3U3WA

Crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
280
structure length
280
Chain Sequence
b'AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator PlcR protein
publication title Structural basis for the activation mechanism of the PlcR virulence regulator by the quorum-sensing signal peptide PapR.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transcription activator/dna
total genus 120
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3u3wA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u3wA02
2C0MA 3CECA 3KJXA 3SZ7A 4AY6A 1QQEA 3LY8A 2KEIA 4Z58A 4G25A 3UPVA 3ZPJA 4I8TA 2E2EA 4GA2A 3K9IA 2XCBA 1NZNA 2XEVA 5HI7A 1R63A 5BT1A 1OUVA 4JHRA 1P5QA 2LYLA 3D1NI 4JCXA 2XGMA 2OFYA 1ZBPA 1PRVA 5G04J 2UWJG 5CCMA 2EWTA 2VGXB 1POUA 2VQ2A 3QOUA 2XI8A 3VK0A 3G7DA 1NERA 4OB4A 3AS5A 1O4XA 1KT0A 4N2QA 3BD1A 3S7JA 3QWPA 4W9RA 2HINA 4PU4C 4GYOA 4CGWA 2V5FA 1HZ4A 4J1XA 1RZRD 3O9XA 1S7EA 1XNFA 3LYAA 2LYSA 4YG7B 4J0UA 2XCJA 4YNDA 5DBKA 3CLCA 1DWKA 4GHJA 5G05C 1ZVVA 3LKUA 4F3VA 2J9QA 4I2ZA 1HXIA 3S7BA 3RIBA 3RZZA 4O8BA 4BTBA 3FWVA 4JL0A 2PUDA 4YBAA 1DW9A 3JXBC 3LCAA 3ZKCA 4X4GA 3R1FA 1ZZCA 3VTXA 3BS3A 2R1JL 5ARGA 3ZHIA 3CVQA 1R69A 2MQKA 5EX3A 1XWRA 3TAXA 1JH9A 4YVOA 1HH8A 4XI0A 4HOSA 2KPJA 4GCOA 1RIOA 4CGVA 4JA7A 4HOUA 3AS4A 4FBIA 2IU7A 4GZ6A 4G1TA 3KAEA 2PUFA 3MKRA 2VGYA 3ASFA 4J8EA 4WNFA 1GT0C 4ME2A 1WH8A 1QP7A 3TGOA 5A7DB 2LYKA 5EKQD 5KJMA 1KLXA 4XI9A 3MA5A 1ZS4A 2Q7FA 2BNOA 2LYPA 5JJ6A 4FN3A 2HYZA 3UUXA 2VSNA 4B94A 2GZUA 4J1WA 2YHCA 3UQ3A 3QYXA 1ZPQA 2VGXA 4UQZA 3TG5A 3U3WA 3GZ1A 4KYOB 4Z5DA 4BWRA 2HSGA 2AUWA 3SF4A 2LNIA 5FZRA 2VYIA 2XCCA 4IA8A 2XGSA 3ZHMA 4RG6A 4UI9C 5A7LA 2DBAA 3UFDA 4GA1A 2VSYA 4UQYA 2BNMA 2ONDA 5FZSA 3JXDL 1IC8A 2O38A 2WPVA 3RKVA 5LCWC 3OQMA 1JWLA 2XGOA 3EUSA 3GW4A 2LYQA 4GZ3A 1ELWA 1QZ2A 2OOEA 4NRHB 4N2SA 4HOQA 3GBFA 3ZGQA 4X4DA 5KJKA 3L1PA 3ZFWA 4AY5A 3PE4A 3PDNA 1JFTA 3CVNA 3FYMA 3OXFA 4YG1A 4G23A 3CV0A 2KZ8A 1UXDA 3PE3A 3KZ3A 5M72A 3F51A 4U07A 4I9CA 4GA0A 5D0QD 1IYGA 1BDHA 2L6JA 1FCHA 3RJVA 3QKYA 1B0NA 3QWVA 5BW8C 5JJTA 2XSDC 1NA0A 4JA9A 4ABNA 1RZRA 2KCVA 1LMB3 3CKBA 2HO1A 4LEUA 3EDTB 3LY7A 1RZSA 3TG4A 3FP3A 1Y9QA 2PL2A 2WIUB 3CK9A 3G5GA 3FFLA 1ELRA 4N39A 2AXUA 1HF0A 2UY1B 4XIFA 2LYRA 2JCGA 4I2WA 2QFCA 1WAO1 1ZZ8A 4WNDA 4GPKA 3GN5B 4UI9K 1YA0A 3LFPA 5C1DA 3IVPA 4GYYA 2JVLA 3TRBA 4X4BA 2KEKA 4KBQA 3PXPA 3MLFA 3MEKA 1IHGA 3VTYA 3QQ6A 2PUEA 2O4AA 3B7HA 4RG9A 1NA3A 1JFSA 2FEZA 1UTXA 1KT1A 3FYAA 4BT8A 3OQOA 2MHKA 4I6RA 2O49A 2KCKA 4GYWA 3ZHEA 4WNGA 3ASGA 3O48A 1ZZ6A 4HOTA 2IVQA 3RU0A 3CVLA 2MEZA 4J8FA 3F6WA 1ZZBA 4HORA 2PUGA 5KJLA 4X4EA 3Q4AB 3QF3A 2XIUA 3OXGA 4NQ0A 1AU7A 3OMTA 3R9AB 4Z5HA 3SCGA 4CDRA 4Z5CA 2FO7A 5FZQA 5LCWJ 5DIZA 4N3BA 3RO3A 4G2VA 3CVPA 3ULQA 1QPZA 1RPEL 1LCCA 1ZZ9A 3FMYA 2ICPA 2WUSR 3F52A 1ADRA 3BDNA 2PQNA 3IEGA 1X2LA 3QWGA 3QDNA 3WXXA 2BJCA 1Y8MA 4A1SA 4EQFA 1PNRA 5CHEE 4I6UA 2B5AA 2GW1A 2FI7A 1WM5A 3GYZA 1Y7YA 2BNNA 2KEJA 2R5SA 2FJRA 4F8DA 1QQAA 4AIFA 3HZIB 2PQRA 2UY1A 3AS8A 2NC9A 1ZUGA 4IN3B 2BUGA 3MV2B 3GN5A 2IF4A 3CROL 4GQMA 4AM9A 2EF8A 2YQ8A 3ESKA 4U0UA 3LY9A 4JQDA 4G26A 3Q47B 5G05J 4NDWA 5ARFA 4H7YA 1CJGA 2FBNA 3CKCA 4GCNA 2PE5A 1CQTA 4G24A 3Q5MA 2LYJA 3S8QA 4U0SA 2PZIA 3URZA 4X4HA 1B89A 3MV3B 1ZU2A 5D0OD 3ASHA 4YG4A 2FF4A 2C0LA 1X57A 5CCLA 1WIZA 4MCTA 3GZ2A 4WNEA 3H5TA 5FTPA 5KJNA 3Q49B 1ZAYA 1OSLA 2WQHA 2LSUA 3CK7A 3SCFA 2L8NA 2IVGA 1PERL 2KATA 3E4BA 4UQXA 2OR1L 2PUBA 4Y42A 2JLBA 4YARA 1LQCA 5A6CA 1WH6A 3HYMB 1A17A 2IFUA 3KS2A 2LCVA 4BT9A 3OQNA 2IV1A 4N3CA 4I1AA 1BDIA 4MCXA 2LSVA 3S7FA 2A6CA 3CEQA 4O6FA 2D5VA 3CK8A 1LLIA 4N5CA 3LPZA 4IWRA 3QWWA 3U4TA 5K98B 5G04C 2Y4TA 1PRAA 2PUAA 3ASDA 4H7XA 4Y6WA 5AYWD 4N3AA 2AW6A 1PRUA 1W3BA 2ICTA 3N71A 1LCDA 1SQ8A 4KXKB 3KXAA 2GRLA 1E96B 1VPWA 4I17A 3KD7A 5FJYA 4Y6CA 3Q15A 5FT9A 1ZZ7A 2AVPA 5BNWA 3RO2A 3S7DA 1NEQA 2CROA 1OCTC 2GRMA 4BTAA 2AXZA 4UI9J 3SCHA 1TJCA 3OXLA 2KC7A 2PUCA 2L49A 1EFAA 3LISA 2EBYA 2I6HA 5JJ7A 2PIJA 3DNVB 4I9EA 4X4IA 2AXVA 4X4FA 1QP4A 2AWIA 4YVQC 2P58C 2H8RA 4PU3C 2PPXA 4U0ZA 1QQBA 4JCYA 4U04A 4APOA 3BEEA 4X4CA 4WUYA 1QP0A 2Y4UA 4IVZA 1PC2A 3ZN3A 2XPIA 1YSEA 3OP9A 4J8DA 1E3OC 4PU7A 2IUOA 3JXCL 4GZ5A 1WETA 1L1MA 4Z59A 2CSFA 4PU8A 2HR2A 2C2LA 4I6TA 1UXCA 3JYSA 3NF1A 2IVBA 2XJ3A 5EX0A 2KCLA 5HQ8A 3ZHEB 2R63A
chains in the Genus database with same CATH superfamily
3CVUA 3ML9A 4PS8A 4GTRA 4LG6A 1QQEA 3JUEA 4LERA 1E8ZA 4V3IA 2FO1E 2E2EA 2WXPA 2XCBA 4GPMA 1NZNA 3APCA 4OYSA 5BT1A 4Q96A 5H7PA 5LOZA 2EWTA 2BTDA 2LXMA 2YNQA 4YDYA 4P29A 4HNAD 1AWCB 3DEPA 1WY6A 3QWPA 2HINA 2V5FA 3O9XA 3LYAA 2J4DA 4J0UA 2JQEA 2XCJA 4HS2A 2V4HC 2L1PA 1DWKA 4GHJA 5G05C 4KZCA 3LKUA 4JW1A 4I2ZA 4BTBA 2PXBA 4UWKA 3ZKCA 3ZHIA 3CVQA 5ENOD 3HXFA 4HXIA 4HOSA 1FPPA 5D66A 3MYVA 4GCOA 3DPDA 3TWXA 4G8KA 4LNUD 5AJLA 3FH7A 2XPYA 4GZ6A 3JXJA 3ASFA 4MBGA 2X6HA 3SBTB 3UIPC 4WNFA 4ME2A 1WH8A 1OWLA 5LFAA 5A7DB 2LYKA 1BI7B 2FULA 4XI9A 1ZS4A 1OCOE 3UM1A 5IY5E 5J08A 2CHXA 4FN3A 3UUXA 2GZUA 3UQ3A 4UQZA 4ILHB 3U3WA 3I3NA 3GZ1A 4Z5DA 2PXDA 1N4PA 2GRPB 2LNIA 1OWMA 2VYIA 2XGSA 4UI9C 5ITZF 3TWRA 2DBAA 1E8WA 2R03A 4GA1A 3AG4E 1N4SA 5FZSA 1OT8A 1NI1A 3S2AA 4DX5D 2YBDA 3OQMA 1JWLA 2IOLA 3GW4A 2QYUA 3LJNA 4XE0A 3UM0A 1XGWA 4HOQA 5KJKA 3C3OA 4AY5A 5GAGi 1QYMA 3GZDA 3PDNA 2OVFA 4A3VA 1TNZA 4EZIA 2R2LA 3LQXA 3ZXSA 3APFA 5FWQA 3F51A 3SY2A 2X6KA 1FCHA 4O60A 4EK9A 3VLFA 5JJTA 1X81A 2J4BA 3TXNA 1NA0A 4CDNA 3L6AA 4ER0A 1LMB3 1FT1A 2CHWA 3J5QB 3TG4A 3OTNA 2RFAA 1OXJA 1Y9QA 3AAAC 3CK9A 4J8YA 1ELRA 3SHFA 2LYRA 4HB5A 4C48B 2LNMA 2QYJA 1MX6A 3C3RA 1ZZ8A 2WXRA 1RZ4A 2JVLA 3TRBA 3E30A 2P2CP 3PZ3A 2P9LG 2VEOA 2PXLA 3CHOA 3D9LA 4WWNA 2BEDA 3B7HA 3FUHA 4LNBA 2H6HA 1UTXA 5CERB 4KMOA 3OQOA 4HLLA 5AJDA 3ZHEA 3TWSA 5ENTD 1OCRE 2RFMA 4JZYA 2IVQA 2J08A 2I1KA 3RU0A 3F6WA 1YYHA 2DWZA 2WXFA 3QF3A 3OXGA 2OCCE 5DTQA 4JVSA 4DI4A 4Z5HA 5GAHi 1U2VG 4ER6A 3UM2A 2FO7A 5FZQA 5LCWJ 2KZTB 2X6IA 4N3BA 3CVPA 3HVEB 3ESLA 1LCCA 1ZZ9A 3U64A 2ICPA 3F52A 4JPSA 1OCCE 2KM4A 2WM9A 3QDNA 3WXXA 1HS6A 1UN9A 4UWHA 1Y8MA 4GTQA 1VDYA 3BG1B 2HCNA 1PNRA 2IOSA 1U3DA 2GW1A 2FI7A 3FTUA 1WM5A 1UJKA 2BNNA 2KEJA 2WXOA 4FC8A 3D9IA 3HZIB 1N9AA 3V2OA 3D9NA 1ZUGA 2BUGA 1H2TC 3ZIMA 3GN5A 2X6JA 3DPYA 2EF8A 1IQUA 1QZXA 1E7UA 2B6CA 2ETBA 1TN7A 4HRAA 2FBNA 3CVYA 3HHMA 3C72A 2V8SE 4EHMA 2V4LA 1O1TA 3D9KA 1O5MA 4X4HA 1B89A 1E8YA 4FLBA 1NW3A 4IULA 1WIZA 3JXIA 2DYSE 4MCTA 3GZ2A 5ENSD 5FTPA 3Q49B 4CRWA 3CK7A 3SCFA 1PERL 2KATA 2WXIA 2OR1L 2PUBA 2BKGA 4MS6A 4YARA 1E90A 2VJ8A 2LCVA 4I1AA 2LSVA 4FJYA 3KEZA 1H2VC 1H2UA 3IV0A 3CK8A 3LPZA 3NBNB 4BY6A 4IWRA 4ANWA 3TEPA 3W9GA 5G04C 2Y4TA 1PRAA 1UN8A 4H7XA 4Y6WA 5AYWD 4N3AA 2AW6A 1SQ8A 2BKKB 2WMOA 3FUFA 4GTPA 2XRZA 5ENNA 2AVPA 5BNWA 2CG3A 4DLQA 1OCTC 4FP7A 3VLEA 4BTAA 1Q2ZA 3G0TA 3OXLA 3ABKE 5CMWA 3LISA 2I6HA 1TNBA 4URKA 2DCPA 2F8YA 4NIKA 2AXVA 3PEUB 5KCMA 4FLHA 4L2LA 3SR4A 4YVQC 3L13A 3D9HA 4JCYA 3FUIA 2EIME 4JEHA 4X4CA 2X3MA 2WXKA 3UWPA 3LJ3A 4IVZA 1PC2A 3FTZA 1YSEA 1E3OC 5HKPA 2IUOA 2IO3C 3LDZA 3ME5A 2LO6A 4AVXA 2HR2A 2XRYA 3CIAA 4HRLA 3UX4A 4AV7A 