3U3WA

Crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
280
structure length
280
Chain Sequence
AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation mechanism of the PlcR virulence regulator by the quorum-sensing signal peptide PapR.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transcription activator/dna
molecule keywords Transcriptional activator PlcR protein
total genus 120
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3u3wA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u3wA02
1L1MA 3S8QA 3B7HA 5FTPA 5FZQA 3G5GA 2KEIA 3QF3A 2GZUA 1QPZA 3LKUA 3UQ3A 4KXKB 1DWKA 5CCMA 4X4BA 1S7EA 3QQ6A 1RZRA 4J8FA 4X4EA 5KJLA 2LSUA 4WNGA 4Z5HA 4X4HA 3HYMB 5LCWJ 4G23A 4JA9A 1QP4A 3Q47B 3Q5MA 4Z59A 2PIJA 3ASHA 4BT8A 2XGSA 1RZRD 2BUGA 4APOA 2CROA 1ZZ6A 2BNMA 1ELWA 2MHKA 1LQCA 3K9IA 3CEQA 1QQBA 4PU8A 1LCDA 3LYAA 1ZPQA 2LYQA 2KC7A 2O4AA 4G24A 3WXXA 2VQ2A 5C1DA 4AY6A 2HYZA 2LYLA 4J1XA 2LSVA 4G2VA 1NERA 3MV3B 4H7XA 3Q15A 4AIFA 5BT1A 1ZUGA 3KXAA 2WIUB 3CROL 4GA2A 1UXDA 3CVNA 1XNFA 3EUSA 4I17A 1E96B 5EKQD 4YVOA 1PC2A 4IA8A 3VK0A 4N2SA 4X4CA 2KCKA 3CKBA 3MEKA 3R1FA 3L1PA 1OSLA 2R1JL 4JQDA 3R9AB 2PZIA 5A7LA 3TAXA 3ESKA 4PU7A 4GCOA 4J8EA 3QWGA 2P58C 1W3BA 5BNWA 3FYAA 3BS3A 2XCBA 3Q49B 3CLCA 4GZ3A 2PPXA 1R69A 3F6WA 3KJXA 2KEKA 4I2ZA 2YHCA 1JFSA 2BNOA 2KPJA 4FN3A 2BJCA 2D5VA 2PE5A 3CVLA 3QKYA 4FBIA 4N3AA 1NA3A 4Z5CA 3SZ7A 1XWRA 4IVZA 4UQZA 2MEZA 2O38A 3DNVB 3RU0A 1RIOA 2VGXB 3GBFA 1IC8A 3VTXA 3JXBC 2GW1A 2LYRA 4Z58A 3O48A 4G25A 2ICTA 1JWLA 1DW9A 4I2WA 1ZZBA 2L8NA 4X4DA 2FJRA 5ARGA 3FFLA 2PUCA 1QQAA 4H7YA 3RKVA 3LFPA 5EX3A 4N3BA 3FYMA 3CVPA 2HR2A 4I9CA 3KS2A 3RO2A 5G04C 3FP3A 4JL0A 2PUDA 4KYOB 3FMYA 1ZZ8A 3G7DA 1QQEA 4BT9A 2GRLA 2FF4A 2PL2A 2XCJA 4N5CA 4CGVA 2CSFA 2IF4A 4ME2A 3F51A 3AS4A 1SQ8A 1Y9QA 3MA5A 5EX0A 5BW8C 3RIBA 5KJKA 1R63A 5FJYA 3IVPA 2IVGA 2JVLA 3TGOA 2LYKA 1Y7YA 1HF0A 1UTXA 1CJGA 4AM9A 2AXUA 4KBQA 3VTYA 3URZA 1PERL 2DBAA 3CK8A 2C0MA 2FI7A 3UFDA 3MLFA 4Z5DA 2AXZA 1PRAA 4JCYA 3KZ3A 3MKRA 1YSEA 2UY1B 3CKCA 4YARA 4EQFA 3KAEA 3ULQA 4NRHB 3OP9A 1LMB3 3RO3A 3GW4A 1ZZ9A 1WAO1 1PRVA 2EWTA 4G26A 5CHEE 3BD1A 2FEZA 3D1NI 2UWJG 4G1TA 1ZU2A 3TG4A 4U0UA 2XEVA 4PU4C 5CCLA 1E3OC 2XJ3A 1UXCA 1VPWA 4XI0A 2XPIA 4IN3B 3SF4A 3OQNA 4I8TA 2BNNA 2KATA 2VYIA 3OXFA 1WM5A 4WNEA 1LCCA 4CDRA 5G05C 2C0LA 1HH8A 2XI8A 2JCGA 4XIFA 2VSNA 5DBKA 4NQ0A 5JJTA 2XCCA 1YA0A 3E4BA 4N3CA 5KJMA 3U4TA 2AW6A 4MCXA 4YBAA 2O49A 4Y42A 2KCLA 1B0NA 3QWWA 2IUOA 2JLBA 1PRUA 1ZAYA 4UI9C 2FO7A 4J0UA 3BDNA 4MCTA 1OUVA 1ZVVA 3HZIB 3BEEA 4O6FA 3ASDA 3GZ1A 3CECA 4GA1A 2FBNA 4N39A 1QZ2A 3ASGA 4J8DA 3QWPA 3UPVA 1ZS4A 3CK7A 3AS8A 3ZN3A 3LY9A 2LNIA 4X4IA 3EDTB 4HOUA 1CQTA 4F8DA 1OCTC 2KCVA 4WUYA 3N71A 3CVQA 2LYSA 2UY1A 1JH9A 2PQNA 1NEQA 5AYWD 3QYXA 3OQOA 2Y4TA 3SCHA 3SCFA 2AVPA 3RJVA 4U04A 4HOSA 2E2EA 4F3VA 4BWRA 4GYOA 3GZ2A 4YG7B 4GYWA 4Y6CA 3OQMA 4XI9A 4GHJA 4Y6WA 3ZPJA 2I6HA 2WUSR 4U0ZA 3O9XA 1IYGA 1ADRA 5M72A 4X4GA 1ELRA 1Y8MA 3PE3A 2H8RA 3GN5B 3CV0A 3NF1A 4CGWA 2QFCA 2HSGA 1NA0A 1ZZCA 4IWRA 4OB4A 4X4FA 5A6CA 3LISA 4I6UA 5FZRA 2PQRA 2HO1A 1WH8A 2PUAA 2ICPA 4UQXA 1NZNA 3TG5A 1BDIA 1POUA 2Y4UA 3IEGA 1FCHA 3S7JA 4ABNA 2OFYA 2AXVA 3S7FA 2MQKA 3SCGA 5G04J 3JXCL 4BTAA 4BTBA 2VSYA 1QP7A 1ZBPA 4YG4A 4JCXA 2ONDA 3ZKCA 3PDNA 4GYYA 2J9QA 4UQYA 4I1AA 4RG6A 2EBYA 2LYJA 2IV1A 1PNRA 5DIZA 1JFTA 4GZ6A 3UUXA 5KJNA 2VGYA 4RG9A 4U0SA 3CK9A 2HINA 1LLIA 3LY8A 1EFAA 4N2QA 3RZZA 1HXIA 2R63A 4GZ5A 2KEJA 4GA0A 4B94A 1KT0A 3GN5A 2IVQA 3OXLA 2A6CA 3ASFA 4YNDA 2L49A 5HQ8A 3AS5A 2Q7FA 4JA7A 1IHGA 1AU7A 4HOQA 2XGMA 4WNFA 3GYZA 3JYSA 2R5SA 3LPZA 3ZHEA 5D0OD 4LEUA 4JHRA 3PXPA 3F52A 5JJ7A 4W9RA 4HOTA 3H5TA 4UI9K 4U07A 2L6JA 1RZSA 4GCNA 4WNDA 2NC9A 2KZ8A 4I9EA 2PUGA 1KT1A 2YQ8A 1A17A 1X2LA 5A7DB 3OMTA 1WIZA 1KLXA 2OR1L 2IU7A 1B89A 4YG1A 3U3WA 2GRMA 3Q4AB 3S7BA 1X57A 5LCWC 4YVQC 2VGXA 3S7DA 1RPEL 2V5FA 2XSDC 4UI9J 1WETA 5ARFA 3ZHIA 4A1SA 1HZ4A 3ZHMA 5FZSA 3KD7A 2XIUA 2PUBA 3JXDL 3LY7A 1ZZ7A 4HORA 4J1WA 2PUEA 2AWIA 1WH6A 2C2LA 3TRBA 2AUWA 2IVBA 4GPKA 4PU3C 1BDHA 4I6RA 5G05J 3ZGQA 3FWVA 3PE4A 4NDWA 1GT0C 4GQMA 1P5QA 3QDNA 1QP0A 5FT9A 3ZFWA 2IFUA 5JJ6A 2B5AA 4AY5A 4I6TA 5K98B 3ZHEB 2WPVA 5HI7A 2WQHA 2XGOA 2OOEA 2PUFA 3QOUA 3QWVA 1O4XA 4O8BA 5D0QD 2LYPA 1TJCA 3OXGA 3MV2B 3LCAA 2EF8A 2LCVA
chains in the Genus database with same CATH superfamily
3CHOA 2BTDA 5CEAA 3B7SA 2CFUA 5T4YA 5FZQA 3A9ZA 1BU9A 1TNZA 4IRUA 1K1AA 5E75A 3ABME 2LLWA 4X4BA 3HXEA 1S7EA 5BUZA 4J8FA 5AJDA 4A1GA 1L5JA 2LSUA 4WNGA 5ANRA 3CHMA 3PUKA 4ZHBA 3HYMB 3FTUA 4JA9A 1N4PA 4ANUA 3Q47B 3CGHA 3CVVA 4J8YA 2F8YA 2JABA 2BUGA 1ZZ6A 1LQCA 4AVXA 2WXFA 3AG1E 4PU8A 1UG3A 4BX8A 3QB2A 4K5AB 4XKCA 3D9OA 5AQBA 3UM2A 3B95A 3TWWA 1ZPQA 2LYQA 2O4AA 2ZIRA 5J08A 2LXLA 4G24A 5FQ7A 2HYZA 3KSLA 4RSYA 4J1XA 5JHAA 3FEXA 1U3DA 4IULA 1YCSB 1UXDA 2HM8A 2WXGA 4U96D 5EILA 3EUSA 1TNOA 3FTXA 3TJPA 4YVOA 5CERB 3EIQC 2WXKA 1HE8A 3VK0A 2PXVA 4HBDA 1OWMA 4HI9A 3ZW3A 5D66A 3L1PA 1OSLA 3AJIA 4JW1A 3VLDA 4PU7A 3JQ1A 4KVOA 4GCOA 4FHJA 4PUCA 4PS8A 2XCBA 4DX1A 1UW4B 3Q49B 4M3OA 2PPXA 2YHCA 2BNOA 2KPJA 2XS8A 4EPZA 3MKQB 1TYQG 3CVLA 4FBIA 4N3AA 1NA3A 4AOFA 4Z5CA 2PXLA 5FQ4A 3PZ2A 3LEWA 4PS7A 2ZGDA 3TFLA 2V4LA 1OWLA 3Q7AA 4G25A 5B1BE 2ICTA 1O1RA 4FHKA 3VWSA 5LFAA 3APCA 4L9PA 1S70B 4K03A 3LVQE 2ODRD 4N3BA 3CVPA 2DYRE 3HVEB 2HR2A 3RO2A 3FMYA 1EPUA 1ZZ8A 4CT0A 2GRLA 4TXPA 4CGVA 3ONKA 3MCXA 1SW6A 2F8XK 4ER6A 5ENQD 3RIBA 3DWLG 1H0AA 3B13A 3VLEA 1R63A 5FJYA 2IVGA 1Y7YA 2X6FA 3GZCA 4B93B 1CJGA 3PVLA 4I6EA 4GMJA 2OEWA 1PERL 3D9HA 2WXPA 3UTMA 3D9NA 3UM1A 5GAGi 3DBSA 2FI7A 2J7WA 2AXZA 4JCYA 3KZ3A 3AG4E 3R09A 2UY1B 4OAUC 3TXMA 3KAEA 2IY0C 4NRHB 4F1PA 3OP9A 3RO3A 2ILRA 4G26A 3D1NI 4CRWA 1IKND 3OAWA 1ZU2A 3SD5A 4UWGA 4A3VA 3LVRE 4AP2A 4URKA 3CHRA 4XKBA 1VPWA 2X6KA 4UUCA 4HNAD 3DRAA 3A9YA 2ETAA 2C0LA 1HH8A 2XI8A 5ENPD 5DBKA 1YA0A 4N3CA 5A23A 3QWWA 4GPMA 1OUVA 1X81A 3BEEA 1N11A 3DSWA 4O6FA 2PXEA 4GA1A 3ZUVB 2FBNA 2V0PA 4N39A 4J8DA 4GMLA 3GZSA 3T9KA 3LY9A 3D9KA 1CQTA 4F8DA 1OCTC 3DSUA 4WUYA 3CVQA 5KBAA 4EKIA 3Q73A 1EF1C 3DEPA 3NZUA 3SCHA 4L23A 2VEOA 3NOCD 1SVXA 2P9PG 2WMOA 5EN5D 4BWRA 1N9AA 4LNBA 3L13A 1Z3XA 3JCKC 4Y6WA 3PEUB 1N0RA 4U0ZA 3BU8A 1ELRA 3GN5B 2IEJA 1S0PA 4X4FA 5A6CA 2PQRA 2HO1A 3EU5A 1H6OA 2ICPA 1RZ4A 3FULA 1JCSA 1POUA 1IQRA 3FU5A 3SO8A 3ESLA 4RQIA 3S7FA 1NW3A 2RG8A 4BTAA 1QP7A 4JCXA 2R03A 4ZFHA 1HX8A 4KVMA 3ME5A 1N0QA 4EKGA 3SX0A 1PNRA 4L2YA 3UIPC 2VGYA 1A5EA 1FVHA 2I2OA 1D8DA 3RZZA 1X5BA 3DSVA 3RRMB 2R63A 3I5PA 4B94A 3ZYQA 1KT0A 3GN5A 4WVLA 3AS5A 1H6KA 2R02A 2XGMA 4WNFA 3L08A 2VSXE 3ZHEA 2IONA 2P9NG 4LEUA 2A4ZA 5D0OD 3BUAA 4W9RA 4HOTA 3H5TA 1LTXA 4JB8P 3D9JA 4UI9K 4BX9A 1JWGA 1Y6IA 2YINA 4HLLA 2XRYA 4WWNA 2F0YA 4I9EA 4BY6A 3QFIA 2PUGA 3C72A 2YQ8A 1A17A 1X2LA 4DLOA 5A7DB 5EDSA 1WIZA 2OVBA 4LUNU 4F53A 2GRMA 4FC8A 3S7BA 3FUIA 1RPEL 2V5FA 2XSDC 1SZ9A 4HRMB 4JEUA 4UI9J 4A1SA 3RK6A 2XIUA 3G2WA 1H19A 3DEOA 4JPSA 2AWIA 1WH6A 3NBNB 1PAQA 3FTZA 2IU1A 3PE4A 4NDWA 2L9BA 3Q9UC 2XXPA 1QP0A 5FT9A 3ZFWA 3PZ4A 2QZAA 3FTYA 2B5AA 4AY5A 3HRAA 