3U4CA

Crystal structure of ywfh, nadph dependent reductase involved in bacilysin biosynthesis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
254
Chain Sequence
SKRTAFVMGASQGIGKAIALKLADQHFSLVINSRNLDNIESVKEDILAKHPEASVIVLAGDMSDQHTRAGIFQKIESQCGRLDVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEFGRIINIVGNLWKEPGANMFTNSMMNAALINASKNISIQLAPHNITVNCLNPGFIATDRYHQFVENVMKKNQKAEEQIASGIPMKRVGSAEETAALAAFLASEEASYITGQQISADGGSMKSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the role of Bacillus subtilis YwfH (BacG) in tetrahydrotyrosine synthesis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Bacilysin biosynthesis oxidoreductase ywfH
total genus 86
structure length 254
sequence length 258
ec nomenclature
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u4cA00
4WPGA 3GK3A 1BVUA 5JC8A 5KVSA 4GH5A 3KV3O 1HE3A 1LSOA 1C3VA 3ENKA 4PIVA 2C7VA 4EGFA 1QYCA 4LSWA 4HBGA 3BA1A 4UUPA 2E48A 3HSKA 3M2TA 1YL5A 4CUJA 1RM0A 2Q1TA 4G5HA 2J6IA 4XGKA 4IS2A 2V6GA 2J3IA 3GFGA 3JYOA 4B3IA 4PZDA 2A92A 5L45A 3JV7A 3TFQA 4D3FA 1I2BA 4DMMA 1M2WA 3ROMA 5F1OA 4B4VA 2Q50A 3KHUA 3CXRA 1YB1A 3V5NA 1BXGA 1PZEA 1VC2A 2QYTA 1LC0A 1M67A 2GYYA 3L4BA 4TVBA 4BO3A 5IDYA 1YS4A 3P2YA 5JCJD 4B79A 1I5RA 5TGDA 1U1IA 4YQYA 1ADCA 3A1NA 3IKVA 5KVQA 1DC6A 3GG9A 1QR6A 2JCXA 5I7SA 4BOYA 5ITVA 4D41A 3ICCA 1BSVA 3UW3A 1R4MA 5EMHA 2E6UX 4XGNA 3RU9A 3S8MA 4QT0A 3IP1A 4J2HA 2R2GA 3PWKA 1BDMA 4Q3DA 3TNLA 4HFNA 4XX0A 3WTBA 4UAGA 3EW7A 4CMEA 1DRVA 4MVJM 3I9LA 4XR9A 5LDHA 1XELA 2HK7A 3GG2A 4JBGA 3N7UA 1WXDA 1XU9A 3KUXA 2UUOA 4A0SA 1WWKA 2VWPA 2O4UX 3RKRA 3S2FA 3V1UA 4A7PA 2PLAA 1QV7A 3NTQA 3CTMA 3DOJA 1O8CA 3OMLA 4UUNA 3H3JA 1R66A 2NADA 1Y9AA 4XIYA 3GH3A 1S6YA 3VH1A 4C4OA 4JX8A 5CDGA 1KERA 1FK8A 3WWYA 4NFHA 1YL6A 4ND4A 2C0CA 4ALLA 2AW5A 4B7XA 2I5PO 3KB6A 1C0PA 1B0AA 1C1DA 2O3TA 1P31A 1MP0A 2OO5A 3K5PA 3WWZA 4CQLA 1LC3A 2YDYA 2UVDA 2CZCA 7MDHA 1YB4A 3JCZA 4YAIA 3SC4A 3RASA 4AJPA 4FC7A 4BQRA 1KIFA 2C07A 3F9IA 3Q2IA 3DMYA 1LJ8A 4L9RA 3SLGA 1DSSG 4WLNA 1GUYA 5DDIP 2VYND 5A05A 2H6EA 3IAHA 3CE6A 1SC6A 3AOEA 3GRKA 5KJCA 1NFRA 4WK6A 2GZ1A 1LLDA 2GERA 4YPOA 1V6AA 4UVHA 4PLYA 1VJTA 4RQTA 1PU2A 2QRKA 3H9QA 1M6HA 3MWEB 4YT5A 4BNJA 2ZQYA 2PA3A 3HB4X 5CDTA 1MX3A 3F1KA 3Q6IA 1B26A 1LBEA 4W4TA 3QWIA 4FPXA 4ALIA 3RJ5A 2Q99A 1YDEA 5IG2A 1F8GA 1GPDG 2AE1A 3PJDA 4RLHA 1RM4A 1P1HA 2BELA 3QVTA 3QIVA 3V2HA 4BNHA 2HJRA 2QG4A 3ULKA 3Q2KA 2IEDA 3R0IA 1V3TA 3BTSA 1OBFO 4AVYA 3NJ4A 4JLWA 3K9QO 3L9XA 3WQRA 5ADHA 1LRJA 2OP1A 5L4LA 4MVJI 3TZHA 3I52A 5ICSA 2O50A 1E6EA 4MDHA 1XDWA 3L77A 3ORFA 3X2EA 3TF5A 2HDHA 2IXBA 4GGPA 4H16A 1UH5A 4D7AA 5JBIA 4DRYA 4YAKA 4FGSA 2I3GA 1WNTA 3IP3A 4ALNA 1ARZA 2WYVA 3SEFA 2DBZA 2EW8A 1XQ6A 4Y98A 2WTBA 1UXKA 1GUZA 3ZHBA 3FBTA 1A27A 4LVUA 1DAPA 2QHXA 2PKQO 4O1MA 2CVOA 4Q3AA 4CQLB 3OJLA 3OIGA 1J6UA 2B4TO 4FFOA 4PLVA 4WNIA 4CM5A 2JL1A 1GYPA 2GGSA 1IHXA 2EKLA 4GQAA 4N5LA 4DIOA 1H93A 4ZQEA 1UZNA 1PJCA 4DBZA 3LC1O 4IDBA 1SNYA 3KSZO 3TL3A 3LC2O 2DFVA 3QLJA 3DZKA 1FDTA 4HFJA 1OZAA 1VL8A 4U8GA 2PKQP 5U4QA 1CERA 2C2XA 3MJTA 4YJGA 3RROA 3UF0A 2B37A 4AJNA 1ZXBA 3TN7A 1PJ2A 3UN1A 4MVJG 3ROQA 1N92A 3DBHA 1N9GA 4IJWA 3M1AA 4AICA 5TIIA 3WGYA 1JKIA 4PG7A 3RJ9A 4B8WA 3OA2A 1MLDA 2HMWA 2X0RA 3HFSA 1BVRA 1EBUA 4F6CA 2X9NA 3ZZNA 1UAGA 2CFCA 2HKIA 1WP4A 5FFFA 3BXXA 5DCWA 1GADO 3QWAA 5KKCA 3W8DA 1AUPA 1MXHA 1DFGA 4J91A 4BNZA 1H6CA 4DWVA 4MVJP 5A9RA 1P45A 4IINA 1C0IA 3F46A 4R68A 4DC1A 2IE0A 3H9EO 1Z73A 5HS4A 2Z1NA 4IMRA 3CINA 1R16A 3GT0A 4YQZA 2CD9A 3HG7A 4RVDA 3IOYA 4GX5A 1R0LA 3DO5A 4H3VA 2O7SA 2CUKA 2E49A 2Y05A 3NAQA 1K89A 1M6WA 3E9NA 3GVXA 3D3WA 1MGOA 3PJEA 4MIOA 4MVJA 1U5AA 5JAMA 3RC7A 3AWDA 3EHEA 3HQ4O 1UXHA 2Y0CA 2Y1DA 1JKJA 4XQCA 4AG3A 1I3LA 1NAHA 1T2FA 4J16A 4CV2A 2EXXA 3OBBA 1XHLA 5CEJA 3C1AA 3GN1A 3AY3A 1HXHA 2UDPA 5CDSA 2EHDA 4DIFA 1SAYA 2ZJ1A 1PWZA 1HYGA 1U3VA 3RC2A 5EERA 4UUMA 3G79A 4GPD1 3RSHA 3OIFA 4YEDA 4CUKA 4YT8A 2JAPA 4NR0A 4CR6A 5FI3A 4WASA 5U1PA 3LF2A 4JXKA 2Y1GA 4PG8A 4K28A 5KJ6A 1Z82A 2PV7A 3JQAB 2G0TA 2PWZA 2RH8A 4WCFA 3WG9A 3GHHA 2WYWA 2DC1A 5T8KC 1YONA 1PL8A 1T2EA 1RM5A 4FCCA 3PHGA 3ZWAA 4LGVA 3KOUA 2Q49A 3GVPA 1V3VA 1NVTA 1HDGO 4JBIA 5C7OO 3INGA 4GMFA 3ZHXA 4PG6A 3I9OA 1ISMA 1T24A 3LT4A 3FPLA 4R1UA 3O26A 3I5MA 3CMMA 5K6AC 1N2SA 3NGLA 4ESOA 3GN2A 2UYYA 4Y9DA 3AM5A 4HX5A 4JP2A 1HYEA 2ZYDA 1LX6A 4MINA 1EVIA 3IMFA 1M75A 2D5AA 4BKOA 4P4NA 4Q3CA 1LSJA 4IPTA 1UUFA 4JROA 3PIIA 1Z75A 1FXSA 4WE3A 3GUCA 1A7AA 2A94A 3F5SA 1JAYA 1XKQA 3CPSA 4NIMA 1BGVA 2BGLA 2HJSA 2VZ0A 4J1SA 1U8FO 2GPTA 4P4LA 3ZGYA 5G0VA 4FC6A 8LDHA 1PTJA 3DOOA 3FN4A 4QO7A 1GQQA 2NACA 1E3IA 4D79A 3U62A 4K6FA 1YH3A 3BHJA 4ZQHA 5AVOA 3V2UA 4ND2A 4BB5A 4LCJA 3BMQB 1FDUA 1E77A 3GDOA 2W98A 4KOAA 2ZB7A 3EGOA 1E5QA 2AA3A 1U3TA 5T5QA 3V1YA 3BMNB 4NNJA 3UICA 3COSA 4BGIA 3AY7A 5A3JA 3VH4A 1KS9A 1X7GA 1KEVA 4FFLA 5AXCA 5JO9A 4L4XA 4Q3EA 4R1TA 5C3MA 1CQIA 1P1FA 1LNQA 4OO3A 5FF9A 3WGTA 5JS6A 3WGHA 1E7YA 1EZ4A 3PJFA 3H9UA 4FD3A 3RIHA 1B15A 2IODA 3TZQA 3VHRA 1Q1NA 2VCYA 4LSMA 1NBOA 1T2DA 2BFOA 5I8ZA 4W6ZA 3LT0A 3KXDA 2X8LA 4NH4A 4CMCA 3ZU4A 3GF4A 4NBTA 4PLGA 2DPGA 