3U3XA

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
330
structure length
330
Chain Sequence
ELRFAAVGLNHNHIYGQVNCLLRAGARLAGFHEKDDALAAEFSAVYADARRIATAEEILEDENIGLIVSAAVSSERAELAIRAMQHGKDVLVDKPGMTSFDQLAKLRRVQAETGRIFSILYSEHFESPATVKAGELVAAGAIGEVVHIVGLGPHRLRRETRPDWFFRRADYGGILTDIASHQCEQFLFFTGVNDATVLSASVGNQSVPDAPELQDTGSIHLSTGRTTGMIHVNWLTPEGMPTWGDGRLFIVGTSGTIEVRKTVDLAGREGGNHLFLADRNGVEHIDCSRVDLPFGRQFLADIRDRTETAMPQERCFKAMELALQAQAIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative oxidoreductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Oxidoreductase
total genus 104
structure length 330
sequence length 330
chains with identical sequence D, G, J, M
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3u3xA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u3xA01
4I5DA 4IDDA 3O26A 1J5PA 2YHIB 1UAYA 3FWZA 4KMSA 3VDRA 4G5HA 4U5QA 4I1IA 3MJ4A 2Y05A 4Z0TA 1ADBA 4J3FA 4ZA2A 4MVJF 1GQQA 4MIEA 3F1KA 2O4UX 2B36A 4UEJA 4D46A 3SEFA 3OIFA 4MVJE 2X22A 2RH8A 4FFLA 3H5AA 2C0CA 2BGMA 3AOEA 3JQGA 3D0OA 1M76A 4PG8A 4IJKA 4NBUA 4R3NA 1I0ZA 4CODB 4ND5A 1ID1A 2B4QA 4Q3EA 3W4KA 3IJRA 2P68A 4BNVA 2ZB4A 2RIRA 2Q2QA 2EW8A 3H5RA 5TSDA 1PZGA 2OP1A 3GZ4A 3PFWO 5JYFA 4OYRA 4EUHA 3PQFA 2O2YA 4DLLA 4XJTA 5TNXA 3JD3A 1LLCA 3NKLA 2VNSA 3I52A 4B79A 4YDRA 2Y1CA 4CM6A 4D43A 5KTKA 4TZKA 3VTZA 3GOHA 3JQAA 2ZCVA 3WGOA 4DQXA 2D4AA 5L7YA 1HXHA 1BW9B 3OQBA 1ISGA 3K2EA 1CERA 2P91A 3DR3A 2Y1OA 4JP3A 4I9HA 5KVSA 4PG6A 2E48A 1A9YA 4D41A 1HF3A 1NAIA 1KETA 5F1PA 2C7GA 2CNBA 3ADOA 3I9OA 1P33A 1U28A 3FHLA 2WE8A 3GDFA 4MVJM 3RUCA 2G82A 4H7PA 4TVOA 3HZZA 4YQZA 5G0SA 5L51A 2A4KA 1A27A 3H5NA 3KYCB 1U7HA 4BNYA 3WGHA 1IULA 1M6WA 1DIHA 4BMNA 3WGTA 5LDHA 2Q49A 3RFXA 4CLOB 4JBGA 3QV1A 4MDHA 4R68A 2P9CA 2GLXA 2EIHA 3AI2A 3NTRA 3DHNA 1ZSYA 1T2AA 3CMMA 5I7SA 2FOIA 4CPDA 4KQXA 4NBWA 4IMPA 1X1EA 3VH4A 4DPLA 4GSKA 2RBEA 4P4NA 4YJHB 3VC7A 3HHPA 1LXCA 3LZ6A 1Z7BA 1LLUA 3E9MA 2FY8A 4J90A 4GPD1 5T64A 1DFHA 4XCVA 1GZ4A 4FOSA 3LC7O 1CRWG 2DFVA 4CV0A 1P1IA 1GV1A 2X8LA 3LC2O 4BHTA 3E1KA 3ZHYA 4L8VA 3CZMA 3VPXA 4II3A 1JWAB 2PA3A 4EYEA 1C0IA 3ZU2A 4CM9A 5ITVA 4GKBA 4A2CA 4GWKA 3W8DA 1DFGA 2OUIA 1GEGA 5A9SB 1P1HA 4D3FA 4QSMA 3WR5A 1H6AA 4IDAA 2AEJA 4UAGA 1PJ3A 1U3UA 3TF5A 2DUWA 4XEHA 5TJ9A 4YYZA 4RF4A 2X0JA 3INGA 2J6IA 4ZQEA 1GDHA 2CDCA 3FR8A 4Y6SA 3U4DA 1MUUA 1JN0A 4MVJH 1Q7BA 1NQTA 4MKRA 1Q0HA 5IDQA 4P4LA 4GVXA 5JAIA 1YO6A 3G79A 1DC3A 3M1LA 1ENPA 1LC0A 3DBLB 2CDAA 3DQPA 4NJMA 3HSKA 2VOEA 3FTNA 3I9LA 5EN4A 1H2HA 4A7PA 4YPOA 5L45A 3GK3A 1FMCA 1UZLA 4IUYA 3O03A 2OL4A 3Q2IA 4XYEA 1HDCA 1OAAA 3V8BA 2ZB8A 4L75A 3FF4A 1O0SA 2CDBA 3PPIA 1YQXA 3C1OA 1E7QA 3LU1A 1E3WB 5FI5A 3RKUA 3RWBA 4BGEA 5JE8A 2FSSA 1G0OA 1GD1O 2D0IA 3WICA 1YONA 4E3ZA 3LT1A 1GCUA 3ZNPA 3DBRA 5JFOA 5L7TA 1ORRA 4HFRA 5F1OA 4HP8A 2GZ1A 1KBZA 3EW7A 1QR6A 5GMOA 4DGSA 3V2HA 4WCFB 1DAOA 4WGGA 3RBXA 3I4FA 3QY9A 5JY6A 2O3SA 4CQLB 3DBVO 3Q11A 4J9UE 4XZ3A 3PJGA 2Q2WA 3MWDB 3VPSA 4OO3A 5CAEA 3U0BA 2WM3A 3UOGA 4A26A 3ASVA 4W7HA 3O8QA 1HDXA 3HUDA 1ISIA 4BIIA 5EQDA 5JO0A 4TWRA 1SC6A 1HWYA 1LDGA 2BD0A 2HCTA 2VHYA 4WNIA 2WDZA 3K31A 4Z9FA 4AJPA 3QQPA 1YXMA 1UDCA 1TXGA 1P45A 3HDHA 3PIIA 3Q6IA 4ITUA 1XQ6A 5IF3A 3INRA 4CQMB 4Q9NA 2CVZA 3DO5A 1EDOA 1DIGA 4RVSA 1MFPA 4BNNA 1NR7A 1R6DA 4YRDA 4NQZA 4GGPA 3BHJA 3NUGA 1ZXBA 4PVDA 2HO5A 4Z0PA 3RQSA 4JCOA 2C54A 3IAHA 3EVTA 3LT0A 4YEDA 5DT9A 2OGUA 3HFSA 4WNCA 1Y9EA 2X86A 2YJZA 1XG5A 4CM4A 2WWRA 4URFA 3ETEA 3OIDA 1OFGA 4YT8A 1ZCJA 3V1TC 5BSEA 4CMIB 4MP8A 4Y6RA 2JFHA 2OMEA 4GAEA 4BO0A 2O4CA 2GSDA 2WMDA 2EV9A 1JW9B 3WS7A 4WE3A 4B8ZA 1HL3A 4NU6A 4CJXA 5L7WA 4A03A 1VKOA 5DBIA 1DIAA 4O1MA 2O2SA 4MJLA 3VKVA 3AW9A 1KERA 3WJ7A 4BKRA 3IKTA 2PZLA 3HWRA 1F0YA 3NV9A 3RUHA 3JCZA 3PI7A 1GUFA 4FFPA 2EKQA 2RHCA 1CIVA 2NTVA 4YBZA 4BO3A 3VH2A 1MV8A 3H6KA 3RASA 5H81A 5JSFA 1GR0A 4L0QA 1BHSA 2GD1O 1PZHA 3Q2KA 2Y0DA 4IY1A 4B4OA 4AL4A 1LDYA 1C0KA 3PHIA 3ENKA 2DQ4A 3A28A 3V2GA 1PR3A 3DHEA 5DP2A 1FF9A 5CEFA 5HBRA 4EZBA 4HXYA 4WCFA 1D4FA 2DKNA 4IINA 2J3IA 1G6KA 5BSGA 4CL3A 3EY4A 4JBHA 2Y1FA 1E3LA 3PGXA 1TT5B 3IS3A 4R1UA 4ALKA 5BSHA 4E5PA 3H4VA 1T26A 3ONEA 1ZFNA 3AOEC 4TRNA 3OP4A 4AJJA 1OI7A 3IKVA 4R1SA 2Y0EA 3E9NA 1PQUA 5KWEA 1U4SA 4AJ4A 3E8XA 1GU7A 3CXRA 1RM4A 4DIFA 1RM5A 1JLLA 2GN6A 3TFOA 4B4WA 2VYND 4EJ0A 2FSVA 4XGKA 1ZK0A 4AVYA 4ALJA 2VWPA 1GUYA 3U3XA 5CDUA 3TQHA 1B15A 1LSSA 1SEVA 4D44A 1SMKA 3JQ9C 5JAZA 1NXQA 3L0DA 1JAXA 1ZH8A 2PY6A 3PYMA 4O5OA 4OHUA 2XAAA 5L40A 2GF2A 1VI2A 3KYBA 2VWGA 3WGQA 3PYXA 2VWQA 1HLDA 2B5VA 1DLJA 1TLTA 1DFIA 5M6DA 3WNQA 2CD9A 3N58A 5C7LO 2WEKA 1LUAA 4RPGA 4Y6PA 1U4OA 1H6CA 3GAZA 3W8FA 2ZB7A 2FP4A 4LCJA 3O38A 1JKIA 4KUHA 2PWZA 3VTFA 4A73A 3DZFA 1UZMA 1GYQA 2AQ8A 1EUCA 1X0VA 3IIEA 4XR9A 4NHEA 1VLLA 2CMDA 3Q0EA 4U6QA 2VQ3A 3FRJA 5C5IA 1HYEA 1ZEMA 3AM3A 4NJOA 5ENDA 3W4IA 4UEKA 3GA0A 1C1XB 4EITA 1HEUA 2X23A 1V3VA 1U1IA 3WWZA 2ZK7A 1I30A 2I66A 4BKQA 4D3DA 1ULSA 2HMTA 4GGOA 3AUUA 4U8GA 3G1TA 1F06A 4YXFA 4CMKA 2AEMA 4RORA 3H3FA 3LF1A 3H9JA 3OJ0A 4J0EA 3VDQA 4FDAA 6LDHA 3HDQA 2NLOA 3MWEB 2BFMA 2IYPA 4OQYA 3C8MA 4RCVA 4UVHA 4YR9A 3OA0A 1IL0A 