3D9MA 2XGOA 4FJYA 2PUFA 1MJ0A 4DLQA 5D0QD 4FADA 3J5PA 4O60A 1NI1A 2LYPA 1RW2A 5HKPA 2LCVA 1L1MA 3S8QA 4J7WA 2R59A 3KL4A 3FH8A 3UM3A 3G5GA 4OAVB 3LKUA 4HFGA 5CCMA 2HE0A 3EUVA 2PXPA 3UM0A 5DTQA 3QQ6A 4KT6B 3TWVA 1DNPA 4X4EA 5DRTA 4HRLA 4Z5HA 1YYHA 5AIJA 3DM5A 5FWQA 2DYSE 1E90A 4ER3A 4Z59A 1TN7A 2PIJA 3TELA 2CFZA 1OCZE 3U66A 2H6GA 4C48B 5JHBA 4ANVA 2VSOE 1NFIE 1Z6TA 3LYAA 2PXTA 2KC7A 1TEZA 2GRPB 3HXFA 3WXXA 5C1DA 2I1JA 5IY5E 2LYLA 1EYHA 2WB2A 4CT4A 3CR3A 3KXAA 1MFQC 1INZA 1XNFA 4I17A 3RAUA 4KZ0A 3MEJA 1E8YA 5KNGA 2KCKA 3HXBA 3W9FA 4JQDA 2XENA 2CG2A 4ER7A 1HG5A 3ESKA 2XXAA 1HO8A 2A5UA 3FYAA 3CLCA 4GZ3A 3F6WA 3KJXA 3C3OA 4I2ZA 1OY3D 4XX5A 5AJLA 4FN3A 3FUJA 5E76A 2PE5A 3Q9NC 4N5QA 3QKYA 5DT2A 2P9IG 3SZ7A 3PH0C 3M9LA 2WMNA 3CSFA 1RIOA 1N94A 4UWLA 1N4QA 4B8CB 3Q79A 2GW1A 3FUKA 2LYRA 4Z58A 1S63A 4TUMA 1DCEA 1DW9A 4X4DA 4EHMA 5ARGA 3FFLA 2XS1A 3TWUA 2PUCA 3LFPA 4D10C 4I9CA 1H2TC 5G04C 4KYOB 4FJZA 2XPZA 1QQEA 4BSXA 2CG3A 4JHKA 4HRNA 2PL2A 2XCJA 4M7CA 5CEDB 2IF4A 1UN8A 1OXJA 3AS4A 1Y9QA 1OCOE 2LUHA 3MA5A 5EX0A 1HFAA 3ML9A 3DSTA 5KJKA 4JEHA 3DSXA 3IVPA 1QYMA 3TGOA 2ETBA 5LP0A 3MZLB 1UTXA 3CHQA 2AXUA 3VTYA 4FULA 4LG6A 4FU3A 3ISMC 2QYUA 2DBAA 1N95A 5JA4D 1TN6A 3PUJA 3UFDA 3MLFA 1PRAA 4F6RD 3I4GA 4E6HA 3MKRA 1YSEA 3QOWA 1OWOA 3CKCA 4YARA 1MZCA 1JCQA 4GTOA 2P9LG 1LMB3 3T8KA 4NIKA 4BETA 3GW4A 3CVXA 1E8ZA 3KEAA 4LCTA 4U8VD 3ZRHA 4G1TA 3MX3A 1K8KG 3E37A 5CBOA 3C3QA 5ANLA 2XEVA 2J4DA 1DULA 3OKZA 5AAOA 3ZYMA 2XPIA 4IN3B 4MBGA 4I8TA 3V30A 2KATA 2VYIA 1WY6A 4WNEA 4BESA 1LCCA 3F6QA 3L82A 2WXNA 1TNYA 4XIFA 4NQ0A 1HU3A 3E4BA 5ENRD 3CVYA 4YBAA 3D9LA 1IHBA 2JLBA 1PRUA 5B1AE 3BDNA 4MCTA 3NZLA 3UKRG 3ASDA 3GZ1A 3CECA 3AU5A 1QZ2A 2ZU6B 5GAHi 4Q96A 3IHYA 3CK7A 3ZN3A 1TJFA 2LNIA 1E7UA 2V3CC 3T5VA 3EDTB 4HOUA 2MYOA 1BI7B 1N4RA 2LYSA 3UINC 3P1UA 1Z3YA 2PQNA 5AYWD 3OQOA 3P2BA 3T8MA 3CQGB 1U2ZA 4HOSA 2PXDA 2E2EA 3V2XA 4XEIG 5KCMA 4GB9A 2XZTG 3TEPA 4J8SA 4WAFA 3CVWA 4GYWA 3OQMA 2I6HA 4ILGA 2J49A 4GTQA 1IYGA 4F1SA 4JD2G 3V79K 4DPRA 3CHSA 3C3RA 4MKTA 3LDZA 3FU0A 3B7UX 1MYOA 1IQUA 2HSGA 4OB4A 2LLVA 2RKKA 2PUAA 5BXUA 3ULEG 3DPYA 3QOXA 2MOWA 4ABNA 3SBTB 2OVFA 5G04J 3JXCL 1Q2ZA 4BTBA 1ZBPA 2WQ6A 3ZKCA 4LERA 3QNKA 4X8QA 3HG0D 4UQYA 3L16A 4I1AA 2LYJA 5DIZA 1JFTA 2JQEA 3UUXA 2XRZA 5ENNA 2WXMA 4N2QA 3APDA 1HXIA 4GZ5A 2KEJA 2IVQA 2WXIA 3A9XA 3VLFA 4JA7A 1IHGA 4XE0A 3JYSA 3R7RA 1N54A 3LPZA 4JHRA 3F52A 5JJ7A 3L6AA 2IOLA 3B7RL 4U07A 5AN8A 4C0MA 5DRYA 1GW6A 2KZ8A 3I4RB 3MJWA 3PREA 1KLXA 2OR1L 1B89A 3NAWA 1H2UA 4A55A 3Q4AB 4JVSA 2J8SD 1LF8A 4ATGA 4YVQC 3S7DA 3FTVA 2XXQA 5DSXA 1WETA 5ARFA 3ZHIA 2OV8A 3JXDL 3LY7A 4DX7D 4HORA 3J5QB 2DWZA 3E33A 1DVPA 2IVBA 4NACA 4I6RA 1FPPA 3FEYA 1U3CA 4LNGA 1P5QA 1TNUA 4CZ2D 4FP7A 4DX2A 3HXDA 3NXHA 1QB2A 5K98B 4BERA 3SFYA 4O1OA 1V54E 4EQZA 3QOUA 4GAAA 1WDYA 4XZ4A 4I6JA 1G3NB 2EF8A 2ZISA 3EHMA 5FTPA 4AV7A 1K3ZD 4L1BA 2KEIA 3QF3A 4K0RA 4U7EB 4KXKB 1DWKA 2NYJA 4DX6D 2J07A 4MS6A 1OCCE 3EJNA 4TXRA 3NOGD 2FFHA 1E7VA 4X4HA 3PEVB 4P29A 1QNFA 5LCWJ 4G23A 1QP4A 3NQPA 3X2QE 4BT8A 4Q2JA 3TXNA 1NP7A 2XGSA 1RZRD 2CROA 2BNMA 1ELWA 4TUUA 3K9IA 3CEQA 3UI2A 4FLBA 2HCSA 3D3MA 4EBAA 4AY6A 4UWFA 3HDXA 4G2VA 3JXJA 1HQ1A 3Q15A 3Q7FA 1ZUGA 5BT1A 3R9MA 2WIUB 3CROL 3CVNA 2BKGA 4Q94A 4O1PA 3ASNE 4DRXE 1E96B 5EKQD 5HRYA 3UKUG 5H7PA 3RRNB 4IA8A 5CRUA 4N2SA 4RLYA 1UJKA 3CKBA 3FHEA 3MEKA 2KZTB 3IHVA 1TR4A 2XEHA 3FY4A 2PZIA 2WXHA 4YDYA 1D9SA 3TAXA 4J8EA 2L0IA 2M4HA 3QWGA 2P58C 1W3BA 5BNWA 3BS3A 2HCNA 2BEDA 1R69A 1MQSA 4YDOA 2Y69E 5CMYA 2BJCA 5AARA 3SGHA 2M63A 3T5XA 3FUNA 3GZDC 4DI4A 2Y3AA 2VGEA 1XWRA 2B6CA 2O38A 2R05A 2DIWA 3RU0A 4DX5D 2VGXB 3GBFA 5CBNA 1IC8A 3PS6A 3VTXA 4DJAA 2KM4A 1TN8A 3O48A 4YDEA 1JWLA 4ACKA 1ZZBA 3ZXPA 2FJRA 1QQAA 3RKVA 3SY2A 1S64A 5G2NA 4B0ZA 2QYJA 3KS2A 3FP3A 2PUDA 4U63A 2J09A 1YMPA 4OVUA 4BT9A 4CYMD 3OTNA 3F51A 4QQIA 3PNLB 5BW8C 2IJGX 2LNMA 3NROA 1QBQA 1H6PA 2BF0X 3MYVA 2I9CA 2LYKA 1HF0A 2I1KA 3UT8A 1LD8A 4GTVA 2C0MA 4Z5DA 4FLHA 2PM6A 5ENSD 3I3NA 3LQXA 4ACLA 1DC2A 3FH7A 5HS0A 2L6BA 4EQFA 3ULQA 1ZB1A 3MGBA 3D9PA 3S2AA 3R7QA 1ZZ9A 1WAO1 3CQCB 1PRVA 2EWTA 5CHEE 5AQ9A 2UWJG 4DUIA 5DTRA 1O1TA 4QFVA 4JZYA 4OVVA 2GRNB 5AENA 2XJ3A 4EK9A 1UXCA 1JWFA 3QC1A 4XI0A 2EINE 2FULA 3SF4A 1KZOA 1EDUA 3FUHA 3OXFA 4CDRA 5G05C 2IQCA 2PXFA 2IO2C 3FUMA 3TWTA 2VSNA 3RRUA 5JJTA 2OCCE 2XCCA 5KJMA 3U4TA 2DCPA 5KWDA 4Y42A 2KCLA 1B0NA 4NURA 1ZAYA 2FO7A 4J0UA 4A3TA 1ZVVA 5BV1A 3IXEA 1BI8B 3V31A 3ASGA 3UPVA 3AS8A 4HLEA 3UWPA 1U2VG 3SI5A 1SQMA 3N71A 2H6HA 2UY1A 2B0OE 3QYXA 3LJ3A 5EYPF 2R2LA 2LXMA 3Q78A 3SCFA 2AVPA 4U04A 3E34A 3ZYLA 4F3VA 3GZ2A 3TWSA 4Y6CA 3O4ZA 2GROB 3UX4A 4CEMA 1O1SA 4XI9A 3L17A 2WUSR 3O9XA 1HS6A 1ADRA 5ITZF 3DXMG 4X4GA 5M72A 4WWPA 1Y8MA 3PE3A 2H8RA 1E8XA 3CV0A 3NF1A 2P9KG 3V2OA 2QFCA 5B3SE 1ZZCA 4IWRA 2WQ7A 5FZRA 1WH8A 2QC9A 4PS3A 1NZNA 4IYPA 1KPSB 2Y4UA 1FCHA 2EQXA 1JPLA 3ULYA 2OFYA 2XQ0A 2AXVA 4DI3A 2MQKA 2VSYA 3L54A 2YBDA 2R17C 2J9QA 2E0IA 2XEEA 4RG6A 2IO3C 2IV1A 4EECA 3ZU7B 3ONLA 5KJNA 3CK9A 3DPDA 1LLIA 1SZAA 4UWHA 4DK5A 2NSZA 4KZCA 2KBXA 3SFXA 3ASFA 4JC8A 1WG0A 4OBMA 1PY1A 1AU7A 2LO6A 3GYZA 1FVFA 3TWQA 4B89A 5T3RA 5LOZA 4ANXA 2PXQA 2DVWA 3AU4A 5EIBE 2OEVA 1MX6A 3HHMA 1RZSA 3ZKJA 4GCNA 4WNDA 2NC9A 1O5MA 2CHXA 3KSQA 2GRQB 3U3WA 4EZLA 2VGXA 4BEPA 4TV3A 5FZSA 3ZHMA 3UT7A 3U64A 2PM7A 1KZPA 3PZ1A 1ZZ7A 3ML8A 3G2UA 2WXJA 2PUEA 3TRBA 3EIJA 3ABLE 2XPYA 2AUWA 3BG1B 1BDHA 3NDBB 4GTPA 3ZGQA 2V5QC 4PDXA 5AQAA 3TWXA 3JUEA 5BPPA 3QDNA 3UXGA 1E8WA 2IFUA 3SQVA 2RFAA 4I6TA 3ZHEB 5HI7A 2OOEA 3FUDA 4U8HA 3QWVA 4EZIA 2X3MA 1O4XA 2H6FA 2WXOA 1N52A 4L2LA 3MV2B 3LCAA 4J6IA 5C2YA 3TWRA 3B7HA 3FU3A 2YHEA 3ENEA 2GZUA 1QPZA 3UQ3A 4HI8A 4APFA 3LXUX 3AG2E 4JHJA 1RZRA 4UWKA 4G8LA 5KJLA 4OYSA 2PXKA 4I6GA 3HIZA 1UN9A 2EILE 1UJJA 2P9UG 4CCAA 3APFA 1HF8A 3Q5MA 2GGFA 4BFRA 3ASHA 1V55E 4APOA 2MHKA 2V4HC 1QQBA 1D8EA 2EIME 3TL5A 1LCDA 2DZOA 1FT1A 3EHRA 4GZDA 4HVBA 2VQ2A 5FQ8A 2Y0BG 4DE8A 2LSVA 1NERA 3MV3B 4H7XA 4AIFA 2DZNA 3AG3E 2VTBA 2H6IA 4GA2A 1OCRE 2PXBA 4ILIA 4U95D 1MHQA 5CMWA 2A5EA 2PXUA 4DE9A 4AXHA 2J7UA 1PC2A 3HXCA 4X4CA 4HQDA 5FQ6A 3CLJA 3R1FA 4G8KA 5D2MC 2V8SE 2PNNA 2R1JL 3R9AB 2QY7A 4AJWA 5A7LA 1ELKA 1BLXB 1JUQA 4GZCA 2ZXWE 3UIOC 3ZVVA 4FA6A 3DXKG 3D9IA 5KNHD 2KEKA 3ZXSA 1JFSA 1BD8A 3G2VA 2CHZA 5LX8A 4MRUA 3NB2A 2D5VA 2WM9A 2MRIA 3JUIA 3KEZA 3JXIA 4ANWA 2FO1E 3AAAC 4IVZA 4UQZA 2MEZA 3DNVB 2GRRB 1Z5SC 4GTRA 4CDNA 2F37A 2MXDA 5J90A 4G11A 2WXQA 3JXBC 3DSSA 3FU6A 4I2WA 2L8NA 3WG7E 3ZIMA 4H7YA 3EHQA 5EX3A 3FYMA 4JL0A 3G7DA 1OWPA 2FF4A 3SNXA 4N5CA 3BQOA 3C98A 2CSFA 4ME2A 1SQ8A 4I1MA 5BV0A 3LJNA 3W9GA 2X6HA 2JVLA 3Q75A 3CHPA 4AM9A 4KBQA 1N4SA 2CHWA 3URZA 1BPOA 4ER5A 2XHEA 2ETCA 3ABKE 3CK8A 3CVUA 3SFZA 5T8IA 3QAQA 3FH5A 4KMOA 2WXRA 2P9SG 5BXOA 4V3IA 3B7BA 1QZXA 2IOSA 2XZDG 3BD1A 2FEZA 3PE5A 3TG4A 4U0UA 4L7TA 4PU4C 2JEKA 2VJ8A 1TNBA 5CCLA 1E3OC 4HS2A 4R7LA 4C0EA 3OQNA 2BNNA 3UT4A 4C9BB 1WM5A 5JMND 3EHNA 2JCGA 2KZTA 3SHFA 3B7TA 4LRZA 1LD7A 4I43A 2AW6A 4MCXA 2O49A 5ENTD 2IUOA 4UI9C 1OT8A 3BG0B 3HZIB 5EIDA 2X6JA 5G55A 3EU9A 3QWPA 2LAHA 1ZS4A 