2VHXA 3EZLA 4DLBA 2O4CA 3ZWMA 1ONNA 3KM0A 1KVUA 2AHRA 5JDCC 3F5QA 4FDAA 3MJCA 4E30A 1N7GA 4NU5A 1QLJA 4J1NA 3JYNA 3DXFA 3TZ6A 1P1IA 4WGGA 3O38A 5L95A 4A2CA 5L51A 2WD7A 4Z0TA 1YQDA 1KBZA 4D3DA 2NM0A 3ZWCA 3NDIA 4MVJD 4XDZA 1TXGA 1U8XX 3HN2A 2C29D 3I9MA 3MOGA 4GKBA 3WFIA 2X58A 4JIGA 4IQ8A 1DHRA 2P9CA 5I7FA 1T26A 4PZEA 3SJ7A 1G1AA 2EJWA 1VM6A 1YO6A 4PRKA 1CJCA 1YGYA 2NSDA 3PYLA 4R1NA 4UVDA 3P7MA 4CMIB 3ST7A 1GZ6A 3IDSA 1ONPA 2FR1A 5IZCA 3S55A 2NNLD 3WGGA 4NMHA 3T4XA 2EIHA 3AM3A 2PR2A 2CF6A 1QXSA 1Z74A 5ENDA 3JD1A 4KUEA 2HSDA 4OH1A 5EINA 3UUWA 3K2EA 3PQDA 1EE9A 5G4KA 2ZB4A 5MGBA 2Q4BA 1ZW1A 1VKOA 2B4QA 1H0KA 2AQ8A 3HADA 1H94A 4Z9FA 2Y68A 4XJTA 2V6FA 3ABIA 3INTA 4U0KA 3JYLA 5F1PA 2W2KA 3WLEA 1DXYA 2DT5A 2HMTA 2YUTA 4E2XA 5J23A 1PGQA 2P9GA 4W99A 5JE8A 1UP4A 1YB5A 3R1IA 4E4YA 2QZZA 4QECA 1ULSA 3JQ9A 4II2A 4OMUA 4E6PA 3LYLA 5L9AA 4L4RA 4IXTA 2GRAA 5AXDA 2FP4A 1GEEA 2RIRA 4J1QA 1LXCA 3RKUA 3DBRB 3R6DA 1IY8A 2AQKA 2NTVA 3GEMA 4D43A 3D4NA 1PZFA 1QSGA 3LSYA 2YHIB 2X5JO 5IAAA 3VDRA 2WYUA 2HRZA 1CETA 3PK0A 4L8VA 1I33A 3AK4A 4G2NA 2C20A 1UZLA 2D3TA 4YT4A 2BKAA 1QYVA 1DC3A 2D0IA 1WVGA 3ADPA 1G6KA 4XRGA 4J9UE 1SCUA 2HCTA 2J5RA 3KBOA 5TX7A 5HTOA 4R5MA 4U0JA 1P1RA 2NVUB 4DUPA 4J7CA 2POQX 5A03A 4WCDA 4ONEA 4RVSA 4J6FA 3WSVA 1KC1A 1XIVA 1ENZA 1I0ZA 4BKQA 1AE1A 1P0FA 4L73A 2EW2A 5I9MA 3TDKA 2X6TA 3IKTA 5A5FA 3S2IA 4RO0A 4I5DA 4BNGA 2QW8A 4Q3BA 1P1KA 4KDEA 3H65A 4IS3A 4IIVA 4W9NA 3IS3A 5A9TA 1WZIA 1HZJA 2DTEA 3AI3A 3L6DA 2TMDA 1ZFNA 4LN1A 3AOEC 3JD4A 3KO8A 5B4UA 4CMBA 5L7YA 1ZSNA 3RAJA 3K92A 4R01A 1HT0A 4J2OA 3OIDA 1LU9A 4JBHA 4EJ0A 4GLOA 4HV4A 2LDBA 2Y1CA 1GYRA 2VHVA 4N7RA 4XEHA 2O3JA 4PFJA 3SLKA 4FOSA 4LW8A 3NDRA 3T7EA 2DUWA 3NKLA 2HLPA 1QMGA 5JDIC 2Q46A 4IGEA 4JJIA 4R5HA 3QW2A 1U4SA 4URFA 2X86A 4H7PA 3EK2A 4YDRA 2BF7A 1PGJA 3JYPA 4O59O 5T57A 1VJ0A 5HA5A 1E7WA 1X1TA 2Q2WA 3OSUA 3IL2A 5JDCA 4HWKA 4ZA2A 1T1SA 1ENPA 4CLRA 1A9YA 3P19A 4FJ1A 4CUZA 4B7CA 1G0OA 4EEZA 3GAFA 1JWAB 2X22A 2YDXA 1E7QA 4CQMB 3JQ6A 1Y8RB 3GY0A 4BKPA 1DAOA 1HTBA 3W4KA 1RKXA 3A14A 4CM4B 3RWBA 2W2KB 3QVSA 4RVHA 4CM8B 3WNQA 3PIDA 3UFXA 2BI8A 3HDJA 1EVZA 3L07A 1ONOA 3AU8A 5CFZA 3GPIA 1JWBB 1KEUA 2OBYA 4B3JA 3G0OA 3PP8A 4WNCA 4LISA 2WEKA 5BNFA 2CDAA 1B8PA 3DMTC 4KP7A 4MPDA 2W4QA 1DIBA 1PQUA 2J3HA 4KWHA 5A04A 1NQ5A 1V9LA 4CLOA 3JQDA 5JAZA 4OOFA 4F46A 1AGNA 5F5LA 4NBWA 4J0EA 1GCOA 4R1SA 2VRCD 2YW9A 4IQ0A 1N9GB 4IDDA 5I7EA 1KVRA 4RGBA 4TSKA 5IF3A 3H2SA 4PZCA 4ND3A 3PYXA 2VHWA 3ZU3A 3M1LA 3GFBA 1ZMOA 2X0IA 4UULA 4EYEA 4CQMA 2VTEA 3AFMA 2JHGA 1AXEA 4BNNA 1WPQA 1PR9A 3OF2A 4QO8A 5T64A 4KQWA 3HFGA 1HE5A 1NHGA 3H7AA 1AHIA 4ND1A 2QX7A 4II3A 3GZ4A 3RFTA 3I23A 4KQXA 4NDNE 2YV1A 4AJOA 4KUGA 3ZWPA 2O3RA 4A27A 3W6ZA 2C2YA 4B7UA 4RL6A 2CDCA 4Z3DA 3PGJA 4E5NA 4LK3A 2UUPA 3RFXA 1CQJA 3I9KA 4I08A 4EUEA 2BFPA 2WMDA 4WUVA 1VSUA 2DFDA 3FSRA 3PTZA 1GFSA 1E1MA 4XQ9A 2VN8A 1W0CA 3AOGA 1ISFA 4RJTA 3LT2A 1LSSA 3FBGA 1ZIDA 3E6AA 3OQ1A 4OOEA 2X1HA 4J9VA 1YBVA 5BNTA 5FWNA 3ZCXA 4YAGA 3A4VA 1QORA 3UCEA 1ZUD1 1X0XA 4NG5A 4BNKA 1JW9B 3ZHZA 3CZRA 1UDAA 3C24A 3C7CB 4BNYA 5JPIA 3U49A 1ZK4A 1HZZA 1X1EA 4EW6A 5A1TA 3B1KA 3K2BA 2CMDA 2GZ2A 2X23A 3B1JA 3EZYA 4IGFA 3MOIA 3CUKA 5IJZA 2PY6A 2AQIA 5ENVA 3PWSA 2A35A 3M2PA 3PRJA 4D42A 4BNMA 3NYWA 4ILKA 4D3SA 1VKNA 1R37A 4NK4A 2JAHA 1MB4A 1U2GA 3GUYA 3PPIA 1E1KA 4N5NA 2GZ3A 5TF4A 2Q2VA 3E5MA 2FRDA 1C1DB 4QUKA 4O0LA 2JKVA 4BKRA 1HYHA 3DR3A 3UGKA 3ITDA 3VC7A 2Y0EA 4FIZA 5T6BA 4CMJA 4JGBA 4YJHA 4B8ZA 3DFUA 4YXFA 3E82A 4YRDA 4BHTA 5BNIA 3H4VA 4AJ4A 3QV1A 3VZQA 3HDYA 2GCGA 3GPDG 3KYBA 2X5KO 4IJUA 4OXKA 4XGIA 1NTOA 4BVAA 3JTMA 4EI2A 1JVBA 1U9JA 2GN6A 2NLOA 2RBEA 2HUNA 1OFGA 4WECA 4CMAA 2OORA 3MJ4A 1KYQA 1HE4A 4FBGA 2FPIA 1LDBA 2HU2A 5KJFA 1JAXA 3CIFA 5L40A 3L4BC 4WOKA 1K0UA 1ULUA 3ETEA 1XU7A 1Q0LA 3DZFA 2D8AA 3KLPX 4Z3KA 1D4FA 1X0VA 2GASA 3DZGA 3DB2A 2D5CA 3DAFA 2PZLA 3F1LA 2H5LA 4MP6A 5JLAA 3ZV4A 4P4GA 2PZKA 4GBJA 2AQHA 4YJFB 5EL0A 3LZ6A 4CV3A 4AJHA 3AY6A 4E32A 1ZNQO 1NASA 2RAFA 3D3WB 4FJ2A 3IC5A 5KJEA 3OM9A 3GVHA 5IZCC 1VJ1A 3ZWYA 3DDNA 2I67A 1NX6A 4CMEC 5DOVA 1OAAA 2Y67A 4HNHA 4NPCA 1A4IA 4CQMD 3IUPA 2OXIA 1Y9EA 1WDLA 2FHSA 4F45A 4DYVA 1IZ0A 1UAYA 2W8ZA 2QZ9A 4FFMA 1YRLA 5CG1A 5TT1A 4YB8A 3K96A 5ILOA 5JSFA 1QKIA 1D1SA 2OP0A 2CF5A 4BQPA 2VRCA 3V2GA 4RPLA 4IUYA 5KCZA 3EYWA 3C1OA 1E3EA 3DBVO 4AFNA 3P5SA 3UH1A 3EC7A 4XYMA 4L4SA 4J90A 2FOIA 1EFLA 4OQZA 3CKYA 4W7IA 3QY9A 5DBFA 1I01A 3RUIA 3ANNA 1Y5RA 4XRRA 5AYVA 1MA0A 3TL2A 3U9LA 3ADOA 4YJHB 3D3EA 4BO1A 3ENNA 1BDBA 1PZHA 4I9NA 1ZEMA 1B7GO 3WJ7A 1R6DA 2H9IA 4DQUA 1YJQA 1I3KA 2BI7A 3ZI0A 4X54A 1DO8A 2A4KA 1BRMA 2GR9A 4DLLA 4PG5A 4GVXA 5A02A 3BTVA 5KVCA 1YQXA 3GNSA 2H63A 4DTIA 4I5EA 4MVJF 4E21A 4BMSA 5U9CA 2IDZA 1H6AA 3MEQA 4XYGA 2NVBA 5TS3A 4IIUA 2X4GA 3RUAA 4GX0A 5L3ZA 3HHPA 1WLYA 1E3LA 2R00A 3JQGB 3E03A 1TA4A 5A4DA 5I9NA 1DJQA 2NQ8A 4DREA 5IDXA 1PR3A 4J4TA 5L4NA 4A10A 1NR7A 2B4RO 5IFLA 1DIRA 4WOJA 3OEYA 3KRTA 1T4BA 3SX2A 1EMDA 1BXKA 4YT2A 5DULA 4P22A 4G65A 3WNVA 1Y5MA 3WQSB 1RYDA 3SBOA 5B12A 1XSEA 1VL0A 1ISHA 3WJAA 3D1LA 4I5FA 3RUFA 3ZNPA 3RC1A 4JP3A 5F21A 8ADHA 2B69A 