3U3WA

Crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
280
structure length
280
Chain Sequence
AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator PlcR protein
publication title Structural basis for the activation mechanism of the PlcR virulence regulator by the quorum-sensing signal peptide PapR.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transcription activator/dna
total genus 120
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3u3wA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u3wA02
2E2EA 1Y9QA 3ZHIA 1A17A 3UPVA 4NDWA 3MLFA 1KT1A 4N3BA 3SZ7A 3WXXA 2HINA 3ZHMA 2ONDA 3QWPA 3SCGA 2LCVA 4Z5CA 3RO3A 4APOA 1NEQA 4J8FA 3QKYA 4F8DA 2VQ2A 1RZRD 2JCGA 3SCHA 5FZSA 1ELWA 5CHEE 3CVPA 3LKUA 1LCCA 3KS2A 1ZZBA 4GYYA 1QQBA 2C0LA 1R69A 2ICPA 4IVZA 4I8TA 1WM5A 5JJ7A 2OR1L 3ZPJA 3ASDA 4LEUA 4J1WA 1ZZCA 2LYPA 3URZA 1SQ8A 2A6CA 2OOEA 2PQRA 1B0NA 2WIUB 3BD1A 3BS3A 4N2QA 2ICTA 5G05J 4GA2A 5FTPA 2PUGA 1LLIA 1S7EA 4N39A 2O4AA 2KCKA 3ULQA 1BDIA 3CK8A 4FBIA 3QDNA 4GZ5A 2Y4UA 4UI9K 3Q47B 2AXZA 4J8EA 1XNFA 3QOUA 1PNRA 2LYLA 2NC9A 2C0MA 4AM9A 3QYXA 2KPJA 2FO7A 3Q4AB 5G04C 4GZ3A 4Z59A 4BT8A 5LCWC 1PERL 4I2ZA 2EWTA 3VTYA 1ZBPA 4G25A 1JFSA 1QPZA 3Q5MA 3UQ3A 1ZZ7A 1OSLA 4HOTA 4GA0A 2L6JA 3OMTA 1NERA 1ADRA 3N71A 4KBQA 2H8RA 2JVLA 3FWVA 2AW6A 2VGXB 4UI9J 3ZHEB 4O8BA 4X4GA 1CJGA 1HH8A 4X4IA 2XGSA 4BTAA 3QWGA 4H7YA 2YHCA 3GN5A 4I6RA 1WH6A 4I1AA 4WNDA 1QP7A 2CSFA 3CEQA 2IU7A 3S8QA 2PL2A 5A6CA 3CROL 4FN3A 3OQNA 3ESKA 2Q7FA 1HZ4A 4WUYA 2AVPA 3NF1A 3FYAA 4G2VA 2IVBA 4WNEA 5D0OD 1AU7A 2VSYA 2IUOA 3OXLA 3PE4A 4AY5A 2J9QA 2BUGA 2KEKA 3KD7A 3MV3B 3CKBA 1PC2A 3DNVB 1NA0A 2MHKA 2C2LA 2UY1B 4Z5DA 2LSUA 4HOQA 1DWKA 5A7LA 4W9RA 3MEKA 3F6WA 2AXVA 2KZ8A 1OCTC 3SCFA 2P58C 2WPVA 2B5AA 1WETA 3L1PA 4U0SA 4XIFA 2YQ8A 4BT9A 3TG5A 4Y6WA 4GHJA 2WUSR 4PU7A 2IV1A 3FYMA 3GYZA 5DBKA 2LSVA 4GA1A 3UFDA 2AXUA 4PU8A 1ZAYA 1BDHA 4JCXA 4J8DA 5EX0A 4KYOB 1WIZA 3KAEA 1KT0A 2FBNA 3B7HA 1RZSA 3ZFWA 2XCCA 4HOSA 5G04J 4X4HA 3QQ6A 4JA7A 5LCWJ 1XWRA 3RO2A 1Y7YA 1RPEL 2BNOA 2IVGA 1E3OC 2XGMA 3GZ1A 5D0QD 2HYZA 4HOUA 4BWRA 3ZKCA 5ARGA 3G5GA 5JJ6A 3LCAA 1YSEA 1ZZ9A 3OQMA 3UUXA 4G23A 3CVNA 1QZ2A 1LMB3 2PIJA 3QWVA 3CECA 5DIZA 4I6UA 2BJCA 3LYAA 2PPXA 3E4BA 3EUSA 3SF4A 5C1DA 2O49A 1PRAA 1B89A 3G7DA 2PUFA 2EF8A 1L1MA 2WQHA 2LYQA 3IVPA 4J1XA 2FEZA 5AYWD 1X2LA 1HXIA 4CGWA 1R63A 2IFUA 4GCNA 3O48A 2LYKA 4Y42A 3S7FA 4N2SA 4O6FA 2D5VA 3Q49B 4I9EA 3EDTB 1DW9A 1EFAA 3D1NI 4Z58A 4XI9A 4JHRA 5FJYA 1JWLA 2PUDA 4NQ0A 4ABNA 4Z5HA 3GN5B 2R63A 3CK7A 4JQDA 4MCXA 2PUEA 3RJVA 4PU4C 2DBAA 3RU0A 3JYSA 3ASHA 1ELRA 5ARFA 2KC7A 3PXPA 1P5QA 1PRUA 2IF4A 2LYSA 5KJMA 1LQCA 3CV0A 1IYGA 1ZPQA 3RZZA 4XI0A 3ZHEA 2KEJA 4UQXA 3GZ2A 4AIFA 3OP9A 2R5SA 4IN3B 3K9IA 2V5FA 2MQKA 2EBYA 1LCDA 4CDRA 3R1FA 2LYJA 4U04A 4U07A 2XSDC 3KZ3A 3MA5A 2I6HA 5M72A 4X4BA 4RG9A 4I6TA 4GQMA 2PZIA 1UXCA 4N3CA 1NA3A 4UQZA 1JH9A 1KLXA 4UI9C 3JXCL 2XGOA 4J0UA 1JFTA 4AY6A 4B94A 2BNMA 3U3WA 3AS8A 4G1TA 2MEZA 3BEEA 3MV2B 2HO1A 3FP3A 2GRLA 5HQ8A 2CROA 1ZUGA 3LPZA 3CVQA 3HZIB 4YG7B 4G24A 3OXGA 5EKQD 2KCVA 3TAXA 4YARA 2AUWA 2UY1A 4GPKA 1UXDA 1W3BA 4JCYA 3Q15A 4X4CA 1Y8MA 4ME2A 3CLCA 5KJNA 3JXBC 3GW4A 4HORA 2KATA 5EX3A 4G26A 3ASGA 3LY9A 2PQNA 2HR2A 4GYWA 1QP0A 2XI8A 1RIOA 5JJTA 3S7DA 2XPIA 4OB4A 1ZZ8A 3JXDL 3VK0A 4NRHB 2AWIA 2XCJA 3TRBA 2VGYA 4H7XA 3RKVA 5FT9A 2HSGA 3CK9A 3F52A 4F3VA 3H5TA 4CGVA 4RG6A 5CCLA 2VSNA 1FCHA 3RIBA 1WH8A 2GZUA 3FMYA 3PDNA 2KEIA 3GBFA 1PRVA 3TG4A 4X4FA 3FFLA 5KJLA 3TGOA 4MCTA 4GYOA 3R9AB 2PUCA 3ZGQA 3CKCA 2PUBA 2UWJG 2XJ3A 4YNDA 4YVQC 4EQFA 1WAO1 5KJKA 1YA0A 2O38A 2LNIA 3LFPA 4I9CA 5CCMA 3AS5A 5A7DB 4X4DA 3QWWA 1QQEA 3LISA 1E96B 2GRMA 1NZNA 3ZN3A 1VPWA 4N3AA 1TJCA 2L49A 2XEVA 4UQYA 5G05C 2R1JL 1OUVA 3IEGA 2FI7A 3VTXA 5HI7A 2Y4TA 2JLBA 2VYIA 1QP4A 3U4TA 2L8NA 3LY7A 1POUA 2LYRA 2OFYA 5K98B 2PUAA 4N5CA 4A1SA 1ZS4A 4YVOA 2KCLA 4I2WA 2XCBA 1GT0C 3S7JA 4KXKB 3KJXA 3PE3A 3O9XA 1QQAA 4YBAA 4U0UA 3ASFA 4U0ZA 3AS4A 2VGXA 2IVQA 4GZ6A 1ZVVA 3BDNA 3CVLA 4GCOA 3KXAA 4IA8A 4WNFA 2FJRA 3F51A 1HF0A 1CQTA 5FZRA 4JL0A 2FF4A 5BT1A 5BW8C 1X57A 4YG4A 1ZU2A 4YG1A 2GW1A 3MKRA 1UTXA 2PE5A 5FZQA 5BNWA 3S7BA 4BTBA 3OXFA 4WNGA 4JA9A 1RZRA 3LY8A 4PU3C 1ZZ6A 3HYMB 3OQOA 1O4XA 4I17A 4Y6CA 2XIUA 4X4EA 2QFCA 2BNNA 4IWRA 1IC8A 1IHGA 3QF3A
chains in the Genus database with same CATH superfamily
1VDYA 2E2EA 1K3ZD 1A17A 3JQ0A 2WXJA 3PZ2A 4N3BA 3SZ7A 1HS6A 2ONDA 1MJ0A 3RO3A 3NOGD 4DI4A 3PUKA 3J5QB 3D9PA 5LP0A 2VQ2A 1V55E 1U3CA 3TEPA 5AIJA 1S63A 2Y3AA 4O60A 3CVPA 2LLWA 4APFA 1LCCA 1NW3A 1ZZBA 3M9LA 4I8TA 2X6HA 4LEUA 4J1WA 2KXPC 1ZZCA 3URZA 1IQRA 3FUMA 4L23A 2X38A 1HG5A 3R7QA 4N2QA 3APCA 1PY1A 2DIWA 2J49A 5CERB 3ULQA 1BDIA 1JCSA 2LLVA 5EYLA 4JZYA 2AXZA 4MBGA 3QOUA 2C0MA 5ITZF 3QYXA 2KPJA 5AJDA 3E32A 5G04C 5EIDA 4JHKA 1PERL 2P9SG 1JFSA 3UIPC 3D9HA 3UQ3A 4UWGA 1OSLA 4ER7A 3BU8A 3VLEA 4KT6B 2L6JA 1N0RA 4ILGA 2JEKA 1ADRA 4KBQA 3W9GA 2OCCE 3D9MA 3SY2A 1AWCB 2WVIA 1HH8A 3FTSA 1D8DA 2X6FA 2GGFA 4I1AA 1QP7A 2WXIA 4ANVA 2ODRD 5AARA 3CEQA 3Q9UC 3JUEA 3UXGA 1HZ4A 1GW6A 4WUYA 2IVBA 4I43A 5D0OD 4JXTA 1KZOA 2I9CA 2OEWA 2J9QA 2BUGA 3C98A 1OWOA 4NACA 3CKBA 1QYMA 2GRNB 2C2LA 1E8XA 5ENOD 2IJGX 3F6WA 2XENA 2KZ8A 2RKKA 3G2SA 1OCTC 2CFZA 3B7BA 3EHRA 1N94A 1WETA 4PH4B 3L1PA 2YQ8A 2KM4A 5ANRA 5LX8A 2NSZA 3TJPA 4F7AA 3GYZA 4GA1A 2AXUA 4PU8A 3V2OA 4O1OA 4J8DA 1JCRA 3UINC 4KYOB 1WIZA 2H6IA 4RSYA 4OAUC 2FBNA 5JHBA 3V30A 3B7HA 4LCTA 4U96D 4FC8A 4KMOA 3AJIA 1XWRA 3RO2A 3U66A 2L0IA 3HXCA 3FU5A 2IVGA 1E3OC 2XGMA 3GZ1A 3ZKCA 5JJ6A 5H7PA 1YSEA 3OQMA 5CBOA 1QZ2A 4HXIA 2IO2C 2X6IA 2PIJA 1E8YA 4OBMA 5JMND 2VSXE 4BERA 2BJCA 5FIOA 3SD5A 1LTXA 3V31A 3QK0A 3ZPXA 3UM2A 2O49A 1HX8A 5HRYA 1B89A 3CHRA 4ILIA 4BX9A 3APDA 3IVPA 1OXJA 2FEZA 1MYOA 4LNBA 4G8LA 1HXIA 4HS2A 1R63A 2J09A 4ER0A 4Y42A 4N2SA 3B7RL 2YBDA 4O6FA 2D5VA 3EDTB 3ML9A 2WXGA 4XI9A 5FJYA 1JWLA 2XQ0A 2PUDA 4NQ0A 1S70B 5CMYA 2R63A 4AVXA 5FQ4A 4JQDA 4PU4C 4CCAA 4U7EB 2DVWA 3ASHA 4BSZB 4GTRA 5KCMA 3PXPA 3Q7AA 3T5XA 4UQXA 3CR3A 4IULA 2MQKA 2WXHA 4UWHA 4DE8A 3FTXA 2P9PG 3D9OA 3UM1A 3TXNA 5DTMA 2PZIA 1UXCA 5BXOA 3D9KA 4UQZA 2R59A 1JH9A 4UI9C 4DUIA 1KPSB 2I1KA 3DRAA 3DEPA 2BNMA 5A23A 2ZIRA 2HO1A 3ABME 2E0IA 3TWTA 2CROA 3IKOB 4L7TA 3QOXA 4J8YA 3LVQE 3OXGA 5EKQD 1Z6TA 3TAXA 3CLJA 2ETAA 4JPSA 5BV1A 4HLLA 4LUNU 5EILA 4X4CA 4A1GA 3JXBC 2RFAA 4G26A 3LY9A 4GYWA 4I6JA 4JHJA 4OB4A 3TWUA 2HFZA 4GTTA 3EIJA 3VK0A 4NRHB 3TRBA 3C3RA 1ELKA 5FT9A 4RQIA 2VSNA 3FU3A 3SFZA 3RIBA 2WXMA 4R7LA 4B8CB 1LD7A 3PDNA 2MXDA 1FPPA 4UWKA 3FFLA 3TGOA 3R9AB 3SI5A 3ZGQA 4K03A 2MYOA 2PUBA 5J90A 1JUQA 4GZCA 4EQFA 4ANXA 1H19A 2J07A 3QFIA 1TJFA 2J08A 1E8ZA 3LFPA 3MKQA 3AS5A 4X4DA 5LOZA 3QWWA 1N9AA 3LISA 1TN8A 2IONA 3BG1B 4QQIA 5FINA 4EECA 4UQYA 5CRVA 4C9BB 2XEEA 3PZ4A 3SR4A 3HVEA 1EF1C 2V4HC 2Y4TA 4ER3A 2ZXWE 1OWMA 1POUA 3SHFA 3BUAA 4I2WA 3S7JA 4ANUA 2HM8A 2H6FA 2WM9A 1N4RA 3D9JA 4KVOA 4BSXA 3O9XA 5HS0A 3PZDA 2HCNA 3LQXA 1OCZE 4DX7D 3ZXSA 4HQDA 3OWQA 4WNFA 4EPZA 3MKRA 5BV0A 3PNLB 1UTXA 2XEHA 4XEIG 3CHPA 4YDYA 4EHMA 3TWVA 