FUD A;  4NQ0 A;  3LEW A;  2VTB A;  1H2U A;  3MLF A;  4GZ6 A;  2EF8 A;  2GZU A;  4YBA A;  1LF8 A;  3SNX A;  2OVB A;  3QDN A;  2X3M A;  3G2S A;  4NRH B;  4R7L A;  4U0S A;  1ZUG A;  4N2Q A;  4L2L A;  5EX3 A;  2A6C A;  1WY6 A;  3CVP A;  3NZU A;  3OXG A;  3FUL A;  4YG1 A;  4A55 A;  2WXQ A;  3L13 A;  5G2N A;  3RK6 A;  3SBS A;  4X4B A;  3FUI A;  3D3M A;  1Z3Y A;  1RZS A;  2EBY A;  2KAT A;  1SZA A;  1OWL A;  1EPU A;  1ELR A;  4X4G A;  3MV2 B;  4HS2 A;  5JJ7 A;  1HS6 A;  2KM4 A;  1XNF A;  2XHE A;  4LRZ A;  4L1B A;  2VTB B;  3RJV A;  4X4F A;  3FU0 A;  4GZ3 A;  4I2Z A;  3OQN A;  3P2B A;  3CVX A;  4HVB A;  3SZ7 A;  2VSN A;  2ICP A;  4G26 A;  2ICT A;  4EZJ A;  4UQZ A;  2WXH A;  3LVQ E;  5EX0 A;  3FUH A;  3FUM A;  2CHW A;  3QWW A;  4UWH A;  3HIZ A;  5D0O D;  2Y3A A;  3RRM B;  5KJM A;  4F3V A;  3CGH A;  3BDN A;  3OQO A;  1INZ A;  3LKU A;  4F8D A;  4G11 A;  3CST A;  4CRW A;  2J9Q A;  2WXN A;  3QWG A;  3MV3 B;  3UT8 A;  4UWF A;  2J4B A;  3B7H A;  3FUK A;  2KCL A;  3BEE A;  1JH9 A;  2BF0 X;  3FH7 A;  3K9I A;  3ZRH A;  3QK0 A;  3CVW A;  2IFU A;  2WUS R;  2UWJ G;  4LEU A;  4N5C A;  4E85 A;  3FTZ A;  5LOZ A;  4P29 A;  4IRU A;  3SI5 A;  2LCV A;  4XX5 A;  4MCX A;  5BV0 A;  3L08 A;  4EZK A;  3D1N I;  3UQ3 A;  2KZT B;  2JEK A;  3JQ0 A;  4I1M A;  4L7T A;  4J1W A;  5FQ7 A;  3SFZ A;  2C0L A;  4HOT A;  2LYJ A;  2PUD A;  3NF1 A;  3I3N A;  2L9B A;  3SBT B;  3RU0 A;  3TXN A;  3VK0 A;  4UI9 C;  2J49 A;  5FT9 A;  3QAQ A;  5LCW C;  3L17 A;  3PEU B;  3CHQ A;  1ZZ8 A;  4AV7 A;  3FWV A;  4AIF A;  3CIA A;  2X6K A;  3HVE B;  4J1X A;  4I8T A;  3IEG A;  4G24 A;  4LCT A;  3R7R A;  1YA0 A;  4BY6 A;  3GZS A;  3IVP A;  2WPV A;  2Y4U A;  4TV3 A;  5DIZ A;  4JCX A;  2OND A;  4G1T A;  3TAX A;  5HQ8 A;  2GGF A;  4JA7 A;  4AM9 A;  2XPY A;  3I4G A;  5E76 A;  3U66 A;  2WXI A;  3ONL A;  4KXK B;  4A1G A;  1DNP A;  5G55 A;  5A23 A;  3PEV B;  4JEH A;  3IKO B;  2OR1 L;  4RSY A;  3VTX A;  3G2V A;  3SHF A;  4X4D A;  1IQU A;  4ANV A;  1ZZ7 A;  4ANX A;  2PQN A;  1LCC A;  2XQ0 A;  3SF4 A;  1WM5 A;  2IOS A;  