3JQ6A 5TF4A 4AJIA 4C4OA 1W0CA 4DTIA 3DXFA 2I65A 3I6QA 5T67A 3VOSA 3D5TA 3I9MA 1LA2A 5L4LA 3BXXA 1P1FA 3VZQA 1HE4A 1J49A 2OBNA 2PGJA 4RF2A 3HDYA 4ZRMA 3UN1A 4CLOA 1WVGA 3PJDA 4PRKA 1N1EA 1GFSA 1KVUA 1AUPA 3GG2A 4WPGA 1ENYA 1E5LA 3BMOB 1SB8A 1WWKA 2P4QA 2GN4A 2Y1GA 2O3TA 4J2HA 4WK6A 5A9SA 1X7GA 3RU7A 1KOLA 3L6EA 2IODA 2EEZA 1K0UA 1EBFA 2QZ9A 1ONOA 3NJ8A 2JAHA 3PQEA 2Y67A 3C7CB 4JJIA 3PDJA 2B0JA 5EPOA 1B16A 1ZK1A 3LQFA 1HRDA 1E1MA 1BGVA 3F5SA 2VZ9A 4J91A 1YL7A 1Z6ZA 3DOOA 3JTMA 1BTOA 5JS6A 5KKAA 3AU8A 3C24A 1HE5A 3LVFO 3EDMA 2E82A 3KSDO 3TOXA 4CMIA 1DHRA 4LSWA 4WKGA 5MGBA 1K6IA 1NQAO 2ZTUA 1T2FA 1VJTA 4LMPA 1BMDA 2IZZA 2PGLA 1AN9A 3ZI0A 4CLXA 1KVQA 1WXDA 4IZHA 3BAZA 1Q0LA 2PNFA 1IE3A 2BLLA 1LTHR 1JVSA 4DPMA 3NTQA 1VM6A 1WDKA 1F12A 2O7QA 3QHAA 1YJQA 3ANNA 1DIBA 4BGIA 5ADHA 1VL6A 2JD1A 5ILGA 3ZWAA 2ILTA 3NDJA 4RVHA 3OM9A 1R0LA 4E2XA 3GF4A 2FPPA 1E3WA 1LSUA 1LSOA 1P3DA 1YDEA 2X6TA 4NK4A 4PG4A 1U2GA 3UKOA 4PG5A 1U7TA 4GKVA 4BNHA 3AI3A 3UXYA 5K6AA 1LRJA 3GNQA 1E1LA 2D59A 5IDXA 1SAYA 1YDWA 5GY7A 1JQBA 3JQBA 1H6BA 4PGFA 2HK7A 1M66A 2UV8A 2VHZA 3QWHA 3ETDA 4ZQFA 3L4BC 3GQVA 4FS3A 5F1KA 3EGOA 4DQVA 1I3NA 3QRWA 2AEFA 4KQWA 2I6TA 1GV0A 3EUWA 1EEHA 4PRLA 3LLVA 2HK9A 1E6EA 4A5OA 5IZCC 2AHRA 2HMVA 2GZ2A 4QX6A 2X4GA 2BFAA 4CMEC 1DPGA 1Y6JA 1ZK3A 5DCUA 2ZQYA 4RPKA 2A35A 4EI2A 4WLNA 1OC4A 4YT4A 3UUWA 4P4GA 3BTUA 3DBLA 3LDHA 2VYVD 3ENNA 4MVJP 4EUFA 1PL6A 1LQUA 1PS9A 2HUNA 3CUKA 4O6VA 5HWSA 3H9GA 5IDYA 2GCGA 3WYEA 4ZICA 1WMAA 3AY3A 1KVSA 4RDIA 3GVXA 1BDMA 3MJEA 3NEPX 3FR7A 3M6IA 3UCXA 5KKCA 3DZHA 1T4DA 4HFNA 1PJQA 1EVYA 4B3JA 5K9ZA 2FN7A 3GR6A 3ZU5A 3QLJA 4ALNA 5T5QA 1HSZA 3JYNA 3OMLA 4YT5A 4BNLA 4MINA 1FDWA 2P9GA 4J6FA 3SJUA 3EZLA 5C7OO 2EF1A 5G0WA 1A5ZA 4R1NA 1EK5A 3ZWYA 4ROSA 1F8GA 2PH5A 3JQFA 4I5EA 3DZKA 4NPCA 1ZO8A 2FWMX 4MP3A 1PEDA 2Y99A 1P1JA 4DREA 1AXGA 1M75A 3DOCA 1ISFA 4OQZA 4JQCA 1E7MA 2FR8A 2WSBA 3R1IA 1R16A 3UH1A 3W4JA 4BNFA 5EIOA 2RAFA 3CPSA 3A06A 3VPGA 1WDMA 3DC2A 3F47A 1BVUA 2XPCA 4K6CA 4XB1A 3DOJA 1EBUA 2XF8A 4Y8VA 3UF0A 1R0SA 1HE2A 1DO8A 1GUZA 3S2IA 2I9PA 1ZW1A 4KOAA 1DJNA 1BXKA 5COQA 5CFZA 4L9RA 2J8ZA 2YHUA 5AOVA 2VTDA 3OHSX 3RC7A 4XQCA 1NWHA 3GVHA 4XX0A 1N9GA 2X1HA 3JQ9A 3EAGA 3X2EA 4XQ9A 3KLMX 3WYCA 3OJEA 4IGEA 3H9UA 1DOHA 4RPJA 4IQ0A 4GL4A 4QTZA 4IDEA 3PZRA 3P2YA 3RUEA 3JD4A 3E5MA 1NVTA 2DTDA 4ND3A 2YFHA 1CQJA 3VZRA 1DXYA 4XQGA 4B7CA 2O50A 1XR3A 4QFCA 4ALIA 4E30A 3E03A 5K6AC 1LSJA 3CTMA 4C7JA 4EDFA 3EVNA 5B1YA 4YJGA 3ICCA 4OJNA 4BB6A 3ZWNA 2VUTA 2W90A 2JHGA 3RBVA 3BMOA 4PIVA 4BKOA 4BV8A 1GYPA 4IS2A 1ZSNA 2BF7A 3L4BA 1KS9A 4I9NA 4GI2A 2GR9A 3TZHA 3FSRA 2Y93A 3WQQA 1SB9A 3BMNA 5I8WA 3HADA 4OAQA 4OL9A 1HDRA 1MP0A 5CDTA 4PZEA 4WCDA 2Q1SA 3P19A 5A5EA 2DM6A 5L4SA 1ZK4A 3OJLA 3KZVA 5DCYA 4I9UA 4FB5A 3PWSA 2ZQZA 5IZCA 2BELA 4EGFA 2UUPA 4LMRA 4PLTA 4ALMA 3CH6A 4RVFA 5B4VA 3GNSA 2DVMA 1YL5A 4P8RA 3WNVA 1U5AA 1QMGA 1JVBA 2NV6A 1WZIA 2YQ5A 5ER6A 1E7SA 2BKAA 1E6UA 2UDPA 3JYLA 2EGGA 5AXDA 2JFGA 3I4CA 4NFSA 3RC9A 4PLGA 3HN2A 5JC1A 2LDXA 5EINA 1T4BA 2PKQP 2I5PO 2IEDA 4WEOA 5IFLA 2YDXA 3ROKA 4IIVA 2YYYA 1DDOA 1I5RA 1GTMA 3UGKA 3E48A 1XWFA 5KVVA 3OFSA 5L95A 4EW6A 4BNJA 3K73O 3Q1LA 5U4QA 1B0AA 1IOLA 1UUFA 2AA3A 3AM5A 3LK7A 4FC7A 3ONDA 2GASA 4GQAA 4D45A 2NWQA 1LC3A 4PZCA 2C20A 1GQYA 2RCYA 4BOYA 2I3GA 2XXJA 5L9AA 3HNPA 2AQIA 2X9NA 4E2WA 3JQAD 1O6ZA 3QVXA 1DIRA 2JD2A 5CDGA 4QUKA 2IYOA 1E3EA 3LT2A 3STHA 1CEQA 1EVIA 3ZNQA 1C14A 3V5NA 1V3UA 4Q3NA 3VH1A 1NFRA 3QA9A 4RVGA 5I8ZA 1Y5MA 1C3VA 3EC7A 3ZNNA 3BTOA 5IG2A 3QJ5A 2CVOA 5TGDA 4MVJD 3AUAA 4BO1A 2Y1DA 3K96A 4TVBA 3DDNA 4HWKA 1KEUA 1YBVA 1A71A 3ZCXA 4J4TA 3OJOA 4CLDA 5J23A 2OP0A 4PLHA 5EESA 1MG5A 1TT5A 3PTZA 4B4UA 1PZFA 3D64A 4ONEA 3ASUA 4YAKA 1V6AA 2V6BA 3H2SA 2CVQA 1T2DA 2C5AA 1UXKA 4GH5A 4WOKA 1H6DA 2E6UX 3MJCA 1KC1A 4WOJA 1WLYA 2Z5LA 3GVIA 4J49A 5TC4A 4O59O 1K5HA 3K30A 3WSVA 3DZGA 1P1RA 3U62A 1N2SA 1CDOA 3PFFA 5T6BA 1Q7CA 3ANMA 5CEEA 5ILOA 4R41A 2ZKLA 1PGJA 1KY5A 4IM7A 4E5MA 2OZPA 3K92A 4KZPA 1EVJA 2BH9A 5A05A 1PGNA 2A92A 3TPCA 3UAGA 3UCFA 2AG8A 1Z82A 4AJLA 5I9MA 1ZJZA 4R4JA 3JQAB 4ID9A 1NFFA 4A27A 3S2FA 4MO2A 4CM1A 1EE2A 3PLNA 4OXNA 4RQUA 3UCEA 3V1YA 3ZGYA 5LDGA 4B8WA 1QORA 4IXTA 4CM4B 4AJHA 3D3EA 1T1RA 1YWGO 3JV7A 3DWFA 4EEZA 1YJ8A 2HAEA 4NBRA 3NJ4A 1I01A 4FSHA 5C7IO 3HQ4O 4NG5A 3DBRB 4HV4A 4XJSA 3GVCA 5JDIA 2CZCA 2NUAA 4XD2A 2HJSA 3ZHBA 2YUTA 2VTEA 3VZPA 3KEQA 1Y8QA 4UUPA 4D42A 3QIVA 1GAEO 1M67A 3SVTA 2VHXA 2AQHA 5A06A 1T2EA 4DQUA 3GDGA 1IY8A 5A3JA 1XGKA 4MIYA 2JCYA 1BSVA 4OXKA 1YOVB 4R16A 5L3ZA 1HZZA 1EFKA 1ZSVA 2VHVA 4FOOA 3ZV3A 3ETGA 1PL8A 1PWZA 3SXPA 4ALLA 2C7VA 2ZJ0A 3WGZA 1LU9A 5C37A 1B8UA 4W6ZA 1NPDA 1EK6A 2G17A 3WB9A 3BA1A 4BGVA 3CZRA 3GRPA 2FRDA 2OFPA 4G65A 3X2FA 2JL1A 1VC2A 4IQ8A 3DEYX 1U5CA 3WBBA 4OH1A 3EYWA 3D1LA 1TB4A 2EKPA 7ADHA 2H9IA 1JWBB 3QVSA 1V0JA 1O5IA 3W1VA 4ZQGA 3OH8A 4XGNA 4B3HA 4R5MA 1UXJA 4BNKA 5EQFA 1YQDA 5KJ6A 4K28A 4BO4A 4FJ2A 4BMVA 4CV3A 2AMFA 2Z95A 1ZNQO 4FCCA 3G49A 4FIZA 3NX4A 4FJ0A 4YAEA 4BS9A 1V3TA 1E1NA 4I08A 1I32A 5AVOA 4PLVA 4J7UA 3D4NA 5KOIA 4P22A 1CWUA 2OO5A 4J7XA 2D1YA 1UP7A 5JYAA 