1UXCA 1D8DA 3NF1A 5EYPF 3IXEA 2X38A 1TNUA 3CECA 4JEUA 3RRNB 2J07A 4AY6A 4Z58A 4G25A 3TXMA 3ZPJA 4I8TA 4BEPA 3FUMA 4EKGA 1R63A 3B7TA 1OUVA 5JA4D 1FVFA 4U7EB 3L08A 3TWVA 1P5QA 3AJIA 3FEXA 1MX2A 1HG2A 4JCXA 2XS8A 1ZBPA 3D9PA 5CCMA 1N54A 2VQ2A 3NZSA 3DSSA 3QOUA 3UINC 2HFZA 3G7DA 1NERA 1HQ1A 1UW4B 4A55A 4W9RA 3ULEG 4I1MA 4J1XA 2LYSA 3LVRE 4YNDA 4TUMA 5DBKA 1E7VA 4DX2A 3D3MA 4EZKA 3J5PA 1QB2A 2J9QA 3QAQA 1HXIA 3ZXPA 4TUUA 4B0ZA 2P9NG 4YDWA 3ZRHA 3FWVA 4JL0A 4YBAA 1H6PA 3JXBC 3LCAA 3T9KA 4AJWA 3VTXA 3BS3A 3IHVA 2WVIA 1R69A 2MQKA 5EX3A 3SI5A 3ZU7B 2LXLA 3TAXA 2KPJA 1RIOA 4XEIG 1TJFA 4FBIA 3A9XA 2PUFA 2VGYA 4DE8A 1K8KG 1QP7A 3TGOA 3A9YA 4KVOA 5KJMA 4ILGA 3TWQA 5JMND 1TNYA 1UG3A 3PUKA 2YHCA 2VGXA 3TG5A 1Z5SC 3ONKA 3QK0A 3KSQA 3EHMA 4RLYA 2AUWA 2J09A 4B8CB 3V79K 3SF4A 4IA8A 4Q69A 3R7QA 3ZHMA 2V3CC 3UFDA 2QC9A 4CDMA 2P9PG 4L23A 3CHRA 3P2BA 2R02A 4XZ4A 2PXFA 2LYQA 4GZ3A 1QZ2A 2WXNA 3NROA 4EQZA 2H6GA 4B89A 4X4DA 2NXPA 3ZFWA 2IQCA 3PE4A 3FYMA 4G23A 4PH4B 4FJZA 1UXDA 2Y1LE 4OVUA 1K1BA 5M72A 4DX7D 3ZKJA 5D0QD 1IYGA 1BDHA 1KPSB 1B0NA 3FH5A 4GAAA 1RZRA 1DCQA 3CKBA 3C3QA 1U3CA 4LEUA 3LY7A 5CRUA 3DSVA 2OEVA 4TV3A 2Y0BG 1HF0A 2JCGA 5E76A 5B1BE 5A23A 5EDSA 2J7WA 4I2WA 1JCQA 2QFCA 1WAO1 4KVMA 2H6IA 4O1OA 4GPKA 3GN5B 1O1SA 3PZ4A 4UI9K 3IVPA 3BU8A 5G55A 4KBQA 2HCSA 4HFGA 5JUWA 3MLFA 4D10C 1IHGA 4AXHA 3CQGB 1JCSA 2O4AA 4RG9A 2ODRD 2FEZA 3AG2E 3FH8A 3FYAA 2MHKA 2O49A 4GYWA 4WNGA 1RW2A 2H6FA 3ASGA 3EIQC 4BSXA 3DSWA 4HOTA 2XQ0A 3CVLA 2MEZA 2WQ7A 5KJLA 4I6JA 3B7RL 3NQPA 3I5PA 1IKND 4Z5CA 3MZLB 1SZ9A 5DIZA 2IO2C 3RO3A 4IRUA 3TL5A 1QPZA 3FTVA 3BDNA 4GTTA 3PREA 2PQNA 3IEGA 1X2LA 3QWGA 4EBAG 4A1SA 5DRYA 4EQFA 3PVLA 5CHEE 4I6UA 1N0QA 3UMVA 1NP7A 4QFVA 3TJPA 1LD8A 1QQAA 2UY1A 1OCZE 1QBQA 3HDXA 3UM3A 2ZGGA 2IF4A 4WWOA 1HG5A 4AM9A 2L6BA 3R9MA 3QARA 4JQDA 3PS6A 1X5BA 5ARFA 1AP7A 4H7YA 4MLPA 1CJGA 5AQ9A 4GCNA 5LX8A 2CFUA 1TN8A 3SX0A 2PZIA 3URZA 2VSXE 5ENPD 3MV3B 1TR4A 5D0OD 3B7SA 3JUIA 1X57A 5KJNA 4PUCA 2DZOA 2A5EA 2L8NA 2IVGA 5FQ7A 3Q9NC 2JLBA 1MFQC 1MJ0A 5BPPA 1IQRA 4UWLA 3LS8A 2Y3AA 3GUUA 4BT9A 3EUVA 2IV1A 4M7CA 3CEQA 2D5VA 4N5CA 3NZUA 1YCSB 3QWWA 5EILA 5LP0A 2PUAA 3CVXA 3ASDA 3RK6A 3G2UA 5CECB 1LCDA 4BETA 3KXAA 3RRMB 1E96B 1KZOA 4Y6CA 3QOWA 1TN6A 3CSTA 3L54A 3E32A 3DXMG 4EPZA 3ZVVA 5BV0A 1TJCA 4FU3A 5BXOA 3PH0C 2PUCA 4B8AA 1NL4A 3VWSA 2CHZA 2PIJA 3HXBA 4C9BB 3EJNA 4X4FA 3HIZA 4DI3A 2V0PA 1QP4A 2H8RA 4PU3C 3ZYLA 5KNHD 4TXQA 3MGBA 3UI2A 4APOA 3BEEA 2MRIA 3ASOE 3E34A 3SD5A 1H19A 3QC1A 1OWPA 3OP9A 4OAUC 4Z59A 2V5QC 1D9SA 3DBSA 3V2XA 4PU8A 2P9KG 2C2LA 3O4ZA 3U66A 4ANUA 4J8SA 4GTMA 2XJ3A 5HQ8A 3C5RA 3EU5A 5DRTA 3KJXA 3L22A 1BU9A 3SBSA 2RG8A 1WDYA 3UPVA 1TYQG 1MX4A 4GA2A 5AQAA 3FUKA 3DSXA 4JB8P 4ATZD 5HI7A 4JHRA 3ML8A 4Q94A 3D1NI 5EIDA 2ZISA 5G04J 2UWJG 4MKTA 2IONA 2VGXB 2XZTG 1POUA 5FQ4A 4U63A 3VK0A 4JXTA 1S63A 1O4XA 1KT0A 4A1GA 4N2QA 3BD1A 3S7JA 2JEKA 1HFAA 2A4ZA 4JHJA 1HZ4A 3L9TA 4U95D 4JD2G 1S7EA 1XNFA 2KXPC 4CCAA 4A63B 4YG7B 3Q75A 3CLCA 4F3VA 3HRAA 3ZW3A 4O8BA 3TFLA 2PUDA 3BG0B 4LCTA 3RSEG 4X4GA 3R1FA 1ZZCA 1TEZA 5ARGA 4DLOA 2PXTA 3PZ2A 2R05A 4A3TA 3UKUG 4ANVA 1JH9A 4YVOA 5FIOA 3DWLG 1HH8A 1TNOA 2VSOE 4GZCA 3JQ1A 4FA6A 2J49A 3AS4A 2IU7A 3KAEA 4HLEA 4J8EA 1IXVA 1PAQA 3FTWA 1D8EA 3FTYA 5FINA 3NAWA 5EKQD 1SW6A 4LRZA 4GB9A 3LXUX 3G2TA 2Q7FA 1JWFA 5AIJA 3MEJA 5JJ6A 2VSNA 3AU4A 4B94A 4J1WA 3U9WA 3QYXA 1ZPQA 3ONLA 4ATGA 5FQ8A 4KYOB 4BWRA 4HI8A 3IHYA 5FZRA 4RG6A 1DCEA 2CFZA 2XXPA 5A7LA 2VSYA 3QB2A 3ZYKA 4CT4A 3R09A 3JXDL 1IC8A 2CG2A 2O38A 3LVQE 3RKVA 1H6KA 4FHJA 4RQIA 3KL4A 4N2SA 3GBFA 3SQVA 3ENEA 3CVNA 3CV0A 2KZ8A 3PNTB 2GRRB 2I9CA 3PE3A 2DZNA 3W9FA 1JPLA 4U07A 4ER3A 2PXEA 4GA0A 2AJAA 1PY1A 2L6JA 3RJVA 1Z6TA 2YHEA 3ASNE 2KCVA 2HO1A 3QOXA 1RZSA 2ETCA 3G2VA 2WIUB 3G5GA 3FFLA 2AXUA 2UY1B 2XHEA 4L7TA 5DTMA 4WNDA 1INZA 1E8XA 4O1PA 3LFPA 5C1DA 4GYYA 4X4BA 4WAFA 2KEKA 1N95A 2WMNA 4LNGA 5C2YA 3HG0D 3FUNA 3VTYA 3QQ6A 2OVBA 3GZDC 1Y6IA 1NA3A 4C0EA 5KWDA 1JFSA 3MKQB 4K5CA 1KT1A 5AQ7A 4ANXA 4DE9A 1ZB1A 2FFHA 3O48A 4PS7A 1ZZ6A 1O1RA 4J8FA 4HORA 3CHPA 4X4EA 2WQ6A 2VGEA 2GRNB 4GTVA 4F53A 2XIUA 1AU7A 1YMPA 3FU5A 3CSFA 4G2VA 4DJAA 3CR3A 1NFIE 1RPEL 3FMYA 1LD7A 3CQCB 3Q9UC 3EHRA 2GRQB 1ADRA 3PEVB 5JHBA 3FUDA 3Q7FA 1Z3XA 3EIJA 2IU1A 3UTMA 1N11A 3RRUA 1SQMA 2R5SA 2ZGDA 2FJRA 3SNXA 1S64A 1MHQA 4EKIA 3AS8A 1GW6A 4IN3B 3PZDA 3CROL 3FUEA 4GQMA 3V31A 2YQ8A 3DSTA 3ESKA 3RAUA 4U0UA 3LY9A 5G05J 3UXGA 4FHKA 4NDWA 2P9IG 3CKCA 1CQTA 2DYRE 4F1SA 3EHQA 1Z3YA 1N52A 3ASHA 3B95A 3FEYA 2FF4A 4I6GA 1BLXB 2P9SG 3E33A 3NOGD 4WNEA 3H5TA 2ETAA 2LSUA 4BSZB 1V54E 3E4BA 3UKRG 4Y42A 1LQCA 5AN8A 4J6IA 5JHAA 2R17C 1BDIA 3S7FA 5J90A 5D2MC 2F8XK 3CGHA 3FUJA 4CEMA 2NSZA 2QY7A 3SFXA 2EQXA 1W3BA 2ICTA 3EHNA 3N71A 4KXKB 1G3NB 2GRLA 3JQ0A 3Q15A 5FT9A 1ZZ7A 3GZSA 1UJJA 1K1AA 2EIJE 3RO2A 2PM7A 1NEQA 2CROA 4WVLA 3S7DA 3UIOC 4BFRA 1DNPA 2PXUA 4UI9J 2KC7A 5DTRA 4R7LA 4LSZE 4OVVA 2EBYA 3UT4A 5CBOA 4K03A 2ZXWE 4M3OA 3X2QE 3DNVB 1L5JA 3M9LA 1A5EA 4X4IA 4L1BA 3PNLB 4N5QA 2P58C 2PPXA 3B7BA 4HRMB 2MOWA 3GZCA 3NOCD 3CLJA 2IY0C 1BD8A 4GU5A 1DC2A 4U04A 4BX9A 2WXLA 3QJZA 4WUYA 4AP2A 3CHQA 3T8MA 2Y69E 4G8LA 4U96D 2Y4UA 2XPIA 4FULA 4PS3A 4DK5A 4J8DA 1N94A 3SFYA 1JUQA 4F6RD 4FADA 4C0MA 3JXCL 2PXKA 2ZU6B 3FU3A 1ELKA 5ANRA 4PDXA 5CEAA 4HVBA 3QNKA 3JYSA 2IVBA 5EX0A 4ZHBA 4CT0A 1KZPA 2C0MA 2R63A 3SZ7A 4HI9A 3LY8A 2HM8A 2KEIA 3WG7E 5E75A 2ZIRA 4BERA 1FVHA 3HXDA 3IBEA 3K9IA 2XS1A 3MKQA 2XEVA 3T5XA 2WXQA 1IHBA 2RD0A 2LYLA 2R59A 2OFYA 2XGMA 3C98A 1PRVA 4JHKA 5CRVA 3NDBB 5AENA 4RVBA 2XI8A 4OB4A 2J7UA 3PZ1A 3AS5A 2LLVA 3LEWA 2LAIA 4G11A 3TWWA 4GMJA 4I6EA 4PU4C 3ABME 3D9MA 4GYOA 4CGWA 3AG1E 1RZRD 3FU6A 4K5AB 4TRQA 3FTSA 2KBXA 3FY4A 1JWGA 1LF8A 3R7RA 1ZVVA 3VLDA 3S7BA 4QQIA 3RIBA 3CHSA 3RZZA 1SA5A 4U8YD 1DW9A 2L9BA 2MYOA 2DIWA 4WWPA 4NACA 3UT7A 2LUHA 2R1JL 2ILRA 3CHMA 2PXQA 3F6QA 1XWRA 3HXCA 2A5UA 2NYJA 1K3ZD 4XI0A 3TWUA 4UUCA 2QZAA 4JA7A 3ZYMA 4CGVA 3PUJA 1U2ZA 4HOUA 2WXHA 3FHEA 3SO8A 4ZFHA 4G1TA 4I1OB 3MKRA 2I2OA 3IKOB 1GT0C 3FULA 3HXEA 4LUNU 2GROB 2XEEA 5ENRD 1KLXA 3L82A 3MA5A 2BNOA 2LYPA 1EF1C 2HYZA 1DVPA 3Q7AA 2OV8A 4TXRA 2LLWA 3PRZA 3E37A 2HSGA 4OBMA 2WB2A 3CVVA 2XCCA 3UT8A 2EILE 4UQYA 2VTBB 2BNMA 2ONDA 1BPOA 2IEJA 1FT2A 2WPVA 5LCWC 4NURA 2XGOA 5G2NA 3EUSA 5KNGA 3CVWA 3I4GA 2WXMA 4B93B 1ELWA 3MJWA 3EU9A 2OOEA 2GGFA 1HU3A 4NRHB 3DM5A 3B13A 5CBNA 3ZGQA 4EBAA 4ER7A 3L1PA 4L2YA 1JFTA 1EDUA 3OXFA 4YG1A 2J8SD 1WG0A 3DEOA 2PNNA 4IYPA 5DSXA 3KZ3A 2P9UG 2PM6A 4I9CA 3MX3A 3I4RB 3D9OA 3QKYA 3QWVA 5BW8C 3NZLA 2XSDC 2B0OE 4JA9A 4ABNA 4ACKA 3D9JA 4EECA 3EDTB 2YINA 5HRYA 2OEWA 4XKBA 3ABLE 5EYLA 3FP3A 2PL2A 4DPRA 2RKKA 5B3SE 4N39A 4XIFA 4DX1A 3NB2A 3V30A 4APFA 2JABA 2XZDG 1YA0A 4GTSA 3TWTA 4GTOA 3ZEFA 5ANLA 3PXPA 4UWGA 5AARA 2L0TB 3G2WA 3MEKA 3JCKC 2PUEA 5ENQD 1UOHA 4AEZC 3BUAA 4BT8A 4X8QA 4F7AA 4RSYA 4I6RA 2KCKA 3Q79A 1SA4A 3BQOA 3P1UA 3T8KA 2EIKE 4AOFA 3PE5A 1ZZBA 2PUGA 3G2SA 2PXVA 1MZCA 3Q4AB 3ZUVB 1DULA 4NQ0A 3OMTA 3R9AB 3SCGA 4CDRA 2XXAA 5DT2A 1N0RA 3ULQA 3NXHA 1S70B 2WUSR 3APDA 2M63A 5T4YA 4YDOA 