3FP3 A;  2DIW A;  5KCM A;  2XCC A;  3LFP A;  5M72 A;  1CQT A;  2VSY A;  3CV0 A;  4KVM A;  3SCF A;  5EKQ D;  2PUG A;  3FYM A;  2NC9 A;  2XI8 A;  1L5J A;  1WAO 1;  2XEV A;  4JC8 A;  3D9I A;  4CDR A;  2RD0 A;  3JQ1 A;  3SCH A;  5FZQ A;  2KCV A;  4GZD A;  4BT8 A;  4JHJ A;  2X6F A;  2ZU6 B;  3LJ3 A;  3U4T A;  1IYG A;  2ION A;  1UXC A;  4EBA G;  4IVZ A;  4Z58 A;  1JWF A;  3PXP A;  3JXD L;  2L49 A;  3EIJ A;  4G2V A;  4ACL A;  3GN5 A;  5ARG A;  5K98 B;  1DW9 A;  3C98 A;  4FAD A;  2PUB A;  3ENE A;  4I6R A;  2OVF A;  2WXK A;  3MGB A;  3Q5M A;  4ACK A;  3T5V A;  2O38 A;  2XGS A;  3CLC A;  4OVV A;  3BG1 B;  3UX4 A;  1BDH A;  3JXB C;  4K0R A;  4OVU A;  4WAF A;  3F6W A;  2I2O A;  1HF0 A;  5C1D A;  3JCK C;  3EHN A;  2HR2 A;  2WXL A;  3JYS A;  3R9A B;  3Q15 A;  4JXT A;  1LLI A;  4Z5C A;  3QWV A;  3EJN A;  4N3C A;  1ZS4 A;  4PDX A;  1IC8 A;  2KC7 A;  3ZHI A;  3KXA A;  3DBS A;  3G5G A;  3JUI A;  5ENN A;  5J08 A;  2I9C A;  4L2Y A;  4KVO A;  3GN5 B;  2IUO A;  3S2A A;  4AEZ C;  3PNL B;  4W9R A;  1PC2 A;  4WWN A;  3I5P A;  3L16 A;  4BSX A;  2MOW A;  5CMY A;  1PRV A;  2IVB A;  3ZIM A;  2LYP A;  2A4Z A;  5KJN A;  3L54 A;  3S7D A;  1U3D A;  4Y6C A;  4UQY A;  5DBK A;  1E8W A;  2R59 A;  4I6G A;  1MQS A;  2KEK A;  4LUN U;  3CVQ A;  3TJP A;  3ZHE B;  2KPJ A;  2HSG A;  3GBF A;  3KS2 A;  2PM7 A;  4JZY A;  4WNE A;  2I6H A;  1WH6 A;  4IN3 B;  2WXJ A;  3OXF A;  4O6F A;  4H7Y A;  1E3O C;  3ESK A;  5EDS A;  4M3O A;  5T3R A;  2FF4 A;  1H2V C;  2HM8 A;  1PY1 A;  2VGY A;  3VLD A;  4CT0 A;  2NSZ A;  3OMT A;  2IU1 A;  1KT0 A;  2PZI A;  3T5X A;  2WQ6 A;  3QKY A;  4ILG A;  1IHG A;  2C0M A;  4MCT A;  3D9O A;  4KMO A;  4CEM A;  5BNW A;  3QWP A;  1OWN A;  3ULQ A;  3QQ6 A;  3FH5 A;  3ZHE A;  1KLX A;  2FEZ A;  4FJZ A;  1HXI A;  4AVX A;  4GU5 A;  2GRL A;  1ZPQ A;  2UY1 A;  2X38 A;  3FUF A;  2JVL A;  4ME2 A;  1WH8 A;  3ZYK A;  1LCD A;  2PUC A;  2PUA A;  4N39 A;  3CLJ A;  4AOF A;  4I6T A;  4AY6 A;  3RIB A;  3FFL A;  2LAH A;  1IQR A;  3OAW A;  5J90 A;  2PL2 A;  1OCT C;  1NZN A;  2CFU A;  3OXL A;  