1ZZ6A 2XPYA 1OCCE 3X2QE 3ZYMA 3GZCA 4Y6CA 1V54E 5EYPF 4X4EA 4L1BA 2QFCA 1IC8A 4LRZA 1IHGA 4PUCA 3ZHIA 4FU3A 4NDWA 3MLFA 1KT1A 3WXXA 2AJAA 1Q2ZA 1WY6A 2DZOA 4J8FA 3PS6A 4F8DA 1RZRD 1YMPA 5T8IA 3LDZA 5FZSA 5CECB 1ELWA 5CHEE 5DRTA 1LD8A 2PXBA 3LKUA 3L13A 1UJKA 3KS2A 1O1RA 3FTVA 4GYYA 2C0LA 3ABKE 2OR1L 3ZPJA 3DSVA 2LYPA 4ZHBA 4U63A 2A6CA 1N11A 3HDXA 4UWFA 1QB2A 3CVVA 2F8YA 2P2CP 5G05J 5CEAA 2WXRA 3CVUA 4GA2A 4GTMA 1TYQG 1QNFA 1LLIA 1S7EA 2KCKA 2NYJA 3ZXPA 4LSZE 4FBIA 3IHYA 3DXKG 2ZU6B 2L6BA 2Y4UA 3Q47B 1XNFA 4FJYA 4G8KA 4B8AA 2HCSA 2NC9A 3OKZA 1HU3A 3SX0A 3D9IA 1UW4B 5JHAA 5IY5E 2FO7A 1QZXA 4GTQA 4BT8A 5LCWC 4WWNA 3VTYA 4HLEA 1ZBPA 4G25A 4IYPA 3NXHA 1MFQC 3Q5MA 2XHEA 3ZNGA 3JCKC 2XZTG 1ZZ7A 3CHQA 4JEUA 4U8HA 4BETA 4HOTA 4K5BA 4CRWA 4HNAD 5JA4D 1NERA 3UKRG 1BPOA 2H8RA 2AW6A 2VGXB 4TXPA 3ZHEB 4GMLA 4BFRA 4HI9A 4H7YA 1N4SA 3GN5A 4QFVA 3S8QA 3DSTA 5A6CA 3CROL 4FP7A 1IKND 4MLPA 2XRYA 3EHNA 4EKIA 1NP7A 2AVPA 3FYAA 4G2VA 3I5PA 4URKA 2VSYA 2DYSE 2A5EA 4I6GA 3OXLA 3AG3E 4AY5A 3B13A 2KEKA 2Y1LE 3L22A 5BPPA 2V3CC 3R09A 1EPUA 3HXEA 2WXKA 4WWOA 3FUFA 2CG3A 3MGBA 4HOQA 4W9RA 5ENRD 4LNGA 1MZCA 2V5QC 2I1JA 3UKUG 2B5AA 4XIFA 3ASNE 4HRAA 2KBXA 3TG5A 1N95A 4RVBA 2FULA 5CRUA 4P29A 4GHJA 2WUSR 4PU7A 3DXMG 2R02A 3WG7E 3TFLA 5AQAA 4CEMA 4CDMA 3T5VA 1RZSA 3ZFWA 1EYHA 5G04J 2LAIA 3EHQA 4JA7A 3T9KA 2WMOA 5DSXA 5D0QD 2LO6A 4HOUA 4BWRA 5KNHD 3RRUA 3UUXA 3HIZA 3DBSA 1LMB3 3B7TA 4M3OA 4C48B 2CFUA 3Q79A 2P9IG 3QJZA 1K8KG 2IEJA 3LYAA 4ER6A 3E4BA 3UTMA 3EUSA 3SF4A 1H2TC 2OV8A 2IOSA 2P9KG 2R05A 2PUFA 4ACKA 2F0YA 2EF8A 4TRQA 2R17C 4J1XA 1X2LA 1OWPA 4OVUA 4FHKA 4KVMA 2WXLA 3QB2A 2LYKA 4YDEA 4BX8A 4PS8A 3PVLA 3Q49B 1DW9A 1EFAA 1MX2A 4Z58A 4A55A 4JHRA 1HO8A 1TNYA 1K1AA 4TXQA 1JPLA 3C5RA 2PUEA 4BY6A 3R9MA 3MCXA 4DK5A 3VWSA 3JYSA 2RD0A 1PRUA 2IF4A 3T8KA 2GRRB 2LUHA 3AG2E 3KL4A 5B3SE 3RZZA 2VTBA 2KEJA 3GZ2A 4AIFA 3OP9A 2R5SA 4HI8A 4IN3B 2L9BA 1LCDA 2X6JA 4CDRA 4U04A 4U07A 2PXFA 1L5JA 1MQSA 3MA5A 4AXHA 5M72A 4RG9A 4I6TA 2LNMA 3SO8A 4EZJA 1O1SA 2Y69E 4N3CA 3HXBA 4GB9A 1N4PA 3JXCL 3FTYA 4J0UA 2YHEA 4B94A 3MV2B 2WMNA 5HQ8A 3ZIMA 3FTWA 3CIAA 3CVQA 3PEUB 1NI1A 4GTPA 2KCVA 3ZRHA 1UXDA 1TNBA 3DSWA 4G11A 5KJNA 3GW4A 4HORA 2CHWA 2HR2A 4L2LA 4PS3A 1TEZA 2YNQA 3S7DA 4DE9A 3FTUA 1ZZ8A 3JXDL 3PUJA 2ZISA 3PZ1A 3PRZA 4F3VA 4CGVA 4GMJA 5CCLA 3FDHA 2EIJE 1WH8A 2GZUA 3QAQA 1Y6IA 3TG4A 3ZYLA 2PXVA 2PUCA 3JUIA 5KBAA 3AG4E 4IRUA 2VSOE 4YVQC 5KJKA 1H6PA 3J5PA 3GZDA 3C3OA 2O38A 4I1OB 2LNIA 3RK6A 1QQEA 1H0AA 2FFHA 2OVFA 4N3AA 1IQUA 2R2LA 2R1JL 4LG6A 1OUVA 1OWLA 2FI7A 1UG3A 2JLBA 1N54A 3IBEA 2A4ZA 1E7VA 2LYRA 2OFYA 5K98B 1RW2A 1ZS4A 3AG1E 4YVOA 1GT0C 3ENEA 4FLHA 3PE3A 3CHSA 1QQAA 4YBAA 3CGHA 4NURA 3AS4A 4EZKA 1DVPA 2IVQA 2DYRE 1TNZA 1NL4A 3CVLA 3KXAA 3FEYA 3F51A 1U3DA 1HF0A 5FZRA 3A9YA 4JL0A 2FF4A 5BT1A 4YG4A 1ZU2A 2NXPA 5FZQA 4L9PA 5FWQA 4DLOA 3OXFA 1BI7B 4YDOA 5CBNA 3FUNA 1O4XA 4CT4A 2BNNA 3SBTB 4JC8A 4IWRA 1LF8A 1Y9QA 4F1SA 3UPVA 4WWPA 2PXTA 3DM5A 3EU9A 3ZHMA 4HBDA 3QWPA 3NBNB 3CSTA 2LCVA 4Z5CA 1NEQA 3QKYA 4DPRA 3ZEFA 3I3NA 3RRMB 2JCGA 4MKTA 3B7SA 1G3NB 1Z3YA 2EIKE 1BU9A 4D10C 5AN8A 3TL5A 1DNPA 1QQBA 4IVZA 2ICPA 4HRLA 4GPMA 1SQ8A 3G2VA 2OOEA 4ILHB 2QYJA 2WIUB 4EZLA 3B7UX 3BD1A 4U8VD 1RZ4A 5FTPA 2PUGA 5ENPD 4N39A 2O4AA 5AAOA 3FUHA 2PXEA 4FHJA 2IU1A 3TELA 3NZSA 3QDNA 4GZ5A 1DCEA 1UOHA 3IHVA 4XZ4A 3ZYQA 4J8EA 3D9NA 1OCOE 1PNRA 5GAGi 2LYLA 3D9LA 5ENNA 3ASOE 4ZFHA 5E75A 1JWFA 4AM9A 2ETCA 3HVEB 3Q4AB 3E33A 4GZ3A 3R7RA 1N4QA 1X81A 2EWTA 2WXOA 2WXPA 1QPZA 1DCQA 3KSLA 5FQ8A 2F8XK 3PREA 4GA0A 3MEJA 3KSQA 3N71A 2WQ7A 3HXFA 3IXEA 1CJGA 3NOCD 5DT2A 4X4IA 2PXUA 2XGSA 3LXUX 3QWGA 2YHCA 2GROB 4I6RA 1OWNA 4WNDA 4GTSA 2IU7A 3CQCB 4DI3A 2Q7FA 3NF1A 2ETBA 4K0RA 1AU7A 5CMWA 2IUOA 3PE4A 3BG0B 3TXMA 2IO3C 2UY1B 4A3VA 4Z5DA 2LSUA 2BKKB 2GRPB 3ML8A 3SCFA 3EUVA 2P58C 2WPVA 4U0SA 4JEHA 4BT9A 4Q94A 2IV1A 5DBKA 2LSVA 3UFDA 1ZAYA 1BDHA 4JCXA 4FJZA 3AU5A 3KAEA 4FADA 2DCPA 2XCCA 4X4HA 5AQBA 5LCWJ 4GU5A 5D2MC 3TWQA 2BNOA 1HG2A 3LCAA 3KEAA 3ZVVA 3NDBB 5AENA 4G23A 3U9WA 3QWVA 4I6UA 3SFXA 1Z3XA 4FLBA 2PPXA 1SQMA 5C1DA 1MHQA 3G2UA 3G7DA 3UM0A 1L1MA 2WQHA 2IFUA 1U2VG 3O48A 1KZPA 3HXDA 3S7FA 4DX2A 2BF0X 4EBAA 2PXDA 4I9EA 3FH7A 3D1NI 4K5AB 3G2WA 4DJAA 4ABNA 3GN5B 2X3MA 3TWSA 3GUUA 3CK7A 3PZ3A 3ZYKA 2KZTA 4HRMB 3RJVA 3E34A 4OAVB 1IHBA 2Y0BG 3NROA 1SVXA 3RU0A 2FO1E 1ELRA 3EIQC 4F1PA 1FVFA 4K5CA 4E6HA 3LJNA 2JABA 2V4LA 3ULEG 3ZHEA 4FA6A 3ESLA 3UMVA 3K9IA 2V5FA 2EBYA 2QZAA 2LYJA 2L0TB 2XSDC 3GZDC 3KZ3A 3FUKA 3L17A 5AJLA 2I6HA 4X4BA 5HKPA 3GZSA 4GQMA 4DX6D 1INZA 3TWWA 3RAUA 1BI8B 1NA3A 1OCRE 3CQGB 3DSUA 3DSSA 3FUJA 5T4YA 5EDSA 1YYHA 3AS8A 4G1TA 3TWRA 2MEZA 3FP3A 2GRLA 4AV7A 1ZUGA 3LPZA 3W9FA 4X8QA 1DULA 3HZIB 4YG7B 4CZ2D 2IQCA 1W3BA 1E90A 3Q73A 4B89A 2XS8A 1E7UA 2EQXA 5EN5D 2A5UA 2PQNA 4JW1A 1QP0A 3EU5A 2XI8A 3PE5A 4O1PA 5JJTA 4ATZD 2P9UG 3NZLA 5FQ7A 2VGYA 4UUCA 3L6AA 3RKVA 3LJ3A 1H6KA 3IV0A 3UM3A 4RG6A 3FUDA 1FCHA 3GBFA 3Q78A 2QYUA 4X4FA 1TNOA 5AQ7A 4GYOA 4HB5A 3CKCA 4EZIA 2XJ3A 3ZU7B 1SW6A 3FU6A 3Q7FA 4U8YD 1YA0A 2XPZA 1H2VC 3L82A 2P9NG 4I9CA 5CCMA 2OVBA 2WXNA 5A7DB 3CVXA 3RSEG 1HE8A 1E96B 2GRMA 3ZN3A 1FT2A 2PXQA 1VPWA 2DZNA 1TJCA 2XEVA 1N52A 3UIOC 3IEGA 2PM6A 3FY4A 5D66A 4HFGA 3ZUVB 5BXUA 3CHOA 2VYIA 4ANWA 1QP4A 1BD8A 1QBQA 3U4TA 2L8NA 3DEOA 3PH0C 3Q9NC 1SA5A 4A1SA 1UN8A 2XCBA 1FT1A 4KXKB 3KJXA 3JQ1A 2VTBB 4EQZA 1IXVA 4GZ6A 4L2YA 1SA4A 4J7WA 3BQOA 4I1MA 5EIBE 3AU4A 5DTQA 3L16A 4IA8A 4I6EA 2HE0A 3FEXA 1X57A 2GW1A 4ATGA 3EJNA 3S7BA 1MX4A 4WNGA 4JA9A 3LY8A 3OQOA 4C0MA 3QNKA 5E76A 4I17A 2XIUA 1WDYA 2VJ8A 4M7CA 3DSXA 3P1UA 1SZAA 4MS6A 2P9LG 2HINA 3B95A 5DTRA 3MZLB 4MRUA 2ZGGA 3FUEA 4XKCA 3SCGA 5B1BE 2J4DA 4BEPA 2XS1A 4APOA 2ILRA 2OEVA 5AQ9A 5G2NA 4NIKA 3SCHA 4TXRA 3LVRE 1H6OA 3MX3A 4XKBA 1R69A 5JJ7A 1WM5A 4TUMA 3ASDA 4DRXE 4KZCA 2PQRA 1B0NA 5C2YA 3BS3A 2ICTA 3CHMA 3FULA 3FHEA 4HVBA 3TWXA 3CK8A 3AAAC 4J6IA 4Q69A 1MX6A 4UI9K 1TNUA 1TR4A 3APFA 3CVWA 2XXQA 3T8MA 2WB2A 4C0EA 4B93B 4EK9A 3MYVA 4Z59A 3OAWA 4EBAG 3ONLA 4I2ZA 4DLQA 1EDUA 3ONKA 4ER5A 2EINE 3OMTA 1UJJA 3ME5A 1YCSB 2JVLA 3FWVA 4UI9J 1D8EA 4O8BA 3LEWA 4X4GA 4BTAA 1HFAA 1WH6A 4JD2G 1ZB1A 2CSFA 2XXAA 3NB2A 3QC1A 4Z68A 2WQ6A 2PL2A 2IY0C 4FN3A 2RG8A 3OQNA 3ESKA 3NAWA 4WNEA 2IOLA 2CHZA 4ACLA 4GAAA 1N0QA 4LERA 3KEZA 3KD7A 2H6GA 3MV3B 4DX1A 4GTOA 3S2AA 4F53A 1PC2A 3DNVB 1NA0A 2MHKA 4Q2JA 2JQEA 3V79K 1DWKA 5A7LA 2EILE 1K1BA 3MEKA 3ZW3A 2LAHA 2B6CA 2AXVA 2VGEA 3C72A 1SZ9A 3SBSA 4UWLA 4Y6WA 4HRNA 3I4GA 3FYMA 4A63B 5EX0A 3JXIA 4OVVA 5KWDA 1KT0A 2R03A 2H6HA 3JXJA 4HOSA 3QQ6A 2XRZA 2L1PA 1PAQA 1Y7YA 1RPEL 3FH8A 2HYZA 5ARGA 3G2TA 3G5GA 3A9ZA 1X5BA 2QY7A 1ZZ9A 2I2OA 4GZDA 3MKQB 3CVNA 1TN6A 2WXQA 4BESA 2RFMA 3LS8A 3FTZA 3CECA 5DIZA 5ENSD 5B1AE 4Q96A 3E37A 3CVYA 3ISMC 1PRAA 4XX5A 3SGHA 1OT8A 2LYQA 5AYWD 1S64A 4CGWA 4GCNA 4JVSA 3FH5A 4TUUA 3L54A 3RRNB 1OY3D 2V8SE 3UI2A 3P2BA 2BKGA 3Q75A 3SNXA 4PDXA 3DPDA 4CT0A 1D9SA 4Z5HA 3NZUA 3G0TA 3V2XA 2M63A 4MCXA 5T3RA 3ABLE 3L08A 4EKGA 1WG0A 2J8SD 2DBAA 5ARFA 4V3IA 2KC7A 5LFAA 1P5QA 3ULYA 2LYSA 2CG2A 