1S0PA 2BJCA 2HE0A 4I43A 5HS0A 5BUZA 4J7WA 4HBDA 4YDEA 3T5VA 3DRAA 2B5AA 2XPZA 2F0YA 3DXKG 5AQBA 5CEDB 4BX8A 3GYZA 1Y7YA 1MYOA 4F8DA 4AIFA 1H0AA 2PQRA 4CYMD 2XXQA 3QFIA 1QNFA 2NC9A 3MV2B 3Q78A 4EZJA 3SFZA 1BI8B 4XKCA 3OKZA 3DSUA 4G26A 3Q47B 4DUIA 2E0IA 2PE5A 4G24A 3Q5MA 2LYJA 1H6OA 4HRNA 3ISMC 4ILIA 1OWOA 2L0IA 3S8QA 4U0SA 2XEHA 1ZU2A 1SVXA 4YG4A 2I1JA 2MXDA 2C0LA 3ZNGA 4DRXE 5CCLA 2EINE 3SGHA 3L17A 1ZAYA 4GMLA 1OSLA 1HX8A 2WQHA 3TELA 4JC8A 1MQSA 4UQXA 2IJGX 1LTXA 4ACLA 5A6CA 1WH6A 3HYMB 1A17A 2IFUA 1HE8A 2KZTA 3KS2A 4HQDA 3OWQA 5EIBE 3HVEA 3OQNA 4N3CA 2M4HA 4MCXA 3ULYA 1EYHA 2A6CA 4MRUA 3MCXA 1N4QA 4GMRA 2X6FA 4O6FA 1LLIA 4Z68A 4EZLA 4KT6B 1OY3D 4E6HA 3U4TA 3L16A 5K98B 3AU5A 4E85A 2VTBA 1PRUA 5BXUA 2DVWA 4U8HA 2WXGA 4XX5A 1VPWA 4I17A 3KD7A 2LAHA 5FJYA 5FQ6A 5T8IA 5B1AE 1OWNA 4TXPA 1EPUA 1SZAA 2GRMA 2AXZA 3SCHA 3Q73A 3AG3E 4CZ2D 5AAOA 2L49A 3FDHA 1EFAA 5JJ7A 3ZPXA 4ER5A 4I9EA 4UWFA 1V55E 2F37A 2AWIA 4KZ0A 4U0ZA 1QQBA 3KSLA 3OAWA 4OAVB 3FU0A 4K0RA 4BESA 1HO8A 3B7UX 5EN5D 5T3RA 1QP0A 2WXJA 4Q2JA 3ZN3A 5CMYA 2BF0X 3ZYQA 5KBAA 4PU7A 4L9PA 4GZ5A 5BV1A 1WETA 1HF8A 1N4RA 1L1MA 4DX6D 3KEAA 2CSFA 2XENA 3A9ZA 2PXPA 4GZDA 3FTXA 1JCRA 4I6TA 4K5BA 2KCLA 4U8VD 4F1PA 3ZHEB
chains in the Genus database with same CATH topology
2C0MA 3CECA 3KJXA 3ML9A 4JEUA 4PS8A 3RRNB 3L22A 3SZ7A 2J07A 3CVUA 3SBSA 1QQEA 3LY8A 4LERA 4AY6A 1E8ZA 4V3IA 2HM8A 2KEIA 4Z58A 4G25A 2RG8A 3UPVA 5E75A 3TXMA 3ZPJA 4I8TA 2E2EA 1FVHA 4GA2A 3IBEA 2WXPA 2XCBA 3K9IA 3MKQA 1NZNA 3APCA 3FUKA 2XEVA 4OYSA 3T5XA 3FUMA 5HI7A 1R63A 2WXQA 1OUVA 3B7TA 1FVFA 4JHRA 5BT1A 3L08A 3ML8A 4DLQA 4Q94A 1P5QA 2RD0A 2LYLA 3FEXA 3D1NI 4Q96A 1HG2A 4JCXA 2R59A 2OFYA 1ZBPA 2XGMA 3C98A 5LOZA 1PRVA 3D9PA 2UWJG 4JHKA 2EWTA 5G04J 1N54A 2BTDA 4MKTA 5CCMA 2IONA 2VGXB 2YNQA 1POUA 2VQ2A 5FQ4A 3NZSA 4U63A 5AENA 3QOUA 4RVBA 4P29A 2XI8A 3VK0A 3G7DA 4JXTA 1NERA 4OB4A 3AS5A 1O4XA 3LEWA 2LAIA 1UW4B 1KT0A 4A1GA 4A55A 3BD1A 4N2QA 4G11A 3S7JA 4GMJA 2JEKA 1WY6A 3QWPA 4I6EA 4W9RA 2HINA 4PU4C 1HFAA 2A4ZA 3D9MA 4GYOA 2V5FA 4I1MA 1HZ4A 4JHJA 4CGWA 4J1XA 1RZRD 3FU6A 3O9XA 1S7EA 1XNFA 3LYAA 4CCAA 2LYSA 4YG7B 2J4DA 2XCJA 3LVRE 4HS2A 4J0UA 4TRQA 4YNDA 5DBKA 3FTSA 1E7VA 3FY4A 1JWGA 3CLCA 1LF8A 1DWKA 4GHJA 5G05C 3D3MA 1ZVVA 3R7RA 4KZCA 4EZKA 3LKUA 4F3VA 2J9QA 4JW1A 3QAQA 1HXIA 4I2ZA 3VLDA 4TUUA 3S7BA 3RIBA 4B0ZA 3CHSA 3ZW3A 3RZZA 4O8BA 3ZRHA 4BTBA 3FWVA 4JL0A 2PUDA 4YBAA 1DW9A 2L9BA 3JXBC 3BG0B 4LCTA 2DIWA 3LCAA 4UWKA 4WWPA 4AJWA 3ZKCA 4X4GA 4NACA 3R1FA 1ZZCA 3UT7A 3VTXA 3BS3A 3IHVA 1TEZA 2WVIA 2R1JL 2ILRA 5ARGA 3CHMA 3ZHIA 3CVQA 1R69A 2MQKA 5EX3A 3SI5A 4DLOA 4A3TA 1XWRA 3TAXA 2A5UA 4ANVA 1JH9A 4YVOA 1HH8A 2VSOE 4HXIA 4GZCA 3JQ1A 4XI0A 2KPJA 4FA6A 2J49A 4HOSA 3MYVA 4GCOA 3DPDA 1RIOA 4CGVA 4JA7A 3ZYMA 3PUJA 4HOUA 1TJFA 3AS4A 5AJLA 2WXHA 4FBIA 2IU7A 3FH7A 2XPYA 3FHEA 4GZ6A 4G1TA 3KAEA 2PUFA 4I1OB 3MKRA 4HLEA 2I2OA 2VGYA 3ASFA 4J8EA 3IKOB 2X6HA 3SBTB 4WNFA 1PAQA 3FTWA 1GT0C 3FULA 4ME2A 3FTYA 1WH8A 1QP7A 4LUNU 1OWLA 5LFAA 3TGOA 5A7DB 2LYKA 5EKQD 4KVOA 2FULA 4LRZA 5KJMA 4GB9A 1KLXA 4XI9A 3LXUX 4ILGA 3MA5A 1ZS4A 3G2TA 2Q7FA 1JWFA 5J08A 2CHXA 5AIJA 2BNOA 2LYPA 5JJ6A 4FN3A 1EF1C 2HYZA 1DVPA 3UUXA 2OV8A 2VSNA 3AU4A 4B94A 1UG3A 3PUKA 2GZUA 4J1WA 2YHCA 3U9WA 3UQ3A 3QYXA 1ZPQA 2VGXA 4ILHB 3ONKA 4UQZA 3ONLA 3U3WA 3I3NA 3TG5A 3QK0A 4ATGA 5FQ8A 3GZ1A 4KYOB 3PRZA 4Z5DA 4BWRA 3EHMA 2HSGA 2AUWA 2J09A 4B8CB 3SF4A 2LNIA 5FZRA 3IHYA 1OWMA 2WB2A 2VYIA 3CVVA 2XCCA 4IA8A 4Q69A 3R7QA 2XGSA 3ZHMA 4RG6A 4UI9C 3UT8A 2CFZA 5A7LA 1E8WA 3UFDA 2DBAA 2VSYA 4GA1A 4UQYA 2VTBB 2BNMA 3QB2A 3ZYKA 4CDMA 4L23A 2ONDA 3CHRA 3P2BA 1BPOA 5FZSA 4CT4A 3S2AA 3JXDL 1IC8A 2CG2A 2O38A 2WPVA 4XZ4A 3LVQE 3RKVA 3OQMA 4NURA 5LCWC 1JWLA 2XGOA 5G2NA 3EUSA 2IOLA 3GW4A 3CVWA 2LYQA 1H6KA 4FHJA 3I4GA 2WXMA 4GZ3A 1ELWA 1QZ2A 2WXNA 3MJWA 2OOEA 2GGFA 1HU3A 4NRHB 4XE0A 4N2SA 3B13A 1XGWA 4B89A 4HOQA 3GBFA 3ZGQA 4EBAA 4X4DA 5KJKA 3L1PA 2NXPA 3ZFWA 2IQCA 4AY5A 4L2YA 3PE4A 3PDNA 2OVFA 1JFTA 1EDUA 3ENEA 3CVNA 4A3VA 3FYMA 3OXFA 4YG1A 4G23A 3CV0A 2KZ8A 4PH4B 3PNTB 4IYPA 4FJZA 1UXDA 2I9CA 3ZXSA 3PE3A 3APFA 5FWQA 4OVUA 3KZ3A 5M72A 1JPLA 2PM6A 3F51A 4U07A 4I9CA 2X6KA 4GA0A 1PY1A 5D0QD 1IYGA 1BDHA 2L6JA 1FCHA 3MX3A 3I4RB 3RJVA 3D9OA 3QKYA 1B0NA 1Z6TA 3QWVA 5BW8C 3VLFA 5JJTA 3FH5A 2XSDC 2J4BA 3TXNA 1NA0A 2YHEA 4GAAA 4JA9A 4ABNA 1RZRA 2KCVA 3L6AA 4CDNA 4ACKA 1LMB3 3CKBA 2HO1A 3D9JA 5BNWA 1U3CA 4LEUA 4EECA 3EDTB 3LY7A 2CHWA 1RZSA 3G2VA 3TG4A 2YINA 3OTNA 4XKBA 4TV3A 3FP3A 1Y9QA 2PL2A 4DPRA 2WIUB 3CK9A 3G5GA 3FFLA 1ELRA 4N39A 2AXUA 1HF0A 2UY1B 4XIFA 3SHFA 2LYRA 2JCGA 2XHEA 5E76A 5A23A 5EDSA 4APFA 4I2WA 2QFCA 1WAO1 4L7TA 4KVMA 1ZZ8A 4WNDA 4GPKA 3GN5B 1E8XA 4UI9K 1YA0A 3LFPA 5C1DA 1INZA 3IVPA 2WXRA 4GYYA 2JVLA 3TRBA 4X4BA 4WAFA 5G55A 2KEKA 4KBQA 5ANLA 3ZEFA 3PXPA 4UWGA 2WMNA 4HFGA 2L0TB 3MLFA 3G2WA 3MEKA 5C2YA 1IHGA 4D10C 3VTYA 3CQGB 3CHOA 3QQ6A 3FUNA 3D9LA 4AXHA 2OVBA 3JCKC 2PUEA 2O4AA 1Y6IA 3B7HA 4RG9A 4WWNA 3FUHA 4AEZC 1NA3A 4C0EA 1JFSA 2FEZA 1UTXA 3MKQB 3FH8A 4KMOA 1KT1A 3FYAA 4BT8A 4F7AA 3OQOA 2MHKA 4RSYA 4I6RA 2O49A 2KCKA 4GYWA 5AJDA 3ZHEA 4ANXA 4WNGA 3ASGA 3O48A 4PS7A 1ZZ6A 3EIQC 3P1UA 4BSXA 4JZYA 4HOTA 2IVQA 2J08A 2I1KA 2XQ0A 2MEZA 3CVLA 4J8FA 3RU0A 3F6WA 4AOFA 2WQ7A 1ZZBA 4HORA 2PUGA 3CHPA 4X4EA 3B7RL 3G2SA 3NQPA 4I6JA 3Q4AB 3I5PA 5KJLA 2WXFA 2WQ6A 3QF3A 4F53A 2XIUA 3OXGA 4NQ0A 1AU7A 3OMTA 4JVSA 3R9AB 4DI4A 4Z5HA 3SCGA 4CDRA 4Z5CA 3FU5A 2FO7A 3MZLB 5FZQA 1SZ9A 5LCWJ 5DIZA 2KZTB 2X6IA 3CSFA 4G2VA 4N3BA 3RO3A 4DJAA 3CVPA 3ULQA 3CR3A 3HVEB 4IRUA 3TL5A 1QPZA 1RPEL 1LCCA 1ZZ9A 3ESLA 3FTVA 3FMYA 3CQCB 3U64A 2ICPA 2WUSR 3F52A 3PEVB 1ADRA 3BDNA 3APDA 4JPSA 5JHBA 2M63A 5T4YA 3FUDA 2KM4A 2PQNA 3IEGA 3PREA 1S0PA 2WM9A 1X2LA 3QWGA 3QDNA 3WXXA 1HS6A 1UN9A 2BJCA 4UWHA 1Y8MA 4A1SA 4EBAG 1Z3XA 4I43A 3EIJA 4EQFA 1VDYA 5BUZA 3PVLA 3BG1B 2IOSA 1PNRA 5CHEE 2IU1A 4I6UA 1U3DA 3T5VA 2B5AA 2GW1A 2XPZA 3UMVA 2FI7A 1NP7A 3FTUA 1WM5A 4BX8A 1UJKA 1Y7YA 3GYZA 2BNNA 1SQMA 2KEJA 3RRUA 2R5SA 2FJRA 4QFVA 3SNXA 4F8DA 3TJPA 1QQAA 2WXOA 1MHQA 4FC8A 3D9IA 1H0AA 3HZIB 2PQRA 4AIFA 2UY1A 3AS8A 1QNFA 2NC9A 3D9NA 1ZUGA 1GW6A 3HDXA 4IN3B 2BUGA 1H2TC 3MV2B 3ZIMA 3GN5A 4EZJA 2IF4A 4WWOA 2X6JA 3CROL 3FUEA 4GQMA 1HG5A 3PZDA 3SFZA 4AM9A 3QARA 2EF8A 2YQ8A 3ESKA 4XKCA 1IQUA 4U0UA 3LY9A 4JQDA 1E7UA 4G26A 3Q47B 3PS6A 5G05J 1X5BA 4FHKA 4NDWA 5ARFA 4H7YA 4MLPA 1CJGA 2E0IA 2FBNA 3CKCA 4GCNA 2PE5A 1CQTA 3CVYA 3HHMA 4G24A 2V8SE 4F1SA 3Q5MA 2LYJA 5LX8A 2CFUA 4ILIA 1OWOA 2V4LA 2L0IA 3S8QA 3D9KA 4U0SA 1Z3YA 2PZIA 3URZA 4CT0A 2VSXE 4X4HA 1N52A 1B89A 1E8YA 3MV3B 1ZU2A 5D0OD 3ASHA 3B7SA 4FLBA 4YG4A 3FEYA 2FF4A 2I1JA 3JUIA 4I6GA 4IULA 2C0LA 1X57A 5CCLA 1WIZA 4MCTA 3GZ2A 4WNEA 3H5TA 5FTPA 3L17A 3SGHA 5KJNA 3Q49B 1ZAYA 4GMLA 1OSLA 4PUCA 1HX8A 2LSUA 2WQHA 4JC8A 3CK7A 3SCFA 4CRWA 2L8NA 1MQSA 2IVGA 1PERL 2KATA 2WXIA 3E4BA 2IJGX 2OR1L 2PUBA 4UQXA 5FQ7A 4Y42A 2JLBA 4MS6A 4YARA 1IQRA 1LQCA 1WH6A 4UWLA 4ACLA 3HYMB 5BPPA 1A17A 5A6CA 1E90A 2IFUA 3LS8A 1HE8A 2KZTA 2VJ8A 2Y3AA 3KS2A 4J6IA 5JHAA 2LCVA 4BT9A 2R17C 