3FUFA 4RVBA 2WXLA 2X6IA 4AEZC 2Y1LE 4X4IA 1VDYA 2KCVA 4GTMA 2ZGGA 1JH9A 2L0TB 1NEQA 1FT2A 3GUUA 2J08A 4GTTA 4JXTA 2Y4TA 4BSZB 3ASOE 3RJVA 1HG2A 4GYOA 4YG7B 3MKQA 4EZJA 1AWCB 3PZDA 4E85A 2EIJE 4B8AA 3IBEA 3E32A 2AJAA 4GHJA 3ZPJA 3CIAA 3E30A 5ENOD 3CSTA 4Q69A 5AQ7A 2J4BA 4HXIA 3OWQA 1H2VC 4HB5A 4CGWA 2WVIA 1NA0A 3LISA 4I6UA 1OWNA 4HRAA 4UQXA 3TG5A 1BDIA 3SBSA 4GU5A 4ILHB 3IEGA 3S7JA 4WWOA 3ZPXA 4GMRA 4Z68A 4MLPA 2LAIA 3SCGA 4YG4A 2ONDA 5FIOA 3PDNA 4GYYA 4I1OB 1NL4A 4TRQA 3FTWA 2EIKE 4PH4B 3GZDA 2EBYA 4GZ6A 4EZKA 4RG9A 4A63B 4U0SA 1K1BA 2HINA 3LY8A 1SA4A 1EFAA 3QJZA 1MX4A 3ZEFA 4GA0A 3JQ0A 3U9WA 3OXLA 2A6CA 5CECB 4YNDA 4GTSA 2L49A 5HQ8A 5JUWA 1IXVA 2Q7FA 3L9TA 3C5RA 5FINA 1DCQA 4HOQA 2R5SA 3L22A 3PXPA 5EYLA 2RFMA 3ZNGA 3G2TA 3LS8A 3ZYKA 4LNUD 1XGWA 2L6JA 4YDWA 3FDHA 2NXPA 1JCRA 2HFZA 4ER0A 1KT1A 1MX2A 3QK0A 1UOHA 3OMTA 3QARA 2IU7A 5CRVA 4YG1A 3PNTB 2YNQA 4EBAG 5DTMA 4K5CA 1SA5A 1X57A 5LCWC 3G0TA 3PZ3A 1HZ4A 3KD7A 3FUEA 4CDMA 2PUBA 4LSZE 4J1WA 4ATZD 2P2CP 2C2LA 4GPKA 4PU3C 2VTBB 5G05J 3FWVA 3NZSA 3SR4A 1AP7A 1GT0C 4GQMA 4F7AA 2KXPC 2RD0A 2X38A 5JJ6A 3IKOB 3PRZA 2WPVA 2WQHA 3HVEA 3UMVA 4TXQA 3RSEG 4O8BA 2BKKB 3IV0A 3FTSA 4U8YD 4K5BA 2L1PA 1TJCA 3OXGA 3G2SA
chains in the Genus database with same CATH topology
1L1MA 3S8QA 3EHMA 3CHOA 2BTDA 3B7HA 3FU3A 3B7SA 2CFUA 2R59A 5FTPA 5FZQA 5T4YA 2YHEA 4L1BA 4AV7A 3FH8A 3ENEA 3G5GA 2KEIA 3QF3A 2GZUA 1QPZA 3LKUA 4IRUA 4K0RA 5E75A 3UQ3A 4HFGA 4KXKB 1DWKA 4APFA 5CCMA 4X4BA 2J07A 3LXUX 1S7EA 5BUZA 3QQ6A 4JHJA 4KT6B 1RZRA 1DNPA 4J8FA 4MS6A 4X4EA 3EJNA 4UWKA 5KJLA 4OYSA 5AJDA 4A1GA 4I6GA 1L5JA 3HIZA 2LSUA 4WNGA 1E7VA 4Z5HA 4X4HA 1UN9A 5ANRA 3CHMA 3PEVB 5AIJA 3PUKA 5FWQA 1UJJA 3HYMB 4P29A 1QNFA 3FTUA 5LCWJ 4G23A 4JA9A 1E90A 4CCAA 1QP4A 3APFA 3NQPA 4ANUA 3Q47B 4C9BB 1HF8A 3Q5MA 4Z59A 2GGFA 3CGHA 2PIJA 3ASHA 4BT8A 4BFRA 3TXNA 3CVVA 1NP7A 2XGSA 1RZRD 2BUGA 4APOA 2CROA 1ZZ6A 2BNMA 1ELWA 2CFZA 2MHKA 1LQCA 4TUUA 3K9IA 4AVXA 2WXFA 3CEQA 1QQBA 3U66A 4PU8A 1UG3A 4BX8A 4ANVA 3QB2A 1LCDA 2VSOE 1Z6TA 3TL5A 5JHBA 4XKCA 3D9OA 3LYAA 1ZPQA 2LYQA 2KC7A 4FLBA 1TEZA 3D3MA 2O4AA 5J08A 4G24A 4GZDA 4EBAA 3WXXA 4HVBA 2VQ2A 2I1JA 5FQ8A 5FQ7A 5C1DA 4AY6A 2HYZA 2LYLA 4RSYA 4UWFA 1EYHA 4J1XA 3HDXA 2LSVA 4G2VA 5JHAA 3FEXA 1NERA 3CR3A 4CT4A 2WB2A 3MV3B 4H7XA 3Q15A 1U3DA 4AIFA 1ZUGA 5BT1A 3KXAA 2VTBA 2WIUB 3CROL 4GA2A 4IULA 1INZA 1UXDA 2HM8A 2WXGA 4ILIA 3CVNA 1XNFA 3EUSA 4I17A 4Q94A 1MHQA 5CMWA 1E96B 5EKQD 4KZ0A 3FTXA 3TJPA 4YVOA 1E8YA 3EIQC 3RRNB 4AXHA 1PC2A 2WXKA 1HE8A 4IA8A 3VK0A 4N2SA 4X4CA 5FQ6A 2KCKA 1UJKA 3CLJA 3CKBA 3FHEA 3MEKA 3R1FA 2KZTB 1OWMA 3ZW3A 3IHVA 3L1PA 1OSLA 3FY4A 2V8SE 2R1JL 4JQDA 3R9AB 2QY7A 2CG2A 2PZIA 1HG5A 2WXHA 4AJWA 5A7LA 3TAXA 4JW1A 1ELKA 1JUQA 3ESKA 4GZCA 3VLDA 4PU7A 3JQ1A 4KVOA 4GCOA 1HO8A 2L0IA 4J8EA 3QWGA 2A5UA 2P58C 4FHJA 1W3BA 3ZVVA 4FA6A 5BNWA 3FYAA 3BS3A 4PUCA 4PS8A 2XCBA 3D9IA 1UW4B 3Q49B 4M3OA 3CLCA 4GZ3A 2PPXA 1R69A 1MQSA 3F6WA 3KJXA 2KEKA 4I2ZA 2YHCA 3ZXSA 4XX5A 1JFSA 2BNOA 3G2VA 2CHZA 2KPJA 5AJLA 5CMYA 4FN3A 2BJCA 3FUJA 4MRUA 2D5VA 5E76A 2PE5A 2M63A 3SGHA 3MKQB 3CVLA 2WM9A 2MRIA 3JUIA 4EPZA 3QKYA 4FBIA 4N3AA 3KEZA 1NA3A 4AOFA 4Z5CA 5FQ4A 4ANWA 3T5XA 3SZ7A 3FUNA 3PH0C 4DI4A 2Y3AA 1XWRA 3LEWA 4IVZA 4UQZA 2MEZA 2O38A 2WMNA 3DNVB 2DIWA 3CSFA 3RU0A 4PS7A 1RIOA 2VGXB 3GBFA 4UWLA 4CDNA 4B8CB 5J90A 1IC8A 3PS6A 4G11A 3VTXA 2V4LA 2KM4A 3JXBC 2WXQA 4DJAA 1OWLA 2GW1A 3FUKA 2LYRA 4Z58A 3O48A 4G25A 2ICTA 1JWLA 4ACKA 1DW9A 3FU6A 1ZZBA 2L8NA 4X4DA 4FHKA 4I2WA 2FJRA 5LFAA 3APCA 5ARGA 3FFLA 3ZIMA 2PUCA 1QQAA 4H7YA 3RKVA 3LFPA 4K03A 3LVQE 4D10C 5EX3A 4N3BA 3FYMA 3CVPA 5G2NA 3HVEB 4B0ZA 2HR2A 4I9CA 3KS2A 1H2TC 3RO2A 5G04C 3FP3A 4JL0A 2PUDA 4FJZA 4KYOB 2XPZA 3FMYA 2J09A 4U63A 1EPUA 1ZZ8A 3G7DA 1QQEA 4CT0A 4BSXA 4OVUA 4BT9A 2GRLA 1OWPA 2CG3A 2FF4A 4JHKA 3SNXA 2PL2A 2XCJA 4N5CA 3C98A 4CGVA 2CSFA 2IF4A 1UN8A 3ONKA 3OTNA 4ME2A 3F51A 3AS4A 1SQ8A 3MCXA 1Y9QA 3PNLB 3MA5A 4I1MA 5EX0A 5BW8C 3RIBA 5BV0A 1HFAA 1H0AA 2IJGX 3B13A 3ML9A 5KJKA 3VLEA 1R63A 2BF0X 4JEHA 5FJYA 3IVPA 2X6HA 2IVGA 2JVLA 2I9CA 2LYKA 3MYVA 3TGOA 1Y7YA 5LP0A 2X6FA 1HF0A 3MZLB 3CHPA 1UTXA 3CHQA 2I1KA 1CJGA 4AM9A 2AXUA 4KBQA 3VTYA 2CHWA 3PVLA 3URZA 4FULA 4I6EA 4FU3A 4GMJA 1PERL 1BPOA 2WXPA 3UT8A 3D9NA 2DBAA 2XHEA 3CK8A 3DBSA 3CVUA 2C0MA 2FI7A 3PUJA 3UFDA 3MLFA 4Z5DA 2AXZA 1PRAA 4JCYA 3SFZA 3KZ3A 3I4GA 4FLHA 2PM6A 5T8IA 3QAQA 3I3NA 4E6HA 3FH5A 4ACLA 3MKRA 1YSEA 3FH7A 4KMOA 2UY1B 1OWOA 3CKCA 4YARA 2WXRA 5LX8A 4EQFA 3TXMA 3KAEA 3ULQA 4NRHB 3MGBA 4V3IA 3OP9A 1LMB3 3RO3A 2ILRA 3D9PA 3S2AA 3R7QA 3GW4A 3CVXA 1ZZ9A 1E8ZA 1WAO1 3CQCB 4LCTA 1PRVA 2IOSA 2EWTA 4G26A 3ZRHA 5CHEE 3BD1A 2FEZA 3D1NI 4CRWA 2UWJG 4G1TA 3MX3A 3OAWA 1ZU2A 3SD5A 4QFVA 4UWGA 3TG4A 4U0UA 3LVRE 4L7TA 4JZYA 5ANLA 4A3VA 2XEVA 4AP2A 4PU4C 2J4DA 2JEKA 4OVVA 4URKA 3CHRA 2VJ8A 4XKBA 5CCLA 5AENA 1E3OC 2XJ3A 1JWFA 1UXCA 3QC1A 1VPWA 4XI0A 2X6KA 4HS2A 2FULA 3ZYMA 2XPIA 4IN3B 4R7LA 4C0EA 3SF4A 3OQNA 1EDUA 4I8TA 2BNNA 2KATA 2VYIA 1WY6A 1WM5A 3FUHA 3OXFA 4WNEA 1LCCA 3UT4A 5G05C 2IQCA 3EHNA 3FUMA 2WXNA 4CDRA 2C0LA 1HH8A 2XI8A 2JCGA 2KZTA 3SHFA 3B7TA 4XIFA 2VSNA 4LRZA 4NQ0A 5DBKA 3RRUA 1HU3A 4I43A 2XCCA 1YA0A 3E4BA 4N3CA 5JJTA 3U4TA 2AW6A 2DCPA 4MCXA 5KJMA 3CVYA 5A23A 4YBAA 3D9LA 2O49A 4Y42A 2KCLA 1B0NA 3QWWA 4NURA 2IUOA 2JLBA 1PRUA 1ZAYA 4UI9C 2FO7A 4J0UA 3BDNA 4A3TA 1OUVA 4MCTA 1ZVVA 3BG0B 3HZIB 3BEEA 4O6FA 3ASDA 3GZ1A 5BV1A 3CECA 2X6JA 4GA1A 5G55A 2FBNA 2V0PA 3AU5A 4N39A 1QZ2A 3ASGA 4J8DA 3QWPA 2ZU6B 4GMLA 2LAHA 3UPVA 4Q96A 1ZS4A 3GZSA 3IHYA 3CK7A 3AS8A 3ZN3A 4HLEA 3FUFA 3LY9A 4RVBA 2WXLA 3SI5A 1TJFA 2LNIA 1E7UA 2X6IA 4AEZC 3T5VA 3D9KA 4X4IA 1VDYA 3EDTB 4HOUA 1CQTA 4F8DA 1OCTC 1SQMA 2KCVA 4WUYA 3N71A 3CVQA 2LYSA 2UY1A 3P1UA 1Z3YA 1JH9A 2L0TB 2PQNA 1NEQA 5AYWD 3QYXA 3LJ3A 3OQOA 3P2BA 1EF1C 2J08A 3NZUA 3T8MA 4JXTA 2Y4TA 3SCHA 3SCFA 2AVPA 3CQGB 4L23A 3RJVA 4U04A 4HOSA 2E2EA 2WMOA 3ZYLA 5KCMA 4F3VA 1HG2A 4BWRA 4GYOA 4GB9A 3GZ2A 4YG7B 4J8SA 4WAFA 3MKQA 3CVWA 4EZJA 4GYWA 4Y6CA 3O4ZA 3PZDA 4E85A 3UX4A 4B8AA 3OQMA 3L13A 1Z3XA 3JCKC 3IBEA 4XI9A 4CEMA 4GHJA 4Y6WA 3PEUB 3ZPJA 2I6HA 2WUSR 2J49A 3CIAA 3L17A 3O9XA 4ILGA 1HS6A 4U0ZA 1IYGA 3CSTA 4F1SA 1ADRA 4Q69A 5M72A 4X4GA 4DPRA 3CHSA 4WWPA 1ELRA 4MKTA 1Y8MA 3PE3A 2H8RA 3GN5B 2J4BA 1E8XA 4HXIA 3CV0A 1H2VC 3NF1A 3LDZA 3FU0A 4CGWA 3B7UX 2WVIA 2QFCA 1IQUA 2HSGA 1NA0A 1S0PA 4IWRA 1ZZCA 4OB4A 4X4FA 5A6CA 1OWNA 3LISA 4I6UA 2PQRA 2HO1A 1WH8A 2PUAA 5FZRA 2WQ7A 4PS3A 2ICPA 3FULA 4UQXA 1NZNA 4IYPA 3TG5A 1BDIA 3SBSA 1POUA 1IQRA 4GU5A 2Y4UA 3FU5A 1FCHA 2EQXA 1JPLA 2MOWA 3IEGA 4ILHB 4WWOA 3S7JA 4ABNA 3SBTB 2OFYA 2XQ0A 4MLPA 2AXVA 3ESLA 2LAIA 3S7FA 4DI3A 2MQKA 3SCGA 2OVFA 5G04J 3JXCL 2RG8A 4BTAA 4BTBA 2VSYA 1QP7A 1ZBPA 3L54A 2WQ6A 4YG4A 4JCXA 2ONDA 3ZKCA 4LERA 3PDNA 4GYYA 3QNKA 2R17C 1HX8A 2J9QA 4I1OB 4KVMA 4UQYA 2E0IA 4TRQA 3L16A 4I1AA 3FTWA 4PH4B 4RG6A 2EBYA 2LYJA 2IV1A 4EECA 1PNRA 5DIZA 1JFTA 4L2YA 4GZ6A 3ONLA 3UUXA 4EZKA 5KJNA 2VGYA 4RG9A 1FVHA 2I2OA 4U0SA 3CK9A 2HINA 1LLIA 1SZAA 3DPDA 3LY8A 4UWHA 2XRZA 1EFAA 5ENNA 