5KJMA 1LQCA 3CV0A 1IYGA 1ZPQA 4PS7A 4XI0A 4CYMD 2J4BA 4JB8P 1H2UA 2MRIA 2PXKA 3DWLG 4F6RD 1A5EA 3R1FA 2DWZA 3SFYA 3HHMA 3UWPA 4J8SA 3SQVA 5ENQD 3F6QA 5J08A 1KLXA 5ENTD 4AP2A 2XGOA 4AY6A 1JFTA 5ANLA 3U3WA 3BEEA 2X6KA 3HG0D 4G24A 2WXFA 4XE0A 3OTNA 4YARA 1XGWA 2AUWA 2UY1A 4GPKA 5FQ6A 2B0OE 4JCYA 3Q15A 1Y8MA 4ME2A 3CLCA 5G55A 2KATA 5EX3A 3ASGA 3I4RB 1UN9A 2V0PA 1RIOA 3QARA 4TV3A 2PXLA 2BEDA 2XPIA 2AWIA 2XCJA 3L9TA 4H7XA 2QC9A 4GMRA 2HSGA 3CK9A 3NQPA 2ZGDA 3PEVB 3F52A 4AOFA 3H5TA 4KZ0A 1NFIE 3D3MA 4LNUD 3FMYA 3VLDA 2KEIA 1AP7A 4E85A 1PRVA 5KJLA 5GAHi 2XXPA 4MCTA 3FUIA 4FULA 4RLYA 1FVHA 5BUZA 2VEOA 3QOWA 2UWJG 4YNDA 4AEZC 1WAO1 3A9XA 4B0ZA 1S0PA 4CDNA 2F37A 4U95D 4AJWA 4OYSA 4N5QA 3FU0A 4WVLA 3VLFA 2BTDA 4WAFA 5CEDB 1E8WA 1NZNA 2PXPA 1JWGA 2L49A 2LXLA 3ZKJA 5G05C 2J7UA 3EHMA 4YDWA 2KZTB 3VTXA 5HI7A 3UX4A 3UT4A 2PM7A 3LY7A 2YINA 4N5CA 2PUAA 3O4ZA 2KCLA 1O5MA 2GRQB 3DPYA 1HF8A 3CSFA 2M4HA 1U2ZA 3MJWA 4U0UA 3ASFA 3PNTB 4U0ZA 2MOWA 1BLXB 2VGXA 1ZVVA 2CHXA 2XZDG 3BDNA 4GTVA 1O1TA 4GCOA 3U64A 2FJRA 1CQTA 3HRAA 5BW8C 4YG1A 4DX5D 2PE5A 1HQ1A 3C3QA 5BNWA 1JCQA 4BTBA 3E30A 5KNGA 3UT8A 5JUWA 1RZRA 2J7WA 4PU3C 3HYMB 1DC2A 2LXMA 1Z5SC 2PNNA 1TN7A 4A3TA 3UT7A 5DRYA 3QF3A 2EIME
chains in the Genus database with same CATH topology
4PUCA 1LF8A 1VDYA 1SZAA 2E2EA 1Y9QA 3ZHIA 1A17A 3JQ0A 4FU3A 4F1SA 4NDWA 2WXJA 4MS6A 4WWPA 3MLFA 3UPVA 1KT1A 4N3BA 3SZ7A 3WXXA 2HINA 3MZLB 3ZHMA 1HS6A 4MRUA 2ONDA 3FUEA 3QWPA 4XKCA 3SCGA 3CSTA 5D0QD 2J4DA 2LCVA 4Z5CA 3RO3A 4APOA 2ILRA 1NEQA 1WY6A 4DI4A 3PUKA 4J8FA 3QKYA 3D9PA 3ZEFA 4DPRA 3PS6A 5LP0A 4F8DA 2VQ2A 3I3NA 1U3CA 3RRMB 1RZRD 5G2NA 2JCGA 5T8IA 3SCHA 3LDZA 5AIJA 3LVRE 4MKTA 5FZSA 2Y3AA 3B7SA 3MX3A 1ELWA 4XKBA 5CCLA 1Z3YA 5CHEE 3CVPA 4APFA 3LKUA 3L13A 1LCCA 1UJKA 3KS2A 4D10C 3TL5A 1ZZBA 3FTVA 1DNPA 4GYYA 1QQBA 2C0LA 1R69A 2ICPA 4IVZA 4I8TA 1WM5A 2X6HA 5JJ7A 2OR1L 3ZPJA 3ASDA 4LEUA 4J1WA 1ZZCA 2LYPA 3URZA 1SQ8A 3G2VA 1IQRA 4U63A 2A6CA 2OOEA 3FUMA 4ILHB 4KZCA 4L23A 3HDXA 2X38A 2PQRA 1HG5A 1B0NA 5C2YA 2WIUB 4UWFA 3R7QA 4EZLA 3B7UX 3BD1A 3BS3A 3CVVA 2ICTA 4N2QA 3APCA 1PY1A 5G05J 3CHMA 3FULA 2WXRA 3CVUA 4GA2A 3FHEA 5FTPA 1QNFA 2PUGA 1LLIA 2DIWA 1S7EA 4HVBA 4N39A 2J49A 2O4AA 2KCKA 3FUHA 3ULQA 1BDIA 3CK8A 2IU1A 4FBIA 3IHYA 4FHJA 4J6IA 4Q69A 3NZSA 2ZU6B 3QDNA 4GZ5A 4LRZA 3IHVA 2Y4UA 4UI9K 4XZ4A 3Q47B 3ZYQA 4JZYA 2AXZA 4J8EA 3APFA 3D9NA 1XNFA 3QOUA 4FJYA 4B8AA 1PNRA 3CVWA 2LYLA 2NC9A 3D9LA 5ENNA 2C0MA 1HU3A 3T8MA 3D9IA 2WB2A 5E75A 1UW4B 1JWFA 4C0EA 5JHAA 4AM9A 3QYXA 2KPJA 2FO7A 3HVEB 3Q4AB 5AJDA 5G04C 3MYVA 4GZ3A 4Z59A 3OAWA 4JHKA 1PERL 4WWNA 3ONLA 4I2ZA 3R7RA 4BT8A 4DLQA 2EWTA 3VTYA 4EBAG 2WXOA 4HLEA 1ZBPA 4G25A 1JFSA 4IYPA 2WXPA 1QPZA 1EDUA 2XHEA 3ONKA 3Q5MA 3JCKC 4UWGA 1ZZ7A 3UQ3A 5FQ8A 1OSLA 3CHQA 4JEUA 4U8HA 3VLEA 4HOTA 4CRWA 3PREA 4GA0A 4KT6B 2L6JA 3OMTA 1NERA 2JEKA 4ILGA 1ADRA 1UJJA 3N71A 2WQ7A 4KBQA 1BPOA 2H8RA 2JVLA 3FWVA 2AW6A 2VGXB 4UI9J 4A3TA 3ZHEB 4O8BA 3LEWA 4X4GA 4GMLA 4BFRA 1CJGA 3D9MA 2WVIA 1HH8A 4X4IA 3FTSA 2XGSA 4BTAA 1HFAA 3LXUX 3QWGA 4H7YA 2YHCA 3GN5A 4I6RA 1WH6A 2X6FA 2GGFA 1OWNA 4I1AA 4WNDA 1QP7A 2CSFA 2WXIA 4QFVA 4ANVA 3CEQA 3QC1A 2IU7A 3CQCB 4DI3A 2WQ6A 3S8QA 2PL2A 5A6CA 3CROL 4FN3A 2RG8A 4FP7A 4MLPA 2XRYA 3EHNA 3OQNA 3ESKA 2Q7FA 1HZ4A 1GW6A 4WUYA 1NP7A 2AVPA 3NF1A 3FYAA 4G2VA 2IVBA 4WNEA 2IOLA 3I5PA 2CHZA 4I43A 4URKA 5D0OD 4ACLA 4K0RA 1AU7A 2VSYA 4GAAA 4JXTA 2IUOA 5CMWA 2I9CA 4I6GA 3OXLA 4LERA 3KEZA 3PE4A 3B13A 2J9QA 2BUGA 2KEKA 3KD7A 3C98A 3L22A 3MV3B 4AY5A 5BPPA 1OWOA 4NACA 3BG0B 3CKBA 3S2AA 4F53A 1PC2A 3TXMA 1EPUA 3DNVB 2WXKA 1NA0A 4WWOA 2MHKA 2C2LA 2UY1B 1E8XA 5LCWC 4A3VA 4Z5DA 3FUFA 2LSUA 2CG3A 3MGBA 3ML8A 4HOQA 1DWKA 5A7LA 4W9RA 3MEKA 3ZW3A 2IJGX 2LAHA 3F6WA 2AXVA 2KZ8A 3G2SA 2I1JA 1OCTC 2CFZA 3SCFA 2P58C 2WPVA 2B5AA 1WETA 4PH4B 3L1PA 4U0SA 1SZ9A 2YQ8A 2KM4A 4JEHA 4XIFA 5ANRA 3SBSA 4BT9A 5LX8A 2NSZA 4UWLA 3TG5A 4RVBA 4Y6WA 2FULA 4Q94A 4P29A 4GHJA 2WUSR 4PU7A 3TJPA 2IV1A 4F7AA 3I4GA 3FYMA 3GYZA 5DBKA 2LSVA 4GA1A 3UFDA 2AXUA 4PU8A 1ZAYA 1BDHA 4JCXA 4CEMA 4CDMA 4J8DA 4FJZA 5EX0A 4KYOB 4OVVA 1WIZA 3T5VA 3AU5A 4RSYA 3KAEA 4FADA 1KT0A 2FBNA 5JHBA 3B7HA 2DCPA 4LCTA 1RZSA 3ZFWA 1EYHA 2XCCA 4HOSA 5G04J 4X4HA 2LAIA 3QQ6A 4FC8A 4KMOA 2XRZA 4JA7A 5LCWJ 1XWRA 4GU5A 2WMOA 3RO2A 3U66A 2L0IA 3FU5A 1PAQA 1Y7YA 1RPEL 2BNOA 2IVGA 1E3OC 2XGMA 3FH8A 3GZ1A 2HYZA 2LO6A 4HOUA 4BWRA 3ZKCA 5ARGA 3G2TA 3G5GA 5JJ6A 1X5BA 3RRUA 1HG2A 2QY7A 3LCAA 3ZVVA 1YSEA 1ZZ9A 2I2OA 3OQMA 3HIZA 3MKQB 4GZDA 3UUXA 5AENA 4G23A 3U9WA 3CVNA 3DBSA 1QZ2A 1LMB3 4HXIA 3B7TA 4M3OA 2X6IA 2PIJA 1E8YA 2WXQA 2CFUA 3QWVA 4AY6A 4DJAA 3LS8A 2VSXE 3FTZA 3QJZA 3CECA 5DIZA 4I6UA 4Q96A 2BJCA 1Z3XA 3LYAA 2PPXA 3E4BA 1SQMA 4FLBA 3SD5A 3QK0A 3EUSA 3CVYA 3SF4A 5C1DA 1MHQA 1H2TC 2O49A 2OV8A 1PRAA 1HX8A 2IOSA 3G2UA 1B89A 4XX5A 3G7DA 2PUFA 4ACKA 3SGHA 3CHRA 4ILIA 4BX9A 2EF8A 3APDA 4TRQA 1L1MA 2R17C 2WQHA 2LYQA 3IVPA 4J1XA 2FEZA 5AYWD 1X2LA 1OWPA 4HS2A 1HXIA 4OVUA 1R63A 4CGWA 2IFUA 4GCNA 4FHKA 3O48A 4JVSA 4KVMA 2J09A 2WXLA 3FH5A 3QB2A 4TUUA 2LYKA 4Y42A 3S7FA 4N2SA 2BF0X 3B7RL 4EBAA 4BX8A 4PS8A 4O6FA 3L54A 3PVLA 3RRNB 2D5VA 3Q49B 4I9EA 3FH7A 3EDTB 2V8SE 3ML9A 3P2BA 1DW9A 1EFAA 3D1NI 2WXGA 4Z58A 3G2WA 4JHRA 4XI9A 1JWLA 5FJYA 1HO8A 2PUDA 2XQ0A 3DPDA 4NQ0A 4PDXA 3SNXA 4CT0A 4ABNA 4Z5HA 3GN5B 2X3MA 3NZUA 5CMYA 2R63A 1JPLA 4AVXA 3CK7A 5FQ4A 4JQDA 3ZYKA 2M63A 4MCXA 2PUEA 2KZTA 5T3RA 3RJVA 4PU4C 4BY6A 3L08A 3MCXA 4DK5A 2DBAA 4CCAA 3RU0A 3JYSA 3ASHA 1ELRA 5ARFA 4V3IA 5KCMA 3EIQC 2RD0A 2KC7A 3PXPA 5LFAA 1P5QA 1PRUA 1FVFA 2IF4A 2LYSA 2CG2A 4E6HA 5KJMA 1LQCA 3CV0A 3T5XA 2V4LA 1IYGA 1ZPQA 4PS7A 3RZZA 4XI0A 2VTBA 3ZHEA 2KEJA 4UQXA 3GZ2A 4AIFA 3OP9A 4FA6A 2J4BA 3CR3A 2R5SA 3ESLA 4IULA 1H2UA 3K9IA 4IN3B 2MRIA 2V5FA 3UMVA 2MQKA 2WXHA 2EBYA 4UWHA 2L9BA 1LCDA 3FTXA 2X6JA 4CDRA 3R1FA 2LYJA 4U04A 4U07A 1L5JA 2L0TB 2XSDC 3D9OA 1MQSA 3KZ3A 3FUKA 3HHMA 4J8SA 3MA5A 3L17A 4AXHA 5AJLA 2I6HA 5M72A 4X4BA 3GZSA 4RG9A 4I6TA 3TXNA 4GQMA 2PZIA 1INZA 4EZJA 1UXCA 4N3CA 5J08A 1NA3A 3D9KA 4UQZA 4GB9A 2R59A 1JH9A 1KLXA 4UI9C 3JXCL 3CQGB 2I1KA 4AP2A 3FTYA 3FUJA 2XGOA 4J0UA 1JFTA 5ANLA 2YHEA 5T4YA 4B94A 2BNMA 3U3WA 5EDSA 3AS8A 4G1TA 5A23A 2MEZA 3BEEA 2X6KA 3MV2B 2HO1A 2E0IA 2WMNA 2GRLA 3FP3A 5HQ8A 2CROA 4AV7A 3ZIMA 1ZUGA 3LPZA 3IKOB 4L7TA 3FTWA 3CIAA 3CVQA 3HZIB 4YG7B 3LVQE 3PEUB 4G24A 2WXFA 3OXGA 1Z6TA 2IQCA 2KCVA 3OTNA 4XE0A 3CLJA 4YARA 1XGWA 2AUWA 4JPSA 3TAXA 2UY1A 3ZRHA 5BV1A 1UXDA 4GPKA 4LUNU 5FQ6A 1W3BA 4JCYA 3Q15A 4G11A 4X4CA 1E90A 1Y8MA 3CLCA 4ME2A 4A1GA 3JXBC 5KJNA 3GW4A 5G55A 4B89A 4HORA 2CHWA 1E7UA 2EQXA 2KATA 5EX3A 4G26A 3ASGA 2A5UA 3I4RB 3LY9A 2PQNA 2HR2A 4GYWA 4I6JA 4JW1A 1QP0A 2XI8A 4L2LA 1UN9A 4JHJA 2V0PA 1RIOA 3QARA 4PS3A 4TV3A 1TEZA 2YNQA 3S7DA 5JJTA 2XPIA 4OB4A 3FTUA 1ZZ8A 3JXDL 3PUJA 5FQ7A 3EIJA 3VK0A 4NRHB 2AWIA 2XCJA 3TRBA 2VGYA 3PRZA 3L6AA 4H7XA 1ELKA 5FT9A 2HSGA 3CK9A 3LJ3A 3RKVA 3NQPA 1H6KA 3PEVB 3F52A 3IV0A 4AOFA 3H5TA 4KZ0A 4GMJA 4F3VA 4CGVA 4RG6A 3D3MA 2VSNA 3FU3A 3FUDA 5EKQD 1FCHA 3RIBA 3SFZA 2WXMA 3FDHA 1WH8A 