3U4HA

Cd38 structure-based inhibitor design using the n1-cyclic inosine 5'-diphosphate ribose template
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
245
Chain Sequence
QTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD38 Structure-Based Inhibitor Design Using the N1-Cyclic Inosine 5'-Diphosphate Ribose Template
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ADP-ribosyl cyclase 1
total genus 81
structure length 245
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2011-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3u4hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u4hA02
1NXQA 2PGLA 5JAMA 2TMGA 5K6AA 2W8ZA 2HSDA 5BNTA 1P45A 1DLIA 2C2XA 2X4GA 1U8FO 4HXYA 1KBZA 2OORA 3OF2A 5G0SA 3GNQA 1B3BA 4A26A 4BO5A 1UZMA 1BSVA 1PJTA 2Y0EA 4ALJA 3KYCA 5A5FA 3OEWA 1XCBA 1KVTA 5KVSA 2Y1DA 4CMJA 3ZWNA 2QYTA 5JE8A 2D8AA 3T7CA 2VHWA 3ZHYA 5TJ9A 2JHGA 3JQCA 2Y68A 4L9RA 1MG5A 4YAJA 4OKIA 1LC3A 3JYLA 3ZWBA 4IDCA 4TQGA 4B4OA 2H63A 1PGNA 3LDHA 1KY5A 3GAFA 1PGQA 3CH6A 1X15A 3FI9A 3RIHA 2BF7A 1WLYA 3OECA 1GUZA 5C3MA 4DC0A 1XKQA 4KP7A 4DIBA 3GN2A 1VJ0A 3AM4A 4YJFA 1XU7A 3MJEA 3N74A 1KOLA 3TFOA 4K26A 4BNKA 3QRWA 2BH9A 4EJ6A 1FDSA 3JD0A 3JD1A 2VOEA 4CMIB 1YO6A 4L74A 5TF4A 3STHA 4TZTA 2EGGA 4DBVO 5JNLA 1DC3A 3RFVA 4E21A 3RFXA 1CIVA 2IODA 5B12A 1PJ4A 1ZJZA 2QZ9A 3WSVA 1U1IA 3ROKA 2A4KA 4U7WA 4OKNA 1LLUA 1T1RA 3ASUA 1Q2XA 4JGBA 1JVSA 3RBVA 1LUAA 4TWRA 2EKQA 2I3AA 1LA2A 4FIZA 2AE2A 3Q6IA 3PHIA 3KM0A 5CPFA 3U0BA 3KVOA 2J3KA 3KV3O 4D42A 1CWUA 1PGOA 1PQPA 2J3IA 4FBGA 5IZCC 2A92A 2QRLA 3C24A 5A06A 4BNGA 5EMHA 4HKTA 4CM4A 5F5LA 4LCJA 3CMMA 2BFMA 4IDEA 4I5EA 5AVOA 4G2NA 2FRDA 4IQGA 2X5KO 4DPMA 4YR9A 3RJ9A 1VRWA 2Q1TA 5I9NA 7MDHA 3F9IA 3DZIA 1DFGA 4P38A 1MUUA 2GERA 3DO5A 4MKXA 1HKUA 4NPCA 4JBHA 2AEFA 2D0IA 5KNLA 3K8ZA 2NU8A 1SMKA 3U4DA 4RVGA 3E9QA 2A35A 5JCJA 2FY8A 5T6BA 1GV1A 4Q9NA 3LT1A 4LSWA 5IDXA 3RBZA 3SVTA 3PHGA 4FCCA 3KLPX 4RZHA 3NT5A 1D1SA 5J23A 1WMBA 2TMDA 3IUSA 4CUKA 5JCJD 1QR6A 3ICCA 4R69A 2JFGA 3JQGA 5JS6A 4HFNA 4RVFA 3H3JA 2X9NA 4FDAA 4K9DA 5ILOA 3NGLA 5T67A 1CYDA 3K2EA 3PJEA 1FDWA 4XR9A 4E2ZA 5IJZA 1R16A 3EDMA 3P2YA 4RF4A 1KEPA 4BVAA 4QO8A 4RPKA 3KYCB 1JTVA 2VZ0A 3DZKA 1NHWA 1UZNA 2PKQO 5JO9A 4CQMD 5F1OA 3P7MA 2EP5A 1HRDA 4RDHA 1J49A 2FN7A 3ZNNA 1J0XO 4FFRA 2IEBA 2H6EA 3ZZNA 4J43A 1ML3A 1LBEA 1WPQA 4WOJA 4CQMA 3V1TC 3VZPA 1GFSA 1X14A 4O59O 2X58A 3BTOA 3IUPA 3I1JA 2O7QA 4H15A 4PG5A 4HWKA 3R3SA 4YRAA 4BNHA 4I1IA 4CQMB 2QG4A 4PGFA 4LMRA 3H3FA 4F46A 1NQ5A 3ITDA 4L73A 2G0TA 1KERA 3B1KA 