1XEAA 2A9FA 4W82A 4XR4A 4CM7A 1CQIA 4BUCA 2PKQO 2H1SA 1N9GB 3GHHA 3JYQA 3WG9A 4YJHA 1VSVA 1AGNA 4CMGA 4LISA 2O3QA 4W4TA 1TI7A 1DC4A 4C7KA 3U4HA 3FD8A 4K9DA 3ITKA 4M49A 4PLCA 5B4UA 1PWXA 1SPXA 3I5MA 3RBZA 4NBTA 3ICPA 3H3JA 4E21A 2YV2A 4OOEA 4Y9DA 2BMAA 2B5WA 5JBIA 2NM0A 3RD5A 3GDOA 1E3JA 4GX5A 4TQGA 4XIJA 4A0SA 3DTTA 1P31A 1VPDA 5U9CA 1WDLA 3C1AA 4BO5A 4IDCA 4XQEA 3R3JA 2BI8A 4BO9A 1U3VA 2NU7A 2CF6A 3G3EA 1EMDA 4HFMA 1X7DA 5CPFA 9LDTA 4CLEA 1I3KA 4GLLA 1HE3A 1B14A 3NDRA 5C3MA 1YB1A 1PJTA 1R12A 3H65A 5G4KA 4TMFA 5G4KB 3I83A 4K1LA 3VVCA 4CR6A 1R4NA 2YZ7A 1XSEA 3ST7A 4XB2A 4WLVA 3WMWA 1T1SA 1PGOA 4NR0A 4JK3A 3RU9A 1B8PA 4MVJG 3GY0A 4FC6A 3DZBA 3DFZA 3AJRA 3FPLA 2DFDA 5HTOA 4BNGA 2X5KO 4OMUA 1UXHA 3HFGA 5BQFA 4GX1A 3FCOA 3G17A 1ZZEA 3FNHA 1L1FA 4E2ZA 3KO8A 1ZUD1 2FZEA 2P4HX 1Z7EA 2YDYA 1E1KA 3VVBA 3GZNA 3ZHXA 4TRMA 2PK3A 4YT2A 4JJFA 4FFRA 1D7OA 5IN4A 3TNLA 4Z9YA 3F5QA 1PL7A 3BHIA 3GN2A 4OKIA 4FD3A 2Q46A 1QKIA 1FDSA 4IS3A 5JO9A 1GCOA 3UW3A 1O95A 3PP8A 3KYDA 4TKLA 5KVCA 1PJCA 1Y9AA 3F46A 4JX8A 4LGVA 5ICMA 1ULUA 3FN4A 4D7AA 1ML3A 2VWHA 2ZIZA 3Q9UA 2POQX 4RPHA 4X54A 3G1UA 5JCXA 1G1AA 4RGBA 4U7WA 4S3MA 2YQ4A 1GZ6A 2YFQA 2X0NA 3TDKA 1H5QA 3HJAA 2J5KA 4TKMA 5JMWA 4BL5A 1N92A 2O3UA 3JQ7A 1AHHA 2IEBA 4GVLA 1FJHA 1WMBA 4JNKA 2C2XA 2IE0A 3PXXA 3BZUA 5BSFA 1C0LA 4JROA 2QRLA 4M1QA 4UUMA 5JLAA 1JKFA 1XCBA 2NU8A 1PGQA 4FFOA 2QQ5A 2GNAA 1UR5A 3ZWMA 3A14A 1P1KA 1OOEA 3GMSA 2Q99A 4DMMA 1KEWA 3OEWA 3MTJA 2EW2A 3PHLA 4EBFA 1O8CA 3JD1A 3DONA 4LCEA 1IPFA 1X14A 3RSHA 3ZWCA 5JC8A 3VAZA 3PHJA 4FN4A 1DHTA 3NAQA 4YQYA 2Q22A 3PRJA 2PTGA 1QLJA 3BMCA 3TL3A 3QE3A 3U9LA 1X13A 2TMDA 2JJYA 3I3OA 4NFHA 4ESOA 5I9NA 3BTVA 4PCVA 3PVZA 2OXIA 2NQTA 3LC1O 2BFPA 1I2CA 3CINA 5J9GA 4WLUA 1ZK2A 5ITWA 2DAPA 1IUKA 4QXMA 5GZ1A 4CM5A 4YJDA 5IXYA 4FGWA 4RZIA 2FZWA 3LLSA 2O23A 3WOHA 3JQ8B 2QHXA 3AM4A 3SBOA 3ZWVA 3ROPA 1DLIA 3FI9A 2J3KA 2YY7A 3VZSA 4E5YA 3K2BA 2Y0CA 3M1AA 4RF5A 4UVEA 1JA9A 3ADPA 4CMJA 1EUZA 2IZ1A 4NJMB 4E12A 2PZJA 3QWFA 8ADHA 3GEGA 3IJPA 1X0XA 1YRLA 3AFMA 1HLPA 5A02A 1LLDA 2JD0A 1LX6A 4AJKA 5JY1A 1LLQA 5AYVA 1UXGA 4K6FA 1RWBA 3UHAA 1QG6A 3WGGA 4W9NC 3A9WA 4IZIA 2WTBA 1XQ1A 4H3VA 1RJWA 1HDZA 3MZ0A 1B3BA 2B83A 5BNFA 4XYMA 1JKJA 3OETA 5HM8A 1NWCA 2OBYA 4E33A 1EDZA 3OEYA 1W73A 3QW2A 4FJ1A 1RM3A 4GMFA 4PZDA 5CDYA 1G0NA 4QEDA 1ARZA 5JW6A 1P0FA 4WUVA 4DYVA 4CMBA 4RDHA 1I2ZA 1PQWA 5IZ4A 1H94A 2BFOA 1NHGA 1P9LA 4N5NA 4FGSA 1OMOA 3DHYA 3S2EA 2GGSA 1IB6A 2WJPA 3WLFA 4E32A 4F46A 3SC6A 2VOJA 3KV3O 4YTEA 3KXDA 2D2IA 2DBQA 1NP3A 4ZRNA 3OBBA 5JCJD 4J1NA 3KOUA 5I7EA 1D8AA 4ND4A 4IIUA 3KTDA 2IRWA 4D3SA 1E3IA 3PZBA 1LNQA 4DA9A 1NR1A 4E6PA 3RUFA 3WWYA 3FNFA 3LF2A 1I8TA 5JYEA 1C1DB 3MJSA 1XIVA 3D4PA 5MDHA 4BB5A 2XXBA 4NBVA 1UDBA 2GN8A 1UAGA 1EVZA 4J4HA 3ZV4A 2C2YA 1H9AA 2PD6A 3NT4A 2WE7A 4B7XA 2Q1UA 1QYXA 2VUSA 2G0TA 3ZN2A 1Q0QA 1E0DA 2JCXA 4BQRA 3VPFA 4FR5A 3QP9A 3T4XA 1R66A 1N7GA 2HJRA 3FBTA 1GY8A 4TSKA 4ZQBA 3WQSB 5FI3A 1LJ8A 2EHDA 2FHSA 2ZB3A 2WYWA 4CR7A 4E5KA 2WYUA 2H6EA 4XGIA 4CUJA 4HNHA 3HDJA 1HTBA 4U6SA 5DP1A 2WD8A 1I24A 1KEPA 1P44A 3AWDA 4QFDA 4RF3A 3RC2A 5G0VA 5THQA 5FWNA 1F8FA 1U8FO 1D1SA 2W4QA 3TZKA 4Q3CA 4DRYA 4UVDA 7MDHA 4N7RA 4FQ8A 3HE3A 1DRWA 4CUZA 2I67A 1FDVA 4NU5A 4CM8A 1DEHA 1QRRA 4WCFC 2Q1TA 3GRKA 4TZTA 2VRCA 3ULKA 5GZ3A 4E4YA 1NQOA 4FBGA 3SJ7A 5ES3A 2R6JA 1QV6A 4UVGA 4M55A 4CMCA 1HETA 3DZJA 3MOIA 3WGYA 5HS4A 3DTYA 1BWSA 3AOGA 3GUYA 4TRJA 2C59A 1ZMOA 3WYBA 1CYDA 1SOVA 4Z0HO 3ZDFA 2HLPA 4WLEA 1NHWA 2B37A 4INAA 3VPHA 4B3IA 1XDWA 1F14A 2NTJA 1P74A 2NSDA 3S55A 3WXBA 1I10A 4DL9A 3KETA 3WFJA 9LDBA 4CUKA 5JYDA 4Z3KA 4ZN6A 4JP2A 3DFUA 3RUDA 4J1SA 5FYDA 1U8XX 4L73A 5IAAA 1FK8A 3ONFA 2Y68A 3T7EA 1IYZA 3NGLA 1DC5A 5JPIA 2ZTVA 4MVJA 1ONPA 2AQKA 2I99A 4RVUA 4LN1A 3DBHA 1B2LA 4Y98A 3EZYA 2C07A 4OOFA 3AY6A 1W6UA 4IDFA 4CV1A 3CE6A 3DB2A 3B20A 1BG6A 2W2KA 3PWZA 1ADGA 1LRKA 5JAQA 1UP6A 1DSSG 1BXGA 1RKXA 4CLRA 4BNMA 4Y67A 1PJBA 4RLSA 2ET6A 2HSDA 3PYLA 3IUSA 1MB4A 2HU2A 3T4EA 4CR8A 3P5SA 1NBOA 5BT9A 1PGPA 3QWBA 4QECA 2TMGA 1GZ3A 3L6DA 1H0KA 3RFTA 4E5NA 3ZV6A 3LYLA 4RV9A 3MCVA 4M86A 5A4DA 3FPCA 1LDNA 1MXFA 4IXWA 4AJOA 2IXAA 1MC4A 1U2DA 2V6GA 5EMHA 5KIAA 2PZKA 2JHFA 3DAPA 2O7SA 1HSOA 4IMRA 1Y1PA 2PGDA 2VNAA 3VHRA 4XYLA 1T25A 2DTEA 5G2OA 3BMNB 4OSPA 1YS4A 3L6OO 1E7RA 1KVRA 3GGPA 3IC5A 2W8ZA 5H83A 4R69A 5KJEA 1H9BA 1WAMA 2IZ0A 1VSUA 4PFJA 4YACA 1I2BA 3V2UA 4DIOA 4KWIA 1ISJA 1NNUA 3JSAA 1MXHA 3WMXA 1DJQA 1KYQA 4JIGA 1LBEA 3HB4X 3KEOA 4J2OA 4NMHA 3KLPX 2EXXA 3GUCA 4AFNA 2G76A 4WLOA 3OQ6A 1BVRA 1PJLA 4FPXA 4XA8A 2PD3A 4AJ2A 2QX7A 4GX2A 3F1LA 3U5TA 4LSMA 4IDGA 3U49A 3H9EO 3EHEA 3B1JA 1PIWA 2EP7A 2HMWA 3GT0A 4PLYA 1PJSA 4S1VA 4KDEA 3UVEA 5TQVA 2GZ3A 1NPYA 3ABIA 2PD4A 3A4VA 3JQEA 1LI4A 2GDZA 1K6JA 3Q9NA 1A4UA 2EKLA 3DAGA 3R6DA 3V1UA 2HDHA 2HMSA 1XYGA 2A94A 3NTOA 4O0LA 1MGOA 2PR2A 1ZVMA 2NTNA 4GSLA 4WEQA 2EJVA 1VJ0A 2ZTMA 1Z74A 3PDUA 1UZNA 1V8BA 2CFCA 4IDBA 1IHXA 4R54A 4YWJA 5TIIA 1VKNA 1LDBA 4R9RA 1GPJA 4BNZA 3D3WA 5COBA 1Q7GA 2DC1A 2NU9A 5AXCA 5I7FA 4D0SA 5G4LA 2FPIA 1E3SA 2AG5A 4U0KA 2UVDA 5DULA 2VCYA 2DBZA 1NTOA 4L4XA 