2GZUA 4R7LA 3FMYA 4B8CB 3QAQA 3PDNA 3VLDA 2KEIA 3GBFA 4E85A 1PRVA 1Y6IA 4UWKA 4X4FA 3TG4A 3FFLA 3ZYLA 5KJLA 3TGOA 4MCTA 3FUIA 4FULA 4GYOA 3R9AB 3SI5A 2PUCA 3JUIA 3ZGQA 3CKCA 1FVHA 5BUZA 4K03A 4IRUA 2PUBA 2UWJG 2XJ3A 2VSOE 1JUQA 5J90A 4YNDA 4GZCA 4YVQC 4AEZC 4EQFA 4ANXA 1WAO1 1H19A 3FU6A 5KJKA 4B0ZA 1S0PA 4CDNA 1YA0A 2XPZA 2J07A 1TJFA 2J08A 2O38A 4I1OB 1E8ZA 1H2VC 2LNIA 3LFPA 4I9CA 3RK6A 5CCMA 4AJWA 4OYSA 3FU0A 2OVBA 2WXNA 3AS5A 3MKQA 5A7DB 3VLFA 4X4DA 2BTDA 3QWWA 5LOZA 1QQEA 3CVXA 1HE8A 3LISA 4WAFA 1E8WA 1E96B 2GRMA 1NZNA 1H0AA 2IONA 3BG1B 3ZN3A 2OVFA 1JWGA 1VPWA 4N3AA 1TJCA 2L49A 2XEVA 1IQUA 4UQYA 1N52A 4EECA 5G05C 4C9BB 2R1JL 1OUVA 3IEGA 1OWLA 3HVEA 1EF1C 2PM6A 2FI7A 3EHMA 3FY4A 1UG3A 2KZTB 3VTXA 4HFGA 2Y4TA 5HI7A 3UX4A 3UT4A 2JLBA 1N54A 2PM7A 2VYIA 3CHOA 1QP4A 3IBEA 3U4TA 2A4ZA 4ANWA 2L8NA 1E7VA 3LY7A 1OWMA 1POUA 2LYRA 2OFYA 5K98B 2PUAA 2YINA 3PH0C 4N5CA 4A1SA 3O4ZA 1UN8A 1ZS4A 3SHFA 4YVOA 2KCLA 4I2WA 2XCBA 1GT0C 3S7JA 4ANUA 2HM8A 2WM9A 3ENEA 1HF8A 3CSFA 3D9JA 4KXKB 4FLHA 3KJXA 4KVOA 3PE3A 4BSXA 3O9XA 3CHSA 1QQAA 3JQ1A 4YBAA 3MJWA 3PZDA 4U0UA 3ASFA 3PNTB 4U0ZA 2VTBB 2MOWA 3CGHA 4NURA 3AS4A 4EZKA 1DVPA 2VGXA 2IVQA 4GZ6A 1ZVVA 2CHXA 4L2YA 3BDNA 3ZXSA 4I1MA 4A55A 3AU4A 3CVLA 4GCOA 3U64A 3KXAA 3L16A 3FEYA 4IA8A 4I6EA 2FJRA 3F51A 1HF0A 1CQTA 1U3DA 3FEXA 4WNFA 5FZRA 4EPZA 4JL0A 2FF4A 5BT1A 5BW8C 1X57A 4YG4A 1ZU2A 4YG1A 2GW1A 2NXPA 3MKRA 3PNLB 1UTXA 4ATGA 5BV0A 2PE5A 5FZQA 5BNWA 3EJNA 3CHPA 5FWQA 3S7BA 4BTBA 3OXFA 4DLOA 3UT8A 4WNGA 4JA9A 1RZRA 3LY8A 4PU3C 1ZZ6A 3FUNA 3HYMB 2XPYA 3OQOA 1O4XA 4C0MA 3ZYMA 3QNKA 5E76A 4I17A 4Y6CA 4CT4A 2XIUA 4X4EA 4L1BA 2QFCA 2BNNA 3SBTB 4JC8A 4IWRA 1IC8A 2VJ8A 1IHGA 3UT7A 3QF3A 3P1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2E A;  1Y9Q A;  3ZHI A;  1A17 A;  3UPV A;  4NDW A;  3MLF A;  1KT1 A;  4N3B A;  3SZ7 A;  3WXX A;  2HIN A;  3ZHM A;  2OND A;  3QWP A;  3SCG A;  2LCV A;  4Z5C A;  3RO3 A;  4APO A;  1NEQ A;  4J8F A;  3QKY A;  4F8D A;  2VQ2 A;  1RZR D;  2JCG A;  3SCH A;  5FZS A;  1ELW A;  5CHE E;  3CVP A;  3LKU A;  1LCC A;  3KS2 A;  1ZZB A;  4GYY A;  1QQB A;  2C0L A;  1R69 A;  2ICP A;  4IVZ A;  4I8T A;  1WM5 A;  5JJ7 A;  2OR1 L;  3ZPJ A;  3ASD A;  4LEU A;  4J1W A;  1ZZC A;  2LYP A;  3URZ A;  1SQ8 A;  2A6C A;  2OOE A;  2PQR A;  1B0N A;  2WIU B;  3BD1 A;  3BS3 A;  4N2Q A;  2ICT A;  5G05 J;  4GA2 A;  5FTP A;  2PUG A;  1LLI A;  1S7E A;  4N39 A;  2O4A A;  2KCK A;  3ULQ A;  1BDI A;  3CK8 A;  4FBI A;  3QDN A;  4GZ5 A;  2Y4U A;  4UI9 K;  3Q47 B;  2AXZ A;  4J8E A;  1XNF A;  3QOU A;  1PNR A;  2LYL A;  2NC9 A;  2C0M A;  4AM9 A;  3QYX A;  2KPJ A;  2FO7 A;  3Q4A B;  5G04 C;  4GZ3 A;  4Z59 A;  4BT8 A;  5LCW C;  1PER L;  4I2Z A;  2EWT A;  3VTY A;  1ZBP A;  4G25 A;  1JFS A;  1QPZ A;  3Q5M A;  3UQ3 A;  1ZZ7 A;  1OSL A;  4HOT A;  4GA0 A;  2L6J A;  3OMT A;  1NER A;  1ADR A;  3N71 A;  4KBQ A;  2H8R A;  2JVL A;  3FWV A;  2AW6 A;  2VGX B;  4UI9 J;  3ZHE B;  4O8B A;  4X4G A;  1CJG A;  1HH8 A;  4X4I A;  2XGS A;  4BTA A;  3QWG A;  4H7Y A;  2YHC A;  3GN5 A;  4I6R A;  1WH6 A;  4I1A A;  4WND A;  1QP7 A;  2CSF A;  3CEQ A;  2IU7 A;  3S8Q A;  2PL2 A;  5A6C A;  3CRO L;  4FN3 A;  3OQN A;  3ESK A;  2Q7F A;  1HZ4 A;  4WUY A;  2AVP A;  3NF1 A;  3FYA A;  4G2V A;  2IVB A;  4WNE A;  5D0O D;  1AU7 A;  2VSY A;  2IUO A;  3OXL A;  3PE4 A;  4AY5 A;  2J9Q A;  2BUG A;  2KEK A;  3KD7 A;  3MV3 B;  3CKB A;  1PC2 A;  3DNV B;  1NA0 A;  2MHK A;  2C2L A;  2UY1 B;  4Z5D A;  2LSU A;  4HOQ A;  1DWK A;  5A7L A;  4W9R A;  3MEK A;  3F6W A;  2AXV A;  2KZ8 A;  1OCT C;  3SCF A;  2P58 C;  2WPV A;  2B5A A;  1WET A;  3L1P A;  4U0S A;  4XIF A;  2YQ8 A;  4BT9 A;  3TG5 A;  4Y6W A;  4GHJ A;  2WUS R;  4PU7 A;  2IV1 A;  3FYM A;  3GYZ A;  5DBK A;  2LSV A;  4GA1 A;  3UFD A;  2AXU A;  4PU8 A;  1ZAY A;  1BDH A;  4JCX A;  4J8D A;  5EX0 A;  4KYO B;  1WIZ A;  3KAE A;  1KT0 A;  2FBN A;  3B7H A;  1RZS A;  3ZFW A;  2XCC A;  4HOS A;  5G04 J;  4X4H A;  3QQ6 A;  4JA7 A;  5LCW J;  1XWR A;  3RO2 A;  1Y7Y A;  1RPE L;  2BNO A;  2IVG A;  1E3O C;  2XGM A;  3GZ1 A;  5D0Q D;  2HYZ A;  4HOU A;  4BWR A;  3ZKC A;  5ARG A;  3G5G A;  5JJ6 A;  3LCA A;  1YSE A;  1ZZ9 A;  3OQM A;  3UUX A;  4G23 A;  3CVN A;  1QZ2 A;  1LMB 3;  2PIJ A;  3QWV A;  3CEC A;  5DIZ A;  4I6U A;  2BJC A;  3LYA A;  2PPX A;  3E4B A;  3EUS A;  3SF4 A;  5C1D A;  2O49 A;  1PRA A;  1B89 A;  3G7D A;  2PUF A;  2EF8 A;  1L1M A;  2WQH A;  2LYQ A;  3IVP A;  4J1X A;  2FEZ A;  5AYW D;  1X2L A;  1HXI A;  4CGW A;  1R63 A;  2IFU A;  4GCN A;  3O48 A;  2LYK A;  4Y42 A;  3S7F A;  4N2S A;  4O6F A;  2D5V A;  3Q49 B;  4I9E A;  3EDT B;  1DW9 A;  1EFA A;  3D1N I;  4Z58 A;  4XI9 A;  4JHR A;  5FJY A;  1JWL A;  2PUD A;  4NQ0 A;  4ABN A;  4Z5H A;  3GN5 B;  2R63 A;  3CK7 A;  4JQD A;  4MCX A;  2PUE A;  3RJV A;  4PU4 C;  2DBA A;  3RU0 A;  3JYS A;  3ASH A;  1ELR A;  5ARF A;  2KC7 A;  3PXP A;  1P5Q A;  1PRU A;  2IF4 A;  2LYS A;  5KJM A;  1LQC A;  3CV0 A;  1IYG A;  1ZPQ A;  3RZZ A;  4XI0 A;  3ZHE A;  2KEJ A;  4UQX A;  3GZ2 A;  4AIF A;  3OP9 A;  2R5S A;  4IN3 B;  3K9I A;  2V5F A;  2MQK A;  2EBY A;  1LCD A;  4CDR A;  3R1F A;  2LYJ A;  4U04 A;  4U07 A;  2XSD C;  3KZ3 A;  3MA5 A;  2I6H A;  5M72 A;  4X4B A;  4RG9 A;  4I6T A;  4GQM A;  2PZI A;  1UXC A;  4N3C A;  1NA3 A;  4UQZ A;  1JH9 A;  1KLX A;  4UI9 C;  3JXC L;  2XGO A;  4J0U A;  1JFT A;  4AY6 A;  4B94 A;  2BNM A;  3U3W A;  3AS8 A;  4G1T A;  2MEZ A;  3BEE A;  3MV2 B;  2HO1 A;  3FP3 A;  2GRL A;  5HQ8 A;  2CRO A;  1ZUG A;  3LPZ A;  3CVQ A;  3HZI B;  4YG7 B;  4G24 A;  3OXG A;  5EKQ D;  2KCV A;  3TAX A;  4YAR A;  2AUW A;  2UY1 A;  4GPK A;  1UXD A;  1W3B A;  4JCY A;  3Q15 A;  4X4C A;  1Y8M A;  4ME2 A;  3CLC A;  5KJN A;  3JXB C;  3GW4 A;  4HOR A;  2KAT A;  5EX3 A;  4G26 A;  3ASG A;  3LY9 A;  2PQN A;  2HR2 A;  4GYW A;  1QP0 A;  2XI8 A;  1RIO A;  5JJT A;  3S7D A;  2XPI A;  4OB4 A;  1ZZ8 A;  3JXD L;  3VK0 A;  4NRH B;  2AWI A;  2XCJ A;  3TRB A;  2VGY A;  4H7X A;  3RKV A;  5FT9 A;  2HSG A;  3CK9 A;  3F52 A;  4F3V A;  3H5T A;  4CGV A;  4RG6 A;  5CCL A;  2VSN A;  1FCH A;  3RIB A;  1WH8 A;  2GZU A;  3FMY A;  3PDN A;  2KEI A;  3GBF A;  1PRV A;  3TG4 A;  4X4F A;  3FFL A;  5KJL A;  3TGO A;  4MCT A;  4GYO A;  3R9A B;  2PUC A;  3ZGQ A;  3CKC A;  2PUB A;  2UWJ G;  2XJ3 A;  4YND A;  4YVQ C;  4EQF A;  1WAO 1;  5KJK A;  1YA0 A;  2O38 A;  2LNI A;  3LFP A;  4I9C A;  5CCM A;  3AS5 A;  5A7D B;  4X4D A;  3QWW A;  1QQE A;  3LIS A;  1E96 B;  2GRM A;  1NZN A;  3ZN3 A;  1VPW A;  4N3A A;  1TJC A;  2L49 A;  2XEV A;  4UQY A;  5G05 C;  2R1J L;  1OUV A;  3IEG A;  2FI7 A;  3VTX A;  5HI7 A;  2Y4T A;  2JLB A;  2VYI A;  1QP4 A;  3U4T A;  2L8N A;  3LY7 A;  1POU A;  2LYR A;  2OFY A;  5K98 B;  2PUA A;  4N5C A;  4A1S A;  1ZS4 A;  4YVO A;  2KCL A;  4I2W A;  2XCB A;  1GT0 C;  3S7J A;  4KXK B;  3KJX A;  3PE3 A;  3O9X A;  1QQA A;  4YBA A;  4U0U A;  3ASF A;  4U0Z A;  3AS4 A;  2VGX A;  2IVQ A;  4GZ6 A;  1ZVV A;  3BDN A;  3CVL A;  4GCO A;  3KXA A;  4IA8 A;  4WNF A;  2FJR A;  3F51 A;  1HF0 A;  1CQT A;  5FZR A;  4JL0 A;  2FF4 A;  5BT1 A;  5BW8 C;  1X57 A;  4YG4 A;  1ZU2 A;  4YG1 A;  2GW1 A;  3MKR A;  1UTX A;  2PE5 A;  5FZQ A;  5BNW A;  3S7B A;  4BTB A;  3OXF A;  4WNG A;  4JA9 A;  1RZR A;  3LY8 A;  4PU3 C;  1ZZ6 A;  3HYM B;  3OQO A;  1O4X A;  4I17 A;  4Y6C A;  2XIU A;  4X4E A;  2QFC A;  2BNN A;  4IWR A;  1IC8 A;  1IHG A;  3QF3 A; 