2X38A 3HVEA 3OQNA 2IV1A 4N3CA 4I1AA 1BDIA 4MCXA 2LSVA 4FJYA 3KEZA 1EYHA 2A6CA 3S7FA 1H2VC 4MRUA 5J90A 1H2UA 3IV0A 3CEQA 3MCXA 3CGHA 3FUJA 4O6FA 2D5VA 2X6FA 1LLIA 3CK8A 3LPZA 4N5CA 4BY6A 4KT6B 4CEMA 4EZLA 2NSZA 4IWRA 3NZUA 3QWWA 4E6HA 2QY7A 3U4TA 3L16A 5K98B 4ANWA 5G04C 2Y4TA 1PRAA 2PUAA 3ASDA 1UN8A 4H7XA 5LP0A 3CVXA 2EQXA 3AU5A 4Y6WA 5AYWD 3RK6A 3G2UA 4E85A 4N3AA 2VTBA 2AW6A 1PRUA 1W3BA 2ICTA 3EHNA 3N71A 1LCDA 1SQ8A 4KXKB 3KXAA 2WMOA 4U8HA 3FUFA 2WXGA 2GRLA 1E96B 4XX5A 3RRMB 1VPWA 3JQ0A 3KD7A 4I17A 2LAHA 5FJYA 2XRZA 5ENNA 5FQ6A 4Y6CA 5T8IA 3Q15A 3L54A 3CSTA 1OWNA 1ZZ7A 3GZSA 1UJJA 2AVPA 5FT9A 1EPUA 2CG3A 3RO2A 2PM7A 1NEQA 2CROA 1OCTC 2GRMA 1SZAA 4FP7A 2AXZA 3S7DA 1DNPA 4UI9J 3VLEA 3ZVVA 4BTAA 4EPZA 3SCHA 5BV0A 1TJCA 4FU3A 3OXLA 2KC7A 3PH0C 2PUCA 4B8AA 4BFRA 5CMWA 4R7LA 2L49A 3FDHA 1EFAA 3LISA 2EBYA 4OVVA 3UT4A 2I6HA 5JJ7A 2CHZA 4URKA 4K03A 2DCPA 4M3OA 2PIJA 3DNVB 4C9BB 1L5JA 3EJNA 4I9EA 4X4IA 2AXVA 4UWFA 3PEUB 4X4FA 4L1BA 5KCMA 3HIZA 4FLHA 4DI3A 2V0PA 3PNLB 1QP4A 4L2LA 2AWIA 4KZ0A 4YVQC 2P58C 2H8RA 4PU3C 3L13A 2PPXA 4U0ZA 1QQBA 3ZYLA 4JCYA 2MOWA 3OAWA 3CLJA 3FU0A 3FUIA 4K0RA 3MGBA 4GU5A 4U04A 4BX9A 4JEHA 4APOA 2WXLA 1HO8A 3B7UX 3BEEA 3QJZA 5T3RA 4X4CA 2X3MA 4WUYA 1QP0A 2WXJA 2MRIA 2WXKA 3CHQA 4AP2A 3T8MA 3LJ3A 3SD5A 2Y4UA 4IVZA 1H19A 1PC2A 3QC1A 3ZN3A 2XPIA 5CMYA 4FULA 3FTZA 4PS3A 1OWPA 1YSEA 2BF0X 3OP9A 4J8DA 3ZYQA 4DK5A 1JUQA 1E3OC 4FADA 4PU7A 2IUOA 4C0MA 3JXCL 4GZ5A 3LDZA 5BV1A 2ZU6B 1WETA 3FU3A 1HF8A 1L1MA 4Z59A 1ELKA 5ANRA 2CSFA 4PDXA 2LO6A 3DBSA 4HVBA 4AVXA 4PU8A 2HR2A 4GZDA 2C2LA 3O4ZA 3FTXA 3U66A 4ANUA 2XRYA 3CIAA 3UX4A 4I6TA 4AV7A 1UXCA 4J8SA 3QNKA 3JYSA 3NF1A 2IVBA 2XJ3A 5EX0A 2KCLA 5HQ8A 3ZHEB 2R63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0M A;  3CEC A;  3KJX A;  3SZ7 A;  4AY6 A;  1QQE A;  3LY8 A;  2KEI A;  4Z58 A;  4G25 A;  3UPV A;  3ZPJ A;  4I8T A;  2E2E A;  4GA2 A;  3K9I A;  2XCB A;  1NZN A;  2XEV A;  5HI7 A;  1R63 A;  5BT1 A;  1OUV A;  4JHR A;  1P5Q A;  2LYL A;  3D1N I;  4JCX A;  2XGM A;  2OFY A;  1ZBP A;  1PRV A;  5G04 J;  2UWJ G;  5CCM A;  2EWT A;  2VGX B;  1POU A;  2VQ2 A;  3QOU A;  2XI8 A;  3VK0 A;  3G7D A;  1NER A;  4OB4 A;  3AS5 A;  1O4X A;  1KT0 A;  4N2Q A;  3BD1 A;  3S7J A;  3QWP A;  4W9R A;  2HIN A;  4PU4 C;  4GYO A;  4CGW A;  2V5F A;  1HZ4 A;  4J1X A;  1RZR D;  3O9X A;  1S7E A;  1XNF A;  3LYA A;  2LYS A;  4YG7 B;  4J0U A;  2XCJ A;  4YND A;  5DBK A;  3CLC A;  1DWK A;  4GHJ A;  5G05 C;  1ZVV A;  3LKU A;  4F3V A;  2J9Q A;  4I2Z A;  1HXI A;  3S7B A;  3RIB A;  3RZZ A;  4O8B A;  4BTB A;  3FWV A;  4JL0 A;  2PUD A;  4YBA A;  1DW9 A;  3JXB C;  3LCA A;  3ZKC A;  4X4G A;  3R1F A;  1ZZC A;  3VTX A;  3BS3 A;  2R1J L;  5ARG A;  3ZHI A;  3CVQ A;  1R69 A;  2MQK A;  5EX3 A;  1XWR A;  3TAX A;  1JH9 A;  4YVO A;  1HH8 A;  4XI0 A;  4HOS A;  2KPJ A;  4GCO A;  1RIO A;  4CGV A;  4JA7 A;  4HOU A;  3AS4 A;  4FBI A;  2IU7 A;  4GZ6 A;  4G1T A;  3KAE A;  2PUF A;  3MKR A;  2VGY A;  3ASF A;  4J8E A;  4WNF A;  1GT0 C;  4ME2 A;  1WH8 A;  1QP7 A;  3TGO A;  5A7D B;  2LYK A;  5EKQ D;  5KJM A;  1KLX A;  4XI9 A;  3MA5 A;  1ZS4 A;  2Q7F A;  2BNO A;  2LYP A;  5JJ6 A;  4FN3 A;  2HYZ A;  3UUX A;  2VSN A;  4B94 A;  2GZU A;  4J1W A;  2YHC A;  3UQ3 A;  3QYX A;  1ZPQ A;  2VGX A;  4UQZ A;  3TG5 A;  3U3W A;  3GZ1 A;  4KYO B;  4Z5D A;  4BWR A;  2HSG A;  2AUW A;  3SF4 A;  2LNI A;  5FZR A;  2VYI A;  2XCC A;  4IA8 A;  2XGS A;  3ZHM A;  4RG6 A;  4UI9 C;  5A7L A;  2DBA A;  3UFD A;  4GA1 A;  2VSY A;  4UQY A;  2BNM A;  2OND A;  5FZS A;  3JXD L;  1IC8 A;  2O38 A;  2WPV A;  3RKV A;  5LCW C;  3OQM A;  1JWL A;  2XGO A;  3EUS A;  3GW4 A;  2LYQ A;  4GZ3 A;  1ELW A;  1QZ2 A;  2OOE A;  4NRH B;  4N2S A;  4HOQ A;  3GBF A;  3ZGQ A;  4X4D A;  5KJK A;  3L1P A;  3ZFW A;  4AY5 A;  3PE4 A;  3PDN A;  1JFT A;  3CVN A;  3FYM A;  3OXF A;  4YG1 A;  4G23 A;  3CV0 A;  2KZ8 A;  1UXD A;  3PE3 A;  3KZ3 A;  5M72 A;  3F51 A;  4U07 A;  4I9C A;  4GA0 A;  5D0Q D;  1IYG A;  1BDH A;  2L6J A;  1FCH A;  3RJV A;  3QKY A;  1B0N A;  3QWV A;  5BW8 C;  5JJT A;  2XSD C;  1NA0 A;  4JA9 A;  4ABN A;  1RZR A;  2KCV A;  1LMB 3;  3CKB A;  2HO1 A;  4LEU A;  3EDT B;  3LY7 A;  1RZS A;  3TG4 A;  3FP3 A;  1Y9Q A;  2PL2 A;  2WIU B;  3CK9 A;  3G5G A;  3FFL A;  1ELR A;  4N39 A;  2AXU A;  1HF0 A;  2UY1 B;  4XIF A;  2LYR A;  2JCG A;  4I2W A;  2QFC A;  1WAO 1;  1ZZ8 A;  4WND A;  4GPK A;  3GN5 B;  4UI9 K;  1YA0 A;  3LFP A;  5C1D A;  3IVP A;  4GYY A;  2JVL A;  3TRB A;  4X4B A;  2KEK A;  4KBQ A;  3PXP A;  3MLF A;  3MEK A;  1IHG A;  3VTY A;  3QQ6 A;  2PUE A;  2O4A A;  3B7H A;  4RG9 A;  1NA3 A;  1JFS A;  2FEZ A;  1UTX A;  1KT1 A;  3FYA A;  4BT8 A;  3OQO A;  2MHK A;  4I6R A;  2O49 A;  2KCK A;  4GYW A;  3ZHE A;  4WNG A;  3ASG A;  3O48 A;  1ZZ6 A;  4HOT A;  2IVQ A;  3RU0 A;  3CVL A;  2MEZ A;  4J8F A;  3F6W A;  1ZZB A;  4HOR A;  2PUG A;  5KJL A;  4X4E A;  3Q4A B;  3QF3 A;  2XIU A;  3OXG A;  4NQ0 A;  1AU7 A;  3OMT A;  3R9A B;  4Z5H A;  3SCG A;  4CDR A;  4Z5C A;  2FO7 A;  5FZQ A;  5LCW J;  5DIZ A;  4N3B A;  3RO3 A;  4G2V A;  3CVP A;  3ULQ A;  1QPZ A;  1RPE L;  1LCC A;  1ZZ9 A;  3FMY A;  2ICP A;  2WUS R;  3F52 A;  1ADR A;  3BDN A;  2PQN A;  3IEG A;  1X2L A;  3QWG A;  3QDN A;  3WXX A;  2BJC A;  1Y8M A;  4A1S A;  4EQF A;  1PNR A;  5CHE E;  4I6U A;  2B5A A;  2GW1 A;  2FI7 A;  1WM5 A;  3GYZ A;  1Y7Y A;  2BNN A;  2KEJ A;  2R5S A;  2FJR A;  4F8D A;  1QQA A;  4AIF A;  3HZI B;  2PQR A;  2UY1 A;  3AS8 A;  2NC9 A;  1ZUG A;  4IN3 B;  2BUG A;  3MV2 B;  3GN5 A;  2IF4 A;  3CRO L;  4GQM A;  4AM9 A;  2EF8 A;  2YQ8 A;  3ESK A;  4U0U A;  3LY9 A;  4JQD A;  4G26 A;  3Q47 B;  5G05 J;  4NDW A;  5ARF A;  4H7Y A;  1CJG A;  2FBN A;  3CKC A;  4GCN A;  2PE5 A;  1CQT A;  4G24 A;  3Q5M A;  2LYJ A;  3S8Q A;  4U0S A;  2PZI A;  3URZ A;  4X4H A;  1B89 A;  3MV3 B;  1ZU2 A;  5D0O D;  3ASH A;  4YG4 A;  2FF4 A;  2C0L A;  1X57 A;  5CCL A;  1WIZ A;  4MCT A;  3GZ2 A;  4WNE A;  3H5T A;  5FTP A;  5KJN A;  3Q49 B;  1ZAY A;  1OSL A;  2WQH A;  2LSU A;  3CK7 A;  3SCF A;  2L8N A;  2IVG A;  1PER L;  2KAT A;  3E4B A;  4UQX A;  2OR1 L;  2PUB A;  4Y42 A;  2JLB A;  4YAR A;  1LQC A;  5A6C A;  1WH6 A;  3HYM B;  1A17 A;  2IFU A;  3KS2 A;  2LCV A;  4BT9 A;  3OQN A;  2IV1 A;  4N3C A;  4I1A A;  1BDI A;  4MCX A;  2LSV A;  3S7F A;  2A6C A;  3CEQ A;  4O6F A;  2D5V A;  3CK8 A;  1LLI A;  4N5C A;  3LPZ A;  4IWR A;  3QWW A;  3U4T A;  5K98 B;  5G04 C;  2Y4T A;  1PRA A;  2PUA A;  3ASD A;  4H7X A;  4Y6W A;  5AYW D;  4N3A A;  2AW6 A;  1PRU A;  1W3B A;  2ICT A;  3N71 A;  1LCD A;  1SQ8 A;  4KXK B;  3KXA A;  2GRL A;  1E96 B;  1VPW A;  4I17 A;  3KD7 A;  5FJY A;  4Y6C A;  3Q15 A;  5FT9 A;  1ZZ7 A;  2AVP A;  5BNW A;  3RO2 A;  3S7D A;  1NEQ A;  2CRO A;  1OCT C;  2GRM A;  4BTA A;  2AXZ A;  4UI9 J;  3SCH A;  1TJC A;  3OXL A;  2KC7 A;  2PUC A;  2L49 A;  1EFA A;  3LIS A;  2EBY A;  2I6H A;  5JJ7 A;  2PIJ A;  3DNV B;  4I9E A;  4X4I A;  2AXV A;  4X4F A;  1QP4 A;  2AWI A;  4YVQ C;  2P58 C;  2H8R A;  4PU3 C;  2PPX A;  4U0Z A;  1QQB A;  4JCY A;  4U04 A;  4APO A;  3BEE A;  4X4C A;  4WUY A;  1QP0 A;  2Y4U A;  4IVZ A;  1PC2 A;  3ZN3 A;  2XPI A;  1YSE A;  3OP9 A;  4J8D A;  1E3O C;  4PU7 A;  2IUO A;  3JXC L;  4GZ5 A;  1WET A;  1L1M A;  4Z59 A;  2CSF A;  4PU8 A;  2HR2 A;  2C2L A;  4I6T A;  1UXC A;  3JYS A;  3NF1 A;  2IVB A;  2XJ3 A;  5EX0 A;  2KCL A;  5HQ8 A;  3ZHE B;  2R63 A; 