1PX0A 4HFJA 4BMSA 1VC2A 1QYVA 2JAPA 4IGEA 3M2PA 4PLTA 3HUDA 1W4ZA 3S2IA 4LISA 3L6OO 1XG5A 4R54A 4CQLB 1LSUA 1WDKA 4NK4A 5HS4A 1Q0HA 2C7GA 3HSKA 5EQFA 2LDXA 4E30A 1Z74A 2EKLA 5ENVA 1LDMA 3H9QA 1TT5B 4AJNA 1DC6A 2P68A 1QP8A 1RM5A 1TA4A 4BB6A 2CY0A 1E7MA 4ZQGA 4W6ZA 2BI8A 3I5MA 1YDWA 2P9GA 4R9SA 3NUGA 2BI7A 1F8GA 3PJFA 1O5IA 1ZK0A 3ZHZA 1X7GA 3I83A 2Q50A 3KETA 2IEDA 4YYZA 2IRWA 1IB6A 3GUYA 4Z3KA 4PLGA 2EW2A 4R3WA 2Z95A 1EUZA 4IS3A 4TRRA 1UP6A 5BT9A 1N2SA 4CLHA 4D41A 4XX0A 3SC6A 5F21A 4S1VA 1N8KA 2BHLA 3GZ4A 1GYRA 2VUSA 3WTCA 3ROMA 4AJJA 1NNUA 3OIDA 3Q3CA 1IHYA 3X2FA 1IL0A 1LDGA 4KOAA 2RH4A 5KOIA 1Q0QA 4FQ8A 1JWAB 1VJ1A 5EJ2A 4CMBA 5I8WA 1H6AA 4GSLA 4PLPA 1EUCA 1SOWA 4BV9A 3G79A 2PKQP 4PLCA 1ENYA 1TVEA 3MJCA 4ZVVA 5COAA 2A94A 2EGHA 2HJSA 3KBOA 2C07A 2GZ2A 4DXHA 3GZNA 1O6ZA 4EUFA 1WZEA 2QW8A 2ZB7A 5ENDA 4OH1A 2EWMA 2RCYA 1JWBB 3W6UA 3WB9A 3ZWPA 4BKUA 4EJ0A 4M49A 1SB8A 2YZ7A 1C0KA 1IUKA 1WMAA 1AHHA 4BGIA 1RWBA 3QLJA 1QV6A 4MIEA 4K28A 4E5PA 1C0PA 2PZLA 3ZWYA 3I9JA 3AI3A 2O23A 1NBOA 3PQDA 4BGUA 2EP7A 4XRRA 5IZCA 2CD9A 4O5OA 1R4MB 1DSSG 3IIEA 3VHRA 5BR7A 1NAHA 4O63O 3E8XA 3IP1A 2I3GA 3AY7A 4AJPA 3VTFA 1OI7A 1U4OA 2C7VA 2Q1SA 2PR2A 2FSSA 4RF2A 4K1LA 4TZKA 3OETA 4JCOA 1MFZA 4MKRA 2R00A 3SBOA 2C59A 4BNNA 3GEGA 1PZGA 3AOEC 3CIFA 4XZ3A 1PWZA 3SLGA 4B4UA 5FEUA 2BFOA 4WOKA 3AK4A 4AJEA 3I52A 2WD7B 3ONDA 3VKVA 2HUNA 2Y1CA 1YB1A 1KIFA 3TRIA 4J16A 2PLAA 4BMNA 1HDGO 5ICSA 3FN4A 3G1UA 3H9EO 1K5HA 4J4TA 3PJGA 2OUIA 1K6XA 4IS2A 4KTVE 1E1NA 1LRKA 3MWDB 5A03A 3BTVA 3HE3A 3VPSA 4A5OA 1H6BA 2J5RA 3TZQA 4Y6PA 3TL3A 1WAMA 4RPJA 4WLNA 3ZNOA 5L51A 1YQXA 2RHCA 1R0KA 4FC7A 1P1RA 1YOVA 3ANLA 3GMDA 1GL3A 5H82A 4N5MA 4CMKA 4D44A 3QE3A 4HNHA 3H65A 1L7EA 3AM3A 2Y1FA 3ZV6A 1RYEA 2VYVD 2YHIB 2X9VA 4XCVA 3RUCA 1KEWA 3ONFA 1QLHA 3FR7A 3D5TA 1E6WA 3RUHA 3ST7A 3WGOA 2AE1A 2CMDA 3BAZA 1NWHA 1Z75A 2E82A 4B3JA 1YONA 3WOHA 5EQDA 2R2GA 2PA3A 4PLVA 3OEYA 4L0QA 3O38A 3V5NA 2O3SA 1A7KA 4F6CA 4E33A 2V65A 3F1LA 1B14A 3W4KA 2FZEA 1YJ8A 4CPDA 3E9MA 4BO7A 5TT0A 1F17A 1O89A 1P1KA 3C1TA 4KQXA 4EYEA 1DRUA 1O9BA 3L4BC 1DAPA 4ND4A 3JD3A 2WJPA 4ESOA 3BMQB 2ZATA 3LK7A 2ZIZA 3DQPA 1G0OA 1O0SA 4GLLA 2FR0A 4BNJA 4DRYA 2YUTA 3P5SA 2YJZA 1GPJA 2OOSA 1ZK1A 5CHEA 3WWYA 3PHJA 4TROA 5CG1A 3P19A 2HK8A 4WLOA 4BNFA 3JQEA 1N7GA 1IYZA 3HN2A 3EY4A 3MJ4A 2YQ5A 4YEDA 3DL2A 4Z9YA 4UVDA 2OXIA 4YQYA 2HMWA 3IJRA 1DJQA 2HK9A 1ZCJA 5F3RA 3WGIA 4OAQA 5JC1A 1MA0A 1GAEO 4URFA 2AQIA 3KSZO 4XJSA 4DYVA 3F5QA 1Y8RA 3I23A 4A03A 3DC2A 3PTZA 3ANMA 4WASA 4AL4A 3UGKA 3WTBA 3DBVO 2VWHA 2Y1GA 