2WXMA 3QJZA 4DK5A 4N2QA 3RZZA 1X5BA 3APDA 1HXIA 3ZEFA 2NSZA 4KZCA 3RRMB 2R63A 4GZ5A 2KEJA 3I5PA 4GA0A 3ZYQA 1KT0A 3JQ0A 4B94A 3GN5A 3U9WA 2IVQA 2WXIA 2A6CA 3ASFA 3OXLA 4JC8A 4YNDA 2L49A 5HQ8A 3AS5A 3VLFA 2Q7FA 4JA7A 1IHGA 1H6KA 1PY1A 1AU7A 2LO6A 4HOQA 4XE0A 2XGMA 4WNFA 3GYZA 3JYSA 3L08A 3R7RA 1FVFA 2VSXE 2R5SA 1N54A 3LPZA 4B89A 5T3RA 3ZHEA 2IONA 3L22A 4JHRA 3PXPA 3F52A 2A4ZA 4LEUA 5D0OD 5JJ7A 5LOZA 4W9RA 4ANXA 4HOTA 3L6AA 3H5TA 2IOLA 3AU4A 3B7RL 3G2TA 3D9JA 3LS8A 3ZYKA 4UI9K 4U07A 1XGWA 2L6JA 4C0MA 4BX9A 3FDHA 1JWGA 1Y6IA 2YINA 3HHMA 1RZSA 1GW6A 2XRYA 4GCNA 4WNDA 4WWNA 2NC9A 2NXPA 2KZ8A 3I4RB 4I9EA 4BY6A 2PUGA 1KT1A 3MJWA 3PREA 2YQ8A 1A17A 3QK0A 1X2LA 4DLOA 2CHXA 5A7DB 3OMTA 5EDSA 1WIZA 1KLXA 2OR1L 2OVBA 4LUNU 3QARA 4F53A 2IU7A 1B89A 1H2UA 4YG1A 3U3WA 2YNQA 3PNTB 2GRMA 3Q4AB 4FC8A 4JVSA 3S7BA 4A55A 4EBAG 4EZLA 1LF8A 1X57A 3FUIA 5LCWC 4ATGA 4YVQC 2VGXA 3S7DA 3FTVA 1RPEL 2V5FA 2XSDC 1SZ9A 4UI9J 1WETA 4JEUA 4TV3A 3ZHIA 5ARFA 4A1SA 1HZ4A 3ZHMA 5FZSA 3RK6A 3KD7A 2XIUA 3FUEA 2OV8A 2PUBA 3UT7A 4CDMA 3U64A 2PM7A 3JXDL 3LY7A 3G2WA 1H19A 1ZZ7A 3ML8A 3G2UA 4HORA 4J1WA 2WXJA 4JPSA 2PUEA 2AWIA 1WH6A 1PAQA 2C2LA 3TRBA 3EIJA 3FTZA 2XPYA 1DVPA 2AUWA 2IVBA 3BG1B 4PU3C 1BDHA 4NACA 4I6RA 5G05J 2VTBB 3ZGQA 4GPKA 2IU1A 3FWVA 3NZSA 3PE4A 4NDWA 4PDXA 2L9BA 1GT0C 3FEYA 5BPPA 1U3CA 4GQMA 1P5QA 3QDNA 4F7AA 4FP7A 1QP0A 1E8WA 2RD0A 2X38A 5FT9A 2IFUA 3ZFWA 5JJ6A 3FTYA 3IKOB 2B5AA 4AY5A 3PRZA 4I6TA 5K98B 3ZHEB 2WPVA 5HI7A 3D9MA 2WQHA 2XGOA 2OOEA 3HVEA 4FJYA 2PUFA 3FUDA 3UMVA 4U8HA 3QOUA 3QWVA 4GAAA 2X3MA 1O4XA 4DLQA 4O8BA 4XZ4A 2WXOA 5D0QD 1N52A 3FTSA 3IV0A 4FADA 4L2LA 4I6JA 2LYPA 1TJCA 3OXGA 3MV2B 3LCAA 2EF8A 2LCVA 4J6IA 3G2SA 5C2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1M A;  3S8Q A;  3B7H A;  5FTP A;  5FZQ A;  3G5G A;  2KEI A;  3QF3 A;  2GZU A;  1QPZ A;  3LKU A;  3UQ3 A;  4KXK B;  1DWK A;  5CCM A;  4X4B A;  1S7E A;  3QQ6 A;  1RZR A;  4J8F A;  4X4E A;  5KJL A;  2LSU A;  4WNG A;  4Z5H A;  4X4H A;  3HYM B;  5LCW J;  4G23 A;  4JA9 A;  1QP4 A;  3Q47 B;  3Q5M A;  4Z59 A;  2PIJ A;  3ASH A;  4BT8 A;  2XGS A;  1RZR D;  2BUG A;  4APO A;  2CRO A;  1ZZ6 A;  2BNM A;  1ELW A;  2MHK A;  1LQC A;  3K9I A;  3CEQ A;  1QQB A;  4PU8 A;  1LCD A;  3LYA A;  1ZPQ A;  2LYQ A;  2KC7 A;  2O4A A;  4G24 A;  3WXX A;  2VQ2 A;  5C1D A;  4AY6 A;  2HYZ A;  2LYL A;  4J1X A;  2LSV A;  4G2V A;  1NER A;  3MV3 B;  4H7X A;  3Q15 A;  4AIF A;  5BT1 A;  1ZUG A;  3KXA A;  2WIU B;  3CRO L;  4GA2 A;  1UXD A;  3CVN A;  1XNF A;  3EUS A;  4I17 A;  1E96 B;  5EKQ D;  4YVO A;  1PC2 A;  4IA8 A;  3VK0 A;  4N2S A;  4X4C A;  2KCK A;  3CKB A;  3MEK A;  3R1F A;  3L1P A;  1OSL A;  2R1J L;  4JQD A;  3R9A B;  2PZI A;  5A7L A;  3TAX A;  3ESK A;  4PU7 A;  4GCO A;  4J8E A;  3QWG A;  2P58 C;  1W3B A;  5BNW A;  3FYA A;  3BS3 A;  2XCB A;  3Q49 B;  3CLC A;  4GZ3 A;  2PPX A;  1R69 A;  3F6W A;  3KJX A;  2KEK A;  4I2Z A;  2YHC A;  1JFS A;  2BNO A;  2KPJ A;  4FN3 A;  2BJC A;  2D5V A;  2PE5 A;  3CVL A;  3QKY A;  4FBI A;  4N3A A;  1NA3 A;  4Z5C A;  3SZ7 A;  1XWR A;  4IVZ A;  4UQZ A;  2MEZ A;  2O38 A;  3DNV B;  3RU0 A;  1RIO A;  2VGX B;  3GBF A;  1IC8 A;  3VTX A;  3JXB C;  2GW1 A;  2LYR A;  4Z58 A;  3O48 A;  4G25 A;  2ICT A;  1JWL A;  1DW9 A;  4I2W A;  1ZZB A;  2L8N A;  4X4D A;  2FJR A;  5ARG A;  3FFL A;  2PUC A;  1QQA A;  4H7Y A;  3RKV A;  3LFP A;  5EX3 A;  4N3B A;  3FYM A;  3CVP A;  2HR2 A;  4I9C A;  3KS2 A;  3RO2 A;  5G04 C;  3FP3 A;  4JL0 A;  2PUD A;  4KYO B;  3FMY A;  1ZZ8 A;  3G7D A;  1QQE A;  4BT9 A;  2GRL A;  2FF4 A;  2PL2 A;  2XCJ A;  4N5C A;  4CGV A;  2CSF A;  2IF4 A;  4ME2 A;  3F51 A;  3AS4 A;  1SQ8 A;  1Y9Q A;  3MA5 A;  5EX0 A;  5BW8 C;  3RIB A;  5KJK A;  1R63 A;  5FJY A;  3IVP A;  2IVG A;  2JVL A;  3TGO A;  2LYK A;  1Y7Y A;  1HF0 A;  1UTX A;  1CJG A;  4AM9 A;  2AXU A;  4KBQ A;  3VTY A;  3URZ A;  1PER L;  2DBA A;  3CK8 A;  2C0M A;  2FI7 A;  3UFD A;  3MLF A;  4Z5D A;  2AXZ A;  1PRA A;  4JCY A;  3KZ3 A;  3MKR A;  1YSE A;  2UY1 B;  3CKC A;  4YAR A;  4EQF A;  3KAE A;  3ULQ A;  4NRH B;  3OP9 A;  1LMB 3;  3RO3 A;  3GW4 A;  1ZZ9 A;  1WAO 1;  1PRV A;  2EWT A;  4G26 A;  5CHE E;  3BD1 A;  2FEZ A;  3D1N I;  2UWJ G;  4G1T A;  1ZU2 A;  3TG4 A;  4U0U A;  2XEV A;  4PU4 C;  5CCL A;  1E3O C;  2XJ3 A;  1UXC A;  1VPW A;  4XI0 A;  2XPI A;  4IN3 B;  3SF4 A;  3OQN A;  4I8T A;  2BNN A;  2KAT A;  2VYI A;  3OXF A;  1WM5 A;  4WNE A;  1LCC A;  4CDR A;  5G05 C;  2C0L A;  1HH8 A;  2XI8 A;  2JCG A;  4XIF A;  2VSN A;  5DBK A;  4NQ0 A;  5JJT A;  2XCC A;  1YA0 A;  3E4B A;  4N3C A;  5KJM A;  3U4T A;  2AW6 A;  4MCX A;  4YBA A;  2O49 A;  4Y42 A;  2KCL A;  1B0N A;  3QWW A;  2IUO A;  2JLB A;  1PRU A;  1ZAY A;  4UI9 C;  2FO7 A;  4J0U A;  3BDN A;  4MCT A;  1OUV A;  1ZVV A;  3HZI B;  3BEE A;  4O6F A;  3ASD A;  3GZ1 A;  3CEC A;  4GA1 A;  2FBN A;  4N39 A;  1QZ2 A;  3ASG A;  4J8D A;  3QWP A;  3UPV A;  1ZS4 A;  3CK7 A;  3AS8 A;  3ZN3 A;  3LY9 A;  2LNI A;  4X4I A;  3EDT B;  4HOU A;  1CQT A;  4F8D A;  1OCT C;  2KCV A;  4WUY A;  3N71 A;  3CVQ A;  2LYS A;  2UY1 A;  1JH9 A;  2PQN A;  1NEQ A;  5AYW D;  3QYX A;  3OQO A;  2Y4T A;  3SCH A;  3SCF A;  2AVP A;  3RJV A;  4U04 A;  4HOS A;  2E2E A;  4F3V A;  4BWR A;  4GYO A;  3GZ2 A;  4YG7 B;  4GYW A;  4Y6C A;  3OQM A;  4XI9 A;  4GHJ A;  4Y6W A;  3ZPJ A;  2I6H A;  2WUS R;  4U0Z A;  3O9X A;  1IYG A;  1ADR A;  5M72 A;  4X4G A;  1ELR A;  1Y8M A;  3PE3 A;  2H8R A;  3GN5 B;  3CV0 A;  3NF1 A;  4CGW A;  2QFC A;  2HSG A;  1NA0 A;  1ZZC A;  4IWR A;  4OB4 A;  4X4F A;  5A6C A;  3LIS A;  4I6U A;  5FZR A;  2PQR A;  2HO1 A;  1WH8 A;  2PUA A;  2ICP A;  4UQX A;  1NZN A;  3TG5 A;  1BDI A;  1POU A;  2Y4U A;  3IEG A;  1FCH A;  3S7J A;  4ABN A;  2OFY A;  2AXV A;  3S7F A;  2MQK A;  3SCG A;  5G04 J;  3JXC L;  4BTA A;  4BTB A;  2VSY A;  1QP7 A;  1ZBP A;  4YG4 A;  4JCX A;  2OND A;  3ZKC A;  3PDN A;  4GYY A;  2J9Q A;  4UQY A;  4I1A A;  4RG6 A;  2EBY A;  2LYJ A;  2IV1 A;  1PNR A;  5DIZ A;  1JFT A;  4GZ6 A;  3UUX A;  5KJN A;  2VGY A;  4RG9 A;  4U0S A;  3CK9 A;  2HIN A;  1LLI A;  3LY8 A;  1EFA A;  4N2Q A;  3RZZ A;  1HXI A;  2R63 A;  4GZ5 A;  2KEJ A;  4GA0 A;  4B94 A;  1KT0 A;  3GN5 A;  2IVQ A;  3OXL A;  2A6C A;  3ASF A;  4YND A;  2L49 A;  5HQ8 A;  3AS5 A;  2Q7F A;  4JA7 A;  1IHG A;  1AU7 A;  4HOQ A;  2XGM A;  4WNF A;  3GYZ A;  3JYS A;  2R5S A;  3LPZ A;  3ZHE A;  5D0O D;  4LEU A;  4JHR A;  3PXP A;  3F52 A;  5JJ7 A;  4W9R A;  4HOT A;  3H5T A;  4UI9 K;  4U07 A;  2L6J A;  1RZS A;  4GCN A;  4WND A;  2NC9 A;  2KZ8 A;  4I9E A;  2PUG A;  1KT1 A;  2YQ8 A;  1A17 A;  1X2L A;  5A7D B;  3OMT A;  1WIZ A;  1KLX A;  2OR1 L;  2IU7 A;  1B89 A;  4YG1 A;  3U3W A;  2GRM A;  3Q4A B;  3S7B A;  1X57 A;  5LCW C;  4YVQ C;  2VGX A;  3S7D A;  1RPE L;  2V5F A;  2XSD C;  4UI9 J;  1WET A;  5ARF A;  3ZHI A;  4A1S A;  1HZ4 A;  3ZHM A;  5FZS A;  3KD7 A;  2XIU A;  2PUB A;  3JXD L;  3LY7 A;  1ZZ7 A;  4HOR A;  4J1W A;  2PUE A;  2AWI A;  1WH6 A;  2C2L A;  3TRB A;  2AUW A;  2IVB A;  4GPK A;  4PU3 C;  1BDH A;  4I6R A;  5G05 J;  3ZGQ A;  3FWV A;  3PE4 A;  4NDW A;  1GT0 C;  4GQM A;  1P5Q A;  3QDN A;  1QP0 A;  5FT9 A;  3ZFW A;  2IFU A;  5JJ6 A;  2B5A A;  4AY5 A;  4I6T A;  5K98 B;  3ZHE B;  2WPV A;  5HI7 A;  2WQH A;  2XGO A;  2OOE A;  2PUF A;  3QOU A;  3QWV A;  1O4X A;  4O8B A;  5D0Q D;  2LYP A;  1TJC A;  3OXG A;  3MV2 B;  3LCA A;  2EF8 A;  2LCV A; 