#chains in the Genus database with same CATH topology
 3CVU A;  3ML9 A;  4PS8 A;  4GTR A;  4LG6 A;  1QQE A;  3JUE A;  4LER A;  1E8Z A;  4V3I A;  2FO1 E;  2E2E A;  2WXP A;  2XCB A;  4GPM A;  1NZN A;  3APC A;  4OYS A;  5BT1 A;  4Q96 A;  5H7P A;  5LOZ A;  2EWT A;  2BTD A;  2LXM A;  2YNQ A;  4YDY A;  4P29 A;  4HNA D;  1AWC B;  3DEP A;  1WY6 A;  3QWP A;  2HIN A;  2V5F A;  3O9X A;  3LYA A;  2J4D A;  4J0U A;  2JQE A;  2XCJ A;  4HS2 A;  2V4H C;  2L1P A;  1DWK A;  4GHJ A;  5G05 C;  4KZC A;  3LKU A;  4JW1 A;  4I2Z A;  4BTB A;  2PXB A;  4UWK A;  3ZKC A;  3ZHI A;  3CVQ A;  5ENO D;  3HXF A;  4HXI A;  4HOS A;  1FPP A;  5D66 A;  3MYV A;  4GCO A;  3DPD A;  3TWX A;  4G8K A;  4LNU D;  5AJL A;  3FH7 A;  2XPY A;  4GZ6 A;  3JXJ A;  3ASF A;  4MBG A;  2X6H A;  3SBT B;  3UIP C;  4WNF A;  4ME2 A;  1WH8 A;  1OWL A;  5LFA A;  5A7D B;  2LYK A;  1BI7 B;  2FUL A;  4XI9 A;  1ZS4 A;  1OCO E;  3UM1 A;  5IY5 E;  5J08 A;  2CHX A;  4FN3 A;  3UUX A;  2GZU A;  3UQ3 A;  4UQZ A;  4ILH B;  3U3W A;  3I3N A;  3GZ1 A;  4Z5D A;  2PXD A;  1N4P A;  2GRP B;  2LNI A;  1OWM A;  2VYI A;  2XGS A;  4UI9 C;  5ITZ F;  3TWR A;  2DBA A;  1E8W A;  2R03 A;  4GA1 A;  3AG4 E;  1N4S A;  5FZS A;  1OT8 A;  1NI1 A;  3S2A A;  4DX5 D;  2YBD A;  3OQM A;  1JWL A;  2IOL A;  3GW4 A;  2QYU A;  3LJN A;  4XE0 A;  3UM0 A;  1XGW A;  4HOQ A;  5KJK A;  3C3O A;  4AY5 A;  5GAG i;  1QYM A;  3GZD A;  3PDN A;  2OVF A;  4A3V A;  1TNZ A;  4EZI A;  2R2L A;  3LQX A;  3ZXS A;  3APF A;  5FWQ A;  3F51 A;  3SY2 A;  2X6K A;  1FCH A;  4O60 A;  4EK9 A;  3VLF A;  5JJT A;  1X81 A;  2J4B A;  3TXN A;  1NA0 A;  4CDN A;  3L6A A;  4ER0 A;  1LMB 3;  1FT1 A;  2CHW A;  3J5Q B;  3TG4 A;  3OTN A;  2RFA A;  1OXJ A;  1Y9Q A;  3AAA C;  3CK9 A;  4J8Y A;  1ELR A;  3SHF A;  2LYR A;  4HB5 A;  4C48 B;  2LNM A;  2QYJ A;  1MX6 A;  3C3R A;  1ZZ8 A;  2WXR A;  1RZ4 A;  2JVL A;  3TRB A;  3E30 A;  2P2C P;  3PZ3 A;  2P9L G;  2VEO A;  2PXL A;  3CHO A;  3D9L A;  4WWN A;  2BED A;  3B7H A;  3FUH A;  4LNB A;  2H6H A;  1UTX A;  5CER B;  4KMO A;  3OQO A;  4HLL A;  5AJD A;  3ZHE A;  3TWS A;  5ENT D;  1OCR E;  2RFM A;  4JZY A;  2IVQ A;  2J08 A;  2I1K A;  3RU0 A;  3F6W A;  1YYH A;  2DWZ A;  2WXF A;  3QF3 A;  3OXG A;  2OCC E;  5DTQ A;  4JVS A;  4DI4 A;  4Z5H A;  5GAH i;  1U2V G;  4ER6 A;  3UM2 A;  2FO7 A;  5FZQ A;  5LCW J;  2KZT B;  2X6I A;  4N3B A;  3CVP A;  3HVE B;  3ESL A;  1LCC A;  1ZZ9 A;  3U64 A;  2ICP A;  3F52 A;  4JPS A;  1OCC E;  2KM4 A;  2WM9 A;  3QDN A;  3WXX A;  1HS6 A;  1UN9 A;  4UWH A;  1Y8M A;  4GTQ A;  1VDY A;  3BG1 B;  2HCN A;  1PNR A;  2IOS A;  1U3D A;  2GW1 A;  2FI7 A;  3FTU A;  1WM5 A;  1UJK A;  2BNN A;  2KEJ A;  2WXO A;  4FC8 A;  3D9I A;  3HZI B;  1N9A A;  3V2O A;  3D9N A;  1ZUG A;  2BUG A;  1H2T C;  3ZIM A;  3GN5 A;  2X6J A;  3DPY A;  2EF8 A;  1IQU A;  1QZX A;  1E7U A;  2B6C A;  2ETB A;  1TN7 A;  4HRA A;  2FBN A;  3CVY A;  3HHM A;  3C72 A;  2V8S E;  4EHM A;  2V4L A;  1O1T A;  3D9K A;  1O5M A;  4X4H A;  1B89 A;  1E8Y A;  4FLB A;  1NW3 A;  4IUL A;  1WIZ A;  3JXI A;  2DYS E;  4MCT A;  3GZ2 A;  5ENS D;  5FTP A;  3Q49 B;  4CRW A;  3CK7 A;  3SCF A;  1PER L;  2KAT A;  2WXI A;  2OR1 L;  2PUB A;  2BKG A;  4MS6 A;  4YAR A;  1E90 A;  2VJ8 A;  2LCV A;  4I1A A;  2LSV A;  4FJY A;  3KEZ A;  1H2V C;  1H2U A;  3IV0 A;  3CK8 A;  3LPZ A;  3NBN B;  4BY6 A;  4IWR A;  4ANW A;  3TEP A;  3W9G A;  5G04 C;  2Y4T A;  1PRA A;  1UN8 A;  4H7X A;  4Y6W A;  5AYW D;  4N3A A;  2AW6 A;  1SQ8 A;  2BKK B;  2WMO A;  3FUF A;  4GTP A;  2XRZ A;  5ENN A;  2AVP A;  5BNW A;  2CG3 A;  4DLQ A;  1OCT C;  4FP7 A;  3VLE A;  4BTA A;  1Q2Z A;  3G0T A;  3OXL A;  3ABK E;  5CMW A;  3LIS A;  2I6H A;  1TNB A;  4URK A;  2DCP A;  2F8Y A;  4NIK A;  2AXV A;  3PEU B;  5KCM A;  4FLH A;  4L2L A;  3SR4 A;  4YVQ C;  3L13 A;  3D9H A;  4JCY A;  3FUI A;  2EIM E;  4JEH A;  4X4C A;  2X3M A;  2WXK A;  3UWP A;  3LJ3 A;  4IVZ A;  1PC2 A;  3FTZ A;  1YSE A;  1E3O C;  5HKP A;  2IUO A;  2IO3 C;  3LDZ A;  3ME5 A;  2LO6 A;  4AVX A;  2HR2 A;  2XRY A;  3CIA A;  4HRL A;  3UX4 A;  4AV7 A;  1UXC A;  1D8D A;  3NF1 A;  5EYP F;  3IXE A;  2X38 A;  1TNU A;  3CEC A;  4JEU A;  3RRN B;  2J07 A;  4AY6 A;  4Z58 A;  4G25 A;  3TXM A;  3ZPJ A;  4I8T A;  4BEP A;  3FUM A;  4EKG A;  1R63 A;  3B7T A;  1OUV A;  5JA4 D;  1FVF A;  4U7E B;  3L08 A;  3TWV A;  1P5Q A;  3AJI A;  3FEX A;  1MX2 A;  1HG2 A;  4JCX A;  2XS8 A;  1ZBP A;  3D9P A;  5CCM A;  1N54 A;  2VQ2 A;  3NZS A;  3DSS A;  3QOU A;  3UIN C;  2HFZ A;  3G7D A;  1NER A;  1HQ1 A;  1UW4 B;  4A55 A;  4W9R A;  3ULE G;  4I1M A;  4J1X A;  2LYS A;  3LVR E;  4YND A;  4TUM A;  5DBK A;  1E7V A;  4DX2 A;  3D3M A;  4EZK A;  3J5P A;  1QB2 A;  2J9Q A;  3QAQ A;  1HXI A;  3ZXP A;  4TUU A;  4B0Z A;  2P9N G;  4YDW A;  3ZRH A;  3FWV A;  4JL0 A;  4YBA A;  1H6P A;  3JXB C;  3LCA A;  3T9K A;  4AJW A;  3VTX A;  3BS3 A;  3IHV A;  2WVI A;  1R69 A;  2MQK A;  5EX3 A;  3SI5 A;  3ZU7 B;  2LXL A;  3TAX A;  2KPJ A;  1RIO A;  4XEI G;  1TJF A;  4FBI A;  3A9X A;  2PUF A;  2VGY A;  4DE8 A;  1K8K G;  1QP7 A;  3TGO A;  3A9Y A;  4KVO A;  5KJM A;  4ILG A;  3TWQ A;  5JMN D;  1TNY A;  1UG3 A;  3PUK A;  2YHC A;  2VGX A;  3TG5 A;  1Z5S C;  3ONK A;  3QK0 A;  3KSQ A;  3EHM A;  4RLY A;  2AUW A;  2J09 A;  4B8C B;  3V79 K;  3SF4 A;  4IA8 A;  4Q69 A;  3R7Q A;  3ZHM A;  2V3C C;  3UFD A;  2QC9 A;  4CDM A;  2P9P G;  4L23 A;  3CHR A;  3P2B A;  2R02 A;  4XZ4 A;  2PXF A;  2LYQ A;  4GZ3 A;  1QZ2 A;  2WXN A;  3NRO A;  4EQZ A;  2H6G A;  4B89 A;  4X4D A;  2NXP A;  3ZFW A;  2IQC A;  3PE4 A;  3FYM A;  4G23 A;  4PH4 B;  4FJZ A;  1UXD A;  2Y1L E;  4OVU A;  1K1B A;  5M72 A;  4DX7 D;  3ZKJ A;  5D0Q D;  1IYG A;  1BDH A;  1KPS B;  1B0N A;  3FH5 A;  4GAA A;  1RZR A;  1DCQ A;  3CKB A;  3C3Q A;  1U3C A;  4LEU A;  3LY7 A;  5CRU A;  3DSV A;  2OEV A;  4TV3 A;  2Y0B G;  1HF0 A;  2JCG A;  5E76 A;  5B1B E;  5A23 A;  5EDS A;  2J7W A;  4I2W A;  1JCQ A;  2QFC A;  1WAO 1;  4KVM A;  2H6I A;  4O1O A;  4GPK A;  3GN5 B;  1O1S A;  3PZ4 A;  4UI9 K;  3IVP A;  3BU8 A;  5G55 A;  4KBQ A;  2HCS A;  4HFG A;  5JUW A;  3MLF A;  4D10 C;  1IHG A;  4AXH A;  3CQG B;  1JCS A;  2O4A A;  4RG9 A;  2ODR D;  2FEZ A;  3AG2 E;  3FH8 A;  3FYA A;  2MHK A;  2O49 A;  4GYW A;  4WNG A;  1RW2 A;  2H6F A;  3ASG A;  3EIQ C;  4BSX A;  3DSW A;  4HOT A;  2XQ0 A;  3CVL A;  2MEZ A;  2WQ7 A;  5KJL A;  4I6J A;  3B7R L;  3NQP A;  3I5P A;  1IKN D;  4Z5C A;  3MZL B;  1SZ9 A;  5DIZ A;  2IO2 C;  3RO3 A;  4IRU A;  3TL5 A;  1QPZ A;  3FTV A;  3BDN A;  4GTT A;  3PRE A;  2PQN A;  3IEG A;  1X2L A;  3QWG A;  4EBA G;  4A1S A;  5DRY A;  4EQF A;  3PVL A;  5CHE E;  4I6U A;  1N0Q A;  3UMV A;  1NP7 A;  4QFV A;  3TJP A;  1LD8 