4QO7A 1I36A 3QW2A 4MO2A 3RVDA 3KUXA 4KZPA 5CDGA 2E37A 3AY6A 1UAGA 4MVJA 4A0SA 1RM3A 5COQA 3WS7A 1AE1A 1ISHA 2NU9A 1I01A 5ITVA 5KTKA 2OZPA 2VWQA 3C1OA 4IPTA 3PI7A 4GX5A 3TZCA 5DN9A 1E3IA 1HDOA 2O48X 1EUDA 3MEQA 1HWYA 4QX6A 3O26A 4GPD1 3PWZA 4ND3A 4KUEA 4NBVA 4PZCA 3RKRA 3DZHA 1M67A 5KJCA 1BHSA 3FR8A 4ALNA 1FDVA 1LI4A 1P1FA 4D3DA 5IAAA 2Q2QA 3DWFA 5HA5A 3H5RA 1ZZEA 2QYSA 4L4RA 2AHRA 5KCZA 3I9LA 3SJUA 1ORRA 1UDBA 1D8AA 3QVXA 2B69A 4Y6RA 3AUSA 1F12A 1LLCA 4QQRA 4ND5A 1H5QA 3WIDA 3JQ7A 4IJKA 4IZIA 2CDCA 5KJFA 5L4LA 1XEAA 4XQGA 2JCVA 3ETGA 4ALLA 3PYMA 1M76A 2Y93A 3D3WA 3ZWMA 1GCUA 4J6FA 4E0BA 2D59A 2D5CA 1D4FA 5IDYA 2BD0A 4MINA 3B6ZA 1DJNA 4F6LA 2V6GA 4GGOA 3ZWXA 2OHXA 1LLQA 2QHXA 4BKQA 1KVRA 1ADCA 4EW6A 5CG2A 4AJLA 3AFMA 5A1TA 2Q1WA 4IDDA 3FBTA 3BMNB 2UUPA 4BGVA 3HDQA 1Q7CA 4BKOA 2HMUA 1NTOA 3RI3A 3O03A 4RDIA 3UN1A 4BNMA 1OBFO 1EDOA 3S2GA 4BNUA 4CR8A 1JDJA 5G4LA 4ZQBA 1MC4A 4WPGA 3AOEA 1YE3A 5JSFA 3K92A 1K6IA 3TFQA 4IQ8A 4OSPA 5GZ3A 5HTOA 1E3LA 4WCFB 4B3IA 3MTJA 1PZEA 1XQ6A 4RLSA 3NTQA 4KWIA 3ZDFA 3E48A 1N1EA 3PLRA 2R6JA 3QVWA 4XB2A 4H16A 2BKAA 1BW9A 1DIGA 1E77A 1H94A 5DT9A 2JFHA 5JBIA 3DMYA 4O1MA 2XPCA 4MVJI 4R3NA 1OOEA 3PGXA 4P22A 3DAPA 4CR6A 3DONA 4ZN6A 1I2BA 3ZV5A 2OBNA 3B70A 1YH3A 1XQ1A 4BO0A 1E7YA 3S8MA 1U8XX 4L4XA 4UUPA 1YBAA 3PZRA 5L4SA 1T26A 4OHUA 3RUFA 2EJVA 1PQUA 1YRLA 5AYVA 2PKRA 2AMFA 4Y6SA 4E2XA 3UW3A 1ZK4A 4AJ4A 5CDTA 1DIAA 4Q3CA 3UCEA 1HE3A 5L7WA 4XGKA 4NFHA 5HBRA 5KVVA 3AUUA 4DGSA 4BGEA 4D43A 3ZWWA 4FR5A 1PU2A 4OQZA 1Y9EA 5L4NA 1PGPA 2VQ3A 1G0NA 3H2ZA 4DBZA 2EG9A 1ZW1A 1FDUA 3DBLB 4FC6A 4BNXA 1Y7TA 4U6SA 4WNCA 3LF2A 3Q2IA 1HDCA 4XYMA 4Y8VA 1U3TA 1DXYA 1JQBA 1ENOA 3AJRA 3OIGA 1PQWA 5DULA 4R5HA 2ZQYA 3SEFA 1ZFNA 5K0ZA 2I65A 5JFOA 1B8UA 2WYVA 3JQBC 4MKZA 3H9UA 1PS9A 1C0LA 3K5PA 5CEEA 5C5IA 2HJRA 3UICA 4FGWA 2B83A 4KUHA 1H0KA 2NTVA 3W1VA 4D79A 3I9KA 3JV7A 4NFSA 1I5RA 3SXPA 3TQHA 2I76A 4YCAA 3EZYA 2FWMX 2OP0A 2QIOA 4FS3A 5I7VA 2NSDA 1KETA 3ETEA 1J4AA 1UZLA 3AOGA 1UXJA 4EUEA 4I08A 2HAEA 1PIWA 4HBGA 3L9XA 3F47A 4RVDA 3D4PA 2X23A 3HWRA 4HFMA 3PK0A 1YJQA 3OA2A 3K73O 1F8FA 3CXRA 3PHLA 3UCFA 4XRGA 3E1KA 4LGVA 3OJ0A 1NR7A 4DL9A 1DFHA 3GDGA 2XF8A 3AUTA 2O50A 1GDHA 1BVRA 1UJMA 5DCUA 3JYQA 4QTZA 1QSGA 5DOZA 2HK7A 1UDCA 3PWSA 4CMGA 4CMHA 3FTNA 1BWSA 4I5GA 5IZ4A 4HY3A 1HXHA 1CF2O 3N58A 2W2LA 1EMDA 2X6TA 2Z1MA 3HFSA 5B4TA 1I3LA 3QA9A 4I8XA 3GT0A 3RROA 5ER9A 3K6JA 1HLDA 1KY4A 2GCGA 5JDIA 1DPGA 3UCXA 4NIMA 3CUKA 3R6DA 4OYRA 5AXCA 4D45A 4EZBA 3GA0A 4RCVA 3ORFA 5H81A 4IBOA 1RM0A 4DQXA 2VHXA 3ICPA 1HE5A 