#chains in the Genus database with same CATH topology
 3CHO A;  2BTD A;  5CEA A;  3B7S A;  2CFU A;  5T4Y A;  5FZQ A;  3A9Z A;  1BU9 A;  1TNZ A;  4IRU A;  1K1A A;  5E75 A;  3ABM E;  2LLW A;  4X4B A;  3HXE A;  1S7E A;  5BUZ A;  4J8F A;  5AJD A;  4A1G A;  1L5J A;  2LSU A;  4WNG A;  5ANR A;  3CHM A;  3PUK A;  4ZHB A;  3HYM B;  3FTU A;  4JA9 A;  1N4P A;  4ANU A;  3Q47 B;  3CGH A;  3CVV A;  4J8Y A;  2F8Y A;  2JAB A;  2BUG A;  1ZZ6 A;  1LQC A;  4AVX A;  2WXF A;  3AG1 E;  4PU8 A;  1UG3 A;  4BX8 A;  3QB2 A;  4K5A B;  4XKC A;  3D9O A;  5AQB A;  3UM2 A;  3B95 A;  3TWW A;  1ZPQ A;  2LYQ A;  2O4A A;  2ZIR A;  5J08 A;  2LXL A;  4G24 A;  5FQ7 A;  2HYZ A;  3KSL A;  4RSY A;  4J1X A;  5JHA A;  3FEX A;  1U3D A;  4IUL A;  1YCS B;  1UXD A;  2HM8 A;  2WXG A;  4U96 D;  5EIL A;  3EUS A;  1TNO A;  3FTX A;  3TJP A;  4YVO A;  5CER B;  3EIQ C;  2WXK A;  1HE8 A;  3VK0 A;  2PXV A;  4HBD A;  1OWM A;  4HI9 A;  3ZW3 A;  5D66 A;  3L1P A;  1OSL A;  3AJI A;  4JW1 A;  3VLD A;  4PU7 A;  3JQ1 A;  4KVO A;  4GCO A;  4FHJ A;  4PUC A;  4PS8 A;  2XCB A;  4DX1 A;  1UW4 B;  3Q49 B;  4M3O A;  2PPX A;  2YHC A;  2BNO A;  2KPJ A;  2XS8 A;  4EPZ A;  3MKQ B;  1TYQ G;  3CVL A;  4FBI A;  4N3A A;  1NA3 A;  4AOF A;  4Z5C A;  2PXL A;  5FQ4 A;  3PZ2 A;  3LEW A;  4PS7 A;  2ZGD A;  3TFL A;  2V4L A;  1OWL A;  3Q7A A;  4G25 A;  5B1B E;  2ICT A;  1O1R A;  4FHK A;  3VWS A;  5LFA A;  3APC A;  4L9P A;  1S70 B;  4K03 A;  3LVQ E;  2ODR D;  4N3B A;  3CVP A;  2DYR E;  3HVE B;  2HR2 A;  3RO2 A;  3FMY A;  1EPU A;  1ZZ8 A;  4CT0 A;  2GRL A;  4TXP A;  4CGV A;  3ONK A;  3MCX A;  1SW6 A;  2F8X K;  4ER6 A;  5ENQ D;  3RIB A;  3DWL G;  1H0A A;  3B13 A;  3VLE A;  1R63 A;  5FJY A;  2IVG A;  1Y7Y A;  2X6F A;  3GZC A;  4B93 B;  1CJG A;  3PVL A;  4I6E A;  4GMJ A;  2OEW A;  1PER L;  3D9H A;  2WXP A;  3UTM A;  3D9N A;  3UM1 A;  5GAG i;  3DBS A;  2FI7 A;  2J7W A;  2AXZ A;  4JCY A;  3KZ3 A;  3AG4 E;  3R09 A;  2UY1 B;  4OAU C;  3TXM A;  3KAE A;  2IY0 C;  4NRH B;  4F1P A;  3OP9 A;  3RO3 A;  2ILR A;  4G26 A;  3D1N I;  4CRW A;  1IKN D;  3OAW A;  1ZU2 A;  3SD5 A;  4UWG A;  4A3V A;  3LVR E;  4AP2 A;  4URK A;  3CHR A;  4XKB A;  1VPW A;  2X6K A;  4UUC A;  4HNA D;  3DRA A;  3A9Y A;  2ETA A;  2C0L A;  1HH8 A;  2XI8 A;  5ENP D;  5DBK A;  1YA0 A;  4N3C A;  5A23 A;  3QWW A;  4GPM A;  1OUV A;  1X81 A;  3BEE A;  1N11 A;  3DSW A;  4O6F A;  2PXE A;  4GA1 A;  3ZUV B;  2FBN A;  2V0P A;  4N39 A;  4J8D A;  4GML A;  3GZS A;  3T9K A;  3LY9 A;  3D9K A;  1CQT A;  4F8D A;  1OCT C;  3DSU A;  4WUY A;  3CVQ A;  5KBA A;  4EKI A;  3Q73 A;  1EF1 C;  3DEP A;  3NZU A;  3SCH A;  4L23 A;  2VEO A;  3NOC D;  1SVX A;  2P9P G;  2WMO A;  5EN5 D;  4BWR A;  1N9A A;  4LNB A;  3L13 A;  1Z3X A;  3JCK C;  4Y6W A;  3PEU B;  1N0R A;  4U0Z A;  3BU8 A;  1ELR A;  3GN5 B;  2IEJ A;  1S0P A;  4X4F A;  5A6C A;  2PQR A;  2HO1 A;  3EU5 A;  1H6O A;  2ICP A;  1RZ4 A;  3FUL A;  1JCS A;  1POU A;  1IQR A;  3FU5 A;  3SO8 A;  3ESL A;  4RQI A;  3S7F A;  1NW3 A;  2RG8 A;  4BTA A;  1QP7 A;  4JCX A;  2R03 A;  4ZFH A;  1HX8 A;  4KVM A;  3ME5 A;  1N0Q A;  4EKG A;  3SX0 A;  1PNR A;  4L2Y A;  3UIP C;  2VGY A;  1A5E A;  1FVH A;  2I2O A;  1D8D A;  3RZZ A;  1X5B A;  3DSV A;  3RRM B;  2R63 A;  3I5P A;  4B94 A;  3ZYQ A;  1KT0 A;  3GN5 A;  4WVL A;  3AS5 A;  1H6K A;  2R02 A;  2XGM A;  4WNF A;  3L08 A;  2VSX E;  3ZHE A;  2ION A;  2P9N G;  4LEU A;  2A4Z A;  5D0O D;  3BUA A;  4W9R A;  4HOT A;  3H5T A;  1LTX A;  4JB8 P;  3D9J A;  4UI9 K;  4BX9 A;  1JWG A;  1Y6I A;  2YIN A;  4HLL A;  2XRY A;  4WWN A;  2F0Y A;  4I9E A;  4BY6 A;  3QFI A;  2PUG A;  3C72 A;  2YQ8 A;  1A17 A;  1X2L A;  4DLO A;  5A7D B;  5EDS A;  1WIZ A;  2OVB A;  4LUN U;  4F53 A;  2GRM A;  4FC8 A;  3S7B A;  3FUI A;  1RPE L;  2V5F A;  2XSD C;  1SZ9 A;  4HRM B;  4JEU A;  4UI9 J;  4A1S A;  3RK6 A;  2XIU A;  3G2W A;  1H19 A;  3DEO A;  4JPS A;  2AWI A;  1WH6 A;  3NBN B;  1PAQ A;  3FTZ A;  2IU1 A;  3PE4 A;  4NDW A;  2L9B A;  3Q9U C;  2XXP A;  1QP0 A;  5FT9 A;  3ZFW A;  3PZ4 A;  2QZA A;  3FTY A;  2B5A A;  4AY5 A;  3HRA A;  3D9M A;  2XGO A;  4FJY A;  2PUF A;  1MJ0 A;  4DLQ A;  5D0Q D;  4FAD A;  3J5P A;  4O60 A;  1NI1 A;  2LYP A;  1RW2 A;  5HKP A;  2LCV A;  1L1M A;  3S8Q A;  4J7W A;  2R59 A;  3KL4 A;  3FH8 A;  3UM3 A;  3G5G A;  4OAV B;  3LKU A;  4HFG A;  5CCM A;  2HE0 A;  3EUV A;  2PXP A;  3UM0 A;  5DTQ A;  3QQ6 A;  4KT6 B;  3TWV A;  1DNP A;  4X4E A;  5DRT A;  4HRL A;  4Z5H A;  1YYH A;  5AIJ A;  3DM5 A;  5FWQ A;  2DYS E;  1E90 A;  4ER3 A;  4Z59 A;  1TN7 A;  2PIJ A;  3TEL A;  2CFZ A;  1OCZ E;  3U66 A;  2H6G A;  4C48 B;  5JHB A;  4ANV A;  2VSO E;  1NFI E;  1Z6T A;  3LYA A;  2PXT A;  2KC7 A;  1TEZ A;  2GRP B;  3HXF A;  3WXX A;  5C1D A;  2I1J A;  5IY5 E;  2LYL A;  1EYH A;  2WB2 A;  4CT4 A;  3CR3 A;  3KXA A;  1MFQ C;  1INZ A;  1XNF A;  4I17 A;  3RAU A;  4KZ0 A;  3MEJ A;  1E8Y A;  5KNG A;  2KCK A;  3HXB A;  3W9F A;  4JQD A;  2XEN A;  2CG2 A;  4ER7 A;  1HG5 A;  3ESK A;  2XXA A;  1HO8 A;  2A5U A;  3FYA A;  3CLC A;  4GZ3 A;  3F6W A;  3KJX A;  3C3O A;  4I2Z A;  1OY3 D;  4XX5 A;  5AJL A;  4FN3 A;  3FUJ A;  5E76 A;  2PE5 A;  3Q9N C;  4N5Q A;  3QKY A;  5DT2 A;  2P9I G;  3SZ7 A;  3PH0 C;  3M9L A;  2WMN A;  3CSF A;  1RIO A;  1N94 A;  4UWL A;  1N4Q A;  4B8C B;  3Q79 A;  2GW1 A;  3FUK A;  2LYR A;  4Z58 A;  1S63 A;  4TUM A;  1DCE A;  1DW9 A;  4X4D A;  4EHM A;  5ARG A;  3FFL A;  2XS1 A;  3TWU A;  2PUC A;  3LFP A;  4D10 C;  4I9C A;  1H2T C;  5G04 C;  4KYO B;  4FJZ A;  2XPZ A;  1QQE A;  4BSX A;  2CG3 A;  4JHK A;  4HRN A;  2PL2 A;  2XCJ A;  4M7C A;  5CED B;  2IF4 A;  1UN8 A;  1OXJ A;  3AS4 A;  1Y9Q A;  1OCO E;  2LUH A;  3MA5 A;  5EX0 A;  1HFA A;  3ML9 A;  3DST A;  5KJK A;  4JEH A;  3DSX A;  3IVP A;  1QYM A;  3TGO A;  2ETB A;  5LP0 A;  3MZL B;  1UTX A;  3CHQ A;  2AXU A;  3VTY A;  4FUL A;  4LG6 A;  4FU3 A;  3ISM C;  2QYU A;  2DBA A;  1N95 A;  5JA4 D;  1TN6 A;  3PUJ A;  3UFD A;  3MLF A;  1PRA A;  4F6R D;  3I4G A;  4E6H A;  3MKR A;  1YSE A;  3QOW A;  1OWO A;  3CKC A;  4YAR A;  1MZC A;  1JCQ A;  4GTO A;  2P9L G;  1LMB 3;  3T8K A;  4NIK A;  4BET A;  3GW4 A;  3CVX A;  1E8Z A;  3KEA A;  4LCT A;  4U8V D;  3ZRH A;  4G1T A;  3MX3 A;  1K8K G;  3E37 A;  5CBO A;  3C3Q A;  5ANL A;  2XEV A;  2J4D A;  1DUL A;  3OKZ A;  5AAO A;  3ZYM A;  2XPI A;  4IN3 B;  4MBG A;  4I8T A;  3V30 A;  2KAT A;  2VYI A;  1WY6 A;  4WNE A;  4BES A;  1LCC A;  3F6Q A;  3L82 A;  2WXN A;  1TNY A;  4XIF A;  4NQ0 A;  1HU3 A;  3E4B A;  5ENR D;  3CVY A;  4YBA A;  3D9L A;  1IHB A;  2JLB A;  1PRU A;  5B1A E;  3BDN A;  4MCT A;  3NZL A;  3UKR G;  3ASD A;  3GZ1 A;  3CEC A;  3AU5 A;  1QZ2 A;  2ZU6 B;  5GAH i;  4Q96 A;  3IHY A;  