A;  1QQA A;  2UY1 A;  1OCZ E;  1QBQ A;  3HDX A;  3UM3 A;  2ZGG A;  2IF4 A;  4WWO A;  1HG5 A;  4AM9 A;  2L6B A;  3R9M A;  3QAR A;  4JQD A;  3PS6 A;  1X5B A;  5ARF A;  1AP7 A;  4H7Y A;  4MLP A;  1CJG A;  5AQ9 A;  4GCN A;  5LX8 A;  2CFU A;  1TN8 A;  3SX0 A;  2PZI A;  3URZ A;  2VSX E;  5ENP D;  3MV3 B;  1TR4 A;  5D0O D;  3B7S A;  3JUI A;  1X57 A;  5KJN A;  4PUC A;  2DZO A;  2A5E A;  2L8N A;  2IVG A;  5FQ7 A;  3Q9N C;  2JLB A;  1MFQ C;  1MJ0 A;  5BPP A;  1IQR A;  4UWL A;  3LS8 A;  2Y3A A;  3GUU A;  4BT9 A;  3EUV A;  2IV1 A;  4M7C A;  3CEQ A;  2D5V A;  4N5C A;  3NZU A;  1YCS B;  3QWW A;  5EIL A;  5LP0 A;  2PUA A;  3CVX A;  3ASD A;  3RK6 A;  3G2U A;  5CEC B;  1LCD A;  4BET A;  3KXA A;  3RRM B;  1E96 B;  1KZO A;  4Y6C A;  3QOW A;  1TN6 A;  3CST A;  3L54 A;  3E32 A;  3DXM G;  4EPZ A;  3ZVV A;  5BV0 A;  1TJC A;  4FU3 A;  5BXO A;  3PH0 C;  2PUC A;  4B8A A;  1NL4 A;  3VWS A;  2CHZ A;  2PIJ A;  3HXB A;  4C9B B;  3EJN A;  4X4F A;  3HIZ A;  4DI3 A;  2V0P A;  1QP4 A;  2H8R A;  4PU3 C;  3ZYL A;  5KNH D;  4TXQ A;  3MGB A;  3UI2 A;  4APO A;  3BEE A;  2MRI A;  3ASO E;  3E34 A;  3SD5 A;  1H19 A;  3QC1 A;  1OWP A;  3OP9 A;  4OAU C;  4Z59 A;  2V5Q C;  1D9S A;  3DBS A;  3V2X A;  4PU8 A;  2P9K G;  2C2L A;  3O4Z A;  3U66 A;  4ANU A;  4J8S A;  4GTM A;  2XJ3 A;  5HQ8 A;  3C5R A;  3EU5 A;  5DRT A;  3KJX A;  3L22 A;  1BU9 A;  3SBS A;  2RG8 A;  1WDY A;  3UPV A;  1TYQ G;  1MX4 A;  4GA2 A;  5AQA A;  3FUK A;  3DSX A;  4JB8 P;  4ATZ D;  5HI7 A;  4JHR A;  3ML8 A;  4Q94 A;  3D1N I;  5EID A;  2ZIS A;  5G04 J;  2UWJ G;  4MKT A;  2ION A;  2VGX B;  2XZT G;  1POU A;  5FQ4 A;  4U63 A;  3VK0 A;  4JXT A;  1S63 A;  1O4X A;  1KT0 A;  4A1G A;  4N2Q A;  3BD1 A;  3S7J A;  2JEK A;  1HFA A;  2A4Z A;  4JHJ A;  1HZ4 A;  3L9T A;  4U95 D;  4JD2 G;  1S7E A;  1XNF A;  2KXP C;  4CCA A;  4A63 B;  4YG7 B;  3Q75 A;  3CLC A;  4F3V A;  3HRA A;  3ZW3 A;  4O8B A;  3TFL A;  2PUD A;  3BG0 B;  4LCT A;  3RSE G;  4X4G A;  3R1F A;  1ZZC A;  1TEZ A;  5ARG A;  4DLO A;  2PXT A;  3PZ2 A;  2R05 A;  4A3T A;  3UKU G;  4ANV A;  1JH9 A;  4YVO A;  5FIO A;  3DWL G;  1HH8 A;  1TNO A;  2VSO E;  4GZC A;  3JQ1 A;  4FA6 A;  2J49 A;  3AS4 A;  2IU7 A;  3KAE A;  4HLE A;  4J8E A;  1IXV A;  1PAQ A;  3FTW A;  1D8E A;  3FTY A;  5FIN A;  3NAW A;  5EKQ D;  1SW6 A;  4LRZ A;  4GB9 A;  3LXU X;  3G2T A;  2Q7F A;  1JWF A;  5AIJ A;  3MEJ A;  5JJ6 A;  2VSN A;  3AU4 A;  4B94 A;  4J1W A;  3U9W A;  3QYX A;  1ZPQ A;  3ONL A;  4ATG A;  5FQ8 A;  4KYO B;  4BWR A;  4HI8 A;  3IHY A;  5FZR A;  4RG6 A;  1DCE A;  2CFZ A;  2XXP A;  5A7L A;  2VSY A;  3QB2 A;  3ZYK A;  4CT4 A;  3R09 A;  3JXD L;  1IC8 A;  2CG2 A;  2O38 A;  3LVQ E;  3RKV A;  1H6K A;  4FHJ A;  4RQI A;  3KL4 A;  4N2S A;  3GBF A;  3SQV A;  3ENE A;  3CVN A;  3CV0 A;  2KZ8 A;  3PNT B;  2GRR B;  2I9C A;  3PE3 A;  2DZN A;  3W9F A;  1JPL A;  4U07 A;  4ER3 A;  2PXE A;  4GA0 A;  2AJA A;  1PY1 A;  2L6J A;  3RJV A;  1Z6T A;  2YHE A;  3ASN E;  2KCV A;  2HO1 A;  3QOX A;  1RZS A;  2ETC A;  3G2V A;  2WIU B;  3G5G A;  3FFL A;  2AXU A;  2UY1 B;  2XHE A;  4L7T A;  5DTM A;  4WND A;  1INZ A;  1E8X A;  4O1P A;  3LFP A;  5C1D A;  4GYY A;  4X4B A;  4WAF A;  2KEK A;  1N95 A;  2WMN A;  4LNG A;  5C2Y A;  3HG0 D;  3FUN A;  3VTY A;  3QQ6 A;  2OVB A;  3GZD C;  1Y6I A;  1NA3 A;  4C0E A;  5KWD A;  1JFS A;  3MKQ B;  4K5C A;  1KT1 A;  5AQ7 A;  4ANX A;  4DE9 A;  1ZB1 A;  2FFH A;  3O48 A;  4PS7 A;  1ZZ6 A;  1O1R A;  4J8F A;  4HOR A;  3CHP A;  4X4E A;  2WQ6 A;  2VGE A;  2GRN B;  4GTV A;  4F53 A;  2XIU A;  1AU7 A;  1YMP A;  3FU5 A;  3CSF A;  4G2V A;  4DJA A;  3CR3 A;  1NFI E;  1RPE L;  3FMY A;  1LD7 A;  3CQC B;  3Q9U C;  3EHR A;  2GRQ B;  1ADR A;  3PEV B;  5JHB A;  3FUD A;  3Q7F A;  1Z3X A;  3EIJ A;  2IU1 A;  3UTM A;  1N11 A;  3RRU A;  1SQM A;  2R5S A;  2ZGD A;  2FJR A;  3SNX A;  1S64 A;  1MHQ A;  4EKI A;  3AS8 A;  1GW6 A;  4IN3 B;  3PZD A;  3CRO L;  3FUE A;  4GQM A;  3V31 A;  2YQ8 A;  3DST A;  3ESK A;  3RAU A;  4U0U A;  3LY9 A;  5G05 J;  3UXG A;  4FHK A;  4NDW A;  2P9I G;  3CKC A;  1CQT A;  2DYR E;  4F1S A;  3EHQ A;  1Z3Y A;  1N52 A;  3ASH A;  3B95 A;  3FEY A;  2FF4 A;  4I6G A;  1BLX B;  2P9S G;  3E33 A;  3NOG D;  4WNE A;  3H5T A;  2ETA A;  2LSU A;  4BSZ B;  1V54 E;  3E4B A;  3UKR G;  4Y42 A;  1LQC A;  5AN8 A;  4J6I A;  5JHA A;  2R17 C;  1BDI A;  3S7F A;  5J90 A;  5D2M C;  2F8X K;  3CGH A;  3FUJ A;  4CEM A;  2NSZ A;  2QY7 A;  3SFX A;  2EQX A;  1W3B A;  2ICT A;  3EHN A;  3N71 A;  4KXK B;  1G3N B;  2GRL A;  3JQ0 A;  3Q15 A;  5FT9 A;  1ZZ7 A;  3GZS A;  1UJJ A;  1K1A A;  2EIJ E;  3RO2 A;  2PM7 A;  1NEQ A;  2CRO A;  4WVL A;  3S7D A;  3UIO C;  4BFR A;  1DNP A;  2PXU A;  4UI9 J;  2KC7 A;  5DTR A;  4R7L A;  4LSZ E;  4OVV A;  2EBY A;  3UT4 A;  5CBO A;  4K03 A;  2ZXW E;  4M3O A;  3X2Q E;  3DNV B;  1L5J A;  3M9L A;  1A5E A;  4X4I A;  4L1B A;  3PNL B;  4N5Q A;  2P58 C;  2PPX A;  3B7B A;  4HRM B;  2MOW A;  3GZC A;  3NOC D;  3CLJ A;  2IY0 C;  1BD8 A;  4GU5 A;  1DC2 A;  4U04 A;  4BX9 A;  2WXL A;  3QJZ A;  4WUY A;  4AP2 A;  3CHQ A;  3T8M A;  2Y69 E;  4G8L A;  4U96 D;  2Y4U A;  2XPI A;  4FUL A;  4PS3 A;  4DK5 A;  4J8D A;  1N94 A;  3SFY A;  1JUQ A;  4F6R D;  4FAD A;  4C0M A;  3JXC L;  2PXK A;  2ZU6 B;  3FU3 A;  1ELK A;  5ANR A;  4PDX A;  5CEA A;  4HVB A;  3QNK A;  3JYS A;  2IVB A;  5EX0 A;  4ZHB A;  4CT0 A;  1KZP A;  2C0M A;  2R63 A;  3SZ7 A;  4HI9 A;  3LY8 A;  2HM8 A;  2KEI A;  3WG7 E;  5E75 A;  2ZIR A;  4BER A;  1FVH A;  3HXD A;  3IBE A;  3K9I A;  2XS1 A;  3MKQ A;  2XEV A;  3T5X A;  2WXQ A;  1IHB A;  2RD0 A;  2LYL A;  2R59 A;  2OFY A;  2XGM A;  3C98 A;  1PRV A;  4JHK A;  5CRV A;  3NDB B;  5AEN A;  4RVB A;  2XI8 A;  4OB4 A;  2J7U A;  3PZ1 A;  3AS5 A;  2LLV A;  3LEW A;  2LAI A;  4G11 A;  3TWW A;  4GMJ A;  4I6E A;  4PU4 C;  3ABM E;  3D9M A;  4GYO A;  4CGW A;  3AG1 E;  1RZR D;  3FU6 A;  4K5A B;  4TRQ A;  3FTS A;  2KBX A;  3FY4 A;  1JWG A;  1LF8 A;  3R7R A;  1ZVV A;  3VLD A;  3S7B A;  4QQI A;  3RIB A;  3CHS A;  3RZZ A;  1SA5 A;  4U8Y D;  1DW9 A;  2L9B A;  2MYO A;  2DIW A;  4WWP A;  4NAC A;  3UT7 A;  2LUH A;  2R1J L;  2ILR A;  3CHM A;  2PXQ A;  3F6Q A;  1XWR A;  3HXC A;  2A5U A;  2NYJ A;  1K3Z D;  4XI0 A;  3TWU A;  4UUC A;  2QZA A;  4JA7 A;  3ZYM A;  4CGV A;  3PUJ A;  1U2Z A;  4HOU A;  2WXH A;  3FHE A;  3SO8 A;  4ZFH A;  4G1T A;  4I1O B;  3MKR A;  2I2O A;  3IKO B;  1GT0 C;  3FUL A;  3HXE A;  4LUN U;  2GRO B;  2XEE A;  5ENR D;  1KLX A;  3L82 A;  3MA5 A;  2BNO A;  2LYP A;  1EF1 C;  2HYZ A;  1DVP A;  3Q7A A;  2OV8 A;  4TXR A;  2LLW A;  3PRZ A;  3E37 A;  2HSG A;  4OBM A;  2WB2 A;  3CVV A;  2XCC A;  3UT8 A;  2EIL E;  4UQY A;  2VTB B;  2BNM A;  2OND A;  1BPO A;  2IEJ A;  1FT2 A;  2WPV A;  5LCW C;  4NUR A;  2XGO A;  5G2N A;  3EUS A;  5KNG A;  3CVW A;  3I4G A;  2WXM A;  4B93 B;  1ELW A;  3MJW A;  3EU9 A;  2OOE A;  2GGF A;  1HU3 A;  4NRH B;  3DM5 A;  3B13 A;  5CBN A;  3ZGQ A;  4EBA A;  4ER7 A;  3L1P A;  4L2Y A;  1JFT A;  1EDU A;  3OXF A;  4YG1 A;  2J8S D;  1WG0 A;  3DEO A;  2PNN A;  