3NJ8A 1EE9A 1U3UA 1HETA 4MOWA 3F3SA 2OFPA 3ONEA 3NT4A 4JJFA 4YXFA 2QZZA 4J0EA 4W99A 3TZHA 3JCZA 5A9SB 5JC8A 4J91A 1I3KA 1MGOA 4XWYA 4PVCA 4RO0A 3BXXA 4UUMA 3VKUA 2X5OA 1W8DA 3VTZA 4NJMA 2CVZA 3B1JA 3ZW9A 1UDAA 3MTGA 4CQLA 2QRKA 3KB6A 1EK5A 1H6DA 1HEUA 3C7CB 5L7TA 1ISMA 1MLDA 2WD8A 1NASA 5B37A 2WE8A 1GUFA 4UAGA 4FFNA 1Z73A 4D0SA 4NDNE 1YKFA 4R51A 5JAZA 1DIRA 4UVIA 5DBFA 4CLRB 2GZ3A 2XXJA 2EV9A 3WQRA 4J4BA 4FFMA 1XELA 4Y9DA 4FJ1A 1PJQA 4RQTA 1A7AA 4B8ZA 1DOHA 2D2IA 2O3UA 1Y8RB 2AXQA 4JJGA 3WXBA 1HF3A 4ALIA 1LU9A 2RHRA 4FOOA 5DOVA 4LSMA 4P4NA 3W8DA 1SEPA 3ZU4A 3E03A 1Y81A 3H5AA 2VHYA 1NPTO 3O8QB 1B2LA 1ONPA 3TNLA 1X1EA 3EGOA 4PLZA 6LDHA 4CR7A 3BHIA 4XIYA 4J1QA 2YV2A 4LRSB 2PH3A 5ER6A 4CUZA 2VWPA 4FFPA 4NBUA 5L45A 4ZU3A 3WJAA 5JAQA 3DZBA 4Q3NA 1A9ZA 4CMAA 1EEHA 1PEDA 3DBRA 1GYPA 3ADOA 2V6FA 3PPIA 1BW9B 5JW6A 3ROQA 3JQFA 3QVTA 1RYDA 2VNAA 1PJLA 1R4NA 3SC4A 1QLJA 1ZSVA 4WK6A 2GR9A 1YL6A 3HG7A 4WNIA 1Z45A 2PH5A 5TRTA 1X13A 2VTDA 3SJ7A 4CL8A 1O94A 3E9NA 5T64A 4J1NA 5I7EA 3DBHA 3DZJA 3GLQA 3U4IA 3D0OA 2VZ9A 4NFYA 1ZEJA 4RPGA 3U4CA 4EEZA 3M1AA 3F1KA 3INRA 1QG6A 3DBHB 1LQUA 2ZTLA 2C20A 1OC2A 1X0XA 5C7OO 3DHEA 3SX2A 4YT8A 1R4MA 4TKLA 3VPGA 3AU8A 4BO8A 2F00A 3ENNA 1SCUA 1JN0A 3VPHA 1BTOA 1AXEA 4YACA 3PFFA 3FSRA 4R1UA 2Q4BA 2X0RA 1SNYA 4DQUA 3RSHA 3OP4A 1T4DA 3JQAD 4XQ9A 4J7UA 1LRLA 2GPTA 1XDWA 3F5SA 4A10A 2DPHA 3VVCA 4GX2A 5G0WA 2I67A 5DF1A 4IMPA 4BQPA 3ENKA 1T24A 1FXSA 3R1IA 1CEQA 4L75A 4BO2A 4GGPA 5A02A 5MGBA 4Q39A 3VDQA 2AG5A 5K9ZA 5ICMA 3U62A 1Q7BA 5T8KC 4DPKA 1R0SA 3C3XA 4R1NA 4INAA 1YL7A 4ND2A 4BL5A 1C3VA 1N92A 1E7QA 4FN4A 5DP1A 1RM4A 4FB5A 1SO8A 1FF9A 4NR0A 1DAOA 3H9JA 3KYDA 3LVFO 3DFUA 2PWZA 5F5NA 2DAPA 5EERA 1X1TA 4I5FA 3QQPA 2WE7A 3I6IA 5AXAA 1T4BA 2AEJA 1O95A 2EJWA 5G4KA 3HADA 3NT2A 5CFZA 2BGLA 1GR0A 4YRBA 1EE2A 4AJIA 4J2OA 3ZW8A 1KEVA 4BKPA 4FGSA 3D64A 3GHYA 3KXDA 4BHTA 1JVBA 2J3HA 3I9NA 3ZNQA 3F4BA 3WR5A 2GRAA 2ZTVA 2P5UA 4ZGWA 5DCWA 3OFSA 1NQOA 3DZGA 2Q46A 4NBWA 1MG0A 1NHGA 3GR6A 4PG4A 4TSKA 4XYGA 2H1SA 1VSUA 1ZK3A 3UHAA 4DIFA 5U1PA 2X86A 1DO8A 3PDUA 9LDTA 3NJ4A 5G0TA 1E0DA 1U2GA 1YQGA 3D4NA 1HDRA 3A28A 2P9CA 5DBGA 4KUGA 5FFFA 3CZRA 4MPDA 5COBA 1LDBA 4OJNA 2FHSA 2JFFA 5A05A 2D1YA 3X2EA 1CDOA 1B8VA 1XYGA 4MVJG 1VLLA 1YWGO 1ZSNA 5HS6A 1PGJA 1SEVA 3G0OA 1R37A 3BMCB 2D3TA 2PY6A 2ZYGA 1R15A 3IOYA 4ND1A 1H9AA 3MOGA 5CDSA 4I5DA 3HFGA 4FFLA 3T4XA 5IF3A 3RC9A 4N54A 4II2A 1EZ4A 4CMEA 3QV1A 2YV1A 3ZHXA 4PZDA 4BNTA 3JQ8A 2C54A 2VCYA 3IQDB 1DB3A 2J5KA 3S2EA 3JYNA 4FW8A 4JIGA 4U0JA 4W4TA 2HQ1A 2GN9A 1I8TA 