5IDQA 2AG8A 4E5KA 3KETA 2FN7A 3BTUA 1HE2A 4XJSA 3H9JA 5DT9A 4TQGA 4L0QA 1NWCA 4FW8A 1FMCA 1U4OA 4AJIA 2C7GA 1O95A 1MFPA 3GRPA 4AL4A 2VNSA 3ZWWA 3GNQA 4WCFC 1RJWA 2VHZA 3PZRA 2HRBA 3GQVA 3RUHA 1S7CA 4KTVE 1DPGA 3DHYA 3ZNNA 1W73A 3RBXA 1PQWA 5COAA 4DL9A 5A5EA 3GGOA 1SOVA 1C14A 4MOWA 4BNLA 4WEOA 5DCUA 1GD1O 1KEWA 3PHJA 4JK3A 1F12A 4CM6A 4DPMA 3I6QA 3WOHA 3HDQA 4XIJA 1I30A 1QG6A 2Z95A 1R0SA 2DTXA 3ZV6A 3LU1A 4CMKA 4R3NA 2YHIA 3W4IA 2PTGA 1P44A 1B3RA 1PS9A 1GL3A 2JFFA 3H5AA 2W2LD 4WKGA 4CR7A 5CDUA 3AFNA 4GI2A 1M66A 3O9ZA 2FPGA 3KYDA 4LRSB 2NU7A 3D5TA 1VRWA 4XA8A 4IBOA 4CLEA 1TI7A 1ENYA 1W6UA 1N8KA 4GWKA 3I9NA 3ZU2A 4Z9YA 3U4CA 1FDWA 2C82A 4HFRA 5THKA 2B83A 5JYDA 1PS0A 3FNGA 3U3XA 1T2AA 5G0UA 4EJ6A 2UAGA 4RDIA 3KYDB 1Z7BA 2G5CA 3JQFA 3PLRA 3Q9UA 2GO1A 4FSHA 5LDGA 4EEXA 3D64A 2PZMA 5BQFA 4BO4A 1V0JA 3DBLA 4BO2A 3ASUA 1YOVB 4C7KA 1ISJA 1ADGA 1VSVA 2B5WA 2O2YA 3C3XA 3D5QA 3NJ8A 3JQEA 2ZQZA 3B70A 3EAGA 3H2ZA 4R69A 3ICPA 3N74A 1XWFA 4OM8A 5DBGA 1ADBA 1YDWA 3WSWA 3WR5A 1C1XB 1KY5A 1RWBA 2D2IA 3FPCA 4A03A 2D1YA 4CM4A 5HS6A 4YJFA 4DC0A 3B6ZA 2DLDA 1QLHA 3UAGA 1NFFA 4N5MA 4U7WA 4OQYA 5H82A 1X13A 5JAIA 4D44A 4Y6PA 5JCXA 5BSEA 2HK9A 4XB1A 1UR5A 4XKJA 4BKUA 4K9DA 4Y6RA 4DMLA 2O7QA 3VAZA 1N1EA 1ZEJA 2PZJA 3K8ZA 5K6AA 1Q0HA 4UEKA 4ZICA 2AEMA 1GV0A 4CM9A 2O3SA 4RCVA 2HMUA 3W4JA 5EIOA 3KYCB 3Q3CA 4PCVA 5BT9A 5H81A 4B4UA 1PL6A 1N7HA 1DC4A 1PGPA 2W90A 1JQBA 4R9SA 1K2WA 3NRCA 4R16A 4PLCA 3GOHA 2XOXA 3C1TA 5TJ9A 3ZH2A 2OL4A 3QSGA 4ZQBA 3EUWA 5AXAA 3WB9A 3INRA 1E5LA 1HDXA 1KEPA 1LA2A 1ZBQA 1CIVA 1L7EA 3H5NA 2AXQA 3JQGA 3PHHA 4L74A 5GZ6A 3V8BA 4S1VA 2R00C 3C85A 4DLAA 2DKNA 3VTFA 5LCXA 3VPFA 3Q9NA 5TNXA 1UZMA 1PGNA 2YYYA 2NQTA 4O6VA 1ENOA 4UVGA 1I2CA 1N1GA 5AOVA 3BMNA 1NPTO 1ZXLA 3OQ6A 4E5MA 1Q7BA 3EDMA 4RORA 3ZV3A 2XAAA 1BWSA 1LDGA 2FZWA 1B14A 3GVIA 2XPCA 5JW6A 1H6BA 1ZK1A 3E8XA 4PRLA 1NQTA 1HDYA 1ZJYA 1F06A 1MG5A 1T1RA 2R6JA 3DFZA 3GHYA 2VUTA 2FWMX 3R3SA 4HP8A 1E1LA 4YJDA 5I7VA 2YQ5A 1T4DA 4KZPA 4BNFA 1ZK3A 3VPXA 1E3JA 5HBRA 1LLCA 1E7SA 3QQPA 3MZ0A 3Q11A 4L76A 3TSCA 3UVEA 1ML3A 2EWMA 5HWSA 3H8VA 3D0OA 4PLFA 3AU9A 2VOJA 3BTOA 4CLDA 1NPYA 4FFNA 3RVDA 2PKRA 4W7HA 2VYVD 3OETA 3PQFA 1U28A 3AI2A 4ZD6A 4CM3A 2VNAA 1Q0QA 2YFHA 4TKLA 4TKMA 4WJZA 5G4LA 4EDFA 2GNAA 4E0BA 3DZHA 4FQ8A 3BAZA 3DTYA 3FCOA 1OC2A 2ZTMA 3Q1LA 4RF3A 3WGZA 1K6XA 3ZW9A 4E33A 4PN3A 2G1UA 3I4FA 2HMVA 1CYDA 1C0LA 4M54A 2EJVA 4DA9A 1U7TA 1Y8QA 3CSDA 4GSKA 1NVGA 1SBYA 2BHLA 1CRWG 2YFQA 2OZPA 2NU8A 2PNFA 3WICA 5MDHA 5C7LO 3WYEA 4J43A 1A4UA 1J0XO 2NWQA 3IIEA 3ZDFA 4HNGA 3BHIA 5F3RA 1O9BA 1LTHR 1PJBA 3E48A 1U7HA 5JMWA 3WS7A 2C59A 3MJEA 3RUDA 3FR7A 3TPCA 1P1JA 3AUAA 2IRWA 2D4AA 3HJAA 4NU6A 4RF2A 5KJ1A 1U3WA 2EGHA 1EVYA 2G76A 5DBIA 4FS3A 2CVZA 6LDHA 4N18A 4BGVA 4DYDA 5GZ3A 4QSMA 5TJHA 3JQ8A 5G0TA 2FR0A 1NP3A 5COQA 1XLTA 2I66A 1F8FA 2AMFA 3QA9A 1JU9A 3OECA 1TLTA 2NTNA 4CLHA 4CMHA 1MFZA 4Z0PA 3GC6A 1XQ1A 2PFGA 4QX6A 1NXQA 1A72A 5JO0A 2WE8A 3DMTA 2LDXA 3GVCA 4XCVA 4GWGA 1GY8A 3O03A 4E5PA 5B4VA 1XG5A 1ISGA 1UXGA 3PI7A 5I9LA 1PZGA 2AE2A 4GVLA 3O8QA 4WLEA 2DU8A 2ZATA 4FB5A 4PLZA 5ER6A 2QYSA 5K0ZA 5ITWA 4UVIA 4R51A 5CPBA 3GMSA 4YA6A 3DZBA 5CEFA 1PJQA 1E7MA 1EE2A 4YRBA 4RVFA 3AI1A 4E2YA 3HNPA 1W8DA 1XCBA 2GD1O 4E13A 2X9VA 1IHYA 9LDTA 1HDZA 2IZZA 2YHUA 1X7HA 5EESA 3M6IA 1V3UA 2I6TA 1IL0A 1SO8A 1WZEA 3E9QA 2ZYAA 1Y81A 4Y67A 1H2HA 4M8SA 5FEUA 2BH9A 1XGKA 4UEOA 2PH3A 1HL3A 4MKZA 4F3YA 5TSDA 4IDFA 5CDYA 4B4OA 5IN4A 3FWZA 4RPJA 1D3AA 1EFKA 1YBMA 3GLQA 5EQFA 4A26A 1AXGA 4CM1A 3HE3A 2BRUA 4DXHA 1I3MA 1Y8RA 3GA0A 3Q0EA 4OAQA 4RPHA 3ONDA 4IMPA 2Y1FA 1DRUA 4I5GA 4GKVA 3RUCA 1I2ZA 5EN4A 3PDUA 5I8WA 5LC1A 1GQ2A 5K9ZA 4GGOA 4FN4A 4WLUA 3MJVA 4GLLA 3L0DA 1YBAA 4OXNA 4W82A 3S2EA 3E5RA 4FJ0A 3ZWBA 2P5UA 3EVTA 4RVUA 3PLNA 1GYQA 2J5KA 4CODB 3JD3A 4ALJA 3O4RA 1NQAO 5JFOA 3JYQA 5JDIA 1Q2XA 3W6UA 4K6CA 4XWYA 4E5YA 5GZ1A 1QRRA 1OC4A 1HLDA 1B2LA 4JJGA 3H9GA 1HKUA 3OFSA 2Q3EA 3F47A 4HY3A 1LSUA 4J4BA 4YAJA 4RZIA 3WYCA 1U5CA 3DZIA 4Y6SA 2X0JA 1FF9A 3MTGA 4LMRA 1LRLA 5DF1A 4DIBA 2QRLA 4WCFB 4AJKA 3F4BA 1ZKMA 1PWXA 3ZN2A 1F0YA 2P9EA 5A3VA 4XD2A 4Z6KA 4BO9A 3GEGA 4IZHA 4CLXA 3WIEA 3G3EA 1EQUA 3STHA 4D0RA 4W9NC 4RQUA 1LLUA 2VQ3A 3FI9A 3QRWA 3PFWO 3RI3A 1UP6A 4TROA 4B3HA 3R3JA 2OOSA 3WIDA 4OSPA 2ZKLA 3CMCO 3OJEA 2IZ0A 4J3FA 5JC1A 2Y99A 2ZIZA 2P2SA 3VPGA 1YJ8A 1QYWA 2OGUA 4HKTA 4BL5A 5KVVA 2V6MA 1DFIA 3TZKA 2EP7A 1X7DA 3G1UA 3L4SO 1GAEO 3KZVA 4RDHA 5CHEA 2P4QA 4K1LA 2ET6A 4BNWA 4DPLA 3HN7A 1JN0A 4BNVA 3VVCA 3ZNOA 3QVXA 4NHEA 1VLLA 2BGMA 4NJMA 2CNBA 4BO6A 1C0KA 1ID1A 2EGGA 2JFHA 4TZTA 1PJLA 3KYCA 3NGXA 4E3ZA 1HF3A 2IZ1A 2VYNA 1FDSA 2GN9A 1T2CA 4TRJA 5IXYA 5JYEA 1IPEA 1DBVO 4M87A 4YBZA 1E3WA 5KTKA 1HDRA 1HRDA 4JCOA 1BG6A 2J8ZA 3UCXA 1P77A 2AEFA 5C7IO 1BW9A 4XQEA 4YWJA 3I9JA 4PGFA 5G0SA 1H6DA 1IE3A 4DQXA 3CH6A 4FOOA 3RQSA 3HWRA 5DZSA 2XF8A 1DOHA 2ZTVA 2Y1OA 1A5ZA 1TEHA 2RHCA 4UREA 3QE3A 3ZWVA 4CL8A 4OKIA 2B5VA 2D59A 3PHLA 3JD2A 3TOZA 2EV9A 3IJRA 5A06A 4TRMA 3U5TA 1MC5A 2HQ1A 3AM4A 4EUHA 2ZB3A 3DQPA 3O8QB 4JJFA 5THQA 2VUSA 3QVOA 1A71A 2YV2A 1I3NA 1GV1A 1ZK0A 2P5YA 3OQBA 4PVCA 2WD7B 