4IYP A;  5DSX A;  3KZ3 A;  2P9U G;  2PM6 A;  4I9C A;  3MX3 A;  3I4R B;  3D9O A;  3QKY A;  3QWV A;  5BW8 C;  3NZL A;  2XSD C;  2B0O E;  4JA9 A;  4ABN A;  4ACK A;  3D9J A;  4EEC A;  3EDT B;  2YIN A;  5HRY A;  2OEW A;  4XKB A;  3ABL E;  5EYL A;  3FP3 A;  2PL2 A;  4DPR A;  2RKK A;  5B3S E;  4N39 A;  4XIF A;  4DX1 A;  3NB2 A;  3V30 A;  4APF A;  2JAB A;  2XZD G;  1YA0 A;  4GTS A;  3TWT A;  4GTO A;  3ZEF A;  5ANL A;  3PXP A;  4UWG A;  5AAR A;  2L0T B;  3G2W A;  3MEK A;  3JCK C;  2PUE A;  5ENQ D;  1UOH A;  4AEZ C;  3BUA A;  4BT8 A;  4X8Q A;  4F7A A;  4RSY A;  4I6R A;  2KCK A;  3Q79 A;  1SA4 A;  3BQO A;  3P1U A;  3T8K A;  2EIK E;  4AOF A;  3PE5 A;  1ZZB A;  2PUG A;  3G2S A;  2PXV A;  1MZC A;  3Q4A B;  3ZUV B;  1DUL A;  4NQ0 A;  3OMT A;  3R9A B;  3SCG A;  4CDR A;  2XXA A;  5DT2 A;  1N0R A;  3ULQ A;  3NXH A;  1S70 B;  2WUS R;  3APD A;  2M63 A;  5T4Y A;  4YDO A;  1S0P A;  2BJC A;  2HE0 A;  4I43 A;  5HS0 A;  5BUZ A;  4J7W A;  4HBD A;  4YDE A;  3T5V A;  3DRA A;  2B5A A;  2XPZ A;  2F0Y A;  3DXK G;  5AQB A;  5CED B;  4BX8 A;  3GYZ A;  1Y7Y A;  1MYO A;  4F8D A;  4AIF A;  1H0A A;  2PQR A;  4CYM D;  2XXQ A;  3QFI A;  1QNF A;  2NC9 A;  3MV2 B;  3Q78 A;  4EZJ A;  3SFZ A;  1BI8 B;  4XKC A;  3OKZ A;  3DSU A;  4G26 A;  3Q47 B;  4DUI A;  2E0I A;  2PE5 A;  4G24 A;  3Q5M A;  2LYJ A;  1H6O A;  4HRN A;  3ISM C;  4ILI A;  1OWO A;  2L0I A;  3S8Q A;  4U0S A;  2XEH A;  1ZU2 A;  1SVX A;  4YG4 A;  2I1J A;  2MXD A;  2C0L A;  3ZNG A;  4DRX E;  5CCL A;  2EIN E;  3SGH A;  3L17 A;  1ZAY A;  4GML A;  1OSL A;  1HX8 A;  2WQH A;  3TEL A;  4JC8 A;  1MQS A;  4UQX A;  2IJG X;  1LTX A;  4ACL A;  5A6C A;  1WH6 A;  3HYM B;  1A17 A;  2IFU A;  1HE8 A;  2KZT A;  3KS2 A;  4HQD A;  3OWQ A;  5EIB E;  3HVE A;  3OQN A;  4N3C A;  2M4H A;  4MCX A;  3ULY A;  1EYH A;  2A6C A;  4MRU A;  3MCX A;  1N4Q A;  4GMR A;  2X6F A;  4O6F A;  1LLI A;  4Z68 A;  4EZL A;  4KT6 B;  1OY3 D;  4E6H A;  3U4T A;  3L16 A;  5K98 B;  3AU5 A;  4E85 A;  2VTB A;  1PRU A;  5BXU A;  2DVW A;  4U8H A;  2WXG A;  4XX5 A;  1VPW A;  4I17 A;  3KD7 A;  2LAH A;  5FJY A;  5FQ6 A;  5T8I A;  5B1A E;  1OWN A;  4TXP A;  1EPU A;  1SZA A;  2GRM A;  2AXZ A;  3SCH A;  3Q73 A;  3AG3 E;  4CZ2 D;  5AAO A;  2L49 A;  3FDH A;  1EFA A;  5JJ7 A;  3ZPX A;  4ER5 A;  4I9E A;  4UWF A;  1V55 E;  2F37 A;  2AWI A;  4KZ0 A;  4U0Z A;  1QQB A;  3KSL A;  3OAW A;  4OAV B;  3FU0 A;  4K0R A;  4BES A;  1HO8 A;  3B7U X;  5EN5 D;  5T3R A;  1QP0 A;  2WXJ A;  4Q2J A;  3ZN3 A;  5CMY A;  2BF0 X;  3ZYQ A;  5KBA A;  4PU7 A;  4L9P A;  4GZ5 A;  5BV1 A;  1WET A;  1HF8 A;  1N4R A;  1L1M A;  4DX6 D;  3KEA A;  2CSF A;  2XEN A;  3A9Z A;  2PXP A;  4GZD A;  3FTX A;  1JCR A;  4I6T A;  4K5B A;  2KCL A;  4U8V D;  4F1P A;  3ZHE B; 
#chains in the Genus database with same CATH homology
 2C0M A;  3CEC A;  3KJX A;  3ML9 A;  4JEU A;  4PS8 A;  3RRN B;  3L22 A;  3SZ7 A;  2J07 A;  3CVU A;  3SBS A;  1QQE A;  3LY8 A;  4LER A;  4AY6 A;  1E8Z A;  4V3I A;  2HM8 A;  2KEI A;  4Z58 A;  4G25 A;  2RG8 A;  3UPV A;  5E75 A;  3TXM A;  3ZPJ A;  4I8T A;  2E2E A;  1FVH A;  4GA2 A;  3IBE A;  2WXP A;  2XCB A;  3K9I A;  3MKQ A;  1NZN A;  3APC A;  3FUK A;  2XEV A;  4OYS A;  3T5X A;  3FUM A;  5HI7 A;  1R63 A;  2WXQ A;  1OUV A;  3B7T A;  1FVF A;  4JHR A;  5BT1 A;  3L08 A;  3ML8 A;  4DLQ A;  4Q94 A;  1P5Q A;  2RD0 A;  2LYL A;  3FEX A;  3D1N I;  4Q96 A;  1HG2 A;  4JCX A;  2R59 A;  2OFY A;  1ZBP A;  2XGM A;  3C98 A;  5LOZ A;  1PRV A;  3D9P A;  2UWJ G;  4JHK A;  2EWT A;  5G04 J;  1N54 A;  2BTD A;  4MKT A;  5CCM A;  2ION A;  2VGX B;  2YNQ A;  1POU A;  2VQ2 A;  5FQ4 A;  3NZS A;  4U63 A;  5AEN A;  3QOU A;  4RVB A;  4P29 A;  2XI8 A;  3VK0 A;  3G7D A;  4JXT A;  1NER A;  4OB4 A;  3AS5 A;  1O4X A;  3LEW A;  2LAI A;  1UW4 B;  1KT0 A;  4A1G A;  4A55 A;  3BD1 A;  4N2Q A;  4G11 A;  3S7J A;  4GMJ A;  2JEK A;  1WY6 A;  3QWP A;  4I6E A;  4W9R A;  2HIN A;  4PU4 C;  1HFA A;  2A4Z A;  3D9M A;  4GYO A;  2V5F A;  4I1M A;  1HZ4 A;  4JHJ A;  4CGW A;  4J1X A;  1RZR D;  3FU6 A;  3O9X A;  1S7E A;  1XNF A;  3LYA A;  4CCA A;  2LYS A;  4YG7 B;  2J4D A;  2XCJ A;  3LVR E;  4HS2 A;  4J0U A;  4TRQ A;  4YND A;  5DBK A;  3FTS A;  1E7V A;  3FY4 A;  1JWG A;  3CLC A;  1LF8 A;  1DWK A;  4GHJ A;  5G05 C;  3D3M A;  1ZVV A;  3R7R A;  4KZC A;  4EZK A;  3LKU A;  4F3V A;  2J9Q A;  4JW1 A;  3QAQ A;  1HXI A;  4I2Z A;  3VLD A;  4TUU A;  3S7B A;  3RIB A;  4B0Z A;  3CHS A;  3ZW3 A;  3RZZ A;  4O8B A;  3ZRH A;  4BTB A;  3FWV A;  4JL0 A;  2PUD A;  4YBA A;  1DW9 A;  2L9B A;  3JXB C;  3BG0 B;  4LCT A;  2DIW A;  3LCA A;  4UWK A;  4WWP A;  4AJW A;  3ZKC A;  4X4G A;  4NAC A;  3R1F A;  1ZZC A;  3UT7 A;  3VTX A;  3BS3 A;  3IHV A;  1TEZ A;  2WVI A;  2R1J L;  2ILR A;  5ARG A;  3CHM A;  3ZHI A;  3CVQ A;  1R69 A;  2MQK A;  5EX3 A;  3SI5 A;  4DLO A;  4A3T A;  1XWR A;  3TAX A;  2A5U A;  4ANV A;  1JH9 A;  4YVO A;  1HH8 A;  2VSO E;  4HXI A;  4GZC A;  3JQ1 A;  4XI0 A;  2KPJ A;  4FA6 A;  2J49 A;  4HOS A;  3MYV A;  4GCO A;  3DPD A;  1RIO A;  4CGV A;  4JA7 A;  3ZYM A;  3PUJ A;  4HOU A;  1TJF A;  3AS4 A;  5AJL A;  2WXH A;  4FBI A;  2IU7 A;  3FH7 A;  2XPY A;  3FHE A;  4GZ6 A;  4G1T A;  3KAE A;  2PUF A;  4I1O B;  3MKR A;  4HLE A;  2I2O A;  2VGY A;  3ASF A;  4J8E A;  3IKO B;  2X6H A;  3SBT B;  4WNF A;  1PAQ A;  3FTW A;  1GT0 C;  3FUL A;  4ME2 A;  3FTY A;  1WH8 A;  1QP7 A;  4LUN U;  1OWL A;  5LFA A;  3TGO A;  5A7D B;  2LYK A;  5EKQ D;  4KVO A;  2FUL A;  4LRZ A;  5KJM A;  4GB9 A;  1KLX A;  4XI9 A;  3LXU X;  4ILG A;  3MA5 A;  1ZS4 A;  3G2T A;  2Q7F A;  1JWF A;  5J08 A;  2CHX A;  5AIJ A;  2BNO A;  2LYP A;  5JJ6 A;  4FN3 A;  1EF1 C;  2HYZ A;  1DVP A;  3UUX A;  2OV8 A;  2VSN A;  3AU4 A;  4B94 A;  1UG3 A;  3PUK A;  2GZU A;  4J1W A;  2YHC A;  3U9W A;  3UQ3 A;  3QYX A;  1ZPQ A;  2VGX A;  4ILH B;  3ONK A;  4UQZ A;  3ONL A;  3U3W A;  3I3N A;  3TG5 A;  3QK0 A;  4ATG A;  5FQ8 A;  3GZ1 A;  4KYO B;  3PRZ A;  4Z5D A;  4BWR A;  3EHM A;  2HSG A;  2AUW A;  2J09 A;  4B8C B;  3SF4 A;  2LNI A;  5FZR A;  3IHY A;  1OWM A;  2WB2 A;  2VYI A;  3CVV A;  2XCC A;  4IA8 A;  4Q69 A;  3R7Q A;  2XGS A;  3ZHM A;  4RG6 A;  4UI9 C;  3UT8 A;  2CFZ A;  5A7L A;  1E8W A;  3UFD A;  2DBA A;  2VSY A;  4GA1 A;  4UQY A;  2VTB B;  2BNM A;  3QB2 A;  3ZYK A;  4CDM A;  4L23 A;  2OND A;  3CHR A;  3P2B A;  1BPO A;  5FZS A;  4CT4 A;  3S2A A;  3JXD L;  1IC8 A;  2CG2 A;  2O38 A;  2WPV A;  4XZ4 A;  3LVQ E;  3RKV A;  3OQM A;  4NUR A;  5LCW C;  1JWL A;  2XGO A;  5G2N A;  3EUS A;  2IOL A;  3GW4 A;  3CVW A;  2LYQ A;  1H6K A;  4FHJ A;  3I4G A;  2WXM A;  4GZ3 A;  1ELW A;  1QZ2 A;  2WXN A;  3MJW A;  2OOE A;  2GGF A;  1HU3 A;  4NRH B;  4XE0 A;  4N2S A;  3B13 A;  1XGW A;  4B89 A;  4HOQ A;  3GBF A;  3ZGQ A;  4EBA A;  4X4D A;  5KJK A;  3L1P A;  2NXP A;  3ZFW A;  2IQC A;  4AY5 A;  4L2Y A;  3PE4 A;  3PDN A;  2OVF A;  1JFT A;  1EDU A;  3ENE A;  3CVN A;  4A3V A;  3FYM A;  3OXF A;  4YG1 A;  4G23 A;  3CV0 A;  2KZ8 A;  4PH4 B;  3PNT B;  4IYP A;  4FJZ A;  1UXD A;  2I9C A;  3ZXS A;  3PE3 A;  