3U3W A;  5T8I A;  2MRI A;  1X5B A;  4RVB A;  2XRZ A;  3AS8 A;  4YG4 A;  4F53 A;  1NA3 A;  2WMN A;  4MS6 A;  4EZL A;  2LAI A;  5G04 J;  2CSF A;  5ANR A;  3FH8 A;  4B94 A;  1UN9 A;  1DVP A;  4PS7 A;  2XJ3 A;  5AIJ A;  1X57 A;  1UTX A;  4PU7 A;  3ASG A;  3CR3 A;  1HG5 A;  3EUS A;  4XKB A;  4URK A;  3CEQ A;  4BX8 A;  3B13 A;  4UWL A;  1NP7 A;  4C0M A;  4CCA A;  3APD A;  1JFS A;  4H7X A;  3R7Q A;  4F1S A;  4ANW A;  3LPZ A;  2J08 A;  3PH0 C;  3PUK A;  3QF3 A;  1P5Q A;  4OYS A;  1CJG A;  4U0U A;  2WQ7 A;  2V4L A;  2AXZ A;  3HVE A;  1VDY A;  2FBN A;  4JL0 A;  3ZVV A;  5FJY A;  2AW6 A;  2YIN A;  3ZW3 A;  2AXU A;  3BD1 A;  4J8E A;  3D9M A;  1MHQ A;  2V0P A;  3OTN A;  5AJL A;  2R1J L;  1QZ2 A;  2WXR A;  3ASF A;  4I2W A;  4KZC A;  2D5V A;  4CGW A;  3Q47 B;  1ZBP A;  3KZ3 A;  2VGX B;  4RG9 A;  1NA0 A;  3EIQ C;  3CKB A;  3FTV A;  4B8C B;  4HOU A;  4CGV A;  3D9L A;  2YHE A;  4PUC A;  4PS3 A;  2XPZ A;  2AXV A;  2AVP A;  3UUX A;  1LMB 3;  4XI9 A;  4CDM A;  2A5U A;  4GHJ A;  1S7E A;  1R69 A;  2XSD C;  1JFT A;  2DBA A;  3ASH A;  3FTX A;  4G25 A;  3AU4 A;  4ILI A;  1ADR A;  1FVH A;  4WWP A;  4B8A A;  2E0I A;  2OV8 A;  4XI0 A;  2KEJ A;  4Y6W A;  4GZC A;  3LS8 A;  4U04 A;  4WNF A;  4A1S A;  4X4E A;  2V5F A;  3ASD A;  1L1M A;  2IV1 A;  3T8M A;  5LX8 A;  1ZVV A;  1AU7 A;  2VQ2 A;  3KD7 A;  1EYH A;  3O48 A;  4A3V A;  2ILR A;  4L23 A;  1ELW A;  1UJK A;  2WXF A;  3GZ1 A;  3ONK A;  4BTB A;  3PRE A;  3APF A;  4ILH B;  1RPE L;  5JJT A;  5KJK A;  2XPI A;  1U3C A;  3PNT B;  2RG8 A;  2WB2 A;  3IV0 A;  4ANU A;  3CVY A;  5AEN A;  4B0Z A;  2X6J A;  4JQD A;  3CHS A;  1GW6 A;  2X6I A;  4YND A;  3R1F A;  4BTA A;  4C0E A;  4J8F A;  4EBA A;  3L1P A;  2J4D A;  4NUR A;  4I9C A;  3QAR A;  1E8X A;  2MHK A;  4JA9 A;  3RZZ A;  2XGM A;  2PE5 A;  4GAA A;  3AS5 A;  1GT0 C;  1X2L A;  4X4C A;  3G2U A;  3B7T A;  4EPZ A;  5JHA A;  3MEK A;  2AUW A;  3HDX A;  3KJX A;  3BG0 B;  4PU8 A;  5BUZ A;  3D9N A;  2GRM A;  3H5T A;  3LY7 A;  3UPV A;  3TRB A;  3HHM A;  3F52 A;  1ELK A;  4UQX A;  3TGO A;  1ZZ9 