3CK7 A;  3ZN3 A;  1TJF A;  2LNI A;  1E7U A;  2V3C C;  3T5V A;  3EDT B;  4HOU A;  2MYO A;  1BI7 B;  1N4R A;  2LYS A;  3UIN C;  3P1U A;  1Z3Y A;  2PQN A;  5AYW D;  3OQO A;  3P2B A;  3T8M A;  3CQG B;  1U2Z A;  4HOS A;  2PXD A;  2E2E A;  3V2X A;  4XEI G;  5KCM A;  4GB9 A;  2XZT G;  3TEP A;  4J8S A;  4WAF A;  3CVW A;  4GYW A;  3OQM A;  2I6H A;  4ILG A;  2J49 A;  4GTQ A;  1IYG A;  4F1S A;  4JD2 G;  3V79 K;  4DPR A;  3CHS A;  3C3R A;  4MKT A;  3LDZ A;  3FU0 A;  3B7U X;  1MYO A;  1IQU A;  2HSG A;  4OB4 A;  2LLV A;  2RKK A;  2PUA A;  5BXU A;  3ULE G;  3DPY A;  3QOX A;  2MOW A;  4ABN A;  3SBT B;  2OVF A;  5G04 J;  3JXC L;  1Q2Z A;  4BTB A;  1ZBP A;  2WQ6 A;  3ZKC A;  4LER A;  3QNK A;  4X8Q A;  3HG0 D;  4UQY A;  3L16 A;  4I1A A;  2LYJ A;  5DIZ A;  1JFT A;  2JQE A;  3UUX A;  2XRZ A;  5ENN A;  2WXM A;  4N2Q A;  3APD A;  1HXI A;  4GZ5 A;  2KEJ A;  2IVQ A;  2WXI A;  3A9X A;  3VLF A;  4JA7 A;  1IHG A;  4XE0 A;  3JYS A;  3R7R A;  1N54 A;  3LPZ A;  4JHR A;  3F52 A;  5JJ7 A;  3L6A A;  2IOL A;  3B7R L;  4U07 A;  5AN8 A;  4C0M A;  5DRY A;  1GW6 A;  2KZ8 A;  3I4R B;  3MJW A;  3PRE A;  1KLX A;  2OR1 L;  1B89 A;  3NAW A;  1H2U A;  4A55 A;  3Q4A B;  4JVS A;  2J8S D;  1LF8 A;  4ATG A;  4YVQ C;  3S7D A;  3FTV A;  2XXQ A;  5DSX A;  1WET A;  5ARF A;  3ZHI A;  2OV8 A;  3JXD L;  3LY7 A;  4DX7 D;  4HOR A;  3J5Q B;  2DWZ A;  3E33 A;  1DVP A;  2IVB A;  4NAC A;  4I6R A;  1FPP A;  3FEY A;  1U3C A;  4LNG A;  1P5Q A;  1TNU A;  4CZ2 D;  4FP7 A;  4DX2 A;  3HXD A;  3NXH A;  1QB2 A;  5K98 B;  4BER A;  3SFY A;  4O1O A;  1V54 E;  4EQZ A;  3QOU A;  4GAA A;  1WDY A;  4XZ4 A;  4I6J A;  1G3N B;  2EF8 A;  2ZIS A;  3EHM A;  5FTP A;  4AV7 A;  1K3Z D;  4L1B A;  2KEI A;  3QF3 A;  4K0R A;  4U7E B;  4KXK B;  1DWK A;  2NYJ A;  4DX6 D;  2J07 A;  4MS6 A;  1OCC E;  3EJN A;  4TXR A;  3NOG D;  2FFH A;  1E7V A;  4X4H A;  3PEV B;  4P29 A;  1QNF A;  5LCW J;  4G23 A;  1QP4 A;  3NQP A;  3X2Q E;  4BT8 A;  4Q2J A;  3TXN A;  1NP7 A;  2XGS A;  1RZR D;  2CRO A;  2BNM A;  1ELW A;  4TUU A;  3K9I A;  3CEQ A;  3UI2 A;  4FLB A;  2HCS A;  3D3M A;  4EBA A;  4AY6 A;  4UWF A;  3HDX A;  4G2V A;  3JXJ A;  1HQ1 A;  3Q15 A;  3Q7F A;  1ZUG A;  5BT1 A;  3R9M A;  2WIU B;  3CRO L;  3CVN A;  2BKG A;  4Q94 A;  4O1P A;  3ASN E;  4DRX E;  1E96 B;  5EKQ D;  5HRY A;  3UKU G;  5H7P A;  3RRN B;  4IA8 A;  5CRU A;  4N2S A;  4RLY A;  1UJK A;  3CKB A;  3FHE A;  3MEK A;  2KZT B;  3IHV A;  1TR4 A;  2XEH A;  3FY4 A;  2PZI A;  2WXH A;  4YDY A;  1D9S A;  3TAX A;  4J8E A;  2L0I A;  2M4H A;  3QWG A;  2P58 C;  1W3B A;  5BNW A;  3BS3 A;  2HCN A;  2BED A;  1R69 A;  1MQS A;  4YDO A;  2Y69 E;  5CMY A;  2BJC A;  5AAR A;  3SGH A;  2M63 A;  3T5X A;  3FUN A;  3GZD C;  4DI4 A;  2Y3A A;  2VGE A;  1XWR A;  2B6C A;  2O38 A;  2R05 A;  2DIW A;  3RU0 A;  4DX5 D;  2VGX B;  3GBF A;  5CBN A;  1IC8 A;  3PS6 A;  3VTX A;  4DJA A;  2KM4 A;  1TN8 A;  3O48 A;  4YDE A;  1JWL A;  4ACK A;  1ZZB A;  3ZXP A;  2FJR A;  1QQA A;  3RKV A;  3SY2 A;  1S64 A;  5G2N A;  4B0Z A;  2QYJ A;  3KS2 A;  3FP3 A;  2PUD A;  4U63 A;  2J09 A;  1YMP A;  4OVU A;  4BT9 A;  4CYM D;  3OTN A;  3F51 A;  4QQI A;  3PNL B;  5BW8 C;  2IJG X;  2LNM A;  3NRO A;  1QBQ A;  1H6P A;  2BF0 X;  3MYV A;  2I9C A;  2LYK A;  1HF0 A;  2I1K A;  3UT8 A;  1LD8 A;  4GTV A;  2C0M A;  4Z5D A;  4FLH A;  2PM6 A;  5ENS D;  3I3N A;  3LQX A;  4ACL A;  1DC2 A;  3FH7 A;  5HS0 A;  2L6B A;  4EQF A;  3ULQ A;  1ZB1 A;  3MGB A;  3D9P A;  3S2A A;  3R7Q A;  1ZZ9 A;  1WAO 1;  3CQC B;  1PRV A;  2EWT A;  5CHE E;  5AQ9 A;  2UWJ G;  4DUI A;  5DTR A;  1O1T A;  4QFV A;  4JZY A;  4OVV A;  2GRN B;  5AEN A;  2XJ3 A;  4EK9 A;  1UXC A;  1JWF A;  3QC1 A;  4XI0 A;  2EIN E;  2FUL A;  3SF4 A;  1KZO A;  1EDU A;  3FUH A;  3OXF A;  4CDR A;  5G05 C;  2IQC A;  2PXF A;  2IO2 C;  3FUM A;  3TWT A;  2VSN A;  3RRU A;  5JJT A;  2OCC E;  2XCC A;  5KJM A;  3U4T A;  2DCP A;  5KWD A;  4Y42 A;  2KCL A;  1B0N A;  4NUR A;  1ZAY A;  2FO7 A;  4J0U A;  4A3T A;  1ZVV A;  5BV1 A;  3IXE A;  1BI8 B;  3V31 A;  3ASG A;  3UPV A;  3AS8 A;  4HLE A;  3UWP A;  1U2V G;  3SI5 A;  1SQM A;  3N71 A;  2H6H A;  2UY1 A;  2B0O E;  3QYX A;  3LJ3 A;  5EYP F;  2R2L A;  2LXM A;  3Q78 A;  3SCF A;  2AVP A;  4U04 A;  3E34 A;  3ZYL A;  4F3V A;  3GZ2 A;  3TWS A;  4Y6C A;  3O4Z A;  2GRO B;  3UX4 A;  4CEM A;  1O1S A;  4XI9 A;  3L17 A;  2WUS R;  3O9X A;  1HS6 A;  1ADR A;  5ITZ F;  3DXM G;  4X4G A;  5M72 A;  4WWP A;  1Y8M A;  3PE3 A;  2H8R A;  1E8X A;  3CV0 A;  3NF1 A;  2P9K G;  3V2O A;  2QFC A;  5B3S E;  1ZZC A;  4IWR A;  2WQ7 A;  5FZR A;  1WH8 A;  2QC9 A;  4PS3 A;  1NZN A;  4IYP A;  1KPS B;  2Y4U A;  1FCH A;  2EQX A;  1JPL A;  3ULY A;  2OFY A;  2XQ0 A;  2AXV A;  4DI3 A;  2MQK A;  2VSY A;  3L54 A;  2YBD A;  2R17 C;  2J9Q A;  2E0I A;  2XEE A;  4RG6 A;  2IO3 C;  2IV1 A;  4EEC A;  3ZU7 B;  3ONL A;  5KJN A;  3CK9 A;  3DPD A;  1LLI A;  1SZA A;  4UWH A;  4DK5 A;  2NSZ A;  4KZC A;  2KBX A;  3SFX A;  3ASF A;  4JC8 A;  1WG0 A;  4OBM A;  1PY1 A;  1AU7 A;  2LO6 A;  3GYZ A;  1FVF A;  3TWQ A;  4B89 A;  5T3R A;  5LOZ A;  4ANX A;  2PXQ A;  2DVW A;  3AU4 A;  5EIB E;  2OEV A;  1MX6 A;  3HHM A;  1RZS A;  3ZKJ A;  4GCN A;  4WND A;  2NC9 A;  1O5M A;  2CHX A;  3KSQ A;  2GRQ B;  3U3W A;  4EZL A;  2VGX A;  4BEP A;  4TV3 A;  5FZS A;  3ZHM A;  3UT7 A;  3U64 A;  2PM7 A;  1KZP A;  3PZ1 A;  1ZZ7 A;  3ML8 A;  3G2U A;  2WXJ A;  2PUE A;  3TRB A;  3EIJ A;  3ABL E;  2XPY A;  2AUW A;  3BG1 B;  1BDH A;  3NDB B;  4GTP A;  3ZGQ A;  2V5Q C;  4PDX A;  5AQA A;  3TWX A;  3JUE A;  5BPP A;  3QDN A;  3UXG A;  1E8W A;  2IFU A;  3SQV A;  2RFA A;  4I6T A;  3ZHE B;  5HI7 A;  2OOE A;  3FUD A;  4U8H A;  3QWV A;  4EZI A;  2X3M A;  1O4X A;  2H6F A;  2WXO A;  1N52 A;  4L2L A;  3MV2 B;  3LCA A;  4J6I A;  5C2Y A;  3TWR A;  3B7H A;  3FU3 A;  2YHE A;  3ENE A;  2GZU A;  1QPZ A;  3UQ3 A;  4HI8 A;  4APF A;  3LXU X;  3AG2 E;  4JHJ A;  1RZR A;  4UWK A;  4G8L A;  5KJL A;  4OYS A;  2PXK A;  4I6G A;  3HIZ A;  1UN9 A;  2EIL E;  1UJJ A;  2P9U G;  4CCA A;  3APF A;  1HF8 A;  3Q5M A;  2GGF A;  4BFR A;  3ASH A;  1V55 E;  4APO A;  2MHK A;  2V4H C;  1QQB A;  1D8E A;  2EIM E;  3TL5 A;  1LCD A;  2DZO A;  1FT1 A;  3EHR A;  4GZD A;  4HVB A;  2VQ2 A;  5FQ8 A;  2Y0B G;  4DE8 A;  2LSV A;  1NER A;  3MV3 B;  4H7X A;  4AIF A;  2DZN A;  3AG3 E;  2VTB A;  2H6I A;  4GA2 A;  1OCR E;  2PXB A;  4ILI A;  4U95 D;  1MHQ A;  5CMW A;  2A5E A;  2PXU A;  4DE9 A;  4AXH A;  2J7U A;  1PC2 A;  3HXC A;  4X4C A;  4HQD A;  5FQ6 A;  3CLJ A;  3R1F A;  4G8K A;  5D2M C;  2V8S E;  2PNN A;  2R1J L;  3R9A B;  2QY7 A;  4AJW A;  5A7L A;  1ELK A;  1BLX B;  1JUQ A;  4GZC A;  2ZXW E;  3UIO C;  3ZVV A;  4FA6 A;  3DXK G;  3D9I A;  5KNH D;  2KEK A;  3ZXS A;  1JFS A;  1BD8 A;  3G2V A;  2CHZ A;  5LX8 A;  4MRU A;  3NB2 A;  2D5V A;  2WM9 A;  2MRI A;  3JUI A;  3KEZ A;  3JXI A;  4ANW A;  2FO1 E;  3AAA C;  4IVZ A;  4UQZ A;  2MEZ A;  3DNV B;  2GRR B;  1Z5S C;  4GTR A;  4CDN A;  2F37 A;  2MXD A;  5J90 A;  4G11 A;  2WXQ A;  3JXB C;  3DSS A;  3FU6 A;  