3APF A;  5FWQ A;  4OVU A;  3KZ3 A;  5M72 A;  1JPL A;  2PM6 A;  3F51 A;  4U07 A;  4I9C A;  2X6K A;  4GA0 A;  1PY1 A;  5D0Q D;  1IYG A;  1BDH A;  2L6J A;  1FCH A;  3MX3 A;  3I4R B;  3RJV A;  3D9O A;  3QKY A;  1B0N A;  1Z6T A;  3QWV A;  5BW8 C;  3VLF A;  5JJT A;  3FH5 A;  2XSD C;  2J4B A;  3TXN A;  1NA0 A;  2YHE A;  4GAA A;  4JA9 A;  4ABN A;  1RZR A;  2KCV A;  3L6A A;  4CDN A;  4ACK A;  1LMB 3;  3CKB A;  2HO1 A;  3D9J A;  5BNW A;  1U3C A;  4LEU A;  4EEC A;  3EDT B;  3LY7 A;  2CHW A;  1RZS A;  3G2V A;  3TG4 A;  2YIN A;  3OTN A;  4XKB A;  4TV3 A;  3FP3 A;  1Y9Q A;  2PL2 A;  4DPR A;  2WIU B;  3CK9 A;  3G5G A;  3FFL A;  1ELR A;  4N39 A;  2AXU A;  1HF0 A;  2UY1 B;  4XIF A;  3SHF A;  2LYR A;  2JCG A;  2XHE A;  5E76 A;  5A23 A;  5EDS A;  4APF A;  4I2W A;  2QFC A;  1WAO 1;  4L7T A;  4KVM A;  1ZZ8 A;  4WND A;  4GPK A;  3GN5 B;  1E8X A;  4UI9 K;  1YA0 A;  3LFP A;  5C1D A;  1INZ A;  3IVP A;  2WXR A;  4GYY A;  2JVL A;  3TRB A;  4X4B A;  4WAF A;  5G55 A;  2KEK A;  4KBQ A;  5ANL A;  3ZEF A;  3PXP A;  4UWG A;  2WMN A;  4HFG A;  2L0T B;  3MLF A;  3G2W A;  3MEK A;  5C2Y A;  1IHG A;  4D10 C;  3VTY A;  3CQG B;  3CHO A;  3QQ6 A;  3FUN A;  3D9L A;  4AXH A;  2OVB A;  3JCK C;  2PUE A;  2O4A A;  1Y6I A;  3B7H A;  4RG9 A;  4WWN A;  3FUH A;  4AEZ C;  1NA3 A;  4C0E A;  1JFS A;  2FEZ A;  1UTX A;  3MKQ B;  3FH8 A;  4KMO A;  1KT1 A;  3FYA A;  4BT8 A;  4F7A A;  3OQO A;  2MHK A;  4RSY A;  4I6R A;  2O49 A;  2KCK A;  4GYW A;  5AJD A;  3ZHE A;  4ANX A;  4WNG A;  3ASG A;  3O48 A;  4PS7 A;  1ZZ6 A;  3EIQ C;  3P1U A;  4BSX A;  4JZY A;  4HOT A;  2IVQ A;  2J08 A;  2I1K A;  2XQ0 A;  2MEZ A;  3CVL A;  4J8F A;  3RU0 A;  3F6W A;  4AOF A;  2WQ7 A;  1ZZB A;  4HOR A;  2PUG A;  3CHP A;  4X4E A;  3B7R L;  3G2S A;  3NQP A;  4I6J A;  3Q4A B;  3I5P A;  5KJL A;  2WXF A;  2WQ6 A;  3QF3 A;  4F53 A;  2XIU A;  3OXG A;  4NQ0 A;  1AU7 A;  3OMT A;  4JVS A;  3R9A B;  4DI4 A;  4Z5H A;  3SCG A;  4CDR A;  4Z5C A;  3FU5 A;  2FO7 A;  3MZL B;  5FZQ A;  1SZ9 A;  5LCW J;  5DIZ A;  2KZT B;  2X6I A;  3CSF A;  4G2V A;  4N3B A;  3RO3 A;  4DJA A;  3CVP A;  3ULQ A;  3CR3 A;  3HVE B;  4IRU A;  3TL5 A;  1QPZ A;  1RPE L;  1LCC A;  1ZZ9 A;  3ESL A;  3FTV A;  3FMY A;  3CQC B;  3U64 A;  2ICP A;  2WUS R;  3F52 A;  3PEV B;  1ADR A;  3BDN A;  3APD A;  4JPS A;  5JHB A;  2M63 A;  5T4Y A;  3FUD A;  2KM4 A;  2PQN A;  3IEG A;  3PRE A;  1S0P A;  2WM9 A;  1X2L A;  3QWG A;  3QDN A;  3WXX A;  1HS6 A;  1UN9 A;  2BJC A;  4UWH A;  1Y8M A;  4A1S A;  4EBA G;  1Z3X A;  4I43 A;  3EIJ A;  4EQF A;  1VDY A;  5BUZ A;  3PVL A;  3BG1 B;  2IOS A;  1PNR A;  5CHE E;  2IU1 A;  4I6U A;  1U3D A;  3T5V A;  2B5A A;  2GW1 A;  2XPZ A;  3UMV A;  2FI7 A;  1NP7 A;  3FTU A;  1WM5 A;  4BX8 A;  1UJK A;  1Y7Y A;  3GYZ A;  2BNN A;  1SQM A;  2KEJ A;  3RRU A;  2R5S A;  2FJR A;  4QFV A;  3SNX A;  4F8D A;  3TJP A;  1QQA A;  2WXO A;  1MHQ A;  4FC8 A;  3D9I A;  1H0A A;  3HZI B;  2PQR A;  4AIF A;  2UY1 A;  3AS8 A;  1QNF A;  2NC9 A;  3D9N A;  1ZUG A;  1GW6 A;  3HDX A;  4IN3 B;  2BUG A;  1H2T C;  3MV2 B;  3ZIM A;  3GN5 A;  4EZJ A;  2IF4 A;  4WWO A;  2X6J A;  3CRO L;  3FUE A;  4GQM A;  1HG5 A;  3PZD A;  3SFZ A;  4AM9 A;  3QAR A;  2EF8 A;  2YQ8 A;  3ESK A;  4XKC A;  1IQU A;  4U0U A;  3LY9 A;  4JQD A;  1E7U A;  4G26 A;  3Q47 B;  3PS6 A;  5G05 J;  1X5B A;  4FHK A;  4NDW A;  5ARF A;  4H7Y A;  4MLP A;  1CJG A;  2E0I A;  2FBN A;  3CKC A;  4GCN A;  2PE5 A;  1CQT A;  3CVY A;  3HHM A;  4G24 A;  2V8S E;  4F1S A;  3Q5M A;  2LYJ A;  5LX8 A;  2CFU A;  4ILI A;  1OWO A;  2V4L A;  2L0I A;  3S8Q A;  3D9K A;  4U0S A;  1Z3Y A;  2PZI A;  3URZ A;  4CT0 A;  2VSX E;  4X4H A;  1N52 A;  1B89 A;  1E8Y A;  3MV3 B;  1ZU2 A;  5D0O D;  3ASH A;  3B7S A;  4FLB A;  4YG4 A;  3FEY A;  2FF4 A;  2I1J A;  3JUI A;  4I6G A;  4IUL A;  2C0L A;  1X57 A;  5CCL A;  1WIZ A;  4MCT A;  3GZ2 A;  4WNE A;  3H5T A;  5FTP A;  3L17 A;  3SGH A;  5KJN A;  3Q49 B;  1ZAY A;  4GML A;  1OSL A;  4PUC A;  1HX8 A;  2LSU A;  2WQH A;  4JC8 A;  3CK7 A;  3SCF A;  4CRW A;  2L8N A;  1MQS A;  2IVG A;  1PER L;  2KAT A;  2WXI A;  3E4B A;  2IJG X;  2OR1 L;  2PUB A;  4UQX A;  5FQ7 A;  4Y42 A;  2JLB A;  4MS6 A;  4YAR A;  1IQR A;  1LQC A;  1WH6 A;  4UWL A;  4ACL A;  3HYM B;  5BPP A;  1A17 A;  5A6C A;  1E90 A;  2IFU A;  3LS8 A;  1HE8 A;  2KZT A;  2VJ8 A;  2Y3A A;  3KS2 A;  4J6I A;  5JHA A;  2LCV A;  4BT9 A;  2R17 C;  2X38 A;  3HVE A;  3OQN A;  2IV1 A;  4N3C A;  4I1A A;  1BDI A;  4MCX A;  2LSV A;  4FJY A;  3KEZ A;  1EYH A;  2A6C A;  3S7F A;  1H2V C;  4MRU A;  5J90 A;  1H2U A;  3IV0 A;  3CEQ A;  3MCX A;  3CGH A;  3FUJ A;  4O6F A;  2D5V A;  2X6F A;  1LLI A;  3CK8 A;  3LPZ A;  4N5C A;  4BY6 A;  4KT6 B;  4CEM A;  4EZL A;  2NSZ A;  4IWR A;  3NZU A;  3QWW A;  4E6H A;  2QY7 A;  3U4T A;  3L16 A;  5K98 B;  4ANW A;  5G04 C;  2Y4T A;  1PRA A;  2PUA A;  3ASD A;  1UN8 A;  4H7X A;  5LP0 A;  3CVX A;  2EQX A;  3AU5 A;  4Y6W A;  5AYW D;  3RK6 A;  3G2U A;  4E85 A;  4N3A A;  2VTB A;  2AW6 A;  1PRU A;  1W3B A;  2ICT A;  3EHN A;  3N71 A;  1LCD A;  1SQ8 A;  4KXK B;  3KXA A;  2WMO A;  4U8H A;  3FUF A;  2WXG A;  2GRL A;  1E96 B;  4XX5 A;  3RRM B;  1VPW A;  3JQ0 A;  3KD7 A;  4I17 A;  2LAH A;  5FJY A;  2XRZ A;  5ENN A;  5FQ6 A;  4Y6C A;  5T8I A;  3Q15 A;  3L54 A;  3CST A;  1OWN A;  1ZZ7 A;  3GZS A;  1UJJ A;  2AVP A;  5FT9 A;  1EPU A;  2CG3 A;  3RO2 A;  2PM7 A;  1NEQ A;  2CRO A;  1OCT C;  2GRM A;  1SZA A;  4FP7 A;  2AXZ A;  3S7D A;  1DNP A;  4UI9 J;  3VLE A;  3ZVV A;  4BTA A;  4EPZ A;  3SCH A;  5BV0 A;  1TJC A;  4FU3 A;  3OXL A;  2KC7 A;  3PH0 C;  2PUC A;  4B8A A;  4BFR A;  5CMW A;  4R7L A;  2L49 A;  3FDH A;  1EFA A;  3LIS A;  2EBY A;  4OVV A;  3UT4 A;  2I6H A;  5JJ7 A;  2CHZ A;  4URK A;  4K03 A;  2DCP A;  4M3O A;  2PIJ A;  3DNV B;  4C9B B;  1L5J A;  3EJN A;  4I9E A;  4X4I A;  2AXV A;  4UWF A;  3PEU B;  4X4F A;  4L1B A;  5KCM A;  3HIZ A;  4FLH A;  4DI3 A;  2V0P A;  3PNL B;  1QP4 A;  4L2L A;  2AWI A;  4KZ0 A;  4YVQ C;  2P58 C;  2H8R A;  4PU3 C;  3L13 A;  2PPX A;  4U0Z A;  1QQB A;  3ZYL A;  4JCY A;  2MOW A;  3OAW A;  3CLJ A;  3FU0 A;  3FUI A;  4K0R A;  3MGB A;  4GU5 A;  4U04 A;  4BX9 A;  4JEH A;  4APO A;  2WXL A;  1HO8 A;  3B7U X;  3BEE A;  3QJZ A;  5T3R A;  4X4C A;  2X3M A;  4WUY A;  1QP0 A;  2WXJ A;  2MRI A;  2WXK A;  3CHQ A;  4AP2 A;  3T8M A;  3LJ3 A;  3SD5 A;  2Y4U A;  4IVZ A;  1H19 A;  1PC2 A;  3QC1 A;  3ZN3 A;  2XPI A;  5CMY A;  4FUL A;  3FTZ A;  4PS3 A;  1OWP A;  1YSE A;  2BF0 X;  3OP9 A;  4J8D A;  3ZYQ A;  4DK5 A;  1JUQ A;  1E3O C;  4FAD A;  4PU7 A;  2IUO A;  4C0M A;  3JXC L;  4GZ5 A;  3LDZ A;  5BV1 A;  2ZU6 B;  1WET A;  3FU3 A;  1HF8 A;  1L1M A;  4Z59 A;  1ELK A;  5ANR A;  2CSF A;  4PDX A;  2LO6 A;  3DBS A;  4HVB A;  4AVX A;  4PU8 A;  2HR2 A;  4GZD A;  2C2L A;  3O4Z A;  3FTX A;  3U66 A;  4ANU A;  2XRY A;  3CIA A;  3UX4 A;  4I6T A;  4AV7 A;  1UXC A;  4J8S A;  3QNK A;  3JYS A;  3NF1 A;  2IVB A;  2XJ3 A;  5EX0 A;  2KCL A;  5HQ8 A;  3ZHE B;  2R63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...