3L9XA 4PLPA 5G0UA 1VJ1A 4J0FA 2D8AA 2Q4EA 2AE2A 3GPIA 2D5AA 2B35A 2OHXA 4E13A 4CMHA 4BO8A 2XOXA 4L76A 3C3XA 4AICA 1EQUA 1Y7TA 5TT0A 5HA5A 1NX6A 4XYBA 2BGKA 4PVCA 3WGIA 5DBFA 1MLDA 2RH4A 5KJCA 1VRWA 2E37A 4UULA 2YV3A 3OSUA 3SLGA 1YQGA 2GO1A 3QVOA 4BKPA 1KEVA 4JGBA 5TT1A 1RPNA 1UJMA 4J43A 2BRUA 5I9LA 1NM5A 3H2ZA 4G81A 4JLWA 2NVWA 2NU6A 3ANLA 3T7CA 1BDBA 4AJ1A 1PQPA 2NVUB 1N8KA 1HDYA 4E0BA 4CQMD 1AE1A 3E18A 1TVEA 1IPEA 3PJEA 5JNLA 4MOWA 2NVBA 1Y81A 3KB6A 4JBIA 1LQTA 4XIYA 2VYVA 4L4RA 4CLRB 2G5CA 1PJ4A 5A1TA 1WNTA 3AI1A 4PLFA 3RI3A 4N5MA 1X7HA 3TZCA 1HZJA 1M2WA 2E49A 3UICA 2GYYA 2H5LA 3PHHA 4Z3DA 4CMEA 3AFNA 4ZD6A 4HNGA 3RVDA 1E92A 3SC4A 3PLRA 4H16A 3U09A 3GNTA 2JKVA 2YW9A 5DCWA 2OOSA 3WIDA 4F6LA 4BMSA 1ADCA 2C5EA 2B69A 2YV1A 3BMCB 4Q3DA 2HRBA 3ZWPA 1T24A 2VT2A 3D3WB 1W4ZA 4UUOA 3D7LA 1U9JA 2GPTA 2H63A 2DLDA 3M2TA 1X15A 4GBJA 4DYDA 4MVJI 3INTA 1ZBQA 2CUKA 3KYCA 4M54A 3NRCA 4IJWA 5EERA 3GGOA 1NQ5A 3MJTA 5L4NA 1EUDA 3ORFA 1AHIA 2HKIA 4M87A 2VRCD 5A04A 3FWNA 4HADA 5DNAA 2J3HA 4TROA 1YBAA 3TFQA 2B4RO 1DRUA 2FR1A 4GWGA 1VL0A 4RQTA 5F5LA 4DC1A 2DPHA 1A7KA 3TZ6A 1Y8QB 2V7PA 4YAGA 4OXYA 1L7EA 1T2CA 5ICSA 4I5GA 2C29D 1D1TA 2R2GA 3EMKA 3RROA 3ZZNA 4XRGA 1YBMA 2VZ0A 3E82A 2ZCUA 4N18A 1JU9A 4FFNA 5DF1A 3NGXA 1JTVA 2EJWA 2DBVO 4I5FA 5T8KC 4IQGA 1Y5RA 3KVOA 1SBYA 4R9SA 3LSYA 5CPBA 3WLEA 2O3JA 1QYVA 3JD2A 1NPTO 2C82A 1K2WA 2GUGA 3E9QA 3QSGA 3ZWBA 2ZJ1A 1GYRA 4K26A 4RZHA 1GPDG 3DMTA 1NFQA 1TEHA 2W2KB 3GH3A 2PFGA 2BGLA 4RJTA 1OZAA 4II2A 3B70A 1Q1NA 4NZ9A 2O48X 4UVIA 4E2YA 3U4IA 3VKUA 3H8VA 4D0RA 3U4CA 1MC5A 5COAA 3JQBC 4UREA 4I8XA 3PEFA 3VH3A 1ZKMA 1N5DA 2D3TA 2UYYA 3MTGA 2QG4A 1HYGA 4J16A 3ROQA 3ZWOA 4BGUA 3JQGB 3TRIA 1MG0A 2CY0A 4LVCA 5AQ1A 3IUPA 1A9ZA 1X1TA 1D3AA 2E4AA 3NDIA 1SZJG 5BNIA 1U3TA 2F1KA 1R15A 1HT0A 1PZEA 1QP8A 2GERA 3TN7A 4CQLA 5DN9A 2YHIA 4KTVE 1QYWA 4BO7A 1ONNA 4YRBA 3K9QO 4OSOA 2CF5A 2DU8A 4KUGA 3GFGA 5DOZA 1OBFO 1XHLA 2WYVA 3WJAA 2X9VA 4CLHA 2NADA 4YA6A 4XRRA 4J1TA 3CSDA 5EJ2A 1V35A 1UXIA 4BNTA 5L53A 5TLSA 3ZU4A 3KBOA 8LDHA 1MA0A 5TX7A 3TSCA 3TWOA 3MEQA 4OKNA 3HG7A 3GG9A 3FTPA 3F4BA 4NDNE 3ITDA 2V6MA 4YB8A 1ZJYA 2Q2VA 4JJGA 4ZU3A 3WBFA 2CSUA 1ZXLA 4ZJUA 1DBVO 1B26A 1NVGA 2P5UA 5HRUA 4Q3AA 3O8QB 2Q3EA 2HMUA 1UP4A 4CM9D 4TRRA 1PS0A 4G2NA 4LRTB 1XKQA 2F00A 4ZQHA 4YAIA 3F3SA 1NAHA 4DUPA 2PH3A 3FNGA 5LC1A 3I6IA 4ND2A 3MOGA 4HUJA 4PLWA 2Q1WA 4EJMA 1C1XA 1KC3A 1R37A 4QO7A 1P77A 3OIGA 2V6FA 2EG9A 4D79A 2AXQA 1C1DA 1PSDA 1WPQA 4OGWA 4YJFB 5CP8A 4YRAA 3OQ1A 2QIOA 3JD0A 5JCJA 2P2SA 3W6ZA 1A4IA 1NVMB 4L74A 1HDGO 4DPKA 2X58A 3TJRA 3JYOA 1HDOA 3P2OA 3CMCO 3GPDG 3L4SO 1KY4A 3GC6A 3WTBA 2DT5A 2PKRA 4B4VA 1V9LA 1SOWA 4GX0A 4LVUA 5CEJA 5GZ6A 3OICA 3N7UA 3RKRA 2FR0A 4PG7A 2IDZA 3GVPA 2LDBA 1YL6A 2O3RA 1NYTA 3DMYA 1E7WA 5CG1A 3QVTA 3KYDB 5EL0A 4AG3A 4RLHA 4HKTA 3KHUA 2V65A 3H9QA 3OF2A 5DOVA 1CETA 1M6HA 3Q3CA 1YKFA 2X0IA 1HYHA 3PHGA 5KNLA 2W98A 5T8KA 5IJZA 4KTTE 1SEPA 1IHYA 1YGYA 3JQ7B 2ZYGA 3GEMA 4L4SA 1R4MA 5FEUA 2G1UA 1C0PA 1H93A 2NNLD 3JYPA 4R1TA 1R0KA 3RC1A 2I76A 3ZU3A 2Q4BA 3I9JA 5H82A 3GEDA 4BNUA 1WW8A 1P0CA 4DLAA 1XA0A 4E31A 3IL2A 1A72A 2OORA 3PWKA 3DMTC 5AXBA 3MJVA 5IXSA 5CDSA 1O94A 4EUEA 3COSA 3PIDA 5KVQA 5T73A 4CMAA 4KP7A 3GAFA 4BV9A 1ISHA 3H7AA 1E6WA 2SCUA 1TA4A 1XU7A 3C85A 3FBGA 3B1KA 5CHEA 1JAYA 5DZSA 3R3SA 4AJNA 5KJ1A 3KRTA 3BMQB 5BR7A 1H2BA 2EWMA 4H15A 4ND1A 2DTXA 3K6JA 4EJ6A 2X7HA 5ER9A 1SO8A 2B4TO 1EE9A 2UUOA 4DLBA 3E5RA 1JDJA 4O63O 4W99A 1O9BA 2D5CA 3AUSA 4B7UA 4WASA 2QRKA 1QV7A 1QXSA 3RJ9A 4CL8A 3IDSA 1WZEA 3QVWA 3DZIA 3IP1A 4W9NA 2BHLA 3DBHB 1U3WA 1B7GO 1K3TA 1J6UA 5A3VA 4LK3A 4JXKA 4U0JA 2VRBA 1ZMTA 5JDCA 2J5RA 1I3LA 3K5PA 3IQDB 3P7MA 3RFVA 1J0XO 1PTJA 4BKUA 2PV7A 4MPDA 4IJUA 3GHYA 4N5LA 3F4LA 4R5HA 1YE3A 4QQRA 4HFJA 2NQ8A 3B1FA 2QYTA 3IMFA 5KCZA 4Q3BA 3TOZA 4XYGA 1RM0A 3TZQA 3G0OA 1I3MA 1ISMA 4PN3A 5DBGA 4DC0A 3D5QA 4PLZA 2R00A 1XELA 4HY3A 1DC6A 4R51A 2NVUA 3WIEA 4DMLA 4IBOA 4DBZA 4MIOA 1B3RA 1EQ2A 3JQCA 5IN5A 3I23A 3OJFA 5AXAA 4DVJA 4J1QA 1PJ2A 3A1NA 1MX3A 3DAFA 1IZ9A 3KM0A 5FF9A 4N54A 4KUEA 4DIBA 4AJEA 4ZGWA 4YAJA 1LDMA 4RPLA 1NASA 3HB5X 1DB3A 4IPTA 4BNIA 5KJFA 1GQ2A 4ILKA 1UH5A 4NIMA 4LW8A 3ZH2A 5B12A 2IXBA 3PQDA 4J7CA 3S8MA 4R01A 2PZMA 2W2LD 3B6ZA 3QWAA 1UDAA 3BHMA 4BVAA 1Y8RA 1CF2O 2DUUA 3F6YA 4IGFA 2J3JA 4M89A 1YB5A 4BO2A 3GLQA 1E5QA 1PR9A 1QLHA 4BNWA 5HS6A 1FDUA 3GGGA 3E6AA 1XLTA 2AW5A 3CKYA 5U1PA 4M8SA 3CIFA 1J4AA 1AXEA 4BQPA 1Z75A 2NACA 3D4OA 3K8ZA 1BXGB 5I7VA 2ZATA 2P9EA 3KSZO 3AU9A 4XDZA 1E7YA 1O89A 2EP5A 3PJFA 3RAJA 3BMQA 1B8VA 1L7DA 1GL3A 1YVEI 4RL6A 2VN8A 3GMDA 3NT2A 4HX5A 5F21A 2Q45A 4CV2A 1IZ0A 5A9RA 1Y8RB 5DDIP 4MKXA 4A10A 4DXHA 4NI5A 4RVDA 4YJGB 1GADO 5FFFA 3ON5A 3SX2A 1TT7A 2BI7A 4YVFA 3JQDA 5JAMA 4CM8B 4Q39A 2I3AA 1I33A 3L07A 3I1JA 1ENZA 1N7HA 2J5QA 3GZNB 1LRLA 2Y1EA 4F45A 1QYCA 5TJHA 4JN6B 2GN9A 3L9WA 3UFXA 2QZZA 3AK4A 3PGJA 1XU9A 5JXWA 4KWHA 1SNYA 3PK0A 2Z1NA 1KIFA 5THKA 3WTCA 1Z73A 4IJVA 2HK8A 4XKJA 4MKZA 4FW8A 4RO0A 4WECA 3W6UA 5CG2A 2Z1MA 3M2PA 3WX0A 3WQRA 4EEXA 4UUNA 4FFMA 2X9GA 4HBGA 2VZ8A 3BIOA 4Z6KA 4WLFA 3ZW9A 1YB4A 3GN1A 