A;  1Y7Y A;  1HU3 A;  3AU5 A;  2Q7F A;  3JXC L;  3E4B A;  3QOU A;  2HIN A;  3QYX A;  4J8D A;  5BPP A;  4IYP A;  1YSE A;  4WND A;  3P1U A;  4GCO A;  1Y6I A;  4XE0 A;  2FUL A;  3S7F A;  2KEI A;  4N2S A;  3TL5 A;  2QY7 A;  5G04 C;  3VTY A;  1QNF A;  1H19 A;  2OOE A;  2WVI A;  4U63 A;  4UWG A;  3N71 A;  1OWM A;  5C2Y A;  4MKT A;  4AXH A;  3ZYQ A;  4ABN A;  4Z5D A;  3ZEF A;  3QC1 A;  3SCG A;  3PE4 A;  2H8R A;  2R5S A;  4UI9 K;  2HYZ A;  1B89 A;  5ARF A;  3FMY A;  5BW8 C;  1HG2 A;  5T4Y A;  3RO2 A;  4A3T A;  4GB9 A;  5LCW J;  4BT9 A;  2LYS A;  3GW4 A;  5D0Q D;  4BWR A;  1QPZ A;  4QFV A;  3FU5 A;  3IHV A;  2BNN A;  3QJZ A;  3FTW A;  4LER A;  4Y42 A;  3SGH A;  2LYQ A;  1XWR A;  1VPW A;  5FQ6 A;  3LY9 A;  4EEC A;  2M63 A;  5A7D B;  1PER L;  3CQC B;  3FUJ A;  3LIS A;  4FBI A;  3HYM B;  3KAE A;  2JLB A;  3B7U X;  2UY1 B;  1B0N A;  1OWO A;  4X4I A;  1JWL A;  2VSO E;  2XRY A;  2LYK A;  4FLB A;  4U0Z A;  4DLO A;  1RIO A;  5FTP A;  4FLH A;  1KT1 A;  1JPL A;  3FU3 A;  3UFD A;  3LDZ A;  4CDN A;  1Y9Q A;  3FHE A;  3U9W A;  4KYO B;  3UMV A;  4DLQ A;  3MA5 A;  3RRN B;  4JW1 A;  4KT6 B;  2MEZ A;  2L0I A;  4FA6 A;  3UT4 A;  4GA1 A;  3PDN A;  4ATG A;  2E2E A;  1N52 A;  4DJA A;  1RZR D;  2EQX A;  1QQB A;  1S0P A;  3S8Q A;  3ZN3 A;  4NDW A;  2O49 A;  2B5A A;  2WMO A;  1BDI A;  2GW1 A;  3O4Z A;  3Q4A B;  3PVL A;  3ML9 A;  3IHY A;  4I1A A;  4DPR A;  1PAQ A;  1HE8 A;  3WXX A;  1TEZ A;  3O9X A;  2BTD A;  3G2W A;  1QP7 A;  1JWG A;  4I6E A;  1E8Z A;  1TJF A;  2MQK A;  2QFC A;  3EHM A;  1E96 B;  3MX3 A;  1NER A;  1ZAY A;  1W3B A;  3CVV A;  2YQ8 A;  3VLE A;  1PRU A;  3CHO A;  4JHR A;  1QP4 A;  3OP9 A;  1E8Y A;  3PZD A;  3RKV A;  5JHB A;  1HH8 A;  4GML A;  1EF1 C;  4HOQ A;  2KZT A;  1ZZ6 A;  5FQ8 A;  4FC8 A;  2VSX E;  2FJR A;  1HX8 A;  2CHX A;  1O4X A;  1FVF A;  3APC A;  3F51 A;  4U8H A;  3CVU A;  1QP0 A;  3FUE A;  4APF A;  2C2L A;  4YAR A;  4O8B A;  2CRO A;  1A17 A;  4IWR A;  2BUG A;  4NAC A;  3FYA A;  4I17 A;  4TUU A;  4DK5 A;  2L8N A;  3HZI B;  4FU3 A;  2WXO A;  3MKR A;  3VLF