2NU6A 1YDEA 1C1DA 3DAFA 3D7LA 4XA8A 3T7EA 2OP1A 3RAJA 1E92A 1IOLA 1Q7GA 4NH4A 1PTJA 2Y67A 3UVEA 5L95A 3TWOA 2E4AA 2PTGA 3JQAA 4IJVA 3WGQA 1UR5A 2G76A 3LT4A 1D3AA 2LDBA 4AJ2A 1ZIDA 4RL6A 4U6QA 1MC5A 4C7KA 2I9PA 1C1DB 4KTTE 1DFIA 3K2BA 5IDQA 4GMFA 3VZQA 3U49A 5BNFA 1LDYA 3VZRA 2HRZA 4ALMA 1ZJYA 3JD2A 4DLLA 3GVPA 4B7CA 2CF6A 3PHHA 2R00C 1KEUA 4GX0A 5BSHA 1ADGA 3FHLA 5JDCC 1R6DA 3FNFA 3ZHBA 1EBUA 3QP9A 3L0DA 3TDKA 1I2ZA 3UXYA 4BIIA 1Y8QA 1V9LA 5EPOA 3DHYA 2P4QA 4U5QA 2GYYA 3GNSA 5EIOA 1GQYA 1E6UA 1TT7A 3WYEA 1S7CA 2Y0DA 1E1KA 1R4NB 1HYHA 5KVCA 4LCEA 3WG9A 3KTDA 1IE3A 4Z0TA 1CRWG 4Y98A 4WKGA 3BTSA 2H5LA 1ISGA 3PRJA 8LDHA 5EINA 5JO0A 3A06A 3RU7A 4A27A 5BSEA 3DEYX 4Z3DA 4HX5A 3I4FA 4RVUA 1MV8A 1XGKA 2P9EA 3JQGB 2B0JA 2CNBA 4ZQHA 4YQZA 2B37A 2EXXA 4OXYA 3D4OA 1GCOA 4XQEA 2DFVA 3WICA 1HYEA 1M66A 5MDHA 3LZ6A 4WCFC 4CV1A 1B7GO 1M75A 3GUCA 4LN1A 3RJ5A 2JD0A 2WM3A 3QWAA 2Y1EA 4YAEA 2YY7A 1E3SA 4TVBA 4IUYA 1QORA 4J9UE 4PVDA 2NVWA 1TI7A 2DUUA 4Q3AA 1ADBA 1M6WA 3WGZA 4TRMA 5G0VA 2DU8A 4N7RA 2HMSA 4JXKA 2WEKA 2P91A 3VPXA 3VDRA 1HSOA 3B1FA 4F45A 5A3VA 5BNIA 5FF9A 2E49A 2UAGA 2Y1OA 3HB5X 4CM6A 3CMCO 1NVGA 5THKA 4YA6A 4B4VA 3INGA 3Q2KA 5DZSA 3TJRA 4B79A 3GRPA 3TOXA 1I2CA 1Z6ZA 1U7HA 4YPOA 2C0CA 4GKVA 1NVTA 2CDAA 3U9LA 2OMEA 3AWDA 4BOYA 3RBXA 2VN8A 3WFIA 3TL2A 1ZNQO 2B5VA 1W0CA 4JROA 2I5PO 3GEMA 1AXGA 3VH1A 3HB4X 4Z6KA 4UVHA 3Q11A 3SLKA 3GH3A 1MXHA 2WDZA 3NGXA 2ZKLA 2PGDA 3KSDO 4RVHA 1ZKMA 3WBBA 3GC6A 1PS0A 3CPSA 5DCYA 4CLOB 4YB8A 4NZ9A 1N5DA 2UYYA 4RPLA 5JMWA 4EEXA 4AJKA 4PG6A 1N9GA 2WWRA 1JU9A 4GWKA 1H9BA 1YGYA 1Y9AA 4YT5A 3DOCA 2X22A 2DLDA 1AUPA 3ANNA 4PIVA 1DIBA 5JY1A 2V6BA 1E7RA 1LLDA 3ZV3A 4YVFA 4YJGA 1H93A 4KQWA 2G1UA 2XAAA 3FNHA 2ZTUA 4CV2A 4YJFB 1JKIA 3WGGA 4IY1A 1QXSA 4BKRA 1P3DA 4KDFA 3PDJA 4HUJA 4RF5A 2Y0CA 4LK3A 4DC1A 4J1SA 4YJGB 5TQVA 1P33A 4Z0HO 2EW8A 4YBZA 3BTUA 2GO1A 2O3QA 4E5NA 3PFWO 3PYLA 1A5ZA 3ASVA 3ZWCA 1ISFA 5TJHA 3RD5A 2FPPA 2H9IA 3DFZA 1E3WA 4XIJA 2UVDA 4MP3A 5LCXA 4CLDA 4XEHA 1FJHA 1T2FA 3LC7O 4DVJA 2V6MA 2X5JO 3I4CA 4ITUA 1T25A 4J2HA 2DM6A 1NX6A 1UP7A 1Y5MA 3C7AA 1PJBA 2GNAA 1I24A 1ZMTA 3OHSX 4P8RA 3S2FA 4ROSA 4XJTA 2Q2WA 4CL3A 5GZ6A 3IJPA 2NQTA 2NVUA 2YFHA 4P4GA 4QECA 4ZRNA 1U4SA 3V2GA 2ZJ1A 5JXWA 4GL4A 3NYWA 2VNSA 1GYQA 3WWZA 3NDRA 1K6JA 2CDBA 3D3WB 5IFLA 3PJDA 1BXZA 4FSHA 1C14A 1B15A 3W8EA 4B7UA 4Z9FA 3LC1O 4WEOA 3EZLA 4HNGA 2VRBA 1E7WA 3GY0A 2IYOA 4BV8A 2JCXA 3E5RA 3ADPA 5ADHA 1SOVA 3NX4A 5TSDA 1YL5A 1U9JA 1GY8A 3GGGA 2BFAA 3GAZA 3FPCA 1P0FA 3OQ6A 2HMVA 4GBJA 5KVQA 2HMTA 1QYCA 4BUCA 