3O4RA 4MP6A 3ROMA 3QWIA 2QYSA 5T57A 3CEAA 1N1GA 3OECA 1I36A 4OIMA 4DBVO 3AY7A 3S1LA 1R4MB 3N74A 3FNEA 2P5YA 4UEOA 5LCXA 1YH3A 2FPGA 1SCUA 3ZNOA 2Y66A 3IP3A 2HQ1A 3SLKA 4J4BA 2HRZA 3NYWA 5A9TA 3IOYA 2QRJA 1A7AA 1Z45A 3RCBA 5F3RA 1K6XA 3F9IA 3KUXA 2X5OA 1R4NB 1DRVA 4GMGA 4NK5A 4F3YA 3ZW8A 3DL2A 4NFYA 5JDCC 1BXZA 5JDIC 2FMUA 1ZEJA 2ZYDA 4XWYA 4ZHSA 3JQ8A 1PX0A 5A5FA 3BTSA 5B4TA 5TS3A 2ZTLA 6ADHA 3C1TA 5BNTA 2JAPA 5TRTA 3S2GA 3ZWWA 2VT3A 5K0ZA 5G0TA 3L77A 2JCVA 1QSGA 3OA2A 1DAPA 4W7IA 1E77A 2Q50A 1S6YA 4F6CA 1EFLA 1RYDA 2R00C 1W8DA 2UAGA 1BRMA 2RHRA 5A03A 3WFIA 3O9ZA 1LEHA 1MFZA 3C7DB 1S7CA 1BW9A 1QYDA 3NT5A 1LDEA 1VE9A 2GRAA 3ZV5A 1FXSA 1Q2XA 1ENOA 2W2LA 4ZVVA 2DPGA 4QT0A 4GLOA 3ZHZA 3ZWXA 4CQMA 1EZ4A 5F5NA 4R3WA 1ADFA 4Z9XA 2JFFA 2ZYAA 1HKUA 4J9VA 1F17A 2VYNA 4YCAA 5ENVA 1PS8A 2VUUA 4BO6A 3R0IA 3JQFC 1GEEA 1RYEA 3I9NA 2WD7B 1ZIDA 4OM8A 3RUIA 2QW8A 4NH4A 4P38A 3RJ5A 4DWVA 3C7AA 4NNJA 3BYZA 3EK2A 1KVTA 1YOVA 1OC2A 4LRSB 3WSWA 3RIHA 1VL8A 2EGHA 3HN7A 4XDYA 2DBRA 3LT4A 4CM3A 3W8EA 1PU2A 3WDSA 2AE1A 2PLAA 4WJZA 3TL2A 3KSUA 5B37A 2VHWA 4KDFA 5IDWA 1K89A 1CJCA 3AUTA 3RUAA 1WP4A 4YJFA 4BNXA 2X0RA 2X5JO 4QO8A 5JMPA 2WD7A 3I9KA 2EERA 3GFBA 1FDTA
chains in the Genus database with same CATH superfamily
4I5DA 4IDDA 1DWUA 1MAUA 2YHIB 1UAYA 2VP2A 3FWZA 3VDRA 4G5HA 1DU4A 4I1IA 3UWPA 4LDQA 1ADBA 1ZHOA 4L8WB 4LQCA 3EODA 4MTCA 2YW2A 4Y2RA 3R3ZA 2MHCA 3MWFA 3IPYA 4LJ5A 4J0JA 4UEJA 3TI7A 2D5LA 2W42A 3IEVA 2X0DA 5CA1B 1NNSA 3NHUA 4TYNA 4KBGA 4U7FA 2R8RA 2R1VA 1TCBA 3O73A 3CKMA 5D00A 5G41A 4XD7D 3JQGA 3BSSA 5H9VA 5SZKB 2QTLA 4NBUA 1I0ZA 1LNSA 2BKEA 1ZOPA 3LDFA 3DPIA 2OA0A 5FA8A 4CODB 2B4QA 5DE3A 3RV3A 2QAGB 1H4SA 2A4MA 3OU7A 1WCIB 1QFJA 1V8PA 2R5WA 4UOQA 1PT7A 1PZGA 4FYMA 2OP1A 1TLFA 5KQLA 5JYFA 3DFKA 3JXEA 3LH5A 1SC4A 2E18A 3PQFA 1RJFA 3AL3A 4DLLA 1YS6A 5TNXA 1JYFA 3JD3A 4CNBA 1RCFA 1MJFA 4ZDWA 3UOWA 4KW7A 3CRQA 4CM6A 4OLFA 5KTKA 3DW1X 2OYSA 1JG2A 1MAHA 3SFTA 4DVGA 2ZCVA 3K0FA 2I6UA 1HXHA 1RC1A 2NUBA 1BW9B 5K0BA 4G9EA 3CNNA 2IUEA 3K2EA 2P91A 1FUYB 2II6A 3DR3A 1JEAA 1KJWA 4I9HA 5KVSA 4PG6A 1K63A 1NLFA 1ZOIA 2RHDA 4D41A 2XVYA 4J0HA 4UOEA 5F1PA 5AESA 3HBNA 2CNBA 3DLHA 4Z4CA 1P33A 1U28A 3FHLA 1YT5A 4OH7A 4P08A 5LZ8A 1MOZA 3BGIA 3GDFA 4YO7A 3RUCA 5EZQA 3TR5A 1FIUA 2G82A 3ZY2A 3IULA 3IOMA 2G08A 1J99A 3HZZA 4YQZA 4CTMA 2X4DA 4RZQA 4D81A 3UC9A 1A27A 1U7HA 5BQ3A 1Y1LA 4FZRA 1M6WA 1DIHA 3CLSC 1E18A 1M5RA 5AM2A 2XMDA 1M9NA 2V9ZA 4M0KA 3AO0B 5LDHA 3F7NA 3W90A 1XEWX 4MDHA 2CZQA 2QPOA 1FVXA 5HYVA 3G2PA 3REQB 3DHNA 4QELA 2GPJA 1T2AA 2XNJA 4QUEA 2CJYA 3OZEA 1CJKC 2QVZX 4B40A 3KALA 2LKDA 3RRBA 4D9GA 2CLDX 3MMNA 4GSKA 5JALA 2C4MA 3PQ5A 4X93A 3HHPA 4D4GA 3IFSA 3WMEA 1LXCA 2XUIA 2HZ7A 2QGFA 2VF4X 4J90A 1PQ4A 4O4LF 5HRAA 4NMWA 2ZRNA 5KS2A 3PDCA 5T64A 4XCVA 4MR9A 4ZCPA 4YC7A 9MHTA 3PDWA 3DWIA 1SUAA 3KZXA 5ALSA 4CV0A 4LQDA 1P1IA 1O6FA 2BW0A 4ETWA 2I22A 1GRVA 3SNKA 2W9XA 5C1BA 2XYHA 2P5TB 5ALMA 4C6HA 3AF3A 2WIDA 1RBMA 3Q4GA 4H1VA 4IHKA 2C4WA 3B52X 5HKLA 2FOXA 2YH2A 4FCVA 1NXVA 4L8YA 3SR0A 1P4RA 3ZU2A 3AVWA 2PWBA 1T5BA 4OMDA 1SVWA 4GOMD 3EIQA 1UFOA 1DFGA 3VI3B 4RZSA 4GL2A 1GEGA 3QKUA 3JATB 4ZVNA 4D3FA 5GONB 5A9SB 2FQQA 1Z5ZA 1PYGA 1H2WA 2EKZA 2JK1A 3PKZA 1RE0A 4OUDB 3WR5A 4YRIA 3TFWA 4O4JF 3T94A 2O54A 4ZHQB 1PJ3A 3EGDA 3I6MA 1E60A 4I0WB 2CMHA 1P0PA 2DUWA 1PG5A 4UBNA 5TJ9A 1PR5A 2X0JA 1X1BA 3AETA 2J6IA 3B3JA 4MUGA 1GDHA 3DCIA 3FR8A 4ZI2A 4J0CA 1OH7A 3M5DA 3LCCA 3CV3A 1Q7BA 1NQTA 2PSJA 2WDPA 2YY5A 3CCFA 4MKRA 4PX5A 1TCUA 2O7VA 3O7WA 1B8NA 2V97A 3BK2A 3DP7A 3KQWA 3CFYA 1DC3A 1KJJA 3G79A 3M1LA 4KO3S 4ZK2A 3P32A 4CIVA 3DQPA 2J0SA 3QA3E 2JG3A 2I62A 3G7NA 2JBAB 3A31A 4QDUA 3TKLA 2G3YA 3N8HA 1R6VA 1EFTA 4UUBA 5L45A 1O8BA 3GK3A 3D7RA 2OL4A 3Q2IA 421PA 1HDCA 3IQZA 3NI2A 3ZZ0A 2ZB8A 1NC3A 4WL0A 1Q91A 1X1QA 2BHTA 2X2PA 2CDBA 3PPIA 4QEKA 4RPCA 5BR4A 4INZA 3RKUA 5FI5A 1ZXXA 1JFVA 4F4CA 1TM2A 4W1QA 3NCHA 3VPBA 2FMHA 1C3EA 1GD1O 2FSSA 2UKDA 2D0IA 4PC1A 521PA 2OB2A 3S8EA 2QMHA 4E3ZA 4PAQA 1ORRA 4BLOA 5KTNA 4DLYA 3SCZA 2GZ1A 2QEQA 4TWBA 1CUUA 1U2GC 2CE2X 4Z9BA 2XECA 4JLUA 2C9YA 3CM0A 1FE8A 4ZMSA 1XRSB 3P8ZA 1SU8A 1HT2E 2NPOA 1GXSB 1JRLA 1DAHA 2NYRA 3QPUA 4J9UE 1KDZA 2EU8A 4UXIA 2DT8A 3I01M 4MW1A 2LGJA 5EMNA 3IQGX 3LDAA 4B2PA 5CAEA 3KSAC 1NBWB 3H83A 4QDJA 3T5PA 3EF3A 4UTVA 4G89A 3QYAA 4PBRA 3LOPA 2V7UA 1TU3A 3KDAA 2F1HA 5JO0A 5M5BA 4AKIA 1Q57A 4TWRA 1U6JA 2CXXA 4I6EA 4QPNA 4N3NA 3Q0IA 4HCJA 4OP1A 4MH0R 3BWMA 4WOBA 3OTQA 4QL3A 2FPKA 2BUBA 3OQIB 3SXUB 1YQUA 3K31A 4GECA 3IUEA 5BYJA 1V1MA 3VMFA 1QOZA 4GE0A 3GFPA 4EVIA 3WV5A 2WNSA 1YIAA 1FNDA 4IO0A 3CBQA 3A11A 3DEHA 1OILA 1RAGA 3INRA 4QU8A 5I5EA 3LHKA 1S96A 5EIEA 1TM7E 2ZE6A 1NR7A 1R6DA 1IOVA 2XT6A 3FUUA 5HQJA 2ID9A 4A16A 1QHHB 1Y3CE 1KZ4A 3BK1A 4UZSA 1ZXBA 5AVKA 2G1KA 1XD2A 2BEUA 2PWPA 3NWJA 4XVRA 4CF4A 3FVQA 2ZANA 4Z7NB 3H97A 3NTLA 4JZKA 1M6NA 1BMFA 5BUQA 2P3SA 1IBMB 3QLEA 4ER0A 1T6YA 2LD4A 3G13A 5ES4B 3UV3A 2G40A 1XG5A 1KDTA 3DQZA 3RNOA 3G89A 4O2BB 1ZCJA 5BSEA 3A25A 2GK4A 4YECA 1WABA 3N3AC 4G1VA 2PPVA 1ADYA 1JDTA 2Q5OA 2H51A 3IE1A 3FOFC 3M5CA 1YE5A 1DCKA 2CL0X 5LP1A 3C15C 