3C7AA 2I76A 1JTVA 1BXGB 3EY4A 4HFMA 3SC6A 3NT5A 4GMGA 4E2ZA 1O0SA 3DBHB 3C8MA 1Q7CA 2F1KA 1KOLA 1V35A 3T4EA 2Y1EA 2WE7A 2VWHA 3OJOA 2IXAA 3WTCA 3GDGA 1B8VA 1O94A 3NDJA 3QJ5A 1PQPA 1BW9B 1D8AA 2DM6A 2ZCUA 5DN9A 1HSOA 4J7UA 1E92A 3JQFC 1FJHA 2BFMA 2CSUA 2EG9A 2GLXA 4QEDA 3A28A 3DOCA 3FTNA 4UVEA 1ISIA 1I24A 1KVSA 3FWNA 3QWBA 1M76A 4BNXA 3I83A 3RC9A 1SB8A 3W1VA 1DLIA 3VH3A 5A9SB 4S3MA 2ZTUA 2HO5A 5H83A 1E6UA 1CEQA 1MUUA 2SCUA 3JQ7A 4YAEA 2FR8A 5BSHA 3NT4A 2E4AA 3OEWA 4QFCA 4G81A 3H6KA 3BMOA 1VI2A 1NYTA 1MC4A 3DHNA 4R41A 2Z5LA 1UXIA 1SEVA 5F1KA 4BO0A 2RH4A 4BV8A 3KSUA 1PL7A 5JXWA 4F6LA 5A9SA 4OHUA 4BNUA 1E7RA 1XR3A 3DTTA 5KKAA 4ZHSA 4NBUA 2E82A 4DQVA 1IZ9A 1CWUA 2AG5A 1X14A 5GMOA 3WLFA 3K30A 2EF1A 3PFFA 4QQRA 1JLLA 1G0NA 1GZ3A 1KVTA 2O2SA 2ILTA 3G1TA 1QV6A 4E12A 5FYDA 4ALMA 1NM5A 2GDZA 4GX2A 1PJ4A 1R4NB 4PLHA 4NK5A 5TT0A 3I3OA 2OFPA 3NUGA 5JY6A 4O63O 2FSSA 2WSBA 2FSVA 2PD6A 5L4SA 2NV6A 2BFAA 4AJ2A 4IM7A 3JQ7B 3NX4A 4OYRA 2IEBA 4ZRMA 1BXZA 5AQ1A 4ZJUA 4KMSA 4O5OA 1UJMA 2VUUA 2YZ7A 4YVFA 1RPNA 2C54A 4BO5A 4CJXA 4XQGA 2QRJA 3DAPA 4YACA 4NFSA 2P91A 1NPDA 2PD3A 3I4CA 1NNUA 1GR0A 1GTMA 2ZTLA 3FR8A 4BGUA 4CV0A 5IZ4A 4CMIA 2X7HA 1I10A 2I3AA 3ASVA 2ZB8A 4IY1A 3A06A 1GPJA 4AJEA 1KY4A 2YJZA 1VE9A 4YRAA 3GGPA 1GEGA 3BMCB 1Q7GA 4ZRNA 5G4KB 1U2DA 1A7KA 2VT2A 3TFOA 1YL7A 1YOVA 1C1XA 1Y7TA 3RD5A 4RF5A 4MIEA 4E2WA 2BMAA 2JCYA 4RVGA 5GY7A 4ZGWA 4DBVO 1FDVA 4LMPA 4R4JA 4HADA 4Z9XA 1K3TA 2Y66A 2VHYA 4FGWA 3RUEA 3JQ8B 9LDBA 2I9PA 4IDEA 4WLOA 1KETA 3GMDA 1ORRA 1VPDA 1OMOA 3K31A 5KNLA 3MWDB 5DOZA 4BGEA 2X0NA 5L7TA 2G82A 4NFYA 1WMAA 2CY0A 3ITKA 4J7XA 2JD2A 1PJSA 5CAEA 1E6WA 1SOWA 2IYOA 3NT2A 3I1JA 3CEAA 1RYEA 3PYMA 1MV8A 2Y0DA 3OH8A 3DWFA 3KSDO 3ROPA 1EDZA 1PJ3A 1WAMA 4LVCA 4ZQFA 4B4WA 5CEEA 1IYZA 2DBVO 3G49A 1IUKA 4NBRA 4IJVA 4CLRB 3IUSA 4LCEA 3LLSA 3BMCA 1DB3A 1DIGA 4I9HA 5HM8A 5T67A 4BB6A 2YY7A 1ADFA 5C37A 1LRKA 4GSLA 4BNIA 4JQCA 4ZU3A 4P8RA 1BTOA 1A9ZA 1E0DA 3TRIA 2OUIA 2HK8A 4R3WA 2Q1UA 3F4LA 3SJUA 3TQHA 4MP3A 2ZCVA 5KIAA 4MIYA 2HAEA 4CM7A 3PVZA 2GSDA 4KWIA 4J0FA 1IOLA 3FNHA 1DIHA 5DP1A 4JNKA 3MCVA 4YJGB 3RFVA 1JA9A 1R4NA 3WDSA 1TVEA 3VZPA 4R9RA 3WFJA 1KVQA 2PGLA 4U6QA 3DONA 5AXBA 1VL6A 1Y8QB 1E1NA 3GDFA 2VYVA 3JQBC 3PDJA 3FNFA 3JQAD 4H15A 3L6EA 3WXBA 1N5DA 1WDMA 1YQGA 1CDOA 1IPFA 3RU7A 4D0SA 1UXJA 4QFDA 3PEFA 4J1TA 4A5OA 3EVNA 3ONEA 3OICA 1ZSVA 1XYGA 3MJSA 3WMXA 3C7DB 4OSOA 2Q4EA 2GN8A 2C5EA 1YVEI 1DC5A 3BYZA 4PG4A 3L9WA 1UDBA 3L6OO 4OIMA 4IDCA 4PLWA 5CP8A 2HMSA 2EKPA 3BIOA 2B36A 1ZH8A 4OL9A 4BIIA 4CPDA 2FPPA 2I99A 5EPOA 3SVTA 4TRNA 2Q1SA 5KOIA 4XDYA 1NVMB 3LF1A 1P3DA 4M55A 3PJGA 5JY1A 2O3QA 1HDCA 1R0KA 1XEAA 4TMFA 1W4ZA 3B20A 3JSAA 4Q9NA 3KEOA 5B1YA 4FFPA 3OJ0A 2I65A 3BZUA 3JQCA 1LDMA 4D45A 4HUJA 1K5HA 4RPKA 1SMKA 2WM3A 4OKNA 1T25A 3PQEA 3PWZA 4GX1A 3GR6A 3LLVA 1BMDA 1D7OA 3E9MA 2VOEA 2DAPA 3A9WA 2ZJ0A 1PJTA 1K6JA 2WD8A 4DGSA 1HDOA 3DBRA 4IQGA 4KUHA 1LDYA 1TT5A 3FD8A 1P0CA 2OHXA 4YTEA 4CM9D 2V65A 3GZNB 3VVBA 3NEPX 3RBVA 3F6YA 1EDOA 2VZ9A 1I36A 2YQ4A 1GDHA 3WBFA 4BO7A 7ADHA 1Y1PA 1PS8A 1GCUA 2CDBA 1DRWA 1EK5A 2GF2A 3VDQA 3CZMA 3QVWA 4BUCA 3V1TC 5BSGA 5C5IA 3G17A 1EUZA 3FTPA 3KEQA 1NHWA 3AJRA 5JAQA 1Z6ZA 4ROSA 2RCYA 4HXYA 2C5AA 2OBNA 4AJ1A 4WLFA 4M86A 4MKXA 4TZKA 1HETA 1B8UA 4PVDA 2BD0A 4WEQA 3VZRA 1EEHA 2PK3A 3P2OA 3DEYX 2DUUA 2JHFA 2J3JA 1B16A 2VWQA 3MTJA 1NQOA 1DJNA 4RV9A 1LQUA 1R4MB 4D46A 1JDJA 1UP7A 2DQ4A 2Q45A 1GUFA 1ZSYA 2X9GA 3H5RA 1IB6A 4CLOB 1H2BA 4IJKA 1E3WB 1HLPA 1SB9A 3AUSA 1LUAA 2DTDA 5ES3A 3T7CA 4NJOA 4R54A 1YE3A 3UCFA 1DHTA 3GZNA 3BHMA 3D7LA 3AUTA 4M89A 1GZ4A 1TT5B 1MXFA 5TC4A 2VTDA 3H3FA 4UEJA 4OXYA 3WQQA 1ZVMA 2XXJA 2PD4A 3PXXA 4GAEA 4J49A 3TOXA 1NR1A 1Y6JA 5CG2A 2FZEA 1PGOA 3FHLA 5B4TA 1O5IA 3VKUA 3F3SA 3E18A 5DP2A 2AEJA 4Y8VA 2W2LA 3EMKA 5EJ2A 4ZQGA 1ZJZA 3W8EA 1NAIA 3WGQA 5B37A 3N58A 4UUOA 4A73A 1O6ZA 2NUAA 3ANMA 5CPFA 4E31A 1V8BA 5L53A 3WGIA 3ZV5A 3HZZA 3W8FA 5COBA 4QXMA 3NV9A 3U4DA 3VH2A 1LLQA 2J3KA 3VZSA 3U4IA 5IXSA 3WBBA 3TZCA 4ND5A 1LDEA 1NFQA 4YCAA 4GL4A 1OOEA 2NU6A 3D4OA 3PZBA 4NQZA 4MJLA 3NTRA 1MG0A 3RCBA 4CMGA 3KTDA 2JFGA 1K6IA 2YV3A 3GEDA 1LQTA 1WDKA 4P38A 4DVJA 4KTTE 1GQYA 4CR8A 2ZYGA 3NTOA 2O3UA 1DDOA 1XA0A 3HB5X 4JN6B 4BMNA 3FRJA 5FI5A 4BNTA 1H5QA 1Z45A 2Y93A 4NI5A 1Z7EA 4CV1A 4XYLA 5ICMA 3RBZA 2B0JA 3DAGA 3ZWXA 3TWOA 1HSZA 6ADHA 1ZCJA 2GUGA 3DZJA 2V7PA 4EITA 3AW9A 3IJPA 4MVJH 2V6BA 3WMWA 4ALKA 3DL2A 1NWHA 1J5PA 2VRBA 3HDHA 4M49A 4QTZA 4RPGA 5BR7A 1SPXA 2QQ5A 2JD1A 1YWGO 2VZ8A 4RZHA 5HRUA 3WX0A 4AJJA 3QHAA 4MP8A 2P68A 4PLPA 1WMBA 3FNEA 4NBVA 3HUDA 1EQ2A 2B35A 3PGXA 1I32A 3U4HA 4MO2A 3U0BA 1F17A 2NTJA 3VKVA 4WLVA 5ER9A 3ETDA 2UV8A 1DLJA 1UDCA 4BV9A 1GU7A 2Q2QA 1HWYA 3OP4A 4I8XA 2NU9A 1SEPA 3LQFA 4I9UA 4Q3NA 4OJNA 4EBFA 2BLLA 4Q39A 3OHSX 3JQAA 5DCYA 3UOGA 5L7WA 1DIAA 2WJPA 1BHSA 4CL3A 1IULA 5KWEA 5G2OA 2PGJA 4U5QA 4TRRA 5DNAA 1P33A 3ZW8A 5G0WA 4Z0HO 3DBLB 1PEDA 3SXPA 1O89A 2VWGA 4I1IA 3ZNQA 3WYBA 5IDWA 1L7DA 3QWHA 3VTZA 2GN4A 1X15A 4ITUA 1EVJA 1TB4A 1ZK2A 5ILGA 4TVOA 4IDAA 1D1TA 1QYXA 3QWFA 5TQVA 1R15A 1TT7A 4RF4A 4XR4A 3JQ9C 2JCVA 1ZZEA 2G17A 3ZHYA 