3PIIA 4GH5A 4ALKA 1GV0A 3L9WA 3RFTA 5ILGA 3JQ9C 4LVUA 4AJHA 1LXCA 3EMKA 1E6EA 1KC3A 3U5TA 1HYGA 1WW8A 5CP8A 2Q49A 1XR3A 1P1IA 3ZU3A 3KZVA 2VRCD 3OQBA 4RJTA 3DXFA 4RLHA 1JAYA 2HU2A 4UUOA 4WUVA 5JYEA 2BMAA 3LT0A 3CE6A 3GDFA 3L07A 3RC2A 1EVZA 2JD1A 3O4RA 3GZNB 3PGJA 2ZB8A 3QSGA 3GN1A 1M2WA 4GI2A 5T57A 1X7HA 3OICA 4ZHSA 1BRMA 4WGGA 2ZCVA 1T2AA 2FPIA 2AQHA 1EFKA 1V3TA 3IKTA 5FYDA 1QYWA 4GSKA 1SB9A 1U5AA 1NQAO 3BMCA 4HFRA 4ZJUA 3QWIA 3R3JA 5KKAA 5JAIA 4II3A 4MVJE 5TNXA 4FFOA 1A9YA 5FI5A 4Z0PA 1MXFA 3KSUA 3KEQA 1RKXA 4MIYA 3F4LA 5CDUA 5LDGA 4ZD6A 4LRTB 1JKJA 5A9RA 1VL6A 2OL4A 3GFBA 2DBRA 3WFJA 3FTPA 2EKPA 1VKNA 1BXGB 4JQCA 4R68A 1LTHR 4ZA2A 1UXIA 4OIMA 4J0FA 5JPIA 3C7DB 3K30A 4E5MA 4JP2A 3H4VA 3GPDG 4OXNA 5KWEA 1VL8A 4OSOA 1BXGA 2PV7A 4ZRMA 3W6ZA 1PJ2A 4DQVA 4CLOA 3PXXA 5JCXA 4BS9A 4GMGA 2Q45A 4UREA 4XGNA 4J90A 2ZTMA 1VL0A 4JX8A 4WEQA 2YW9A 4XYLA 5AOVA 4IXWA 4EITA 1DEHA 2P2SA 4IDBA 3ULKA 3V8BA 3PQEA 1XHLA 4CM7A 1HL3A 1GQQA 1QV7A 4KWHA 2EEZA 1AN9A 4R1TA 3VH3A 4BO1A 1I0ZA 2QRJA 3E18A 4IM7A 1CQJA 5ES3A 1I32A 1ZUD1 2C29D 5TC4A 1Y8QB 4NI5A 3G3EA 4DREA 4TKMA 1D7OA 3AFNA 4IJWA 2VYNA 4XDZA 2W90A 3PZBA 3AI2A 3IKVA 3W4JA 4YTEA 3DBRB 5BQFA 3QWHA 4HADA 3WLEA 1U3VA 3QVSA 3WQSB 1E5QA 1GZ6A 4QUKA 5JLAA 1UH5A 4J1TA 5I7FA 2DBZA 4W82A 4RVSA 2NLOA 3C8MA 3BYZA 5C7LO 2G5CA 4WLUA 2YFQA 1V3UA 4E32A 1B3RA 2GN6A 1E3JA 2FOIA 3PLNA 3WSWA 4D3SA 2ZK7A 5TX7A 3ABIA 1DRWA 2WSBA 3F6YA 2RBEA 2CFCA 3KHUA 5TGDA 3FCOA 2FSVA 1GZ4A 5KJEA 3WDSA 1T2DA 4PG8A 2EF1A 1U7TA 3LYLA 4BO6A 1ZO8A 1DLJA 2W98A 1QRRA 2X0JA 2Y66A 3DTYA 2DVMA 2GGSA 3H9GA 4DMLA 4IDGA 1OFGA 1GADO 1EK6A 2CUKA 3QIVA 1V8BA 2YDYA 2VWGA 2Z1NA 2IE0A 1H6CA 3CEAA 4YDRA 1CERA 2WYUA 2I66A 1HE4A 1NP3A 1P31A 2FP4A 2NM0A 3HDHA 4MDHA 4QEDA 4DLAA 3MJSA 3WGYA 3D1LA 1NWCA 3I6QA 3LQFA 4MP8A 3LLVA 4QFCA 4UEJA 2IZZA 1DIHA 3HN7A 1A71A 3K96A 3RC7A 1UUFA 3UOGA 3L6DA 3RCBA 1Y1PA 4LW8A 2DC1A 4RZIA 4XQCA 3FWNA 1B8PA 5A9SA 5EN4A 4BNVA 1NFQA 1AGNA 5FWNA 4ZQFA 5L40A 2JKVA 3D5QA 4FOSA 1P77A 1W6UA 4JJIA 2IXAA 1ZH8A 8ADHA 3IC5A 4AICA 1KVUA 3UFXA 4H7PA 3ZCXA 2NNLD 4A2CA 4BNLA 1E3WB 4C7JA 4E2WA 4OGWA 2DUWA 4FD3A 4CODB 1EVJA 3EAGA 1KVQA 5GMOA 2GASA 4ILKA 1BXKA 1PL7A 1GEEA 4LVCA 5B4VA 4J9VA 1C0IA 4YJDA 3WLFA 3RWBA 1GZ3A 2DPGA 1GD1O 4CM9A 4YJHB 2VTEA 4DWVA 5EL0A 2WMDA 2CSUA 4YRDA 3WJ7A 3HDJA 3TOZA 2QX7A 4C4OA 3R0IA 2X1HA 1PJ3A 3NTRA 4D3FA 2X0NA 3NRCA 4NG5A 3GVCA 4CM9D 3KOUA 1D1TA 1ZK2A 3I9MA 2GF2A 3RUIA 4CM3A 3WBFA 4E3ZA 4X54A 5JDIC 3M1LA 4GLOA 4HV4A 5KIAA 2Q1UA 4CM4B 2ZYDA 4E13A 5CEFA 1YOVB 3OJFA 2JHFA 