A;  1ZU2 A;  4MLP A;  3ESL A;  4I43 A;  3TG4 A;  4DI4 A;  3RO3 A;  4FJY A;  4JEU A;  2PUF A;  3CSF A;  2X6H A;  2R17 C;  2WQH A;  3FUN A;  3ZXS A;  3Q49 B;  3FTU A;  1OSL A;  4N3A A;  4YVQ C;  1DWK A;  4D10 C;  2XCJ A;  1BPO A;  4Q69 A;  2XCB A;  1FCH A;  2IOL A;  3CHP A;  3MCX A;  3GZ2 A;  4JHK A;  5KJL A;  3MKQ B;  3BS3 A;  2J09 A;  4HXI A;  1H0A A;  1EDU A;  1WIZ A;  4K03 A;  5AJD A;  1NEQ A;  3ZYM A;  2CG2 A;  5G05 C;  1Z3X A;  3CK9 A;  1QQE A;  1Y8M A;  4RG6 A;  2VGX A;  1SZ9 A;  2LYL A;  4X4H A;  1RZR A;  1JUQ A;  2P58 C;  3CKC A;  3CQG B;  4JVS A;  4J0U A;  4APO A;  4I1O B;  2I1K A;  3CK8 A;  4HFG A;  1HFA A;  3D9J A;  2LSU A;  3CHR A;  1OUV A;  3B7R L;  3CVL A;  4F7A A;  2PIJ A;  3L22 A;  2CHZ A;  5LP0 A;  2L6J A;  5FZS A;  2LO6 A;  3MKQ A;  3IBE A;  4FHJ A;  2J07 A;  4XKC A;  1UN8 A;  3FDH A;  3S7B A;  4C9B B;  4WUY A;  4FN3 A;  4WWO A;  1QQA A;  1SQ8 A;  3CRO L;  1Z6T A;  3QNK A;  3GYZ A;  3B7S A;  3ML8 A;  2BJC A;  1ZZC A;  2O4A A;  4N3B A;  4CT4 A;  4EQF A;  2IVQ A;  2WXM A;  1OWP A;  2WXG A;  4Q94 A;  4AJW A;  5CCM A;  2BNO A;  4GYO A;  2PPX A;  4GYW A;  2CFZ A;  1ZZB A;  3MYV A;  5A6C A;  5BT1 A;  2WM9 A;  5CCL A;  3FEY A;  3PE3 A;  2R63 A;  1TJC A;  4HLE A;  5E75 A;  3UT7 A;  4PU4 C;  2AWI A;  3U64 A;  2XGO A;  4UWK A;  2FI7 A;  1HO8 A;  3ZGQ A;  4HOS A;  3G7D A;  3QB2 A;  1UXD A;  2PM6 A;  4Q96 A;  2IF4 A;  4AY5 A;  2WXP A;  2IQC A;  4MRU A;  3NQP A;  1EFA A;  1HF8 A;  1PRA A;  5FZR A;  3PS6 A;  4J6I A;  4OB4 A;  4BFR A;  3CVN A;  3TG5 A;  4B89 A;  3FTY A;  4I6J A;  4XIF A;  4YVO A;  1UW4 B;  2IVG A;  2XIU A;  1UG3 A;  3DPD A;  4GA2 A;  5FWQ A;  2V8S E;  3LVR E;  2PQR A;  5A7L A;  4FUL A;  4AP2 A;  4PU3 C;  4GPK A;  4GA0 A;  4HOR A;  1H2T C;  3SD5 A;  3EDT B;  4GZ5 A;  2KZ8 A;  4PS8 A;  5BV1 A;  5CMW A;  4JCY A;  1PNR A;  4FHK A;  2FO7 A;  3L6A A;  3MZL B;  4YG7 B;  4GQM A;  4TRQ A;  2IJG X;  1R63 A;  4U07 A;  5CHE E;  2CG3 A;  4KZ0 A;  3LCA A;  3AS4 A;  2I1J A;  2YHC A;  3G2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...