4RELA 1P6QA 4Q1EA 3LOUA 1DTWB 1RQNA 4QKQA 1BWPA 2PXAA 4TTJA 2WYOA 1FFBA 4A03A 2JAXA 4ETMA 1C9DB 4D0GA 1VBKA 4LFAB 4JITA 1F6WA 5I4IA 1Q84A 3FSEA 4BKRA 3KQNA 2G1PA 1T9ZA 3TLZA 2PZLA 1KMHA 1SZCA 3NYRA 1TU0A 2R8XA 4ZT2A 3O94A 3PI7A 1OLSA 2Q3FA 5D2CA 5SZJA 3W1WA 5B57C 2J3QA 1Y5IA 4G07A 3B82A 4YBZA 2X14A 5FFNA 4D9KA 4UU8A 5H81A 5FA6A 5JSFA 5ALHA 4L0QA 1IWPB 1BHSA 1PLKA 1PZHA 4U7HA 2Y0DA 1GGKA 2O57A 2IX9A 4FYXA 4OI1A 1RBQA 4AL4A 1C0KA 2DQ4A 3A28A 4CYMA 1JYSA 2UZAA 2ZE7A 3DHEA 3K72B 3MGCA 4U2GA 2DKFA 2QAIA 5DP2A 4EUNA 3O3CA 5M2QA 1JKXA 5IKEA 2DXIA 1NLYA 3ETLA 1KZ9A 5BV0A 1CJUC 4LC9A 4ZMBA 4OATA 1B93A 2QT9A 3PCTA 3EY4A 1ZRSA 2Q5CA 5E1MA 4EKEA 4DR5B 2JFUA 1XVVA 4C2BA 5CDHA 2JNWA 1G8FA 2ANCA 1I2MA 1YVRA 2ZRJA 1COWA 2P3QA 3O74A 1C3XA 1TM3E 4R1UA 3H4VA 3VHXA 3ONEA 4K9OA 4E5PA 4KFRA 1KZYC 4B6FA 5BWOA 2IOFA 4XARA 4F85A 3IAM1 3RVPA 1RHMA 3E9NA 3V1LA 2DCUA 3ASZA 1YBHA 4Y2SA 3WIUA 1GU7A 1K8RA 1Z2DA 4K3UA 4QDOA 1IAVA 4DABA 4Q1DA 3TFOA 4HWPA 3PICA 3LYAA 4NYMQ 4G0PA 3L0CA 5CVCA 1YCFA 2FSVA 4XGKA 3U81A 3H5IA 3KTFA 3WHLA 4FHCA 4ALJA 3AX6A 4AVYA 3AB8A 4GUAA 3TX2A 4ZYLA 5CDUA 4DR2B 1SXPA 2ZS8A 2HA4A 3DDZX 1NXQA 5AJYA 4L16A 3UV6A 2IZ6A 2O7RA 1IWOA 4OQMA 3PYMA 1SVKA 5L40A 2G77B 2XAAA 3A2MA 2GF2A 1UMKA 3OQVA 4MA0A 5DGDA 5HIJA 3RW9A 2WIKA 4KO1S 3IVXA 1DEOA 1RC8A 5E38A 2CNDA 1HLDA 2H85A 4TT3D 2GJSA 2IBSA 1DLJA 3O8NA 4B47A 1TLTA 1DFIA 2FWJA 4ZAYA 3CT6A 2FNAA 4RACA 1VL1A 1P2GA 1JILA 3N58A 2R1TA 4H77A 2BMDA 1K1EA 4IIEA 1U4OA 1H6CA 2CNLA 1HORA 3PUYA 3UK1A 4OYLA 1JKIA 1XRLA 2R8EA 5C8YB 4PYKA 4A73A 4CHGA 4M7WA 4E5DA 1GYQA 3HXOA 5KQRA 3HA7A 1X0VA 1U8EA 3IBSA 3CU5A 1XXLA 3FUCA 4P33A 2VQ3A 1E0JA 2FVYA 3QKTA 3LOQA 4JJ4A 5E7MA 4YYEA 1ZEMA 2AH5A 4L4UA 4ZVRA 4Q1VA 1KH3A 4BBZA 3GA0A 2R62A 5CG1A 1JV2B 1HEUA 2BJWA 1E79A 2PXHA 3O9VA 4BFTA 4HVCA 1FNCA 1I0LA 2PFKA 4O1IA 4XCXA 1ODFA 4BFUA 5IF9A 2XODA 3QBEA 3PD7A 2YCBA 1I30A 2I66A 3AFIA 4REOA 4TMXA 5AVUA 2GJKA 3AUUA 3DZ3B 1W85B 5DI3B 5M3BA 2Q9BA 4OQLA 1WMFA 1EGHA 3H3FA 4MQUA 2VEOA 1R3DA 1UBHS 4NZOA 2B8NA 1AO3A 3DT6A 6LDHA 3N87A 4OQYA 4ZI5A 4DR3B 1U8AA 1MF7A 1LI7A 4JBWA 2ZULA 5TF4A 1QTNA 1R9JA 1G5PA 1HPLA 4XASA 3SOZA 4HO1X 4PBSA 4AB1A 4AJIA 5BV8A 3ZVKA 1BYIA 1CBUA 5I9IA 3CF6R 3H16A 3KQSA 4OJQA 3LX5A 2XIQA 2OCXA 3LK6A 3UUEA 3E3NA 4OQFA 1J9GA 1QOPB 4AU1A 3VZQA 3VU1A 1N2HA 1J49A 2WIJA 4FU0A 5ALDA 5JSQA 3A4TA 2PGJA 3BWVA 3O90A 3HDYA 1MJHA 4AURA 3PJDA 3QXHA 4TTSA 4PC3A 4UKDA 5TQ2A 3DZ7B 3QX9A 4MVCA 1VHWA 5FV7A 3H1TA 4ENTA 1OLUA 1DWOA 4MGYR 4DY4A 3TRJA 4P0TA 1AUPA 3GG2A 1WU8A 2EJCA 1CR2A 1NMSA 1VLQA 2OBMA 3IHKA 1FFGA 2CYBA 1SB8A 1NZJA 2GN4A 2F3PA 2Y1GA 3PUKA 1DXOA 4WK6A 2FR8C 4GM0A 1X7GA 5FKJA 2GKOA 1KOLA 3ET4A 3UMYA 4PGAA 5EZYB 1K0UA 2EEZA 1EBFA 2QZ9A 4CQMD 3ZV4A 2Y67A 2ZRDA 3PDJA 1NW5A 4GI3A 3KC2A 5JH7A 2KI5A 4TXHA 3BULA 1V1RB 3LW8A 4EEKA 3GP8A 5JZBA 1U1DA 3CVOA 3U44A 2AB0A 2ZYHA 4F9GA 4J91A 1Z6ZA 3FCEA 3JTMA 5F9FA 3AU8A 4B2LA 3WYAA 3NYQA 4PC2A 3IMCA 3CW2A 2A5YB 3TOXA 1DHRA 5DYWA 4WQMA 2BTQB 1FLNA 4LBVA 3FPHA 1EX6A 1T2FA 2EJUA 1X74A 1P81A 2YWFA 3WL4A 4EA9A 4GOLD 1AN9A 1KVQA 4JYPA 4PX2A 2H1CA 2FB9A 4XW2A 1KQPA 2QAGC 3BAZA 4H17A 4IIHA 5LQAA 3Q1KA 1T1IA 1LTHR 4F4HA 1RAIA 1JVSA 4HVLA 1VM6A 3AIKA 3MD0A 3OUTA 3OOWA 1P4JA 5BP7A 3ZWAA 4YLGA 2H1IA 5KSWB 5DSZA 4RVHA 4UBKA 5EKSA 1R0LA 2CWWA 2YOGA 3A9CA 1H2YA 2FPPA 2GKSA 3IVRA 4L50A 1GZHB 3ZR4B 5I7HA 5E0OA 1US8B 2QTVA 2VTVA 4O4LA 3KXIA 1VJ5A 1KXZA 1G42A 1S9HA 3OLWA 5F4BA 1TZCA 4G5RA 4IW3B 3UXYA 3GNQA 1VRVA 2D59A 2R751 2FSVC 2XOKD 3OC6A 4Y2VA 3U0VA 4EHDA 5IDXA 1JQBA 3EVGA 5FO1A 5KAPA 3TW8A 5CT8A 4YFVA 4ARCA 3GYBA 3TCXB 2ZSEA 2H16A 3EEFA 4I3GA 4NBSA 3IELA 2J33A 3L0IB 4KHZA 3L4BC 4ZQFA 5TF0A 5ALJA 2C00A 1MW9X 5JFTA 4FHEA 1CRPA 1I3NA 3QRWA 4JT9A 4KQWA 3CW9A 1ZOSA 1VLMA 1QCDA 3VA7A 4C78A 2XYQA 4BN5A 3V9AA 1GV0A 1LBQA 3RS3A 1JHUA 4MWSA 1PHRA 4YMLA 4ATNA 5LMUB 2C8JA 1DAMA 4GR4A 2BWJA 1EPUA 3QELB 2GOYA 3QBJA 3RG2A 1USKA 1SUWA 5LFAA 2HMVA 2RB4A 2P9JA 2YS7A 4LDZA 4AO6A 2O5CA 1GFWA 3F0TA 3VHQA 1GPH1 1VPVA 3KQTA 3HRHA 4E7OA 3UZUA 1MQAA 1QHYA 2WU1A 4NBNA 5AKZA 4QUAA 3ORQA 3MAJA 3DVQX 4RPKA 1T4MA 4YGXB 2NO0A 2C83A 3L7CA 3ZIDA 2XYGA 4YT4A 5ADWA 3W5DA 4DLKA 2QROA 3ZHQA 3HUTA 1AV7A 3HUFA 5JBNA 1VKRA 1Z25A 4MVJP 1GL6A 4MQBA 1PS9A 3DJYA 4O6VA 1RWQA 1VCIA 3EQ8A 4MS3B 4EUFA 3WYEA 3LXMA 3AF6A 2OFFA 1RIIA 4IXNA 1WMAA 2IXFA 3AY3A 4GZ5A 2XHEA 2EBWA 5EVJA 1BDMA 3NEPX 3R41A 5J4LA 5DRTA 2KW5A 5KKCA 2IHKA 1T4DA 3A7EA 1L5GB 4YI5A 4HFNA 2GEDA 2VJNA 2APJA 3C5CA 4BN0A 5JNTA 1EWTA 5K9ZA 3GR6A 2PL9A 2HA2A 3H2KA 3OY2A 3QLJA 4M8LA 3DT9A 5DXJA 4ZKDA 3NEYA 1HSZA 1DZIA 3MN1A 4EABA 4X7PA 4C0WA 2J6BA 4HAUA 4BNLA 1UWKA 3K0SA 2BGGA 5DTEA 1JIUA 2BFDA 4I4NA 2HSEA 3E0XA 1E96A 3G0GA 4OGFA 5C7OO 2GDJA 1TMKA 2ZRMA 4GC5A 1EK5A 2VHEA 1P91A 2PH5A 3DR5A 4GBGA 4CDRA 5AVXA 3DZKA 4EEZA 1XWIA 1V11A 1KBQA 4JUIA 1PEDA 4Q0MA 1CIPA 5BSUA 7MHTA 2QUAA 1IBSA 4R1QA 4ZO6A 5E9WA 1LGYA 1DBSA 5DX0A 1IK6A 1AXGA 1XDSA 3B3QA 1UZUA 2X7XA 3B6EA 3N59A 1ISFA 1UC9A 3N7TA 2DEUA 3EUEA 5CBPA 1BS9A 1T5TA 2XMGA 3V8EA 1UEXC 5SZHB 4HZUA 2OYRA 3R1IA 4AP6A 1FUEA 1SIOA 5KAMA 5HVNA 1F1JA 1RAFA 4EQ6A 2BLNA 