4GWGA 1LSSA 5TT1A 3VPFA 1LQTA 3WMXA 2GZ1A 3LLSA 2V7PA 3ON5A 3AM5A 4UEOA 1IY8A 3UUWA 4BB5A 2ZYAA 4N18A 5CPBA 3GNTA 1BDMA 4RPHA 1Z7BA 4XD2A 3PWKA 2POQX 2EIHA 2O4UX 4IXTA 3DHNA 1DDOA 3RQSA 4CJXA 3PVZA 5B1YA 1YB4A 1EQUA 3EVTA 4QSMA 2X9GA 1OC4A 4IINA 3C85A 1JLLA 4DIOA 1LX6A 3UKOA 3RUDA 2PZKA 3QY9A 2C5EA 1B26A 3GDOA 4E4YA 3AW9A 4JN6B 1PWXA 4WE3A 3M2TA 3V2UA 1YVEI 2J3JA 2VHZA 4PLFA 3CSDA 2D4AA 2AW5A 4E5KA 3CINA 1AHIA 3O9ZA 3TSCA 3IP3A 1ULUA 3Q1LA 2GN4A 5IG2A 4BO3A 2Q99A 1HT0A 4XKJA 3JQAB 5BSGA 2GN8A 1QYDA 4D46A 1HDYA 3EYWA 3BMNA 4PN3A 3LF1A 1P44A 1ZSYA 3FWZA 2DFDA 2YHUA 4RF3A 1DHRA 4OOEA 1ENZA 1YXMA 3OQ1A 4M87A 4BMVA 3MJTA 1VKOA 1TEHA 2HKIA 5JY6A 1ZBQA 1I3NA 4UEKA 3WGHA 5GZ1A 3U09A 3RASA 4NBRA 3H2SA 1EDZA 5EESA 1JAXA 1YQDA 1ULSA 4LMPA 5DBIA 1IPFA 2XOXA 3BMQA 4DLBA 4CLEA 4ZICA 1H2BA 5IN4A 1PJCA 4I9HA 1Q0LA 5HM8A 4K6FA 5G0UA 3DMTA 2FR8A 4IGFA 2YQ4A 3JSAA 4MIOA 2DQ4A 2IXBA 1NQTA 2D5AA 4IDFA 2Q3EA 1T1SA 1EVIA 2PK3A 2VOJA 2W2LD 3JQDA 4EI2A 5TLSA 3PIDA 1WP4A 2DBVO 5AXDA 3T4EA 3UH1A 2GLXA 2AA3A 3DDNA 1PZFA 1OMOA 3C1AA 2PGJA 2DT5A 3OJOA 3S1LA 4AVYA 1SZJG 2BGMA 4AJOA 5IXSA 1ID1A 1TT5A 4IDAA 2NWQA 3DAGA 1ISJA 4R41A 2B36A 4CM8A 3HQ4O 4MVJM 3QVOA 4OOFA 4TMFA 1MP0A 1PS8A 1T2CA 2RH8A 1P0CA 4BNWA 3VOSA 3ZN2A 4CUJA 5L53A 3LC2O 3AUAA 3A14A 4GVXA 4I9UA 4GVLA 3OJEA 4XYEA 3DOOA 1EBFA 2FPGA 3GVHA 5L3ZA 2W2KA 2HCTA 1B16A 3MCVA 2O2SA 1IZ0A 4G65A 2Z5LA 5A5EA 3FRJA 1UXHA 5TS3A 4OMUA 4NQZA 4PFJA 1BVUA 1GPDG 1PR9A 5TIIA 3VH2A 2W2KB 1N7HA 6ADHA 1O8CA 1A4UA 3PEFA 3BMOA 3E82A 3OBBA 4E2YA 1J5PA 1SAYA 1KVSA 3OMLA 2PZMA 1LC0A 3ZI0A 4YWJA 5I7SA 2WD7A 4G5HA 3DZFA 2O2YA 3QWFA 4NJOA 1XU9A 2ZCUA 4PG7A 2NVBA 3BMOB 2BGKA 2DTEA 4GX1A 2CF5A 2PD4A 3GVIA 1ZMOA 4XGIA 5DP2A 1N1GA 2DKNA 1LJ8A 4EBFA 4MP6A 3FF4A 4M86A 5T8KA 2SCUA 5F1KA 5I9MA 4W9NC 1CETA 5GY7A 4PRLA 4RQUA 4E6PA 1QMGA 3EW7A 3IL2A 4R01A 2CVQA 2VUUA 3KRTA 5C7IO 3JYOA 3WX0A 1DC5A 4CLRA 4OL9A 2FR1A 1ZXLA 3IAHA 3QHAA 2BLLA 3GFGA 2G17A 2P4HX 4DTIA 1L1FA 3VVBA 2VRCA 1YBMA 4PRKA 3CZMA 4EJMA 4AG3A 3EK2A 1IZ9A 1ENPA 1MB4A 1I30A 1E3EA 3AI1A 1PSDA 4NU6A 3GMSA 4ZQEA 3BIOA 5U4QA 3RC1A 3INTA 1RPNA 1L7DA 4WECA 5JMPA 3KO8A 2JJYA 4WCFA 4R5MA 4JK3A 5F1PA 3EC7A 3RKUA 4OM8A 5FI3A 1J6UA 1V0JA 3OJLA 5I9LA 1V35A 1R12A 5ITWA 1F0YA 1VE9A 1LEHA 3EHEA 1JA9A 3LU1A 4NMHA 1R66A 4UVEA 4WLVA 3MWEB 3VC7A 1K0UA 4EDFA 4UULA 3EVNA 2GDZA 3DB2A 1BG6A 1WZIA 4M89A 1H2HA 4CV3A 3NKLA 4WLFA 1ONOA 2G82A 3UF0A 3O8QA 1WDMA 1XIVA 3ZU5A 3VH4A 3ZH2A 1VI2A 3TPCA 1CJCA 3OA0A 1ADFA 3K31A 3U4HA 1E7SA 2NQ8A 1E1LA 3N7UA 1EFLA 4E5YA 1WNTA 