#chains in the Genus database with same CATH topology
 1VDY A;  2E2E A;  1K3Z D;  1A17 A;  3JQ0 A;  2WXJ A;  3PZ2 A;  4N3B A;  3SZ7 A;  1HS6 A;  2OND A;  1MJ0 A;  3RO3 A;  3NOG D;  4DI4 A;  3PUK A;  3J5Q B;  3D9P A;  5LP0 A;  2VQ2 A;  1V55 E;  1U3C A;  3TEP A;  5AIJ A;  1S63 A;  2Y3A A;  4O60 A;  3CVP A;  2LLW A;  4APF A;  1LCC A;  1NW3 A;  1ZZB A;  3M9L A;  4I8T A;  2X6H A;  4LEU A;  4J1W A;  2KXP C;  1ZZC A;  3URZ A;  1IQR A;  3FUM A;  4L23 A;  2X38 A;  1HG5 A;  3R7Q A;  4N2Q A;  3APC A;  1PY1 A;  2DIW A;  2J49 A;  5CER B;  3ULQ A;  1BDI A;  1JCS A;  2LLV A;  5EYL A;  4JZY A;  2AXZ A;  4MBG A;  3QOU A;  2C0M A;  5ITZ F;  3QYX A;  2KPJ A;  5AJD A;  3E32 A;  5G04 C;  5EID A;  4JHK A;  1PER L;  2P9S G;  1JFS A;  3UIP C;  3D9H A;  3UQ3 A;  4UWG A;  1OSL A;  4ER7 A;  3BU8 A;  3VLE A;  4KT6 B;  2L6J A;  1N0R A;  4ILG A;  2JEK A;  1ADR A;  4KBQ A;  3W9G A;  2OCC E;  3D9M A;  3SY2 A;  1AWC B;  2WVI A;  1HH8 A;  3FTS A;  1D8D A;  2X6F A;  2GGF A;  4I1A A;  1QP7 A;  2WXI A;  4ANV A;  2ODR D;  5AAR A;  3CEQ A;  3Q9U C;  3JUE A;  3UXG A;  1HZ4 A;  1GW6 A;  4WUY A;  2IVB A;  4I43 A;  5D0O D;  4JXT A;  1KZO A;  2I9C A;  2OEW A;  2J9Q A;  2BUG A;  3C98 A;  1OWO A;  4NAC A;  3CKB A;  1QYM A;  2GRN B;  2C2L A;  1E8X A;  5ENO D;  2IJG X;  3F6W A;  2XEN A;  2KZ8 A;  2RKK A;  3G2S A;  1OCT C;  2CFZ A;  3B7B A;  3EHR A;  1N94 A;  1WET A;  4PH4 B;  3L1P A;  2YQ8 A;  2KM4 A;  5ANR A;  5LX8 A;  2NSZ A;  3TJP A;  4F7A A;  3GYZ A;  4GA1 A;  2AXU A;  4PU8 A;  3V2O A;  4O1O A;  4J8D A;  1JCR A;  3UIN C;  4KYO B;  1WIZ A;  2H6I A;  4RSY A;  4OAU C;  2FBN A;  5JHB A;  3V30 A;  3B7H A;  4LCT A;  4U96 D;  4FC8 A;  4KMO A;  3AJI A;  1XWR A;  3RO2 A;  3U66 A;  2L0I A;  3HXC A;  3FU5 A;  2IVG A;  1E3O C;  2XGM A;  3GZ1 A;  3ZKC A;  5JJ6 A;  5H7P A;  1YSE A;  3OQM A;  5CBO A;  1QZ2 A;  4HXI A;  2IO2 C;  2X6I A;  2PIJ A;  1E8Y A;  4OBM A;  5JMN D;  2VSX E;  4BER A;  2BJC A;  5FIO A;  3SD5 A;  1LTX A;  3V31 A;  3QK0 A;  3ZPX A;  3UM2 A;  2O49 A;  1HX8 A;  5HRY A;  1B89 A;  3CHR A;  4ILI A;  4BX9 A;  3APD A;  3IVP A;  1OXJ A;  2FEZ A;  1MYO A;  4LNB A;  4G8L A;  1HXI A;  4HS2 A;  1R63 A;  2J09 A;  4ER0 A;  4Y42 A;  4N2S A;  3B7R L;  2YBD A;  4O6F A;  2D5V A;  3EDT B;  3ML9 A;  2WXG A;  4XI9 A;  5FJY A;  1JWL A;  2XQ0 A;  2PUD A;  4NQ0 A;  1S70 B;  5CMY A;  2R63 A;  4AVX A;  5FQ4 A;  4JQD A;  4PU4 C;  4CCA A;  4U7E B;  2DVW A;  3ASH A;  4BSZ B;  4GTR A;  5KCM A;  3PXP A;  3Q7A A;  3T5X A;  4UQX A;  3CR3 A;  4IUL A;  2MQK A;  2WXH A;  4UWH A;  4DE8 A;  3FTX A;  2P9P G;  3D9O A;  3UM1 A;  3TXN A;  5DTM A;  2PZI A;  1UXC A;  5BXO A;  3D9K A;  4UQZ A;  2R59 A;  1JH9 A;  4UI9 C;  4DUI A;  1KPS B;  2I1K A;  3DRA A;  3DEP A;  2BNM A;  5A23 A;  2ZIR A;  2HO1 A;  3ABM E;  2E0I A;  3TWT A;  2CRO A;  3IKO B;  4L7T A;  3QOX A;  4J8Y A;  3LVQ E;  3OXG A;  5EKQ D;  1Z6T A;  3TAX A;  3CLJ A;  2ETA A;  4JPS A;  5BV1 A;  4HLL A;  4LUN U;  5EIL A;  4X4C A;  4A1G A;  3JXB C;  2RFA A;  4G26 A;  3LY9 A;  4GYW A;  4I6J A;  4JHJ A;  4OB4 A;  3TWU A;  2HFZ A;  4GTT A;  3EIJ A;  3VK0 A;  4NRH B;  3TRB A;  3C3R A;  1ELK A;  5FT9 A;  4RQI A;  2VSN A;  3FU3 A;  3SFZ A;  3RIB A;  2WXM A;  4R7L A;  4B8C B;  1LD7 A;  3PDN A;  2MXD A;  1FPP A;  4UWK A;  3FFL A;  3TGO A;  3R9A B;  3SI5 A;  3ZGQ A;  4K03 A;  2MYO A;  2PUB A;  5J90 A;  1JUQ A;  4GZC A;  4EQF A;  4ANX A;  1H19 A;  2J07 A;  3QFI A;  1TJF A;  2J08 A;  1E8Z A;  3LFP A;  3MKQ A;  3AS5 A;  4X4D A;  5LOZ A;  3QWW A;  1N9A A;  3LIS A;  1TN8 A;  2ION A;  3BG1 B;  4QQI A;  5FIN A;  4EEC A;  4UQY A;  5CRV A;  4C9B B;  2XEE A;  3PZ4 A;  3SR4 A;  3HVE A;  1EF1 C;  2V4H C;  2Y4T A;  4ER3 A;  2ZXW E;  1OWM A;  1POU A;  3SHF A;  3BUA A;  4I2W A;  3S7J A;  4ANU A;  2HM8 A;  2H6F A;  2WM9 A;  1N4R A;  3D9J A;  4KVO A;  4BSX A;  3O9X A;  5HS0 A;  3PZD A;  2HCN A;  3LQX A;  1OCZ E;  4DX7 D;  3ZXS A;  4HQD A;  3OWQ A;  4WNF A;  4EPZ A;  3MKR A;  5BV0 A;  3PNL B;  1UTX A;  2XEH A;  4XEI G;  3CHP A;  4YDY A;  4EHM A;  3TWV A;  1ZZ6 A;  2XPY A;  1OCC E;  3X2Q E;  3ZYM A;  3GZC A;  4Y6C A;  1V54 E;  5EYP F;  4X4E A;  4L1B A;  2QFC A;  1IC8 A;  4LRZ A;  1IHG A;  4PUC A;  3ZHI A;  4FU3 A;  4NDW A;  3MLF A;  1KT1 A;  3WXX A;  2AJA A;  1Q2Z A;  1WY6 A;  2DZO A;  4J8F A;  3PS6 A;  4F8D A;  1RZR D;  1YMP A;  5T8I A;  3LDZ A;  5FZS A;  5CEC B;  1ELW A;  5CHE E;  5DRT A;  1LD8 A;  2PXB A;  3LKU A;  3L13 A;  1UJK A;  3KS2 A;  1O1R A;  3FTV A;  4GYY A;  2C0L A;  3ABK E;  2OR1 L;  3ZPJ A;  3DSV A;  2LYP A;  4ZHB A;  4U63 A;  2A6C A;  1N11 A;  3HDX A;  4UWF A;  1QB2 A;  3CVV A;  2F8Y A;  2P2C P;  5G05 J;  5CEA A;  2WXR A;  3CVU A;  4GA2 A;  4GTM A;  1TYQ G;  1QNF A;  1LLI A;  1S7E A;  2KCK A;  2NYJ A;  3ZXP A;  4LSZ E;  4FBI A;  3IHY A;  3DXK G;  2ZU6 B;  2L6B A;  2Y4U A;  3Q47 B;  1XNF A;  4FJY A;  4G8K A;  4B8A A;  2HCS A;  2NC9 A;  3OKZ A;  1HU3 A;  3SX0 A;  3D9I A;  1UW4 B;  5JHA A;  5IY5 E;  2FO7 A;  1QZX A;  4GTQ A;  4BT8 A;  5LCW C;  4WWN A;  3VTY A;  4HLE A;  1ZBP A;  4G25 A;  4IYP A;  3NXH A;  1MFQ C;  3Q5M A;  2XHE A;  3ZNG A;  3JCK C;  2XZT G;  1ZZ7 A;  3CHQ A;  4JEU A;  4U8H A;  4BET A;  4HOT A;  4K5B A;  4CRW A;  4HNA D;  5JA4 D;  1NER A;  3UKR G;  1BPO A;  2H8R A;  2AW6 A;  2VGX B;  4TXP A;  3ZHE B;  4GML A;  4BFR A;  4HI9 A;  4H7Y A;  1N4S A;  3GN5 A;  4QFV A;  3S8Q A;  3DST A;  5A6C A;  3CRO L;  4FP7 A;  1IKN D;  4MLP A;  2XRY A;  3EHN A;  4EKI A;  1NP7 A;  2AVP A;  3FYA A;  4G2V A;  3I5P A;  4URK A;  2VSY A;  2DYS E;  2A5E A;  4I6G A;  3OXL A;  3AG3 E;  4AY5 A;  3B13 A;  2KEK A;  2Y1L E;  3L22 A;  5BPP A;  2V3C C;  3R09 A;  1EPU A;  3HXE A;  2WXK A;  4WWO A;  3FUF A;  2CG3 A;  3MGB A;  4HOQ A;  4W9R A;  5ENR D;  4LNG A;  1MZC A;  2V5Q C;  2I1J A;  3UKU G;  2B5A A;  4XIF A;  3ASN E;  4HRA A;  2KBX A;  3TG5 A;  1N95 A;  4RVB A;  2FUL A;  5CRU A;  4P29 A;  4GHJ A;  2WUS R;  4PU7 A;  3DXM G;  2R02 A;  3WG7 E;  3TFL A;  5AQA A;  4CEM A;  4CDM A;  3T5V A;  1RZS A;  3ZFW A;  1EYH A;  5G04 J;  2LAI A;  3EHQ A;  4JA7 A;  3T9K A;  2WMO A;  5DSX A;  5D0Q D;  2LO6 A;  4HOU A;  4BWR A;  5KNH D;  3RRU A;  3UUX A;  3HIZ A;  3DBS A;  1LMB 3;  3B7T A;  4M3O A;  4C48 B;  2CFU A;  3Q79 A;  2P9I G;  3QJZ A;  1K8K G;  2IEJ A;  3LYA A;  4ER6 A;  3E4B A;  3UTM A;  3EUS A;  3SF4 A;  1H2T C;  2OV8 A;  2IOS A;  2P9K G;  2R05 A;  2PUF A;  4ACK A;  2F0Y A;  2EF8 A;  4TRQ A;  2R17 C;  4J1X A;  1X2L A;  1OWP A;  4OVU A;  4FHK A;  4KVM A;  2WXL A;  3QB2 A;  2LYK A;  4YDE A;  4BX8 A;  4PS8 A;  3PVL A;  3Q49 B;  1DW9 A;  1EFA A;  1MX2 A;  4Z58 A;  4A55 A;  4JHR A;  1HO8 A;  1TNY A;  1K1A