3S2GA 4AJLA 4XB2A 1P74A 1EUDA 4J4HA 3X2FA 1CF2O 1F14A 1PX0A 2XXBA 2CVQA 4YR9A 5TLSA 3S1LA 1L1FA 1YKFA 2F00A 3IQDB 3VPSA 2ZK7A 3LK7A 2PH5A 5BSFA 3KVOA 3K73O 1B3BA 3GGGA 4RLSA 4EJMA 4IXWA 2J5QA 2DBQA 3FF4A 3K6JA 3B1FA 4XZ3A 3I6IA 4KDFA 4XYBA 3ON5A 2TMGA 5T8KA 1KC3A 2PGDA 3VOSA 3DC2A 4FFRA 5JCJA 1E3SA 4C7JA 4FR5A 2JJYA 2VT3A 3ZU5A 4EZBA 2E37A 3LDHA 4BS9A 2H1SA 2EEZA 1U3UA 4XYEA 1LDNA 3KLMX 4MKRA 4OGWA 4ID9A 3D4PA 2FMUA 1H9AA 4IZIA 2A9FA 1QYDA 4U6SA 3ZWNA 1H9BA 3OA0A 3ZWOA 1P9LA 3LVFO 2O23A 5EQDA 3ETGA 1SZJG 4CM8A 4M1QA 1J49A 3ONFA 3UKOA 4K26A 2JD0A 3QP9A 3AUUA 1WW8A 4L75A 5TRTA 4IDGA 5JNLA 4NJMB 2EP5A 2OMEA 2BGKA 4BO8A 1AN9A 1DFHA 2X5OA 3OJFA 1PIWA 1YXMA 2O48X 1ZO8A 2EKQA 1DEHA 1R12A 3LT1A 1EUCA 1RM3A 3E1KA 3TJRA 1J4AA 2EERA 3DHEA 5JMPA 3U09A 1EBFA 2IYPA 3JQBA 2DBRA 3PHIA 3ROKA 4ZN6A 2DPHA 1JKFA 2RHRA 1AHHA 1LI4A 4N54A 4INAA 4TWRA 3UXYA 5F5NA 3VPHA 2Z1MA 3GAZA 2QIOA 3UHAA 4LRTB 4EUFA 1QP8A 3BMQA 3LC7O 4DPKA 4NZ9A 4YYZA 2NVWA 3GNTA 3BMOB 1LEHA 4PLTA 4MVJE 3WGOA 4ZVVA 1OI7A 3JD0A 1PSDA 2P4HX 2Q1WA 2WWRA 2DVMA 1ZMTA 5IN5A 2NVUA 1EK6A 1HEUA 2WDZA 1JVSA 4BMVA 1I8TA 3ANLA 2FY8A
chains in the Genus database with same CATH superfamily
1M1NB 4AYWA 1JEYB 4E2FA 3ESRA 3R9IA 1BVUA 3CLTC 3M3DA 1MZPA 2A1TR 5IJXA 1N3IA 1U7ZA 3WGLA 1HE3A 3M82A 1C3VA 5FIUA 1Q0SA 1C4KA 3L1HA 3QU4A 4KAJA 4EGFA 3AL3A 3CC8A 4DG8A 1MGPA 4F1KA 1GG5A 2QZSA 4HBGA 1XVAA 3DA8A 3NALA 3EE6A 1B93A 2NO1A 2QLBA 3BA1A 4Q1FA 1GNQA 1RXUA 2CNKA 2HO4A 2PRSA 4E1VA 2FHPA 2ZS8A 1E1QD 3O0DA 2Q1TA 3TIFA 4G5HA 3FRHA 1WDTA 4PHHA 4YASA 3ZLBA 4XGKA 3LGSA 3VR1A 3M0EA 1ESNA 1X70A 3LYHA 3NANA 4PZDA 5L45A 1YACA 2R2AA 3TFQA 1AS2A 1I2BA 1T8TA 4GO1A 1FQOA 1CZOA 3Q3VA 1NW4A 4Y1GA 3L1VA 1U0OC 1GA4A 5HF5A 3CXRA 4RMIA 3C0KA 1NUHA 4YLEA 4S1TA 4DCJA 4ZAXA 1M67A 3AUYA 4EZIA 4F9EA 2GYYA 3L4BA 4Z7JA 4BO3A 3P4XA 3U81A 1QX3A 5IDYA 5KNBD 1R18A 4W6QA 1JI3A 4IFIA 4B79A 5JCJD 1JS1X 1FNDA 5TGDA 3JPYA 4Q12A 4HNTA 3HWSA 4S24A 1O97C 3DO8A 3IKVA 3IAEA 1DC6A 3IUJA 2ID7A 1U8YA 1QR6A 2JCXA 4Q4CA 3EG9A 1D8TA 1QJ4A 1FMJA 5GAJA 1UMDB 2RFLA 4BLSA 4K03A 4XGNA 4QT0A 3IP1A 4J2HA 2AG0A 2X7XA 1QB8A 1YZHA 2VF7A 3QXSA 1BDMA 1WW2A 3K0AB 3Q41A 4Q3DA 1FRZA 2QAGA 3EXHA 4HFNA 2Q62A 3OZFA 1BJRE 1BMFA 2RK3A 4ZOBA 3HJGA 4K9KA 4QPDA 3C8UA 1EGAA 1XI2A 4JH0A 4A4DA 4MHTA 4MB2A 1XU9A 2BISA 4IX9A 4MULA 3TH5A 4Y9SA 3CLSC 1OQAA 2IPXA 3QYJA 1FCJA 4J29A 2CBGA 1KJYA 4RSMA 5DEIA 5D3ZA 3B13B 4JLPA 2IWRA 3RKRA 3DM5A 3HU1A 3S2FA 1CK4A 2ID4A 1AB5A 1L3CA 3NTQA 4M9RA 2AN3A 4NATA 2C99A 5HIJA 3DOJA 3LWZA 3O73A 5FT9A 3E5NA 2IELA 3L7CA 1Y9AA 2QTLA 3E23A 4X3OA 2F8MA 5U4XA 4FR0A 4OV6B 2WWWA 3PC2A 1P9RA 3P96A 4RACA 1FK8A 5KTSA 2DWPA 4NFHA 2BDTA 1U63A 1YFJA 3C4QA 4FDLA 4ND4A 1OH7A 2PZGA 1NW8A 1LI7A 4XM2A 2I5PO 1ZRNA 1MP0A 4TOIA 1E4EA 5AHWA 4IJ5A 4JL6A 4O4HB 2OG1A 4I3HA 1KTIA 4RGQA 1FZQA 2Q6LA 5BWMA 3FTQA 4QBIA 2D0OB 2UVDA 3SQLA 1R3UA 3VR6H 7MDHA 1BEEA 2XKAA 3CPEA 1GGEA 5JZMA 3K9GA 1CUCA 1EWRA 1G5IA 3HY6A 3QTTA 2Q2NA 1DKMA 2V7QA 5HW0A 3RASA 4EK9A 5B3KA 2ZAOA 3EAFA 4AJPA 1WBDA 1CHDA 4BQRA 2AW3A 5F98A 2Z0MA 2XCQA 3D6NB 4L9RA 1OIVA 3TUJC 2PX5A 2KBEA 1G1MA 2WHYA 2IGBA 3D2LA 4X93A 4DLRA 5HMMA 4WLNA 1GUYA 4NBKA 5CDFA 4F6RB 1YJXA 3A9SA 4OP3A 2EEPA 1SKYE 5C8ZA 5JSUA 3K9NA 1E2HA 1PJ8A 2CEAA 3FDIA 5KJCA 3GRKA 3IDAA 1QGUA 4HDRA 3SZUA 4TKVB 2DHDA 1LLDA 4FZ3A 2OAGA 2I7DA 4QTUB 2VYCA 1PU2A 4RD6A 3WJ2A 3BE5A 3BA6A 2GNPA 1WVMA 2EFHB 2QTGA 2GJ4A 2LZ0A 4G37A 4RU1A 4UBKA 2LNDA 4V39A 1Z16A 1IDN1 4DCUA 2V4UA 2PA3A 5IFKA 1IY2A 2PKXA 2R4UA 3FVTA 1KEEB 2ZIFA 3LIPA 4RA9A 1LBEA 4LWQA 1BE0A 3LHDA 1TO1E 5I7AA 3LHSA 2YINC 4ZARA 5J5CA 1U2RA 3AIIA 3FSEA 3IHWA 3KOYA 4JVOA 4EMBA 2I3BA 4ZO9A 2H0QA 5IVHA 3EDOA 4HGNA 1YB2A 2AE1A 4WFJA 4RLHA 3FOCA 4DUZB 4DDHA 5IKEA 2F8TA 2FUNB 1T5DX 4C7XA 2PWYA 4EX7A 2PGXA 3BD9A 2QG4A 4XD7A 2ACWA 3Q2KA 1IWBB 4DZRA 4S2UA 1LH0A 2M1ZA 3R0IA 4XAQA 1R8XA 2W6NA 1BCSA 3EFHA 4FB4A 4FKBA 4JLWA 4LRQA 3WQRA 3GRVA 1I4DD 1R6UA 1GTJ1 1X3LA 2OP1A 4INPA 4WY5A 5ADHA 3I52A 1E6EA 2ZIAA 2FAXA 3L77A 1W19A 3ORFA 3USCS 3X2EA 1PE0A 2VDPB 4KFTA 4GGPA 3BWVA 5JQGA 2CBXA 2GILA 1G7RA 1UH5A 3F9CA 1JZSA 4MV6A 3UUFA 1OYOA 2JW5A 2JGRA 3L8DA 1M6NA 3MWFA 2I3GA 2VJCA 3IP3A 1M54A 1GTZA 4JU9A 3FAKA 3THYB 2NSJA 4D9CA 3ZHBA 3WLHA 1F0KA 1GUZA 1NBIA 4KNWA 4KU4A 1OJLA 2HEIA 2PKQO 2CLKB 3OIGA 4FFOA 2H3EA 4DSZA 2JL1A 1O08A 1GYPA 3IQHX 4JQSA 3QX3A 1HTTA 1NVAA 4WOCA 3KUUA 4ZJPA 2EKLA 2HQSA 1TFRA 1V3QE 4EGSA 4DIOA 3ZZUA 3CZ5A 4D26A 1ATZA 4ZQEA 3RJZA 1F7UA 3LC1O 1M0WA 3T7IA 2PUTA 1IEWA 3AP2A 4INOA 2F67A 1VL8A 1RBYA 2ILVA 2PKQP 3SYKA 3TQQA 1L0BA 1SK8A 1V4NA 5FTLA 1CF4A 3CVOA 3VTAA 4UHCA 1KGSA 3Q0TA 2IUUA 1CF9A 3RROA 3D1JA 3UF0A 4TVSA 4YCNA 4N41A 3RIXA 3JZFA 3TQOA 4EB0A 1L4GA 2X3YA 1EJ0A 2HQOA 2QYHA 2VKTA 2Z8ZA 3DEFA 4IJWA 4IMJB 4L95C 3D3QA 4LQ4A 5EYPA 1R50A 4N8SA 3OLCX 2N0SA 4PAMA 3DVRX 5LXTB 4PO3X 4K9OA 3WA7A 4TWAA 5GONF 1BVYF 3AEUB 1UAGA 3EWAA 2EJCA 4FFWA 1O95C 1WP4A 4EHNA 4CEIB 1VDZA 1LZLA 3ZBQA 4HWGA 4R8KA 4PYOA 2VXOA 3TUZC 5KKCA 1AUPA 1GP2A 4J91A 2FW9A 2L82A 2HL6A 5A9RA 1ILEA 1BGXT 3EWSA 5DM70 3NMUF 1P7PA 2W2MA 1C0IA 1JIQA 4BFLA 4FHFA 5CT5A 3OE7D 