4FKBA 4NARA 1FQOA 3Q3JB 5AW5A 3UFBA 1AGRA 1BEEA 1JIIA 4QDTA 4ZEOA 3A9RA 2VKTA 4F3RA 1A7UA 1DKPA 2XPCA 3O7MA 1Z8DA 4F93B 1GCGA 2K5UA 3UF0A 3FCYA 3EUAA 5AI6A 1PUIA 1R0SA 3LKDA 4TV8F 4JP8A 5EXXA 3ZQ4A 4DSNA 4EI8A 4BBPA 2HCBA 3UIEA 1H1LB 1Z4QA 4RA9A 1T9AA 2D74A 1ZW1A 3KZ1E 1YDGA 3M4XA 1L4NA 3D0KA 4MTLA 4AECA 2FMIA 5COQA 3I2KA 3TVYA 4L9RA 5AOVA 2PXCA 1XPJA 4NWIA 1XDBA 3TSOA 1H2FA 1QZ3A 1XDZA 4AZ3A 1TEXA 3GVHA 3QEJA 1QVAA 2XMCA 1Q19A 4NESA 2PUWA 1N9GA 3ZXUB 4TUYB 2W2TA 1OXSC 4I1SA 2FUG6 1JQDA 1GUAA 1JU4A 3BT7A 3THWB 3X2EA 3DQQA 3EAGA 2WD9A 3QUSA 3FI0A 3KLMX 4MQEA 2JHPA 3ELUA 3HU3A 3IBGA 1R27A 1DOHA 2ZI9A 4J16C 4O4IF 3TTYA 3R74A 3X1ZA 4A2PA 4RPJA 4GL4A 2GESA 3VBCA 4QTZA 4CETA 1EVKA 1US8A 2QTVB 3MRXA 3JD4A 3CLRC 1LPPA 3L82B 4JKYA 4ND3A 2DTDA 4AM8A 2ZUVA 2OGWA 4HGZA 3MTBA 1DXYA 4MWCA 3IUBA 4R2HA 4E30A 2QP3A 3EXIA 3E03A 2FKNA 1YNSA 3EVNA 2QRNA 3IAFA 1MABB 1VCMA 4TMYA 5B1YA 1Z3CA 3ICCA 3OPQA 4FVTA 2HC9A 2XE7A 5CX1A 4OI4A 3BMOA 1Z12A 4BKOA 3QBDA 5AW3A 1N5JA 1IEWA 1BHO1 4OI0A 5EHNA 5AK6A 1GKUB 4KODA 4UU7A 1FYDA 1GO2A 5J63A 3NHPA 4JOCA 3SXJA 3FSRA 4C1BA 2FF5A 1HOXA 2Y93A 3EGXA 2VAMA 4ESHA 1NF3A 1XTQA 2ZYRA 2EYQA 3ISTA 3HADA 1ABBA 3RE1A 2R85A 3A3NA 1HDRA 3DP9A 2ZR7A 2C9ZA 2Q1SA 2IJGX 3VM6A 1JPVA 2YFYA 5EWLB 1MC8A 1ZNWA 4Q7EA 1DBIA 2B2NA 5L4SA 4RKRA 3PWSA 2ZQZA 4HOYA 3I1IA 1GDDA 4D80A 2BELA 2UUPA 3UQZA 3GJYA 4N9WA 3KX2A 1E1RD 2DVMA 2BMWA 2ZROA 3FZEA 4UM5A 1U5AA 4DLVA 1JVBA 3EBOA 1AKRA 1WZIA 3PQCA 3C3YA 4Y2PA 1KPIA 1E7SA 3SDBA 1W44A 1ZZGA 4UTZA 5C8VA 1Z4NA 2UDPA 1QBKC 1KJIA 1OLUB 2VRWA 2EGGA 2ZVQX 1R9NA 2WAMA 1F3LA 3L7BA 4K8OA 1ML4A 3ROFA 2RI1A 1DQZA 5FLXA 3SX0A 1LJLA 2OCBA 2ECOA 3TZLA 1BJRE 4NFSA 5J2UF 3OSZA 1NURA 3HN2A 2XT9A 2JLRA 2R1UA 5I45A 3Q8WA 5KQPA 2RHJA 2E85A 2QGZA 3LYHA 2LDXA 5JC1A 2I4OA 5B58C 1M34A 1TCCA 3MINB 1E2IA 2PKQP 1PG2A 2C9DA 3THYA 4OVKA 4MX8A 1BCRA 1E3DA 2ROQA 4WEOA 1G3QA 1NW9B 4UEQA 3FZQA 4F5YA 3VNAA 3HYCA 3W5AA 1GTMA 1XTTA 1T5HX 1ZLYA 2VJPA 1H2ZA 3HGMA 4L07A 1KR5A 5LA6B 3JVDA 3IIKA 5ECDA 4O5AA 1LZLA 1F6BA 1J42A 2EATA 3JAMA 1WZ2A 3LK7A 4OXRA 2C98A 5ERGB 1HTTA 5A9SA 2AD5A 3WRXC 3DEKA 4GQAA 4UU0A 2H7XA 2JLAA 3ZCUA 2V1XA 5ALVA 2E1RA 3F6SA 1OFTA 1YS1X 4PZCA 4Q4JA 1VE7A 2E6KA 3BXEA 3HNPA 2AQIA 4LJRA 1G6HA 3EBPA 2X9NA 1ESEA 5PNTA 3THOA 3SSAA 3JQAD 3F5FA 5L8VA 2KJQA 3NM5A 2P77A 2Z8ZA 2VH5R 3RADC 2JD2A 3MQ4A 3UWKA 5JSUA 4QUKA 1WKBA 2IYOA 3K4HA 1E3EA 1YZYA 5BQ5A 2DWUA 1ZD4A 3BGSA 4H7IA 3STHA 1CEQA 2VLBA 2XOKA 3L18A 3WLPA 5JT1A 2O2HA 4D6XA 3V5NA 3CKKA 3FYCA 1GRNA 1BJKA 2HGSA 3PEVA 4X95A 4OREX 2HWUA 1C29B 1A5TA 1L6RA 1WY5A 3EJ6A 1HLGA 3R77A 4YRSA 1OXTA 3UH0A 4RVGA 1Y5MA 1C3VA 1LK5A 2UYHA 3ZNNA 1M2KA 3BTOA 1DV2A 2XLBA 3UWDA 5LSAA 2FW8A 2CVOA 3GRUA 3VSDA 5JXGA 4FCTA 3AUAA 3QXXA 3HXQA 2J41A 3LUGA 3PU6A 3RYTC 3AJ8A 3OTWA 3D4LA 5EFOA 3WL8A 4TVBA 2HJWA 4K2AA 1MIHA 4HWKA 1TKRA 1NKSA 2PGXA 2VPTA 1MJGA 1E32A 3L1IA 3KVVA 3OJWA 4JVLA 1A71A 2B0CA 2YN2A 3OJOA 4FK8A 5BORA 4R84A 2G88A 4MW7A 4DLXA 4NHOA 3QLVA 1MG5A 1TT5A 4JJ6A 4B4UA 4QXRA 1SKAA 2VAWA 3D64A 3EVEA 3A1SA 3KYIB 4IIGA 4KGDA 4J3NA 2W6OA 4C76A 1JF8A 4MI9A 2GCIA 2VQ6A 3G2QA 4KL8S 1V37A 1CYEA 2V6BA 5EEHA 1CNMA 4E07A 2C5AA 2ODEA 4OHVA 3TDNA 2PBLA 2AFRA 2DFPA 2E6UX 5DH9A 1KC1A 1T43A 3Q41A 3IXLA 3KQYA 4WOJA 2HIAA 4OJYA 4P98A 3TQCA 4YAOA 4IF6A 4KXWA 4LQ4A 1P8JA 1T1GA 2QN8A 3KT3A 3D6UA 3RRZA 1GUBA 3K8OE 4LI0A 4MIKA 5BYKA 3TGPA 3KZNA 1HMYA 4D9EA 1ZPDA 2Q9AA 1I72B 3DZGA 4YJKA 1RRGA 1XT6A 4YRRA 3ZLVA 3P4YA 4V0QA 2BY4A 4G4IA 1EWKA 1NVKA 4RESA 3KHSA 3PFFA 5CEEA 3NR2A 4ZCMA 1G21E 3AJDA 1W76A 1U3FA 1NU6A 1JT9A 2GJ8A 2IYLD 4TLEA 5LKRA 1UKAA 2OZPA 2BH9A 3AG6A 2B8TA 3NTUA 4KLCA 5IBQA 5T6MA 1Q7TA 2Z9CA 4M88A 1KSJA 4ZU1X 2W6PA 3OOYA 3WA6A 3UCFA 5AJUA 1C7EA 1Z6YA 5FWYA 3CLRD 5JZ9A 1KEEA 5LL6P 4IDQA 4MWTA 5FAKA 2CMKA 4JR1A 3JQAB 1JLMA 1Q16A 2BOVA 4UE3S 1GR1A 5DTRA 3UMCA 2OD9A 2A0FA 1QJCA 1QMHA 1FPQA 3W2IA 3CLSD 4OXNA 4FTWA 4DARA 3UCEA 2EL7A 2HBYA 3ZGYA 4B8WA 3KOOA 5LQUA 1YUNA 1T1RA 3E3LA 2A7XA 4C0HA 4P53A 3O31A 1YJ8A 3FTCA 3RK1A 5KNDA 3PUWA 4DT1B 3NJ4A 1SXJE 3TTTA 1Q20A 2ZT6A 1OBCA 2ZG6A 4IL5A 4EJMA 2YNMA 3AFGA 4Y9UA 1VZ3A 1AQYA 1I7BB 1FDIA 2XCTB 2CZGA 2QZ4A 3K6KA 3I05A 1WW3A 5I7OA 5JDIA 4M0LA 1SCBA 4E1VA 2WHXA 1AZTA 2VTEA 4NQRA 5E9JA 5I9BA 3KEQA 4UUPA 3T7AA 4NNOA 5INTA 1E8DA 1RI4A 2VHXA 2XEXA 3BH6A 2KYRA 5A3JA 4OXQA 1XGKA 3BL8A 4B82A 1GGMA 2GTHA 4OXKA 3MK31 4R16A 5BR8B 1TVCA 2H4ZA 4P54A 4EYSA 2NUTB 3ZD7A 1PL8A 1PWZA 2WWYA 1E98A 4KO8A 1YFZA 4Q47A 3D6HA 5KC9A 4ALLA 5HCNA 4D8YA 4M83A 3C7KA 4C5AA 3REOA 1SD2A 2E1PA 3CVUA 1PV2A 1B8UA 3EVCA 2WP8J 4Z4EA 4I50F 3VJKA 3TNYA 4CF7A 2PZGA 5BY2A 2VA9A 4BGVA 2B78A 2OKGA 3NETA 3TLYA 3C3KA 5FPYA 4X24A 4U7JA 4YALA 3KOMA 3KLBA 3HKEB 3QMPA 2K6GA 4Y1RB 3CZCA 2HWXA 4IDPA 5D6NA 5KI6A 3X2FA 3DEYX 3DD1A 2ZXFA 3OUUA 1NBMD 4LJ8A 1P62B 1P7PA 5FYQA 3OOSA 1V41E 1EHIA 2SICE 3P96A 4HDNB 1GRRA 1XVLA 1V0JA 1OWMA 3C4QA 5C8YF 5LB4A 2PWAA 4FMCF 4OUDA 4KR9A 4BECA 5IEBA 4ZODA 1OH6A 3PFCA 4F7DA 3RU3A 3HRKA 4EPXA 1RLOA 2O7NA 4FJ2A 5ECWA 2AI1A 4BO4A 4NDZA 5BV7A 2O19A 3BJZA 1M8JA 1Z4PX 3VGJA 2P27A 1JQJC 5CVUA 4HXGA 5E1DA 1QYIA 3ZCSA 