A;  4TXQ A;  1JPL A;  3C5R A;  2PUE A;  4BY6 A;  3R9M A;  3MCX A;  4DK5 A;  3VWS A;  3JYS A;  2RD0 A;  1PRU A;  2IF4 A;  3T8K A;  2GRR B;  2LUH A;  3AG2 E;  3KL4 A;  5B3S E;  3RZZ A;  2VTB A;  2KEJ A;  3GZ2 A;  4AIF A;  3OP9 A;  2R5S A;  4HI8 A;  4IN3 B;  2L9B A;  1LCD A;  2X6J A;  4CDR A;  4U04 A;  4U07 A;  2PXF A;  1L5J A;  1MQS A;  3MA5 A;  4AXH A;  5M72 A;  4RG9 A;  4I6T A;  2LNM A;  3SO8 A;  4EZJ A;  1O1S A;  2Y69 E;  4N3C A;  3HXB A;  4GB9 A;  1N4P A;  3JXC L;  3FTY A;  4J0U A;  2YHE A;  4B94 A;  3MV2 B;  2WMN A;  5HQ8 A;  3ZIM A;  3FTW A;  3CIA A;  3CVQ A;  3PEU B;  1NI1 A;  4GTP A;  2KCV A;  3ZRH A;  1UXD A;  1TNB A;  3DSW A;  4G11 A;  5KJN A;  3GW4 A;  4HOR A;  2CHW A;  2HR2 A;  4L2L A;  4PS3 A;  1TEZ A;  2YNQ A;  3S7D A;  4DE9 A;  3FTU A;  1ZZ8 A;  3JXD L;  3PUJ A;  2ZIS A;  3PZ1 A;  3PRZ A;  4F3V A;  4CGV A;  4GMJ A;  5CCL A;  3FDH A;  2EIJ E;  1WH8 A;  2GZU A;  3QAQ A;  1Y6I A;  3TG4 A;  3ZYL A;  2PXV A;  2PUC A;  3JUI A;  5KBA A;  3AG4 E;  4IRU A;  2VSO E;  4YVQ C;  5KJK A;  1H6P A;  3J5P A;  3GZD A;  3C3O A;  2O38 A;  4I1O B;  2LNI A;  3RK6 A;  1QQE A;  1H0A A;  2FFH A;  2OVF A;  4N3A A;  1IQU A;  2R2L A;  2R1J L;  4LG6 A;  1OUV A;  1OWL A;  2FI7 A;  1UG3 A;  2JLB A;  1N54 A;  3IBE A;  2A4Z A;  1E7V A;  2LYR A;  2OFY A;  5K98 B;  1RW2 A;  1ZS4 A;  3AG1 E;  4YVO A;  1GT0 C;  3ENE A;  4FLH A;  3PE3 A;  3CHS A;  1QQA A;  4YBA A;  3CGH A;  4NUR A;  3AS4 A;  4EZK A;  1DVP A;  2IVQ A;  2DYR E;  1TNZ A;  1NL4 A;  3CVL A;  3KXA A;  3FEY A;  3F51 A;  1U3D A;  1HF0 A;  5FZR A;  3A9Y A;  4JL0 A;  2FF4 A;  5BT1 A;  4YG4 A;  1ZU2 A;  2NXP A;  5FZQ A;  4L9P A;  5FWQ A;  4DLO A;  3OXF A;  1BI7 B;  4YDO A;  5CBN A;  3FUN A;  1O4X A;  4CT4 A;  2BNN A;  3SBT B;  4JC8 A;  4IWR A;  1LF8 A;  1Y9Q A;  4F1S A;  3UPV A;  4WWP A;  2PXT A;  3DM5 A;  3EU9 A;  3ZHM A;  4HBD A;  3QWP A;  3NBN B;  3CST A;  2LCV A;  4Z5C A;  1NEQ A;  3QKY A;  4DPR A;  3ZEF A;  3I3N A;  3RRM B;  2JCG A;  4MKT A;  3B7S A;  1G3N B;  1Z3Y A;  2EIK E;  1BU9 A;  4D10 C;  5AN8 A;  3TL5 A;  1DNP A;  1QQB A;  4IVZ A;  2ICP A;  4HRL A;  4GPM A;  1SQ8 A;  3G2V A;  2OOE A;  4ILH B;  2QYJ A;  2WIU B;  4EZL A;  3B7U X;  3BD1 A;  4U8V D;  1RZ4 A;  5FTP A;  2PUG A;  5ENP D;  4N39 A;  2O4A A;  5AAO A;  3FUH A;  2PXE A;  4FHJ A;  2IU1 A;  3TEL A;  3NZS A;  3QDN A;  4GZ5 A;  1DCE A;  1UOH A;  3IHV A;  4XZ4 A;  3ZYQ A;  4J8E A;  3D9N A;  1OCO E;  1PNR A;  5GAG i;  2LYL A;  3D9L A;  5ENN A;  3ASO E;  4ZFH A;  5E75 A;  1JWF A;  4AM9 A;  2ETC A;  3HVE B;  3Q4A B;  3E33 A;  4GZ3 A;  3R7R A;  1N4Q A;  1X81 A;  2EWT A;  2WXO A;  2WXP A;  1QPZ A;  1DCQ A;  3KSL A;  5FQ8 A;  2F8X K;  3PRE A;  4GA0 A;  3MEJ A;  3KSQ A;  3N71 A;  2WQ7 A;  3HXF A;  3IXE A;  1CJG A;  3NOC D;  5DT2 A;  4X4I A;  2PXU A;  2XGS A;  3LXU X;  3QWG A;  2YHC A;  2GRO B;  4I6R A;  1OWN A;  4WND A;  4GTS A;  2IU7 A;  3CQC B;  4DI3 A;  2Q7F A;  3NF1 A;  2ETB A;  4K0R A;  1AU7 A;  5CMW A;  2IUO A;  3PE4 A;  3BG0 B;  3TXM A;  2IO3 C;  2UY1 B;  4A3V A;  4Z5D A;  2LSU A;  2BKK B;  2GRP B;  3ML8 A;  3SCF A;  3EUV A;  2P58 C;  2WPV A;  4U0S A;  4JEH A;  4BT9 A;  4Q94 A;  2IV1 A;  5DBK A;  2LSV A;  3UFD A;  1ZAY A;  1BDH A;  4JCX A;  4FJZ A;  3AU5 A;  3KAE A;  4FAD A;  2DCP A;  2XCC A;  4X4H A;  5AQB A;  5LCW J;  4GU5 A;  5D2M C;  3TWQ A;  2BNO A;  1HG2 A;  3LCA A;  3KEA A;  3ZVV A;  3NDB B;  5AEN A;  4G23 A;  3U9W A;  3QWV A;  4I6U A;  3SFX A;  1Z3X A;  4FLB A;  2PPX A;  1SQM A;  5C1D A;  1MHQ A;  3G2U A;  3G7D A;  3UM0 A;  1L1M A;  2WQH A;  2IFU A;  1U2V G;  3O48 A;  1KZP A;  3HXD A;  3S7F A;  4DX2 A;  2BF0 X;  4EBA A;  2PXD A;  4I9E A;  3FH7 A;  3D1N I;  4K5A B;  3G2W A;  4DJA A;  4ABN A;  3GN5 B;  2X3M A;  3TWS A;  3GUU A;  3CK7 A;  3PZ3 A;  3ZYK A;  2KZT A;  4HRM B;  3RJV A;  3E34 A;  4OAV B;  1IHB A;  2Y0B G;  3NRO A;  1SVX A;  3RU0 A;  2FO1 E;  1ELR A;  3EIQ C;  4F1P A;  1FVF A;  4K5C A;  4E6H A;  3LJN A;  2JAB A;  2V4L A;  3ULE G;  3ZHE A;  4FA6 A;  3ESL A;  3UMV A;  3K9I A;  2V5F A;  2EBY A;  2QZA A;  2LYJ A;  2L0T B;  2XSD C;  3GZD C;  3KZ3 A;  3FUK A;  3L17 A;  5AJL A;  2I6H A;  4X4B A;  5HKP A;  3GZS A;  4GQM A;  4DX6 D;  1INZ A;  3TWW A;  3RAU A;  1BI8 B;  1NA3 A;  1OCR E;  3CQG B;  3DSU A;  3DSS A;  3FUJ A;  5T4Y A;  5EDS A;  1YYH A;  3AS8 A;  4G1T A;  3TWR A;  2MEZ A;  3FP3 A;  2GRL A;  4AV7 A;  1ZUG A;  3LPZ A;  3W9F A;  4X8Q A;  1DUL A;  3HZI B;  4YG7 B;  4CZ2 D;  2IQC A;  1W3B A;  1E90 A;  3Q73 A;  4B89 A;  2XS8 A;  1E7U A;  2EQX A;  5EN5 D;  2A5U A;  2PQN A;  4JW1 A;  1QP0 A;  3EU5 A;  2XI8 A;  3PE5 A;  4O1P A;  5JJT A;  4ATZ D;  2P9U G;  3NZL A;  5FQ7 A;  2VGY A;  4UUC A;  3L6A A;  3RKV A;  3LJ3 A;  1H6K A;  3IV0 A;  3UM3 A;  4RG6 A;  3FUD A;  1FCH A;  3GBF A;  3Q78 A;  2QYU A;  4X4F A;  1TNO A;  5AQ7 A;  4GYO A;  4HB5 A;  3CKC A;  4EZI A;  2XJ3 A;  3ZU7 B;  1SW6 A;  3FU6 A;  3Q7F A;  4U8Y D;  1YA0 A;  2XPZ A;  1H2V C;  3L82 A;  2P9N G;  4I9C A;  5CCM A;  2OVB A;  2WXN A;  5A7D B;  3CVX A;  3RSE G;  1HE8 A;  1E96 B;  2GRM A;  3ZN3 A;  1FT2 A;  2PXQ A;  1VPW A;  2DZN A;  1TJC A;  2XEV A;  1N52 A;  3UIO C;  3IEG A;  2PM6 A;  3FY4 A;  5D66 A;  4HFG A;  3ZUV B;  5BXU A;  3CHO A;  2VYI A;  4ANW A;  1QP4 A;  1BD8 A;  1QBQ A;  3U4T A;  2L8N A;  3DEO A;  3PH0 C;  3Q9N C;  1SA5 A;  4A1S A;  1UN8 A;  2XCB A;  1FT1 A;  4KXK B;  3KJX A;  3JQ1 A;  2VTB B;  4EQZ A;  1IXV A;  4GZ6 A;  4L2Y A;  1SA4 A;  4J7W A;  3BQO A;  4I1M A;  5EIB E;  3AU4 A;  5DTQ A;  3L16 A;  4IA8 A;  4I6E A;  2HE0 A;  3FEX A;  1X57 A;  2GW1 A;  4ATG A;  3EJN A;  3S7B A;  1MX4 A;  4WNG A;  4JA9 A;  3LY8 A;  3OQO A;  4C0M A;  3QNK A;  5E76 A;  4I17 A;  2XIU A;  1WDY A;  2VJ8 A;  4M7C A;  3DSX A;  3P1U A;  1SZA A;  4MS6 A;  2P9L G;  2HIN A;  3B95 A;  5DTR A;  3MZL B;  4MRU A;  2ZGG A;  3FUE A;  4XKC A;  3SCG A;  5B1B E;  2J4D A;  4BEP A;  2XS1 A;  4APO A;  2ILR A;  2OEV A;  5AQ9 A;  5G2N A;  4NIK A;  3SCH A;  4TXR A;  3LVR E;  1H6O A;  3MX3 A;  4XKB A;  1R69 A;  5JJ7 A;  1WM5 A;  4TUM A;  3ASD A;  4DRX E;  4KZC A;  2PQR A;  1B0N A;  5C2Y A;  3BS3 A;  2ICT A;  3CHM A;  3FUL A;  3FHE A;  4HVB A;  3TWX A;  3CK8 A;  3AAA C;  4J6I A;  4Q69 A;  1MX6 A;  4UI9 K;  1TNU A;  1TR4 A;  3APF A;  3CVW A;  2XXQ A;  3T8M A;  2WB2 A;  4C0E A;  4B93 B;  4EK9 A;  3MYV A;  4Z59 A;  3OAW A;  4EBA G;  3ONL A;  4I2Z A;  4DLQ A;  1EDU A;  3ONK A;  4ER5 A;  2EIN E;  3OMT A;  1UJJ A;  3ME5 A;  1YCS B;  2JVL A;  3FWV A;  4UI9 J;  1D8E A;  4O8B A;  3LEW A;  4X4G A;  4BTA A;  1HFA A;  1WH6 A;  4JD2 G;  1ZB1 A;  2CSF A;  2XXA A;  3NB2 A;  3QC1 A;  4Z68 A;  2WQ6 A;  2PL2 A;  2IY0 C;  4FN3 A;  2RG8 A;  3OQN A;  3ESK A;  3NAW A;  4WNE A;  2IOL A;  2CHZ A;  4ACL A;  4GAA A;  1N0Q A;  4LER A;  3KEZ A;  3KD7 A;  2H6G A;  3MV3 B;  4DX1 A;  4GTO A;  3S2A A;  4F53 A;  1PC2 A;  3DNV B;  1NA0 A;  2MHK A;  4Q2J A;  2JQE A;  3V79 K;  1DWK A;  5A7L A;  2EIL E;  1K1B A;  3MEK A;  3ZW3 A;  2LAH A;  2B6C A;  2AXV A;  2VGE A;  3C72 A;  