4I2W A;  2L8N A;  3WG7 E;  3ZIM A;  4H7Y A;  3EHQ A;  5EX3 A;  3FYM A;  4JL0 A;  3G7D A;  1OWP A;  2FF4 A;  3SNX A;  4N5C A;  3BQO A;  3C98 A;  2CSF A;  4ME2 A;  1SQ8 A;  4I1M A;  5BV0 A;  3LJN A;  3W9G A;  2X6H A;  2JVL A;  3Q75 A;  3CHP A;  4AM9 A;  4KBQ A;  1N4S A;  2CHW A;  3URZ A;  1BPO A;  4ER5 A;  2XHE A;  2ETC A;  3ABK E;  3CK8 A;  3CVU A;  3SFZ A;  5T8I A;  3QAQ A;  3FH5 A;  4KMO A;  2WXR A;  2P9S G;  5BXO A;  4V3I A;  3B7B A;  1QZX A;  2IOS A;  2XZD G;  3BD1 A;  2FEZ A;  3PE5 A;  3TG4 A;  4U0U A;  4L7T A;  4PU4 C;  2JEK A;  2VJ8 A;  1TNB A;  5CCL A;  1E3O C;  4HS2 A;  4R7L A;  4C0E A;  3OQN A;  2BNN A;  3UT4 A;  4C9B B;  1WM5 A;  5JMN D;  3EHN A;  2JCG A;  2KZT A;  3SHF A;  3B7T A;  4LRZ A;  1LD7 A;  4I43 A;  2AW6 A;  4MCX A;  2O49 A;  5ENT D;  2IUO A;  4UI9 C;  1OT8 A;  3BG0 B;  3HZI B;  5EID A;  2X6J A;  5G55 A;  3EU9 A;  3QWP A;  2LAH A;  1ZS4 A;  3FUF A;  4RVB A;  2WXL A;  2X6I A;  4AEZ C;  2Y1L E;  4X4I A;  1VDY A;  2KCV A;  4GTM A;  2ZGG A;  1JH9 A;  2L0T B;  1NEQ A;  1FT2 A;  3GUU A;  2J08 A;  4GTT A;  4JXT A;  2Y4T A;  4BSZ B;  3ASO E;  3RJV A;  1HG2 A;  4GYO A;  4YG7 B;  3MKQ A;  4EZJ A;  1AWC B;  3PZD A;  4E85 A;  2EIJ E;  4B8A A;  3IBE A;  3E32 A;  2AJA A;  4GHJ A;  3ZPJ A;  3CIA A;  3E30 A;  5ENO D;  3CST A;  4Q69 A;  5AQ7 A;  2J4B A;  4HXI A;  3OWQ A;  1H2V C;  4HB5 A;  4CGW A;  2WVI A;  1NA0 A;  3LIS A;  4I6U A;  1OWN A;  4HRA A;  4UQX A;  3TG5 A;  1BDI A;  3SBS A;  4GU5 A;  4ILH B;  3IEG A;  3S7J A;  4WWO A;  3ZPX A;  4GMR A;  4Z68 A;  4MLP A;  2LAI A;  3SCG A;  4YG4 A;  2OND A;  5FIO A;  3PDN A;  4GYY A;  4I1O B;  1NL4 A;  4TRQ A;  3FTW A;  2EIK E;  4PH4 B;  3GZD A;  2EBY A;  4GZ6 A;  4EZK A;  4RG9 A;  4A63 B;  4U0S A;  1K1B A;  2HIN A;  3LY8 A;  1SA4 A;  1EFA A;  3QJZ A;  1MX4 A;  3ZEF A;  4GA0 A;  3JQ0 A;  3U9W A;  3OXL A;  2A6C A;  5CEC B;  4YND A;  4GTS A;  2L49 A;  5HQ8 A;  5JUW A;  1IXV A;  2Q7F A;  3L9T A;  3C5R A;  5FIN A;  1DCQ A;  4HOQ A;  2R5S A;  3L22 A;  3PXP A;  5EYL A;  2RFM A;  3ZNG A;  3G2T A;  3LS8 A;  3ZYK A;  4LNU D;  1XGW A;  2L6J A;  4YDW A;  3FDH A;  2NXP A;  1JCR A;  2HFZ A;  4ER0 A;  1KT1 A;  1MX2 A;  3QK0 A;  1UOH A;  3OMT A;  3QAR A;  2IU7 A;  5CRV A;  4YG1 A;  3PNT B;  2YNQ A;  4EBA G;  5DTM A;  4K5C A;  1SA5 A;  1X57 A;  5LCW C;  3G0T A;  3PZ3 A;  1HZ4 A;  3KD7 A;  3FUE A;  4CDM A;  2PUB A;  4LSZ E;  4J1W A;  4ATZ D;  2P2C P;  2C2L A;  4GPK A;  4PU3 C;  2VTB B;  5G05 J;  3FWV A;  3NZS A;  3SR4 A;  1AP7 A;  1GT0 C;  4GQM A;  4F7A A;  2KXP C;  2RD0 A;  2X38 A;  5JJ6 A;  3IKO B;  3PRZ A;  2WPV A;  2WQH A;  3HVE A;  3UMV A;  4TXQ A;  3RSE G;  4O8B A;  2BKK B;  3IV0 A;  3FTS A;  4U8Y D;  4K5B A;  2L1P A;  1TJC A;  3OXG A;  3G2S A; 
#chains in the Genus database with same CATH homology
 1L1M A;  3S8Q A;  3EHM A;  3CHO A;  2BTD A;  3B7H A;  3FU3 A;  3B7S A;  2CFU A;  2R59 A;  5FTP A;  5FZQ A;  5T4Y A;  2YHE A;  4L1B A;  4AV7 A;  3FH8 A;  3ENE A;  3G5G A;  2KEI A;  3QF3 A;  2GZU A;  1QPZ A;  3LKU A;  4IRU A;  4K0R A;  5E75 A;  3UQ3 A;  4HFG A;  4KXK B;  1DWK A;  4APF A;  5CCM A;  4X4B A;  2J07 A;  3LXU X;  1S7E A;  5BUZ A;  3QQ6 A;  4JHJ A;  4KT6 B;  1RZR A;  1DNP A;  4J8F A;  4MS6 A;  4X4E A;  3EJN A;  4UWK A;  5KJL A;  4OYS A;  5AJD A;  4A1G A;  4I6G A;  1L5J A;  3HIZ A;  2LSU A;  4WNG A;  1E7V A;  4Z5H A;  4X4H A;  1UN9 A;  5ANR A;  3CHM A;  3PEV B;  5AIJ A;  3PUK A;  5FWQ A;  1UJJ A;  3HYM B;  4P29 A;  1QNF A;  3FTU A;  5LCW J;  4G23 A;  4JA9 A;  1E90 A;  4CCA A;  1QP4 A;  3APF A;  3NQP A;  4ANU A;  3Q47 B;  4C9B B;  1HF8 A;  3Q5M A;  4Z59 A;  2GGF A;  3CGH A;  2PIJ A;  3ASH A;  4BT8 A;  4BFR A;  3TXN A;  3CVV A;  1NP7 A;  2XGS A;  1RZR D;  2BUG A;  4APO A;  2CRO A;  1ZZ6 A;  2BNM A;  1ELW A;  2CFZ A;  2MHK A;  1LQC A;  4TUU A;  3K9I A;  4AVX A;  2WXF A;  3CEQ A;  1QQB A;  3U66 A;  4PU8 A;  1UG3 A;  4BX8 A;  4ANV A;  3QB2 A;  1LCD A;  2VSO E;  1Z6T A;  3TL5 A;  5JHB A;  4XKC A;  3D9O A;  3LYA A;  1ZPQ A;  2LYQ A;  2KC7 A;  4FLB A;  1TEZ A;  3D3M A;  2O4A A;  5J08 A;  4G24 A;  4GZD A;  4EBA A;  3WXX A;  4HVB A;  2VQ2 A;  2I1J A;  5FQ8 A;  5FQ7 A;  5C1D A;  4AY6 A;  2HYZ A;  2LYL A;  4RSY A;  4UWF A;  1EYH A;  4J1X A;  3HDX A;  2LSV A;  4G2V A;  5JHA A;  3FEX A;  1NER A;  3CR3 A;  4CT4 A;  2WB2 A;  3MV3 B;  4H7X A;  3Q15 A;  1U3D A;  4AIF A;  1ZUG A;  5BT1 A;  3KXA A;  2VTB A;  2WIU B;  3CRO L;  4GA2 A;  4IUL A;  1INZ A;  1UXD A;  2HM8 A;  2WXG A;  4ILI A;  3CVN A;  1XNF A;  3EUS A;  4I17 A;  4Q94 A;  1MHQ A;  5CMW A;  1E96 B;  5EKQ D;  4KZ0 A;  3FTX A;  3TJP A;  4YVO A;  1E8Y A;  3EIQ C;  3RRN B;  4AXH A;  1PC2 A;  2WXK A;  1HE8 A;  4IA8 A;  3VK0 A;  4N2S A;  4X4C A;  5FQ6 A;  2KCK A;  1UJK A;  3CLJ A;  3CKB A;  3FHE A;  3MEK A;  3R1F A;  2KZT B;  1OWM A;  3ZW3 A;  3IHV A;  3L1P A;  1OSL A;  3FY4 A;  2V8S E;  2R1J L;  4JQD A;  3R9A B;  2QY7 A;  2CG2 A;  2PZI A;  1HG5 A;  2WXH A;  4AJW A;  5A7L A;  3TAX A;  4JW1 A;  1ELK A;  1JUQ A;  3ESK A;  4GZC A;  3VLD A;  4PU7 A;  3JQ1 A;  4KVO A;  4GCO A;  1HO8 A;  2L0I A;  4J8E A;  3QWG A;  2A5U A;  2P58 C;  4FHJ A;  1W3B A;  3ZVV A;  4FA6 A;  5BNW A;  3FYA A;  3BS3 A;  4PUC A;  4PS8 A;  2XCB A;  3D9I A;  1UW4 B;  3Q49 B;  4M3O A;  3CLC A;  4GZ3 A;  2PPX A;  1R69 A;  1MQS A;  3F6W A;  3KJX A;  2KEK A;  4I2Z A;  2YHC A;  3ZXS A;  4XX5 A;  1JFS A;  2BNO A;  3G2V A;  2CHZ A;  2KPJ A;  5AJL A;  5CMY A;  4FN3 A;  2BJC A;  3FUJ A;  4MRU A;  2D5V A;  5E76 A;  2PE5 A;  2M63 A;  3SGH A;  3MKQ B;  3CVL A;  2WM9 A;  2MRI A;  3JUI A;  4EPZ A;  3QKY A;  4FBI A;  4N3A A;  3KEZ A;  1NA3 A;  4AOF A;  4Z5C A;  5FQ4 A;  4ANW A;  3T5X A;  3SZ7 A;  3FUN A;  3PH0 C;  4DI4 A;  2Y3A A;  1XWR A;  3LEW A;  4IVZ A;  4UQZ A;  2MEZ A;  2O38 A;  2WMN A;  3DNV B;  2DIW A;  3CSF A;  3RU0 A;  4PS7 A;  1RIO A;  2VGX B;  3GBF A;  4UWL A;  4CDN A;  4B8C B;  5J90 A;  1IC8 A;  3PS6 A;  4G11 A;  3VTX A;  2V4L A;  2KM4 A;  3JXB C;  2WXQ A;  4DJA A;  1OWL A;  2GW1 A;  3FUK A;  2LYR A;  4Z58 A;  3O48 A;  4G25 A;  2ICT A;  1JWL A;  4ACK A;  1DW9 A;  3FU6 A;  1ZZB A;  2L8N A;  4X4D A;  4FHK A;  4I2W A;  2FJR A;  5LFA A;  3APC A;  5ARG A;  3FFL A;  3ZIM A;  2PUC A;  1QQA A;  4H7Y A;  3RKV A;  3LFP A;  4K03 A;  3LVQ E;  4D10 C;  5EX3 A;  4N3B A;  3FYM A;  3CVP A;  5G2N A;  3HVE B;  4B0Z A;  2HR2 A;  4I9C A;  3KS2 A;  1H2T C;  3RO2 A;  5G04 C;  3FP3 A;  4JL0 A;  2PUD A;  4FJZ A;  4KYO B;  2XPZ A;  3FMY A;  2J09 A;  4U63 A;  1EPU A;  1ZZ8 A;  3G7D A;  1QQE A;  4CT0 A;  4BSX A;  4OVU A;  4BT9 A;  2GRL A;  1OWP A;  2CG3 A;  2FF4 A;  4JHK A;  3SNX A;  2PL2 A;  2XCJ A;  4N5C A;  3C98 A;  4CGV A;  2CSF A;  2IF4 A;  1UN8 A;  3ONK A;  3OTN A;  4ME2 A;  3F51 A;  3AS4 A;  1SQ8 A;  3MCX A;  1Y9Q A;  3PNL B;  3MA5 A;  4I1M A;  5EX0 A;  5BW8 C;  3RIB A;  5BV0 A;  1HFA A;  1H0A A;  2IJG X;  3B13 A;  3ML9 A;  5KJK A;  3VLE A;  1R63 A;  2BF0 X;  4JEH A;  5FJY A;  3IVP A;  2X6H A;  2IVG A;  2JVL A;  2I9C A;  2LYK A;  3MYV A;  3TGO A;  