4YGYA 2OSVA 2Q6OA 3UATA 3LOUA 4IMRA 4P3XA 5IBCA 4BRZA 1YC5A 1JDPA 2X8AA 1ZCZA 4WNAA 4XIGS 1VXRA 4MS4B 4UTPA 2XIQA 3IOYA 4FWBA 1JG7A 1R0LA 3WWDA 3M9LA 1L8QA 4NV0A 4DAOA 4YDQA 1FNNA 5CXSA 1Z4IA 3KQPA 3ASZA 2H1VA 3KAQA 4KXMA 5AO9A 4YV7A 2V54A 3E9NA 3G9XA 2XZDA 3H2JA 3U2QA 5KNCA 4AY6A 4OI2A 2UZ0A 5LA6A 2G4CA 2NW6A 3AWDA 3SZGA 1B74A 2XUJA 3HQ4O 2EQBA 3NPAA 2Y0CA 4GR9A 4QYIB 4EO7A 5TMDA 1Z7GA 2W70A 2B61A 1KQGA 4Y2JA 3RC8A 2I03A 1H3NA 2CXSA 2CZGA 3AF1A 1I3LA 1OT5A 4XQCA 5IVDA 1NYRA 4CF6A 5KQRA 2PUFA 4CV2A 3G2QA 2OFWA 4UCXA 1AGRA 4MR9B 4AKEA 1XHLA 1Z8DA 1MZVA 3K70D 3GN1A 3OQOA 2QM3A 5E9JA 2PXAA 3VPDA 4ZEWA 2KB0A 4OBEA 5AJWA 5CDSA 2D74A 2EHDA 3KXIA 4DIFA 1SAYA 4ETWA 2ZJ1A 1HYGA 3UXHA 1XTQA 3COYA 3MB5A 4KB5A 3ZS8A 1YFZA 3FI0A 4G85A 4D9BA 1I5EA 1FXUA 3C6MA 4I1RA 1JB1A 1P6QA 4JELA 4GPBA 3LJKA 4NBNA 2OEPA 3I04A 1W9MA 3H6GA 2OC9A 1JFTA 1JJFA 2X1LA 2WM8A 2EIXA 2HREA 1J21A 1I2DA 2BEUA 2BKVA 2OHOA 4D4HA 3T1HB 4JR2A 5KPDA 2FUG6 4PG8A 4K28A 3WL6A 1RRVA 3AV3A 1UJNA 3PEVA 5EIBC 1Z82A 5CFMA 2G40A 1DX6A 3GFVA 1XXHA 2A9JA 4E94A 6PFKA 5K09A 2RH8A 3WG9A 1T8UA 2YXEA 3KAPA 3MTBA 3PXUA 2P9JA 1QGDA 4XVUA 2DC1A 3RWMB 2VQEB 2J9FA 4G0MA 4PGMA 5IAJA 3F98A 1XEWY 1YONA 4B6EA 1PL8A 3IURA 2C77A 2ZUUA 1E1DA 4FCCA 1ISRA 3TSOA 3U1VA 5EZYB 3WK7A 3TQFA 2IHZA 3QW4B 6YASA 3KOUA 1XCLA 2Q49A 2XV1A 3PNLA 3RK1A 1NVTA 3SZOA 3JR3A 3MOSA 5ALKA 2IYAA 4X65B 4ZEVA 4OHFA 4UFOA 1C7RA 4UZFA 3RJMA 4CKWA 1ISMA 3LT4A 4PSAA 2QGNA 4NXNB 3K9HA 3OTWA 2BEWA 2H1WA 3LCUA 3K70C 1DNPA 4ISCA 3T7DA 2QR5A 4JI5B 5K6AC 1YZQA 4GICA 1ZQ9A 4QGFA 1U9CA 4ESOA 2A7QA 5EE3A 1S2LA 3AM5A 2ZYDA 1XEWX 1QJCA 2H07A 3LCRA 1L7BA 5C32A 2D5AA 4BKOA 3TRJA 4BBJA 4Q3CA 2RSLA 1Z6PA 5EQJB 2HSJA 1FXSA 3QU9A 1JR3A 4KBYA 2HSEA 2J45A 4MO9A 3T5TA 3GUCA 1A7AA 2W9XA 3L84A 3WYDA 1XKQA 4RTNA 2JI9A 3LK6A 1BGVA 1N6IA 2BGLA 5IJWA 4Y6QA 1STOA 5AM2A 1U8FO 3LKVA 5C4GB 2VSOA 4FC6A 1KRWA 1PTJA 1G8YA 4DA6A 1ONSA 1YH3A 2CNDA 4ZQHA 3E7XA 2VJQA 1FP7A 4LCJA 3RS4A 2NXWA 4Q0MA 5B7QA 4FGJA 2WM9B 3R3UA 4RZ2A 5EMKA 1A9QA 3A7EA 2ONYA 2NV0A 2ZB7A 4M0MA 5TE9A 4GSYA 3S2SA 3OZGA 1XC7A 3VZCA 3DE1X 3V1YA 3BB1A 4R9UC 1MA3A 2V7WA 4BJ6A 1CB0A 4WK4B 3COSA 4H7KA 1L5WA 4FGLA 1RVV1 1KS9A 4ENPA 5AXCA 3NXSA 2YOGA 4R1TA 2YV5A 5IVKA 1TTTA 1S2NA 3W5VA 5FF9A 1T34A 5JS6A 3RVNA 1B15A 1T3GA 1TZJA 5JRZA 1UM9B 1QOQB 3K1TA 2BFOA 1T2DA 1QO7A 2V55B 3CUYA 4WCVA 4W6ZA 1HFJA 1FW8A 2FCAA 2X8LA 4FVTA 1Z06A 2O4CA 5F2KA 4Q4AB 2K87A 3U17A 4DDUA 5KSOA 1JJIA 1E64A 1K3FA 1EA7A 2R8EA 4MWTA 3RR2A 3TLEA 1W36B 1X7XB 1X74A 2YZKA 4DCNA 4KVGA 1BKYA 1UK6A 1X9HA 2VHCA 3MJCA 4E30A 4JEHA 4ZDWA 1E62A 4YHHB 2FLWA 3JYNA 2YS7A 4JQYA 4RE5A 3TZ6A 4RUKA 3O38A 3VVMA 1DL5A 4A2CA 4ZQCB 5E4FA 5H3CA 2M6RA 1G8SA 5L51A 3B3QA 1KBZA 4G0WA 2RGGA 2NM0A 3PUJA 4MVJD 4EVQA 3I9MA 3KEMA 3MOGA 2QUJA 4GKBA 4RJLA 4ARUA 5AVYA 4JIGA 4IQ8A 4N0DA 1N2EA 1NATA 1DHRA 4KI0A 1T26A 1Y4DE 2IXFA 4CU5A 3I2GA 3C1UA 4PRKA 3VPCA 1ORIA 2NSDA 2J6CA 4H1VA 5C34B 1CRPA 1H1LB 2VK1A 2G7ZA 1SQSA 3O74A 4DMUB 5AW7A 3KTAB 4CKCA 3S55A 1HFKA 3JAWB 5J4YA 1JR2A 3T4XA 3PD7A 2PR2A 3TOVA 2QTAA 4KUEA 1J8FA 4O4JB 1CRQA 1RWPA 1VI5A 3ADKA 4HQ0A 5LA6B 1NR5A 3UUWA 1DXQA 2ES4A 2BEVB 2H4HA 2RKBA 4JYMA 2YIJA 1EE9A 5G4KA 3SVLA 3AH8A 3IUNA 2ZB4A 4K8OA 2VTKA 3L0ZA 4P31A 1GRCA 1H94A 3NASA 1ZIYA 4WBNF 2B1IA 4O2LA 2A5FA 2Y68A 5DXFA 3ILXA 1GL9B 2DCUA 3U1TA 3DE6X 3CIOA 3JYLA 2GYUA 1TMOA 2EDCA 2W2KA 4XJXA 5EVJA 5F1PA 3PENA 3WLJA 5JOQA 4EJSA 1N1DA 2XGSA 5JNVA 1Q7RA 1ZGAA 4RK5A 1RLJA 2DJIA 3LY8A 4W99A 4YRNA 3CE9A 4DZTA 2E4WA 4G4JA 1U8EA 4OLFA 4LXYA 2VYFA 2P8SA 3EA5A 3GMIA 3JQ9A 2ZREA 4LJSA 2ZRCA 4QECA 1RZRD 1Y48E 1IY9A 3B2NA 5P8WA 3ZR4B 3PX7A 5AXDA 2FP4A 1OA0A 3IO3A 4J8PA 2DH5A 1ZONA 3O75A 4QGHA 3RKUA 1QBGA 3DBRB 2WJZB 2PUJA 4QJ4A 1WV1A 1IY8A 1JFFA 2NTVA 3GEMA 1WXXA 3JVIA 4WBNA 1PZFA 1QSGA 2V6IA 2WUVA 4KG7A 4Y2GA 2XODA 3D6UA 2YHIB 2X5JO 5D1NA 3VDRA 3DV0B 4MI9A 1DZIA 1J1IA 1VKZA 2Q29A 2C2WA 5AR1A 5HKLA 1RCUA 1UZLA 2BKAA 1O1YA 2ZVDA 3AF2A 1Z6XA 2D0IA 2H08A 3C7KA 1X92A 3GBPA 1QC5A 4J9UE 1AF4A 2H1LA 2JA1A 3GLHB 2QX9A 3KBOA 3PS9A 2F3SA 3QF4A 5HTOA 2GXAA 1JA0A 4C4RA 1D2RA 1UOOA 1S0UA 2XYGA 3PPXA 1UPBA 4NARA 3SMQA 3QE9Y 2BKEA 2POQX 1T4CB 4IOJA 5A03A 4KLRA 4WCDA 3LLCA 4M88A 4P81A 2JIZD 4J6FA 4GPZA 2HWYA 4ZV4A 1Z83A 2NZ2A 3CX3A 1PT7A 1RHJA 4OFBA 1P0FA 4U7PB 1L7AA 1W5SA 3WBKA 1AB6A 5DH9A 1MX1A 4I5DA 2MSWA 1WHTA 3CA8A 3CT4A 1B73A 3ESYA 4WN9B 2DLNA 3G82C 5ALIA 4UU8A 3TBHA 3EOAI 3NOQA 4CCYB 1P6XA 5ELMA 3EIWA 3MQ4A 3NFRA 4G3XA 5JSYA 4BP1A 4X1KB 3EXEA 1TU3A 4AN1A 3GPCA 4ZXPA 1ST2A 4X24A 5DSTA 2HSGA 3O94A 3R76A 4Z7OB 1KFCB 3KO8A 4LDPA 4F56A 2H2DA 4G1FA 3NP9A 2O20A 3RAJA 3K92A 3A2KA 2PZFA 4JBHA 1MW8X 2LDBA 4F2GA 2VHVA 3TQIA 3F96A 3KVRA 2AOUA 2ZJZA 3SBDA 3LVBA 1QU2A 5CDHA 1L1EA 5KHOC 2DUWA 4OI0A 1SKUA 4MDEA 4Z99A 3IQZA 2Q6KA 4AWXA 4HHEA 4R5HA 4URFA 2XTJA 3IAAA 3L8HA 4H7PA 4UNQA 3FHJA 4MRVA 1NDUA 1U7DA 1L5GB 5T57A 3JYPA 3SF8A 3D8TA 1N0VC 4WH0A 3IL2A 1E98A 1X1TA 4EWLA 1VCOA 2ID8A 1KKUA 2C4NA 2WHPA 2UU9B 4HWKA 4ZA2A 3W5CA 1V4VA 4FILA 5BV0A 4B0OA 1DBQA 1QHGA 1HKHA 1KIAA 3EQ2A 4CQJA 3P19A 4P6VF 4CUZA 1EH5A 7GPBA 1LPSA 4QBFA 1CBUA 