1SZ9 A;  3SBS A;  4UWL A;  4Y6W A;  4HRN A;  3I4G A;  3FYM A;  4A63 B;  5EX0 A;  3JXI A;  4OVV A;  5KWD A;  1KT0 A;  2R03 A;  2H6H A;  3JXJ A;  4HOS A;  3QQ6 A;  2XRZ A;  2L1P A;  1PAQ A;  1Y7Y A;  1RPE L;  3FH8 A;  2HYZ A;  5ARG A;  3G2T A;  3G5G A;  3A9Z A;  1X5B A;  2QY7 A;  1ZZ9 A;  2I2O A;  4GZD A;  3MKQ B;  3CVN A;  1TN6 A;  2WXQ A;  4BES A;  2RFM A;  3LS8 A;  3FTZ A;  3CEC A;  5DIZ A;  5ENS D;  5B1A E;  4Q96 A;  3E37 A;  3CVY A;  3ISM C;  1PRA A;  4XX5 A;  3SGH A;  1OT8 A;  2LYQ A;  5AYW D;  1S64 A;  4CGW A;  4GCN A;  4JVS A;  3FH5 A;  4TUU A;  3L54 A;  3RRN B;  1OY3 D;  2V8S E;  3UI2 A;  3P2B A;  2BKG A;  3Q75 A;  3SNX A;  4PDX A;  3DPD A;  4CT0 A;  1D9S A;  4Z5H A;  3NZU A;  3G0T A;  3V2X A;  2M63 A;  4MCX A;  5T3R A;  3ABL E;  3L08 A;  4EKG A;  1WG0 A;  2J8S D;  2DBA A;  5ARF A;  4V3I A;  2KC7 A;  5LFA A;  1P5Q A;  3ULY A;  2LYS A;  2CG2 A;  5KJM A;  1LQC A;  3CV0 A;  1IYG A;  1ZPQ A;  4PS7 A;  4XI0 A;  4CYM D;  2J4B A;  4JB8 P;  1H2U A;  2MRI A;  2PXK A;  3DWL G;  4F6R D;  1A5E A;  3R1F A;  2DWZ A;  3SFY A;  3HHM A;  3UWP A;  4J8S A;  3SQV A;  5ENQ D;  3F6Q A;  5J08 A;  1KLX A;  5ENT D;  4AP2 A;  2XGO A;  4AY6 A;  1JFT A;  5ANL A;  3U3W A;  3BEE A;  2X6K A;  3HG0 D;  4G24 A;  2WXF A;  4XE0 A;  3OTN A;  4YAR A;  1XGW A;  2AUW A;  2UY1 A;  4GPK A;  5FQ6 A;  2B0O E;  4JCY A;  3Q15 A;  1Y8M A;  4ME2 A;  3CLC A;  5G55 A;  2KAT A;  5EX3 A;  3ASG A;  3I4R B;  1UN9 A;  2V0P A;  1RIO A;  3QAR A;  4TV3 A;  2PXL A;  2BED A;  2XPI A;  2AWI A;  2XCJ A;  3L9T A;  4H7X A;  2QC9 A;  4GMR A;  2HSG A;  3CK9 A;  3NQP A;  2ZGD A;  3PEV B;  3F52 A;  4AOF A;  3H5T A;  4KZ0 A;  1NFI E;  3D3M A;  4LNU D;  3FMY A;  3VLD A;  2KEI A;  1AP7 A;  4E85 A;  1PRV A;  5KJL A;  5GAH i;  2XXP A;  4MCT A;  3FUI A;  4FUL A;  4RLY A;  1FVH A;  5BUZ A;  2VEO A;  3QOW A;  2UWJ G;  4YND A;  4AEZ C;  1WAO 1;  3A9X A;  4B0Z A;  1S0P A;  4CDN A;  2F37 A;  4U95 D;  4AJW A;  4OYS A;  4N5Q A;  3FU0 A;  4WVL A;  3VLF A;  2BTD A;  4WAF A;  5CED B;  1E8W A;  1NZN A;  2PXP A;  1JWG A;  2L49 A;  2LXL A;  3ZKJ A;  5G05 C;  2J7U A;  3EHM A;  4YDW A;  2KZT B;  3VTX A;  5HI7 A;  3UX4 A;  3UT4 A;  2PM7 A;  3LY7 A;  2YIN A;  4N5C A;  2PUA A;  3O4Z A;  2KCL A;  1O5M A;  2GRQ B;  3DPY A;  1HF8 A;  3CSF A;  2M4H A;  1U2Z A;  3MJW A;  4U0U A;  3ASF A;  3PNT B;  4U0Z A;  2MOW A;  1BLX B;  2VGX A;  1ZVV A;  2CHX A;  2XZD G;  3BDN A;  4GTV A;  1O1T A;  4GCO A;  3U64 A;  2FJR A;  1CQT A;  3HRA A;  5BW8 C;  4YG1 A;  4DX5 D;  2PE5 A;  1HQ1 A;  3C3Q A;  5BNW A;  1JCQ A;  4BTB A;  3E30 A;  5KNG A;  3UT8 A;  5JUW A;  1RZR A;  2J7W A;  4PU3 C;  3HYM B;  1DC2 A;  2LXM A;  1Z5S C;  2PNN A;  1TN7 A;  4A3T A;  3UT7 A;  5DRY A;  3QF3 A;  2EIM E; 
#chains in the Genus database with same CATH homology
 4PUC A;  1LF8 A;  1VDY A;  1SZA A;  2E2E A;  1Y9Q A;  3ZHI A;  1A17 A;  3JQ0 A;  4FU3 A;  4F1S A;  4NDW A;  2WXJ A;  4MS6 A;  4WWP A;  3MLF A;  3UPV A;  1KT1 A;  4N3B A;  3SZ7 A;  3WXX A;  2HIN A;  3MZL B;  3ZHM A;  1HS6 A;  4MRU A;  2OND A;  3FUE A;  3QWP A;  4XKC A;  3SCG A;  3CST A;  5D0Q D;  2J4D A;  2LCV A;  4Z5C A;  3RO3 A;  4APO A;  2ILR A;  1NEQ A;  1WY6 A;  4DI4 A;  3PUK A;  4J8F A;  3QKY A;  3D9P A;  3ZEF A;  4DPR A;  3PS6 A;  5LP0 A;  4F8D A;  2VQ2 A;  3I3N A;  1U3C A;  3RRM B;  1RZR D;  5G2N A;  2JCG A;  5T8I A;  3SCH A;  3LDZ A;  5AIJ A;  3LVR E;  4MKT A;  5FZS A;  2Y3A A;  3B7S A;  3MX3 A;  1ELW A;  4XKB A;  5CCL A;  1Z3Y A;  5CHE E;  3CVP A;  4APF A;  3LKU A;  3L13 A;  1LCC A;  1UJK A;  3KS2 A;  4D10 C;  3TL5 A;  1ZZB A;  3FTV A;  1DNP A;  4GYY A;  1QQB A;  2C0L A;  1R69 A;  2ICP A;  4IVZ A;  4I8T A;  1WM5 A;  2X6H A;  5JJ7 A;  2OR1 L;  3ZPJ A;  3ASD A;  4LEU A;  4J1W A;  1ZZC A;  2LYP A;  3URZ A;  1SQ8 A;  3G2V A;  1IQR A;  4U63 A;  2A6C A;  2OOE A;  3FUM A;  4ILH B;  4KZC A;  4L23 A;  3HDX A;  2X38 A;  2PQR A;  1HG5 A;  1B0N A;  5C2Y A;  2WIU B;  4UWF A;  3R7Q A;  4EZL A;  3B7U X;  3BD1 A;  3BS3 A;  3CVV A;  2ICT A;  4N2Q A;  3APC A;  1PY1 A;  5G05 J;  3CHM A;  3FUL A;  2WXR A;  3CVU A;  4GA2 A;  3FHE A;  5FTP A;  1QNF A;  2PUG A;  1LLI A;  2DIW A;  1S7E A;  4HVB A;  4N39 A;  2J49 A;  2O4A A;  2KCK A;  3FUH A;  3ULQ A;  1BDI A;  3CK8 A;  2IU1 A;  4FBI A;  3IHY A;  4FHJ A;  4J6I A;  4Q69 A;  3NZS A;  2ZU6 B;  3QDN A;  4GZ5 A;  4LRZ A;  3IHV A;  2Y4U A;  4UI9 K;  4XZ4 A;  3Q47 B;  3ZYQ A;  4JZY A;  2AXZ A;  4J8E A;  3APF A;  3D9N A;  1XNF A;  3QOU A;  4FJY A;  4B8A A;  1PNR A;  3CVW A;  2LYL A;  2NC9 A;  3D9L A;  5ENN A;  2C0M A;  1HU3 A;  3T8M A;  3D9I A;  2WB2 A;  5E75 A;  1UW4 B;  1JWF A;  4C0E A;  5JHA A;  4AM9 A;  3QYX A;  2KPJ A;  2FO7 A;  3HVE B;  3Q4A B;  5AJD A;  5G04 C;  3MYV A;  4GZ3 A;  4Z59 A;  3OAW A;  4JHK A;  1PER L;  4WWN A;  3ONL A;  4I2Z A;  3R7R A;  4BT8 A;  4DLQ A;  2EWT A;  3VTY A;  4EBA G;  2WXO A;  4HLE A;  1ZBP A;  4G25 A;  1JFS A;  4IYP A;  2WXP A;  1QPZ A;  1EDU A;  2XHE A;  3ONK A;  3Q5M A;  3JCK C;  4UWG A;  1ZZ7 A;  3UQ3 A;  5FQ8 A;  1OSL A;  3CHQ A;  4JEU A;  4U8H A;  3VLE A;  4HOT A;  4CRW A;  3PRE A;  4GA0 A;  4KT6 B;  2L6J A;  3OMT A;  1NER A;  2JEK A;  4ILG A;  1ADR A;  1UJJ A;  3N71 A;  2WQ7 A;  4KBQ A;  1BPO A;  2H8R A;  2JVL A;  3FWV A;  2AW6 A;  2VGX B;  4UI9 J;  4A3T A;  3ZHE B;  4O8B A;  3LEW A;  4X4G A;  4GML A;  4BFR A;  1CJG A;  3D9M A;  2WVI A;  1HH8 A;  4X4I A;  3FTS A;  2XGS A;  4BTA A;  1HFA A;  3LXU X;  3QWG A;  4H7Y A;  2YHC A;  3GN5 A;  4I6R A;  1WH6 A;  2X6F A;  2GGF A;  1OWN A;  4I1A A;  4WND A;  1QP7 A;  2CSF A;  2WXI A;  4QFV A;  4ANV A;  3CEQ A;  3QC1 A;  2IU7 A;  3CQC B;  4DI3 A;  2WQ6 A;  3S8Q A;  2PL2 A;  5A6C A;  3CRO L;  4FN3 A;  2RG8 A;  4FP7 A;  4MLP A;  2XRY A;  3EHN A;  3OQN A;  3ESK A;  2Q7F A;  1HZ4 A;  1GW6 A;  4WUY A;  1NP7 A;  2AVP A;  3NF1 A;  3FYA A;  4G2V A;  2IVB A;  4WNE A;  2IOL A;  3I5P A;  2CHZ A;  4I43 A;  4URK A;  5D0O D;  4ACL A;  4K0R A;  1AU7 A;  2VSY A;  4GAA A;  4JXT A;  2IUO A;  5CMW A;  2I9C A;  4I6G A;  3OXL A;  4LER A;  3KEZ A;  3PE4 A;  3B13 A;  2J9Q A;  2BUG A;  2KEK A;  3KD7 A;  3C98 A;  3L22 A;  3MV3 B;  4AY5 A;  5BPP A;  1OWO A;  4NAC A;  3BG0 B;  3CKB A;  3S2A A;  4F53 A;  1PC2 A;  3TXM A;  1EPU A;  3DNV B;  2WXK A;  1NA0 A;  4WWO A;  2MHK A;  2C2L A;  2UY1 B;  1E8X A;  5LCW C;  4A3V A;  4Z5D A;  3FUF A;  2LSU A;  2CG3 A;  3MGB A;  3ML8 A;  4HOQ A;  1DWK A;  5A7L A;  4W9R A;  3MEK A;  3ZW3 A;  2IJG X;  2LAH A;  3F6W A;  2AXV A;  2KZ8 A;  3G2S A;  2I1J A;  1OCT C;  2CFZ A;  3SCF A;  2P58 C;  2WPV A;  2B5A A;  1WET A;  4PH4 B;  3L1P A;  4U0S A;  1SZ9 A;  2YQ8 A;  2KM4 A;  4JEH A;  4XIF A;  5ANR A;  3SBS A;  4BT9 A;  5LX8 A;  2NSZ A;  4UWL A;  3TG5 A;  4RVB A;  4Y6W A;  2FUL A;  4Q94 A;  4P29 A;  4GHJ A;  2WUS R;  4PU7 A;  3TJP A;  2IV1 A;  4F7A A;  3I4G A;  3FYM A;  3GYZ A;  5DBK A;  2LSV A;  4GA1 A;  3UFD A;  2AXU A;  4PU8 A;  1ZAY A;  1BDH A;  4JCX A;  4CEM A;  4CDM A;  4J8D A;  4FJZ A;  5EX0 A;  4KYO B;  4OVV A;  1WIZ A;  