1Y7Y A;  5LP0 A;  2X6F A;  1HF0 A;  3MZL B;  3CHP A;  1UTX A;  3CHQ A;  2I1K A;  1CJG A;  4AM9 A;  2AXU A;  4KBQ A;  3VTY A;  2CHW A;  3PVL A;  3URZ A;  4FUL A;  4I6E A;  4FU3 A;  4GMJ A;  1PER L;  1BPO A;  2WXP A;  3UT8 A;  3D9N A;  2DBA A;  2XHE A;  3CK8 A;  3DBS A;  3CVU A;  2C0M A;  2FI7 A;  3PUJ A;  3UFD A;  3MLF A;  4Z5D A;  2AXZ A;  1PRA A;  4JCY A;  3SFZ A;  3KZ3 A;  3I4G A;  4FLH A;  2PM6 A;  5T8I A;  3QAQ A;  3I3N A;  4E6H A;  3FH5 A;  4ACL A;  3MKR A;  1YSE A;  3FH7 A;  4KMO A;  2UY1 B;  1OWO A;  3CKC A;  4YAR A;  2WXR A;  5LX8 A;  4EQF A;  3TXM A;  3KAE A;  3ULQ A;  4NRH B;  3MGB A;  4V3I A;  3OP9 A;  1LMB 3;  3RO3 A;  2ILR A;  3D9P A;  3S2A A;  3R7Q A;  3GW4 A;  3CVX A;  1ZZ9 A;  1E8Z A;  1WAO 1;  3CQC B;  4LCT A;  1PRV A;  2IOS A;  2EWT A;  4G26 A;  3ZRH A;  5CHE E;  3BD1 A;  2FEZ A;  3D1N I;  4CRW A;  2UWJ G;  4G1T A;  3MX3 A;  3OAW A;  1ZU2 A;  3SD5 A;  4QFV A;  4UWG A;  3TG4 A;  4U0U A;  3LVR E;  4L7T A;  4JZY A;  5ANL A;  4A3V A;  2XEV A;  4AP2 A;  4PU4 C;  2J4D A;  2JEK A;  4OVV A;  4URK A;  3CHR A;  2VJ8 A;  4XKB A;  5CCL A;  5AEN A;  1E3O C;  2XJ3 A;  1JWF A;  1UXC A;  3QC1 A;  1VPW A;  4XI0 A;  2X6K A;  4HS2 A;  2FUL A;  3ZYM A;  2XPI A;  4IN3 B;  4R7L A;  4C0E A;  3SF4 A;  3OQN A;  1EDU A;  4I8T A;  2BNN A;  2KAT A;  2VYI A;  1WY6 A;  1WM5 A;  3FUH A;  3OXF A;  4WNE A;  1LCC A;  3UT4 A;  5G05 C;  2IQC A;  3EHN A;  3FUM A;  2WXN A;  4CDR A;  2C0L A;  1HH8 A;  2XI8 A;  2JCG A;  2KZT A;  3SHF A;  3B7T A;  4XIF A;  2VSN A;  4LRZ A;  4NQ0 A;  5DBK A;  3RRU A;  1HU3 A;  4I43 A;  2XCC A;  1YA0 A;  3E4B A;  4N3C A;  5JJT A;  3U4T A;  2AW6 A;  2DCP A;  4MCX A;  5KJM A;  3CVY A;  5A23 A;  4YBA A;  3D9L A;  2O49 A;  4Y42 A;  2KCL A;  1B0N A;  3QWW A;  4NUR A;  2IUO A;  2JLB A;  1PRU A;  1ZAY A;  4UI9 C;  2FO7 A;  4J0U A;  3BDN A;  4A3T A;  1OUV A;  4MCT A;  1ZVV A;  3BG0 B;  3HZI B;  3BEE A;  4O6F A;  3ASD A;  3GZ1 A;  5BV1 A;  3CEC A;  2X6J A;  4GA1 A;  5G55 A;  2FBN A;  2V0P A;  3AU5 A;  4N39 A;  1QZ2 A;  3ASG A;  4J8D A;  3QWP A;  2ZU6 B;  4GML A;  2LAH A;  3UPV A;  4Q96 A;  1ZS4 A;  3GZS A;  3IHY A;  3CK7 A;  3AS8 A;  3ZN3 A;  4HLE A;  3FUF A;  3LY9 A;  4RVB A;  2WXL A;  3SI5 A;  1TJF A;  2LNI A;  1E7U A;  2X6I A;  4AEZ C;  3T5V A;  3D9K A;  4X4I A;  1VDY A;  3EDT B;  4HOU A;  1CQT A;  4F8D A;  1OCT C;  1SQM A;  2KCV A;  4WUY A;  3N71 A;  3CVQ A;  2LYS A;  2UY1 A;  3P1U A;  1Z3Y A;  1JH9 A;  2L0T B;  2PQN A;  1NEQ A;  5AYW D;  3QYX A;  3LJ3 A;  3OQO A;  3P2B A;  1EF1 C;  2J08 A;  3NZU A;  3T8M A;  4JXT A;  2Y4T A;  3SCH A;  3SCF A;  2AVP A;  3CQG B;  4L23 A;  3RJV A;  4U04 A;  4HOS A;  2E2E A;  2WMO A;  3ZYL A;  5KCM A;  4F3V A;  1HG2 A;  4BWR A;  4GYO A;  4GB9 A;  3GZ2 A;  4YG7 B;  4J8S A;  4WAF A;  3MKQ A;  3CVW A;  4EZJ A;  4GYW A;  4Y6C A;  3O4Z A;  3PZD A;  4E85 A;  3UX4 A;  4B8A A;  3OQM A;  3L13 A;  1Z3X A;  3JCK C;  3IBE A;  4XI9 A;  4CEM A;  4GHJ A;  4Y6W A;  3PEU B;  3ZPJ A;  2I6H A;  2WUS R;  2J49 A;  3CIA A;  3L17 A;  3O9X A;  4ILG A;  1HS6 A;  4U0Z A;  1IYG A;  3CST A;  4F1S A;  1ADR A;  4Q69 A;  5M72 A;  4X4G A;  4DPR A;  3CHS A;  4WWP A;  1ELR A;  4MKT A;  1Y8M A;  3PE3 A;  2H8R A;  3GN5 B;  2J4B A;  1E8X A;  4HXI A;  3CV0 A;  1H2V C;  3NF1 A;  3LDZ A;  3FU0 A;  4CGW A;  3B7U X;  2WVI A;  2QFC A;  1IQU A;  2HSG A;  1NA0 A;  1S0P A;  4IWR A;  1ZZC A;  4OB4 A;  4X4F A;  5A6C A;  1OWN A;  3LIS A;  4I6U A;  2PQR A;  2HO1 A;  1WH8 A;  2PUA A;  5FZR A;  2WQ7 A;  4PS3 A;  2ICP A;  3FUL A;  4UQX A;  1NZN A;  4IYP A;  3TG5 A;  1BDI A;  3SBS A;  1POU A;  1IQR A;  4GU5 A;  2Y4U A;  3FU5 A;  1FCH A;  2EQX A;  1JPL A;  2MOW A;  3IEG A;  4ILH B;  4WWO A;  3S7J A;  4ABN A;  3SBT B;  2OFY A;  2XQ0 A;  4MLP A;  2AXV A;  3ESL A;  2LAI A;  3S7F A;  4DI3 A;  2MQK A;  3SCG A;  2OVF A;  5G04 J;  3JXC L;  2RG8 A;  4BTA A;  4BTB A;  2VSY A;  1QP7 A;  1ZBP A;  3L54 A;  2WQ6 A;  4YG4 A;  4JCX A;  2OND A;  3ZKC A;  4LER A;  3PDN A;  4GYY A;  3QNK A;  2R17 C;  1HX8 A;  2J9Q A;  4I1O B;  4KVM A;  4UQY A;  2E0I A;  4TRQ A;  3L16 A;  4I1A A;  3FTW A;  4PH4 B;  4RG6 A;  2EBY A;  2LYJ A;  2IV1 A;  4EEC A;  1PNR A;  5DIZ A;  1JFT A;  4L2Y A;  4GZ6 A;  3ONL A;  3UUX A;  4EZK A;  5KJN A;  2VGY A;  4RG9 A;  1FVH A;  2I2O A;  4U0S A;  3CK9 A;  2HIN A;  1LLI A;  1SZA A;  3DPD A;  3LY8 A;  4UWH A;  2XRZ A;  1EFA A;  5ENN A;  2WXM A;  3QJZ A;  4DK5 A;  4N2Q A;  3RZZ A;  1X5B A;  3APD A;  1HXI A;  3ZEF A;  2NSZ A;  4KZC A;  3RRM B;  2R63 A;  4GZ5 A;  2KEJ A;  3I5P A;  4GA0 A;  3ZYQ A;  1KT0 A;  3JQ0 A;  4B94 A;  3GN5 A;  3U9W A;  2IVQ A;  2WXI A;  2A6C A;  3ASF A;  3OXL A;  4JC8 A;  4YND A;  2L49 A;  5HQ8 A;  3AS5 A;  3VLF A;  2Q7F A;  4JA7 A;  1IHG A;  1H6K A;  1PY1 A;  1AU7 A;  2LO6 A;  4HOQ A;  4XE0 A;  2XGM A;  4WNF A;  3GYZ A;  3JYS A;  3L08 A;  3R7R A;  1FVF A;  2VSX E;  2R5S A;  1N54 A;  3LPZ A;  4B89 A;  5T3R A;  3ZHE A;  2ION A;  3L22 A;  4JHR A;  3PXP A;  3F52 A;  2A4Z A;  4LEU A;  5D0O D;  5JJ7 A;  5LOZ A;  4W9R A;  4ANX A;  4HOT A;  3L6A A;  3H5T A;  2IOL A;  3AU4 A;  3B7R L;  3G2T A;  3D9J A;  3LS8 A;  3ZYK A;  4UI9 K;  4U07 A;  1XGW A;  2L6J A;  4C0M A;  4BX9 A;  3FDH A;  1JWG A;  1Y6I A;  2YIN A;  3HHM A;  1RZS A;  1GW6 A;  2XRY A;  4GCN A;  4WND A;  4WWN A;  2NC9 A;  2NXP A;  2KZ8 A;  3I4R B;  4I9E A;  4BY6 A;  2PUG A;  1KT1 A;  3MJW A;  3PRE A;  2YQ8 A;  1A17 A;  3QK0 A;  1X2L A;  4DLO A;  2CHX A;  5A7D B;  3OMT A;  5EDS A;  1WIZ A;  1KLX A;  2OR1 L;  2OVB A;  4LUN U;  3QAR A;  4F53 A;  2IU7 A;  1B89 A;  1H2U A;  4YG1 A;  3U3W A;  2YNQ A;  3PNT B;  2GRM A;  3Q4A B;  4FC8 A;  4JVS A;  3S7B A;  4A55 A;  4EBA G;  4EZL A;  1LF8 A;  1X57 A;  3FUI A;  5LCW C;  4ATG A;  4YVQ C;  2VGX A;  3S7D A;  3FTV A;  1RPE L;  2V5F A;  2XSD C;  1SZ9 A;  4UI9 J;  1WET A;  4JEU A;  4TV3 A;  3ZHI A;  5ARF A;  4A1S A;  1HZ4 A;  3ZHM A;  5FZS A;  3RK6 A;  3KD7 A;  2XIU A;  3FUE A;  2OV8 A;  2PUB A;  3UT7 A;  4CDM A;  3U64 A;  2PM7 A;  3JXD L;  3LY7 A;  3G2W A;  1H19 A;  1ZZ7 A;  3ML8 A;  3G2U A;  4HOR A;  4J1W A;  2WXJ A;  4JPS A;  2PUE A;  2AWI A;  1WH6 A;  1PAQ A;  2C2L A;  3TRB A;  3EIJ A;  3FTZ A;  2XPY A;  1DVP A;  2AUW A;  2IVB A;  3BG1 B;  4PU3 C;  1BDH A;  4NAC A;  4I6R A;  5G05 J;  2VTB B;  3ZGQ A;  4GPK A;  2IU1 A;  3FWV A;  3NZS A;  3PE4 A;  4NDW A;  4PDX A;  2L9B A;  1GT0 C;  3FEY A;  5BPP A;  1U3C A;  4GQM A;  1P5Q A;  3QDN A;  4F7A A;  4FP7 A;  1QP0 A;  1E8W A;  2RD0 A;  2X38 A;  5FT9 A;  2IFU A;  3ZFW A;  5JJ6 A;  3FTY A;  3IKO B;  2B5A A;  4AY5 A;  3PRZ A;  4I6T A;  5K98 B;  3ZHE B;  2WPV A;  5HI7 A;  3D9M A;  2WQH A;  2XGO A;  2OOE A;  3HVE A;  4FJY A;  2PUF A;  3FUD A;  3UMV A;  4U8H A;  3QOU A;  3QWV A;  4GAA A;  2X3M A;  1O4X A;  4DLQ A;  4O8B A;  4XZ4 A;  2WXO A;  5D0Q D;  1N52 A;  3FTS A;  3IV0 A;  4FAD A;  4L2L A;  4I6J A;  2LYP A;  1TJC A;  3OXG A;  3MV2 B;  3LCA A;  2EF8 A;  2LCV A;  4J6I A;  3G2S A;  5C2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...