1JWAB 1KPIA 1X1RA 1TM2A 3FPAA 2D5IA 2Z58A 3GY0A 4U3JA 1E32A 4M3NA 1HTBA 3W4KA 1RKXA 3K2QA 5F3DA 4CM8B 1RR6A 3NDPA 3IEKA 1P0MA 1MQ9A 4A15A 4OMFG 4YMGA 1ECCA 1RACA 3LKZA 2PZEA 4MYHA 4MI6A 4V03A 1X9GA 2J9XB 2JI8A 2Z2YA 2PVCA 3FKSD 3P2MA 3L07A 4R8LA 1V7QA 3TFWA 2P90A 3TLCA 3UJ3X 5BRAA 2Z3WA 5CFZA 2HJVA 1AX9A 3P9RA 5A5DA 3W9BA 2OBYA 4HWTA 1Q3KA 4B3JA 2OHFA 2XDWA 4AF6A 1W5TA 4XJVA 5E6UA 4LISA 4G6ZA 2WEKA 2R60A 2CDAA 3EJWA 5BNFA 1O4WA 3N6RA 5M29A 4TMYA 4TSRA 3WQHA 1N75A 1J0AA 1NQ5A 3EEYA 3L05A 4K40A 1AQNA 2Q7XA 1I7SB 4OOFA 4BU1A 4JDPA 2GKGA 1X7WB 1SIOA 3E7FA 4NBWA 4YGXB 1EM6A 2WZCA 5LZ2A 3PHCA 2VRCD 2BHNA 3HBAA 2XE6A 4TLCA 4IQ0A 1DJLA 3VZDA 3I8OA 4KK4A 2CLFB 4FNGA 4RGBA 1Z0JA 1GT91 2LP4Y 2VHWA 3KOMA 1J09A 3WBJA 4NESA 1CUDA 4WQMA 2X0IA 3QX8A 1I1NA 1V47A 2I7TA 2PKWA 1LPBB 4FDTA 2JIQA 2VTEA 5EXTA 4LC9A 1O94C 1RRPA 4L8FA 4G36A 4F4JA 2JJ2A 3DO6A 4RIFA 4N1AA 2YNMA 2CUZA 2ECKA 5T64A 4KQWA 2YWBA 4NICA 1AHIA 1QK5A 4GS5A 1NVXQ 2V1XA 2OCDA 3I04M 5F7JA 3T7JA 4EB8A 4AJOA 3HL4A 2C2YA 1QTQA 3GUVA 5LYJB 3M6VA 2WAAA 1QANA 1VL1A 4Z3DA 5E0KB 4B35A 4E5NA 5CXQA 2X0DA 1HI9A 2FGKA 2PRZA 1V8ZA 2WJHA 4UM5A 4HAIA 4BRWA 1FY2A 5JNSA 3IEMA 2GPWA 1VSUA 4FW9A 1QE3A 3FSRA 3IBCA 4IJMA 5IUKC 4S35A 5J40A 1U3DA 3PTZA 2ROQA 5AESA 2FQ1A 1CV2A 3HB1A 1T9GR 1Z4KA 4MQEB 3MINA 1WCXA 4XQ0A 4RJTA 2LV8A 1XWWA 4QVKA 3SQNA 2OXTA 2YICA 3TW8A 1UIMA 4RPIA 3O6VA 4J9VA 4LTMA 4OOEA 3LUCA 2PR7A 2DEUA 2PIDA 2OFXA 3KJNA 1VZ2A 4K86A 1ID8A 1GA1A 3D7RA 3GUUA 4N4AA 3UPDA 1TZKA 5K3OA 3WLNA 1X0XA 1LVUA 1QM5A 1SA0A 3KKZA 3N8IA 1JW9B 4IVPA 4TV9A 2EL7A 2VJLA 1FU7A 4O2AB 4WN9A 2A88A 2HF7A 3C7CB 2WJ4A 3C24A 2H65A 2APJA 2W2QA 2Q9AA 4FTWA 3W79A 5BORA 1J1UA 2QTZA 2J09A 2Z09A 3FGNA 1SCBA 3M83A 3U49A 1SXJC 4HLUA 3VOBA 1ZVJA 4EW6A 1WKBA 3B1KA 5FPSA 3UPUA 2YCBA 3B1JA 1FLDA 2PY6A 5LSAA 5ENVA 3LA6A 1JPVA 5J63A 5KTRA 1P6UA 2VPPA 3LFTA 4UEWA 1JHZA 1QPGA 2C3YA 3O4IA 2KI5A 3FOEC 1QGYA 4D3SA 1VKNA 1KZHA 3JU3A 3GUYA 2O2HA 3B53X 3VYUB 2FGJA 3HYRA 4UM9D 1IHUA 2GZ3A 2Q2VA 3FCSB 3H5IA 2FRDA 1C3OA 1Z4PX 3U39A 1DEKA 2XHEA 1NVUQ 5AKLA 1ZN9A 4B4DA 2H9AA 2D2VA 3UGKA 1J7JA 1A9OA 3LX4A 3ZDQA 1JHQA 3ITDA 3ZUPA 3JATA 3CS3A 1UMCA 5T6BA 4QICA 4ARAA 5FAKA 4GL2A 5DMHA 3RV4A 2FF5A 2PUGA 5AH0A 4YFYA 4BHTA 1H4QA 1KQNA 1PFGA 4Q9IA 5BNIA 2F9MA 5FJIA 1RYBA 3H4VA 3UK6A 2VFAA 2GCGA 5K7SA 3GPDG 2Y2VA 2X5KO 4OXKA 3SIRA 1TVMA 4B7AA 4UM7A 2YJGA 1G7CA 1GILA 2A3RA 2FLVA 2G06A 3N53A 2ECQA 5CAEB 1C3EA 2H2AA 2QXUA 2WPNA 2PGOA 2Y9MB 2RBEA 1M2OA 1UODA 1RABA 5IXJA 2FPIA 1CXZA 3A9CA 1LDBA 3I01M 3ELDA 3ESAA 1J8YF 5L40A 1GNSA 2W43A 5K2MA 1K0UA 4MQ5A 4KQFA 3DQZA 5D2CA 3BWEA 4G09A 5FPQA 3R09A 1NLMA 1D09A 2FWAA 2D8AA 4Q7LA 1OX5A 1D4FA 1X0VA 4RW0A 2JBHA 4G1BA 5JD6A 2MYTA 3H18A 1Z6AA 4HZUA 2Q0QA 2PPLA 4ND8A 4WRRA 3ICQB 1IQRA 5JLAA 5AI4A 4BVFA 5C5DA 3W5SA 4KQHA 4P4GA 4YJFB 3X44A 1AQYA 1HH4A 1MPXA 3LZ6A 3D9QX 5LNK1 4AJHA 2FRVA 2EATA 1TKAA 3GNLA 4E32A 5KX5F 2QVCA 5AUNB 3IC5A 3NKVA 1A76A 2ARKA 3OM9A 3IODA 3RRXA 4G56A 2J07A 3DDNA 1ZNYA 2BM0A 1RXEA 4G0ZA 2VPYA 5AOCA 1OAAA 2XQVA 3R7WB 4HNHA 4NPCA 2XF2A 4WBXC 1E2MA 3VSEA 3H5LA 4F45A 1IZ0A 2PX2A 4JD5A 1J42A 1RYZA 4NZOA 1OYYA 1WUJS 2Z9BA 5HM6A 5JSHA 5K01A 1EVEA 4LMBA 1JA1A 3Q7IA 2WIAA 4KI7A 4YP5A 1QKIA 1SOMA 2PEYA 2Q5EA 2ZIGA 4BQPA 3NWBA 3FE2A 5KQPA 1YQQA 3MIZA 1CE8A 2QMQA 4C4SA 5AK0A 5EYPB 2ODEA 1DTSA 2W6OA 3EXFB 3RM3A 1Y5NA 3UJ7A 3C1OA 4QYTA 3HA7A 1HYBA 3VJLA 3EC7A 4E22A 1GZVA 3KWLA 1EFLA 3IR6A 3AB7A 5H59A 5GADl 2FUCA 4DMFA 1MJFA 2V8BA 3GLVA 3OG9A 5DBFA 1I01A 3VKGA 2OR3A 3ANNA 3SKYA 2ZAYA 4EHBA 4XRRA 1MA0A 3AXTA 4BUJA 5ALMA 2CL5A 5J4VA 1E0JA 2PV0A 2CDNA 2XBUA 3JWJA 1Z63A 1JR3D 3DT9A 3AR7A 1M1YE 2ZIXA 3A58B 3VV2A 3AUJB 1B7GO 2ON6A 3JPWA 1GPBA 3LL7A 1N3BA 4PSVA 4MUXA 5CIQA 4DQUA 5KC9A 4EABA 1M6YA 2Z1DA 1I3KA 4OHRA 2GH1A 1C5KA 2BI7A 1ORDA 2FSHA 1G4UR 4YR7A 1ZVVA 2A4KA 4K7JA 1FLVA 4LOIA 4Q4DA 2DE0X 3NORA 3FIUA 3M4ZA 1MRZA 4PG5A 4MUKA 1VXOA 4IVQA 2W7TA 4JU8A 2OYRA 5KVCA 5JV5A 3LE8A 1SU8A 4NQRA 1JBEA 3T4UA 4MVJF 4E21A 4BMSA 5U9CA 2IDZA 1CEXA 1CR4A 1JHXA 1ZD2P 1Y1TA 2N1BA 5AJHA 5F35A 2X15A 1P8AA 3U3MA 1Y1KE 2X4GA 2PU7A 4GX0A 4A1OA 2XNJA 1IRXA 4BMXA 3UG6A 5ICEA 1XDUA 3BGWA 1SQ5A 2QW0X 1N6OA 3HHPA 2AOUB 2R00A 5I9NA 2HWWA 3OE5A 1QV9A 2OK8A 5HCIA 3RVBA 3SGLA 4F96A 4LE1A 3GLHA 2WM2A 3QF4B 3QUAA 4HJRA 4Y0AA 2WF5A 5LXTF 4DREA 1QRAA 2VK8A 3H42B 5IJ9B 5IFLA 1DIRA 1FU8A 2CXXA 1K92A 1ZS9A 4DV6B 1CU1A 1UFRA 1MJGM 2JFVA 4Z51A 2BFEA 5DULA 2C9BA 5AKHA 1SGWA 2YMQA 1XV5A 3DMPA 3WNVA 1L1RA 4DWJA 4EA7A 4KGDA 3BE6A 4JV5B 1PKXA 3SBOA 1XSEA 5F21A 2HJHA 2B69A 4FMBB 3PT5A 4IG4A 3K0KA 5IDQA 3J81k 4QUEA 2ZRNA 4M1TA 1HE2A 2MIIA 1R8JA 4X84A 4EW1A 4PZYA 1NWCA 4FW8A 3RRFA 1U4OA 1L4UA 4REQA 1AF7A 2G3YA 4RESA 4EI8A 4C9BA 3NETA 4FX2A 1FSGA 4MR9A 4RHTA 4JI7B 3PZRA 4HEHA 1OAOC 1S7CA 2JGNA 3NC0C 4KTVE 1CQJB 3ZNNA 1W73A 1Q0TA 1PQWA 5COAA 1W0JD 5L6MB 1JFLA 2PUEA 4MOWA 2BMWA 3MC1A 4BU0A 2WVGA 2RARA 3R3YA 2OAP1 2H4YA 2GYWA 4LNHA 4MWSA 1ORVA 1JDUA 5DCUA 4UOZA 3ASYA 1F12A 2FSIA 4JK3A 4PAGA 4DPMA 1PD0A 2AX3A 2J0QA 4PAOA 1XFAA 4XGQA 3BCRA 3HDQA 3IAUA 2WJWA 3BPSA 5A7FA 1ZLYA 3ONNA 1H3FA 3ZV6A 3G0IA 