3D8BA 3G49A 4FIZA 1Q1EA 3FDXA 4FJ0A 4QPJC 1E1NA 3FSGD 1BOFA 4I08A 4MVXA 1EBBA 1L1EA 1TJYA 3EF0A 4IFBA 1O54A 5A5GA 4HNAA 3WGMA 3D4NA 5AKJA 3H42B 4JMLA 3GNLA 1CWUA 4A1OA 2YS6A 3RYCA 5KEIA 1XEAA 3CWCA 2Z98A 4RIIA 1RJ9B 4CM7A 1K8XB 3R7DA 2PKQO 2O1EA 4YAFA 1O4VA 1VSVA 1MVLA 3M4NA 3RTEA 2RGNA 3BCUA 1L8QA 4CW7A 1GT6A 3SE0A 3USZA 1DC4A 3ESRA 4K9DA 4H08A 4Q01A 1VGQA 4FFBA 2ISSD 3BMXA 4XCQA 2G63A 3LDGA 3WLNA 4RGYA 3SBDA 2E4VA 3NBYC 3I6YA 3Q88A 4NBTA 2AOVA 3BWYA 3MQ2A 4XX1A 2XVXA 1PT9A 1XQYA 3ZOKA 4IO1A 2W6ZA 4DV2B 5D01A 3GDOA 4GXQA 2HJGA 2WQ6A 3R5HA 2YYSA 1P31A 3DTTA 5FOQA 4YUAA 2PUDA 5U9CA 3DXZA 2GRJA 4HLUC 4X65B 3HP7A 1I1HA 3A04A 4OBWA 4BO5A 1QG4A 4XQEA 2V3WA 5E2AA 3R3JA 1HFEL 4L3VA 1H4TA 4EKDA 1O0CA 2FU5C 4BO9A 3FKJA 1W1WA 2CF6A 4B3XA 3PFHA 4AWBA 5CPFA 4DA7A 4GZ3A 4JB3A 3KKPA 4GLLA 2VATA 2J6CA 1XZJA 1XI2A 1GLGA 2PEZA 3BJIC 5FBRB 3WK5A 3ZLUA 4X8LA 2PVCA 3WJ2A 4TMFA 3OFVA 1CF9A 2WSYB 1YASA 1IN6A 3IP7A 2EKDA 3I83A 3PEUA 3ZHCA 4LZJA 4BFCA 1QH0A 3G6WA 1VXRA 2ZBQA 4V0RA 3TJMA 3W5BA 1XSEA 2VS1A 2H1RA 4KH1A 2WJIA 3WMWA 3CH4B 4BZXA 3AVYA 1Q22A 4FNMA 4PO1A 2F8SA 4XI9A 4WY8A 1YGPA 3ICOA 2PN1A 3EXG1 3A3OA 1PSZA 1NXPA 2PSSA 2BHSA 4ZCSA 3QXJA 2XB9A 4ASUA 3K70D 3EJWA 3I6ZA 1L5RA 1ZI6A 3TRFA 4AUNA 4BNGA 1IBLB 5ITSA 1UXHA 5JIBA 2XWQA 3QE0A 4CKXA 3G17A 1UT8A 3LY9A 3T1TA 1AUOA 3GPCA 2WR8A 4E2ZA 3KO8A 1ZUD1 2R7KA 4EW1A 2WICA 3B85A 2ES4A 5BN5A 2OFWA 4OGGA 1C3OB 2F2TA 2FPRA 4EWLA 2IGBA 2V45A 3QEOA 4GU5A 4X3OA 4BQNA 3IOEA 3K16A 4FFRA 1D7OA 4JJFA 1HE8B 4LIPD 4YT2A 4P4SA 5IN4A 3KQHA 1JJBA 3BHIA 3GN2A 4OKIA 1G5HA 2OCGA 1QKIA 3I76A 4I46A 3RR2A 5BWCA 5JO9A 2WSIA 3LRPA 3OX1A 1DDIA 1QGUA 1USWA 3ENVA 3QNUA 1X94A 4TKUA 1O95A 5DLPA 2IUYA 3RVKA 3V2IA 3D7SA 2PT7A 5KVCA 1I3OA 1U3GA 2AVDA 2PSDA 3DMRA 3OVMA 4LZOA 4XUCA 3ZGVA 5KWJA 2BJVA 4MV8A 5AKYA 3FOZA 2FZLA 2VWHA 2ZIZA 2P40A 2POQX 2W2MA 1QO7A 4JJ8A 1W35A 2KSQA 4US2R 5D7NA 3ZBTA 1JUDA 1G1AA 2Q0XA 2ZUUA 4RGBA 4S3MA 4U7WA 2YQ4A 5DFAA 2YFQA 2X0NA 4LXXA 3TDKA 4B35A 2V5AA 1RU3A 1R64A 1T91A 4HXFB 1FTNA 4P3PA 3C6YA 4IDNA 2I3DA 1J2UA 2W58A 3KAPA 4NSNA 3NPAA 4C4YA 2ZU6A 3IBYA 2BMFA 1THMA 4M7RA 2FGJA 4AN4A 3FJ1A 4HVTA 1E6MA 3OQIA 1DEAA 3R5KA 1OAOC 3SXUA 4RHEA 2NU8A 3T35A 3OX3A 3SZUA 5A4IS 3QYJA 4XPIA 1IJFA 1ULAA 2BF4A 1I4DD 3IUJA 4L4ZA 3R7SA 1ADJA 3A14A 1NE7A 3A3PA 3ZOZA 5HHTA 1LWNA 4MMYB 4OHWA 4KSCA 2Q99A 3L4JA 3OEWA 4GD3Q 2VH2A 1J7JA 4PXSA 5I3ZA 1VG8A 3WL6A 2EW2A 1W25A 1Z08A 4HN2A 4MUYA 1RMQA 2YRFA 3ZWCA 3IHWA 3JAWA 1K4KA 3BILA 3PRJA 3I5AA 3K0CA 1QLJA 1SN7A 2I7VA 3O75A 1PG0A 1ZM7A 2JLYA 1ZVQA 2AYXA 2Y0BA 4D9JA 2OO5C 1R7RA 4TXLA 1T0BA 2Q3BA 3VHXB 3KOYA 3C87A 1J07A 2HRCA 2WM9B 3ND8A 3J81k 1R9MA 2YWXA 2J45A 1I2CA 3CINA 1XCOA 5AKGA 4B5KA 3NUZA 8AT1A 2IOQA 1XLVA 3A2KA 2X15A 3HBJA 3RVOA 4CM5A 4ZOCA 3I3SR 3R6GA 5J4HA 3RVLA 2KBEA 2HXYA 1NR5A 3LNCA 2GETA 2WT4A 1OXUA 2AXEA 1F9AA 2ASEA 2FZWA 2R6R1 3II6X 2F7SA 1Y6ZA 3G8YA 3LLSA 1QE5A 1CUIA 2DOKA 3OTGA 4PCLA 4CF3A 4G24A 4DQLA 5KSYA 1L7PA 2VJAA 4FXOA 1DLIA 1WVMA 2J3KA 1JE1A 1NNEA 3R7BA 4GDFA 1U1EA 5CB4B 5FLKA 1CJTC 4RF5A 4LDRA 3VPCA 5FWYB 4BBJA 5ALNA 5ALKA 4KQFA 5JOQA 1UPTA 5BSRA 2AUNA 1ECLA 1J25A 3IT1A 2JHAA 2Z4TA 3BCRA 2XJ4A 2Q2OA 4JC5A 4AJKA 4A2QA 2RGYA 5JY1A 1LLQA 3QYFA 1UMCA 1GSHA 2WTNA 1GGNA 3LFTA 4W9NC 1J2YA 3A9WA 5JNVA 2WTBA 1HDZA 2W83A 3AETB 3BD6A 3CF4G 5TMDA 1B3BA 2B83A 1JKJA 2QTMA 3CRVA 3OETA 4N3CA 5E6SB 3TIVA 1NWCA 2OBYA 4TL7A 1EDZA 4E33A 3OEYA 1Z2NX 3NIFB 3PA8A 3JR3A 1U0SY 2D4HA 2IYNA 2Q6IA 1E63A 1G0NA 3BB3A 4QEDA 5L3SB 1ARZA 1L8XA 2XJ9A 1KI9A 5JW6A 3NHSA 2PZBA 3QW4B 1UBSB 4PYNA 4ZVLA 3R9IA 3VSBA 2O8BA 1GCIA 4RXUA 1I2ZA 4WVLA 4OHFA 3IO3A 3H18A 1PQWA 2P2CA 4PONA 1RLMA 4LOJA 3V1MA 3JWIA 3TLKA 1NHGA 2PVSA 1P9LA 1MT0A 4FGSA 4Q66C 4JENA 1TE2A 3FJOA 2GGSA 3SYNA 3C70A 1W87A 4BX9A 1SBZA 1V7CA 1TJ4A 1OR8A 3JZAA 4F46A 2FX2A 5GGYA 1ODIA 2B1QA 4Q34A 2D2IA 1XU4A 1CUCA 1MENA 1QNFA 2VJKA 1JECA 4PINA 3R9WA 1D8AA 1YU6A 2X8BA 3ISJA 2HU5A 3KQVA 3LX6A 2A0KA 1P73A 1RSZA 4MI6A 5CXSA 2Y1WA 5ICEA 5LQDA 1VGRA 4M6WB 1E3IA 3EEIA 3PZBA 1LNQA 3DF9A 4DA9A 2V8OA 3KJZA 4DAEA 3WWYA 2LR0A 1M0TA 3EXFA 3H0VB 1KJZA 3D4PA 1RAEA 2JW5A 3L2OB 3O0DA 2XXBA 4BVBA 1UDBA 4HX2A 2YC2C 1QH1A 1UAGA 3JR7A 5AVTA 1GZ5A 2WTEA 2C2YA 1H9AA 1D6NA 1DWPA 2WE7A 3EGCA 3W7BA 4JXZA 4HSEA 4PSUA 1IVYA 3H7IA 1RXEA 1MJNA 2VUIB 4PR0A 1Q0QA 1E0DA 5CAEB 5SY6A 3I0ZA 3BX1A 4PHTA 2ZAIA 3VPFA 4LBZA 4MLDA 1WHTB 2P1DA 4B85A 3GLHA 4RXTA 4Q9AA 4ARZB 4K0KB 5HE8A 1MEEA 3ZHUA 4UM8B 2PIDA 2EHDA 1E2PA 2R3SA 3GPBA 1FUUA 5A3RA 2P9YA 5GJCA 4FWBA 2H6EA 4XGIA 4B6SA 3QXSA 4GYWA 2VK4A 5DK4A 1AF4A 3THXB 4NE7A 2JI6A 2O0MA 1G4UR 2ATCA 3LP8A 1I24A 4TTRA 3RVQA 3SVZA 3K6RA 3UJ9A 5TPZA 4M9SA 2W4QA 1RVV1 2IXEA 3LO8A 1UC5B 1YIDA 1Q0PA 3LCMA 4Q3CA 4UVDA 4Z54A 2RH5A 1X1AA 1KYXA 3VSEA 2XE4A 4QXOA 1K8QA 4WA8A 5EHZA 1DTEA 1NZFA 2DWCA 1KNXA 2WWFA 1J97A 3QITA 1QANA 4XD7A 4A82A 1FDVA 1E5DA 5BVHB 2P6UA 3PNOA 4PZ9A 4WCFC 4K6OA 3GRKA 1F60A 2F59A 2VRCA 2WAOA 3BXPA 1LPMA 4E4YA 3WBKA 1ZU4A 3HHEA 3SJ7A 3NHLA 5C46F 1G16A 3M9XA 1QV6A 2HHLA 4M55A 3TXAA 1AX9A 1HETA 1N2GA 3DZJA 5GIPE 2DPYA 1BWSA 2UVQA 2XNKA 4CT4B 1L5ZA