3T5V A;  3AU5 A;  4RSY A;  3KAE A;  4FAD A;  1KT0 A;  2FBN A;  5JHB A;  3B7H A;  2DCP A;  4LCT A;  1RZS A;  3ZFW A;  1EYH A;  2XCC A;  4HOS A;  5G04 J;  4X4H A;  2LAI A;  3QQ6 A;  4FC8 A;  4KMO A;  2XRZ A;  4JA7 A;  5LCW J;  1XWR A;  4GU5 A;  2WMO A;  3RO2 A;  3U66 A;  2L0I A;  3FU5 A;  1PAQ A;  1Y7Y A;  1RPE L;  2BNO A;  2IVG A;  1E3O C;  2XGM A;  3FH8 A;  3GZ1 A;  2HYZ A;  2LO6 A;  4HOU A;  4BWR A;  3ZKC A;  5ARG A;  3G2T A;  3G5G A;  5JJ6 A;  1X5B A;  3RRU A;  1HG2 A;  2QY7 A;  3LCA A;  3ZVV A;  1YSE A;  1ZZ9 A;  2I2O A;  3OQM A;  3HIZ A;  3MKQ B;  4GZD A;  3UUX A;  5AEN A;  4G23 A;  3U9W A;  3CVN A;  3DBS A;  1QZ2 A;  1LMB 3;  4HXI A;  3B7T A;  4M3O A;  2X6I A;  2PIJ A;  1E8Y A;  2WXQ A;  2CFU A;  3QWV A;  4AY6 A;  4DJA A;  3LS8 A;  2VSX E;  3FTZ A;  3QJZ A;  3CEC A;  5DIZ A;  4I6U A;  4Q96 A;  2BJC A;  1Z3X A;  3LYA A;  2PPX A;  3E4B A;  1SQM A;  4FLB A;  3SD5 A;  3QK0 A;  3EUS A;  3CVY A;  3SF4 A;  5C1D A;  1MHQ A;  1H2T C;  2O49 A;  2OV8 A;  1PRA A;  1HX8 A;  2IOS A;  3G2U A;  1B89 A;  4XX5 A;  3G7D A;  2PUF A;  4ACK A;  3SGH A;  3CHR A;  4ILI A;  4BX9 A;  2EF8 A;  3APD A;  4TRQ A;  1L1M A;  2R17 C;  2WQH A;  2LYQ A;  3IVP A;  4J1X A;  2FEZ A;  5AYW D;  1X2L A;  1OWP A;  4HS2 A;  1HXI A;  4OVU A;  1R63 A;  4CGW A;  2IFU A;  4GCN A;  4FHK A;  3O48 A;  4JVS A;  4KVM A;  2J09 A;  2WXL A;  3FH5 A;  3QB2 A;  4TUU A;  2LYK A;  4Y42 A;  3S7F A;  4N2S A;  2BF0 X;  3B7R L;  4EBA A;  4BX8 A;  4PS8 A;  4O6F A;  3L54 A;  3PVL A;  3RRN B;  2D5V A;  3Q49 B;  4I9E A;  3FH7 A;  3EDT B;  2V8S E;  3ML9 A;  3P2B A;  1DW9 A;  1EFA A;  3D1N I;  2WXG A;  4Z58 A;  3G2W A;  4JHR A;  4XI9 A;  1JWL A;  5FJY A;  1HO8 A;  2PUD A;  2XQ0 A;  3DPD A;  4NQ0 A;  4PDX A;  3SNX A;  4CT0 A;  4ABN A;  4Z5H A;  3GN5 B;  2X3M A;  3NZU A;  5CMY A;  2R63 A;  1JPL A;  4AVX A;  3CK7 A;  5FQ4 A;  4JQD A;  3ZYK A;  2M63 A;  4MCX A;  2PUE A;  2KZT A;  5T3R A;  3RJV A;  4PU4 C;  4BY6 A;  3L08 A;  3MCX A;  4DK5 A;  2DBA A;  4CCA A;  3RU0 A;  3JYS A;  3ASH A;  1ELR A;  5ARF A;  4V3I A;  5KCM A;  3EIQ C;  2RD0 A;  2KC7 A;  3PXP A;  5LFA A;  1P5Q A;  1PRU A;  1FVF A;  2IF4 A;  2LYS A;  2CG2 A;  4E6H A;  5KJM A;  1LQC A;  3CV0 A;  3T5X A;  2V4L A;  1IYG A;  1ZPQ A;  4PS7 A;  3RZZ A;  4XI0 A;  2VTB A;  3ZHE A;  2KEJ A;  4UQX A;  3GZ2 A;  4AIF A;  3OP9 A;  4FA6 A;  2J4B A;  3CR3 A;  2R5S A;  3ESL A;  4IUL A;  1H2U A;  3K9I A;  4IN3 B;  2MRI A;  2V5F A;  3UMV A;  2MQK A;  2WXH A;  2EBY A;  4UWH A;  2L9B A;  1LCD A;  3FTX A;  2X6J A;  4CDR A;  3R1F A;  2LYJ A;  4U04 A;  4U07 A;  1L5J A;  2L0T B;  2XSD C;  3D9O A;  1MQS A;  3KZ3 A;  3FUK A;  3HHM A;  4J8S A;  3MA5 A;  3L17 A;  4AXH A;  5AJL A;  2I6H A;  5M72 A;  4X4B A;  3GZS A;  4RG9 A;  4I6T A;  3TXN A;  4GQM A;  2PZI A;  1INZ A;  4EZJ A;  1UXC A;  4N3C A;  5J08 A;  1NA3 A;  3D9K A;  4UQZ A;  4GB9 A;  2R59 A;  1JH9 A;  1KLX A;  4UI9 C;  3JXC L;  3CQG B;  2I1K A;  4AP2 A;  3FTY A;  3FUJ A;  2XGO A;  4J0U A;  1JFT A;  5ANL A;  2YHE A;  5T4Y A;  4B94 A;  2BNM A;  3U3W A;  5EDS A;  3AS8 A;  4G1T A;  5A23 A;  2MEZ A;  3BEE A;  2X6K A;  3MV2 B;  2HO1 A;  2E0I A;  2WMN A;  2GRL A;  3FP3 A;  5HQ8 A;  2CRO A;  4AV7 A;  3ZIM A;  1ZUG A;  3LPZ A;  3IKO B;  4L7T A;  3FTW A;  3CIA A;  3CVQ A;  3HZI B;  4YG7 B;  3LVQ E;  3PEU B;  4G24 A;  2WXF A;  3OXG A;  1Z6T A;  2IQC A;  2KCV A;  3OTN A;  4XE0 A;  3CLJ A;  4YAR A;  1XGW A;  2AUW A;  4JPS A;  3TAX A;  2UY1 A;  3ZRH A;  5BV1 A;  1UXD A;  4GPK A;  4LUN U;  5FQ6 A;  1W3B A;  4JCY A;  3Q15 A;  4G11 A;  4X4C A;  1E90 A;  1Y8M A;  3CLC A;  4ME2 A;  4A1G A;  3JXB C;  5KJN A;  3GW4 A;  5G55 A;  4B89 A;  4HOR A;  2CHW A;  1E7U A;  2EQX A;  2KAT A;  5EX3 A;  4G26 A;  3ASG A;  2A5U A;  3I4R B;  3LY9 A;  2PQN A;  2HR2 A;  4GYW A;  4I6J A;  4JW1 A;  1QP0 A;  2XI8 A;  4L2L A;  1UN9 A;  4JHJ A;  2V0P A;  1RIO A;  3QAR A;  4PS3 A;  4TV3 A;  1TEZ A;  2YNQ A;  3S7D A;  5JJT A;  2XPI A;  4OB4 A;  3FTU A;  1ZZ8 A;  3JXD L;  3PUJ A;  5FQ7 A;  3EIJ A;  3VK0 A;  4NRH B;  2AWI A;  2XCJ A;  3TRB A;  2VGY A;  3PRZ A;  3L6A A;  4H7X A;  1ELK A;  5FT9 A;  2HSG A;  3CK9 A;  3LJ3 A;  3RKV A;  3NQP A;  1H6K A;  3PEV B;  3F52 A;  3IV0 A;  4AOF A;  3H5T A;  4KZ0 A;  4GMJ A;  4F3V A;  4CGV A;  4RG6 A;  3D3M A;  2VSN A;  3FU3 A;  3FUD A;  5EKQ D;  1FCH A;  3RIB A;  3SFZ A;  2WXM A;  3FDH A;  1WH8 A;  2GZU A;  4R7L A;  3FMY A;  4B8C B;  3QAQ A;  3PDN A;  3VLD A;  2KEI A;  3GBF A;  4E85 A;  1PRV A;  1Y6I A;  4UWK A;  4X4F A;  3TG4 A;  3FFL A;  3ZYL A;  5KJL A;  3TGO A;  4MCT A;  3FUI A;  4FUL A;  4GYO A;  3R9A B;  3SI5 A;  2PUC A;  3JUI A;  3ZGQ A;  3CKC A;  1FVH A;  5BUZ A;  4K03 A;  4IRU A;  2PUB A;  2UWJ G;  2XJ3 A;  2VSO E;  1JUQ A;  5J90 A;  4YND A;  4GZC A;  4YVQ C;  4AEZ C;  4EQF A;  4ANX A;  1WAO 1;  1H19 A;  3FU6 A;  5KJK A;  4B0Z A;  1S0P A;  4CDN A;  1YA0 A;  2XPZ A;  2J07 A;  1TJF A;  2J08 A;  2O38 A;  4I1O B;  1E8Z A;  1H2V C;  2LNI A;  3LFP A;  4I9C A;  3RK6 A;  5CCM A;  4AJW A;  4OYS A;  3FU0 A;  2OVB A;  2WXN A;  3AS5 A;  3MKQ A;  5A7D B;  3VLF A;  4X4D A;  2BTD A;  3QWW A;  5LOZ A;  1QQE A;  3CVX A;  1HE8 A;  3LIS A;  4WAF A;  1E8W A;  1E96 B;  2GRM A;  1NZN A;  1H0A A;  2ION A;  3BG1 B;  3ZN3 A;  2OVF A;  1JWG A;  1VPW A;  4N3A A;  1TJC A;  2L49 A;  2XEV A;  1IQU A;  4UQY A;  1N52 A;  4EEC A;  5G05 C;  4C9B B;  2R1J L;  1OUV A;  3IEG A;  1OWL A;  3HVE A;  1EF1 C;  2PM6 A;  2FI7 A;  3EHM A;  3FY4 A;  1UG3 A;  2KZT B;  3VTX A;  4HFG A;  2Y4T A;  5HI7 A;  3UX4 A;  3UT4 A;  2JLB A;  1N54 A;  2PM7 A;  2VYI A;  3CHO A;  1QP4 A;  3IBE A;  3U4T A;  2A4Z A;  4ANW A;  2L8N A;  1E7V A;  3LY7 A;  1OWM A;  1POU A;  2LYR A;  2OFY A;  5K98 B;  2PUA A;  2YIN A;  3PH0 C;  4N5C A;  4A1S A;  3O4Z A;  1UN8 A;  1ZS4 A;  3SHF A;  4YVO A;  2KCL A;  4I2W A;  2XCB A;  1GT0 C;  3S7J A;  4ANU A;  2HM8 A;  2WM9 A;  3ENE A;  1HF8 A;  3CSF A;  3D9J A;  4KXK B;  4FLH A;  3KJX A;  4KVO A;  3PE3 A;  4BSX A;  3O9X A;  3CHS A;  1QQA A;  3JQ1 A;  4YBA A;  3MJW A;  3PZD A;  4U0U A;  3ASF A;  3PNT B;  4U0Z A;  2VTB B;  2MOW A;  3CGH A;  4NUR A;  3AS4 A;  4EZK A;  1DVP A;  2VGX A;  2IVQ A;  4GZ6 A;  1ZVV A;  2CHX A;  4L2Y A;  3BDN A;  3ZXS A;  4I1M A;  4A55 A;  3AU4 A;  3CVL A;  4GCO A;  3U64 A;  3KXA A;  3L16 A;  3FEY A;  4IA8 A;  4I6E A;  2FJR A;  3F51 A;  1HF0 A;  1CQT A;  1U3D A;  3FEX A;  4WNF A;  5FZR A;  4EPZ A;  4JL0 A;  2FF4 A;  5BT1 A;  5BW8 C;  1X57 A;  4YG4 A;  1ZU2 A;  4YG1 A;  2GW1 A;  2NXP A;  3MKR A;  3PNL B;  1UTX A;  4ATG A;  5BV0 A;  2PE5 A;  5FZQ A;  5BNW A;  3EJN A;  3CHP A;  5FWQ A;  3S7B A;  4BTB A;  3OXF A;  4DLO A;  3UT8 A;  4WNG A;  4JA9 A;  1RZR A;  3LY8 A;  4PU3 C;  1ZZ6 A;  3FUN A;  3HYM B;  2XPY A;  3OQO A;  1O4X A;  4C0M A;  3ZYM A;  3QNK A;  5E76 A;  4I17 A;  4Y6C A;  4CT4 A;  2XIU A;  4X4E A;  4L1B A;  2QFC A;  2BNN A;  3SBT B;  4JC8 A;  4IWR A;  1IC8 A;  2VJ8 A;  1IHG A;  3UT7 A;  3QF3 A;  3P1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...