2YHIA 4JLVA 4M7RA 4ETNA 4JC4A 1B3RA 1EX6A 1PS9A 4KV7A 5BV7A 4ZGBA 3IALA 3AR6A 3G2IA 1ILWA 4F04A 3C6YA 3HCEA 2IHTA 2YBDA 2ZJ7A 4PZLA 5BR1A 3O9ZA 4US0R 2CL7X 4ZVUA 4LRSB 4XA8A 3L6RA 2CW5A 5EWLB 5B2ZA 3HJRA 1U0LA 2AOTB 5K3SA 3C3AA 3PGLA 3I9NA 3Q10A 3AVPA 2DHEA 3GUZA 2JLXA 3NAGA 2A6PA 2QT1A 4C20A 4HFRA 3ZDDA 1MDBA 5DYWA 3DH0A 3RSGA 5B36A 2NUPB 1BRTA 4UTXA 1JPNA 1PS0A 3FNGA 5TPWB 2X6QA 2Z5VA 1VKJA 3RFUA 1TQ6A 4IGIA 3ZGNA 4RDIA 4EJ6A 2XB2A 3HU3A 3JQFA 3KYDB 3QM1A 3GJZA 3PLRA 2GO1A 3UJDA 4AZ0A 4EEXA 3GROA 4RD1A 3V4SA 2GXUA 3AJDA 5BQFA 5AVVA 1A97A 3DBLA 4BO2A 2XSZD 4FYYA 4OHWA 3T3EA 3TSAA 1PEAA 3HBNA 2B5WA 1QHHB 1B8OA 2H2WA 3C3XA 4TTIA 1M1UA 5C4MA 4B3FX 4DIEA 3H2ZA 5A5GA 1EJ2A 5DBHX 4E07A 4DQ0A 1D5WA 3ESDA 1W96A 2FK8A 4Y6OA 4EPWA 1B8NA 4OQLA 2VSNA 1YDWA 4YS6A 4A03A 2D2IA 2INGX 5ITZB 2D1YA 1EFRA 2XADA 3FMFA 2JAUA 1JMKC 3IOMA 2WF8A 4CM4A 4DC0A 3UAGA 1NFFA 4N82A 3QVKA 4N5MA 3QVGB 1XCGB 4V0RA 3UG7A 2O8FA 1ACJA 1FVOA 1SBZA 3A04A 1X13A 4JLDA 3QA3E 4G4SO 3Q5DA 3HVJA 4MMXB 1SCDA 1UBMS 3G7NA 2J32A 5E1OA 1P0IA 1CUIA 3R74A 5JCXA 4P98A 5KYNA 1EUYA 4MICA 4X64B 3ZIAD 4B34A 4D3XA 3IOBA 3N2EA 1XALA 1BDJA 1CYEA 4DM7A 4DNPA 1TKBA 4PQGA 4ZICA 3ZHQA 4FSXA 1GV0A 4GF5A 3MGAA 3SBEA 5KNDD 3KYCB 1C4OA 3CO0S 4PICA 3VR2D 4B4UA 1DWQA 4EA8A 1PL6A 1DC4A 4NMLA 1PFYA 1SC9A 2B25A 1O95D 2V7XA 3L46A 2QD2A 5ALOA 3WO1A 3HO1A 5CB6A 1N2BA 1ZCFA 2XOXA 3C1TA 4M0UA 2NGRA 4LQLA 1PT6A 5E95A 1EGHA 3ZH2A 3QSGA 1CHNA 4AQDA 3UK0A 2YOHA 3L8CA 1R5NA 1L7EA 3K1JA 4P3OA 5FBWB 4RCYA 3TEFA 2A7XA 2R1TA 2R00C 1CP3A 3E22B 3VM6A 3C8HA 1NUPA 3Q9NA 1CFZA 1L4LA 4NECA 2YYYA 4H4DA 3AF0A 2OECA 2RGUA 2BMJA 1FRVA 2I78A 2I1QA 2FZCA 3A1EA 1ZXLA 2FG6C 5JECA 2XAAA 1LDGA 5DGDA 1QCDA 4GEKA 4BFUA 1BXRA 2HEGA 4HLQB 3IP5A 1UBOS 1FNSA 3GJTA 3GVIA 1H1DA 3AERB 3B1WA 4I1SA 2AXPA 1ZK1A 1H6BA 1AKWA 1M3SA 4PRLA 1QGAA 1HDYA 3F9RA 1F06A 1RJFA 1Z47A 4PR0A 1JF8A 4KGZA 4PNZA 3T7KA 3UB4A 4FQ7A 4YJDA 1E1LA 1VLVA 1W4BA 1T4DA 2YQ5A 3QIAA 4KKXB 2OPHA 2OV4A 2F3UA 1FTQA 2RIPA 3QTBA 4B82A 3QQPA 3H1EA 4GRAA 3MZ0A 2YR0A 4YMIA 3TSCA 4YMTA 1RJEA 3CH4B 1YDFA 3CEHA 3RLIA 1KJ8A 4PLFA 3AU9A 4FCVA 1QWOA 4RD3A 2BGIA 1OFUA 3TDNA 2ENWA 3C98A 4CLDA 3IPLA 5BSWA 3AERA 2QRGA 1JAIA 4EG4A 4QOGA 1FYFA 4AKTA 4HL6A 4BFYA 4B4KA 4RK0A 3OTGA 1XEFA 4H18A 1EB9A 2RD2A 4E0BA 2DY0A 1H2FA 3B89A 4LFAB 3HFRA 1TW2A 3DTYA 1S4QA 5FL7D 3H6HA 1P2SA 1QIDA 1A8QA 3CZPA 1Z4QA 4DQLA 3AF3A 4RF3A 4E33A 2FFAA 2QN6A 1T4CA 3I4FA 5IUNC 3F5FA 1CYDA 2CC2A 3AVOA 4M54A 4P92A 4UQOA 1ZQ1A 3EXAA 3IUEA 4G4GA 1F9AA 1NVGA 1SBYA 2HA2A 3O1LA 4Q1BA 4CIWA 5K8JB 1KSJA 2NU8A 1K97A 4P4UA 1Y3AA 2WWYA 1O6FA 1RCTE 2OBXA 3V97A 2NWQA 4YCBA 3AJAA 4FM9A 4S05A 2QROA 4RD4A 5IMBA 3G2KA 5F3RA 1LTHR 1VBKA 1WMFA 3AGQA 2RGXA 3FR7A 5EZ5A 3TPCA 2IRWA 2V6JA 2L17A 3KSMA 1PV4A 4NU6A 2RJ3A 4C22A 3A6HA 2D0DA 1G17A 5EIEA 3G8YA 5KJ1A 1YCHA 3B6JA 2B99A 3O2NA 5HQ3B 6LDHA 3KT3A 2MT9A 4C0SA 1YI0A 1CJBA 4KXLA 3OQIB 1G3RA 1TOAA 1Z2EA 3V34A 1USWA 5ECYA 3STTA 1F8FA 1U9IA 2I66A 5M04A 2KSQA 1RTKA 3LI2A 3TQTA 1W88B 3OECA 4HDNA 3TZLA 1W29A 3LPAA 1A9RA 3EIHA 2H54A 2OCIA 2RCNA 4M6WB 3EEIA 2BCJQ 3E7DA 4OXXA 1JZQA 2PBLA 3M5CA 3HB9A 1XROA 1WB4A 1Z5UA 1Y3FE 2XVAA 3GVCA 4AY3A 4KK3A 1FFYA 3MWYW 1GRQA 1UXGA 1XMPA 3V4OA 4ZTBA 1T5TA 4QYXA 5CK4A 5CK5A 3BWXA 2ZATA 3N8GA 2GZSA 2G0NA 3KU1A 4G1VA 4P4TA 2QYSA 1AKUA 3GJQA 1ZUHA 3MRXA 2IUYA 5ER6A 1RI3A 1JJVA 1XDSA 3G2MA 3UJ8A 4R51A 1D2MA 3EX7C 1CUZA 3H5VA 1VCHA 1SUSA 5CPBA 4QBKA 4YQFA 3MLAA 4JUCA 4YA6A 3C5VA 4GR5A 4HYYA 2XMSA 4ZHQA 5HQTA 4GYJA 1W46A 3ND8A 3ZE2B 2DGDA 3D6JA 3O2SB 1EE2A 3GP8A 2X77A 4X8LA 1HV8A 1R0ZA 1YV9A 2ZG6A 2NQ2C 3AI1A 2GD1O 1XCBA 3KOOA 1OI2A 3DBOB 2GBLC 5E1BA 3SHTA 2BGNA 3MK31 2O06A 4CN9A 1P2FA 3GLGA 3M4NA 5EESA 4YLGA 2BR5A 2QI9C 3L8MA 1IL0A 2P3SA 1M8FA 3SQDA 2G71A 1Y81A 4Y67A 1PR4A 2J4CA 4NF2A 4PSCA 3SSNA 1ZHOA 1NW3A 1S2MA 3OM8A 2PH3A 1AXRA 3HLKA 1XD2B 5CDYA 3FPGA 4L3OA 1FFAA 4Q18A 2Y92A 4RPJA 4B4OA 4FN5A 2VPTA 1ZIOA 3UIEA 3IDZA 1UZUA 1K8YB 4YRJA 3O3CA 3CNNA 1I3MA 3OKAA 4GBED 3G13A 5IM4A 3G5MA 1F5NA 2NZWA 3DEIA 1CY7A 2Q5HA 2CT8A 1SG0A 1BCSB 4IMPA 5A6VA 2XUIA 4BRSA 2GF0A 1USGA 5JBNA 1B76A 2GOYA 2WNSA 5F9MA 3VUEA 1QHYA 1U2EA 5LC1A 1UKZA 4B6GA 2NVOA 4WLUA 3MJVA 2V4MA 2NO6A 2AKYA 4OK6A 2CFTA 4GLLA 4OLAA 1YBAA 4CIBA 1TZMA 3MFQA 3E5RA 3S2EA 2P5UA 4P93A 2HCFA 3PLNA 4TS9A 2VP4A 2ZBRA 2J5KA 4CODB 3JD3A 5LJLA 5DNUA 1CPYA 1OTHA 3P9SA 4UU7A 4K6CA 4XWYA 4E5YA 4HYTA 5GZ1A 2O8VA 1QRRA 2QW1A 5B53A 3V80A 4AUKA 4LFBB 1KQ3A 3NH9A 1CUUA 1Q15A 4WERA 4NOLA 4LXUA 3LPLA 4R81A 1U3GA 5FPKA 4HY3A 1G8FA 3VHLB 1N0WA 3WYCA 4ZJZA 4EPTA 1SXPA 2B4AA 5K03A 2KHZA 4OLHA 1FF9A 3MWLA 2XUPA 3QELB 4Y6SA 3O9VA 5DTJA 1LRLA 1GSAA 2QRLA 4G41A 1ZUIA 4L50A 3ZQ6A 1ZKMA 4YAFA 4RIGA 1F0YA 2HA4A 2P9EA 3GARA 3GJXC 4XD2A 4FONA 3HCNA 3HO8A 1C2TA 3HP7A 4MDYA 2JA2A 3STHA 1U8CB 2AYZA 4RJ2A 1LLUA 3FI9A 3I5AA 2HXYA 3QRWA 4PYLA 5EKDA 4TROA 3W8RA 2YZMA 5I9BA 2QTWB 5HP4A 4BB9A 3CSUA 3ADBA 1RPZA 1AUVA 3ZD6A 4KN8A 2ZKLA 3NWEA 3OJEA 1DEOA 4EW2A 3SZMA 3RREA 3AEYA 3RIEA 2YKGA 2XUOA 1ZISA 3K1YA 4RCZA 3VPGA 3ZWKA 1POXA 1QYWA 4HKTA 4X1OA 3LXRA 1RQRA 4UUBA 4ZOEA 5KVVA 1SWVA 3VU