1V6AA 3RUAA 1SC6A 2AEMA 3AU9A 3RUEA 4KMSA 2OBYA 2C5AA 3E5MA 4BQRA 2AG8A 4J7XA 2YDXA 1YB5A 3GOHA 2IZ0A 3BHJA 2VUTA 4ID9A 4BNYA 3KEOA 3NTOA 3WQQA 3WYBA 4YT2A 4HP8A 2JCYA 4U8GA 2FMUA 4CMIA 1PL8A 4NHEA 1WDLA 4CM5A 3ETDA 1XA0A 3GEDA 4XYBA 1K3TA 1DHTA 4PCVA 4R4JA 1X7DA 1SPXA 2DTDA 4YJHA 2I99A 4M54A 2JL1A 2GSDA 4M55A 3NEPX 5L7YA 1LDNA 1SBYA 3DR3A 1G1AA 1GTMA 2BELA 2JAHA 2PFGA 4A7PA 3Q0EA 4O6VA 2RIRA 3L4BA 2B4RO 3DMTC 3HZZA 1ISIA 4WCDA 4CM1A 5AXBA 1MX3A 1XLTA 3GF4A 2XXBA 5JYDA 3A4VA 3F46A 3WGTA 2Q4EA 3NDIA 4JLWA 4IIUA 2W4QA 2A9FA 3KLMX 3WYCA 1NFRA 1E1MA 3U3XA 3JQ6A 1TB4A 1Y5RA 4NNJA 1KS9A 4W9NA 2ZB3A 2P5YA 3OM9A 3W8FA 2AQ8A 3KYBA 4U0KA 1R0LA 3HJAA 2J5QA 2AQKA 3H5NA 3ZU2A 4O0LA 1RJWA 1YS4A 3JD4A 3TZ6A 1I3MA 4NU5A 4TVOA 2F1KA 4L8VA 3OSUA 1HLPA 3JQ7B 4N5NA 5B4UA 4PLYA 4E31A 1K89A 3I3OA 1PZHA 3TZKA 1HDXA 4JP3A 4IJUA 4WLEA 2YV3A 3JTMA 2B5WA 2RAFA 5LDHA 2BRUA 1NFFA 4PZEA 4J3FA 1X0VA 1FDTA 4Q3EA 3WNQA 3I9OA 5IN5A 3WIEA 5K6AC 5C37A 5A4DA 3CKYA 4Q3DA 2B35A 2YHIA 3ZWVA 4R1SA 2NVUB 2J8ZA 4DPLA 1TLTA 3JYPA 3G17A 4CM8B 2VT3A 5IDWA 1T2EA 2DBQA 3GRKA 2VT2A 1U2DA 3GG9A 1NVMB 2NADA 1HSZA 2EERA 1LDEA 2IYPA 1C1XA 4JBGA 4Z9XA 2GUGA 3GHHA 3B20A 3BZUA 1GQ2A 2PD3A 1A27A 3ZWOA 1U5CA 4FPXA 4F3YA 1JKFA 4B8WA 5IXYA 4M8SA 1W73A 1HTBA 2E6UX 1C1XB 4NBTA 4OQYA 4P4LA 4XB1A 3AY3A 3K9QO 2HRBA 5BSFA 1WVGA 4IZHA 4JNKA 1UAYA 2Q2VA 5H83A 2Y99A 4TRNA 1PL6A 3D3EA 3BHMA 3FNEA 4B7XA 2IDZA 3HHPA 4CMCA 3RU9A 2VZ8A 4EUHA 5I8ZA 1NPYA 4IMRA 1KYQA 1BMDA 4QFDA 5DNAA 3OH8A 4NJMB 4PLHA 3W4IA 4Y67A 4BO4A 1Y6JA 1KC1A 1VJTA 5A3JA 3L4SO 3GK3A 1EVYA 4CLXA 3Q9NA 3LT2A 1LNQA 4MVJP 3A9WA 1Q1NA 1U28A 1HZJA 4BO9A 3PP8A 2O7SA 3QWBA 2NTNA 4FJ0A 4B3HA 5G4KB 4XDYA 3FBGA 4TRJA 4G81A 2BFPA 4YAGA 1NYTA 1P1JA 1P74A 2NTJA 1GU7A 3GG2A 1UXKA 3WMWA 5HRUA 4L4SA 5HWSA 2ET6A 3ZV4A 3L77A 1HZZA 3UAGA 1JW9B 1UP4A 4N5LA 3NAQA 1OAAA 4MJLA 2CZCA 5L9AA 5DDIP 3G1TA 3TF5A 3JQ9A 1FK8A 1WXDA 4M1QA 2HDHA 5AQ1A 2X0IA 2OGUA 3HNPA 3QJ5A 1U3WA 2QQ5A 1LRJA 5CDYA 1EQ2A 1PR3A 5KJ1A 1Z82A 3PYXA 5A9TA 3S55A 4A73A 2WTBA 4L76A 3ROPA 3MOIA 4WJZA 4GQAA 7ADHA 1QYXA 3WNVA 4OO3A 2Y05A 4IQ0A 1QKIA 4R9RA 1NM5A 3DTTA 1LSJA 2WYWA 4MVJH 1TXGA 1IHXA 4UVGA 2GD1O 5KKCA 2J6IA 4OXKA 4CMEC 1XWFA 2NACA 1DBVO 1VSVA 3IMFA 3L6EA 2VYND 1P1HA 9LDBA 4MVJD 4AFNA 1P9LA 1E5LA 2I6TA 2PNFA 4BNZA 4YAKA 1WWKA 2C82A 1Z7EA 3OIFA 3HDYA 1IPEA 1PJSA 1G6KA 5A04A 4DUPA 1ZEMA 2IZ1A 2O3TA 1I10A 1BGVA 1S6YA 2FZWA 3GGPA 3ITKA 3MJVA 3NV9A 4JBIA 3V2HA 4QXMA 3E6AA 1NPDA 1CQIA 1YBVA 3PQFA 5CAEA 4J4HA 2O3JA 3A1NA 3FPLA 1ARZA 3LSYA 1DC4A 4IIVA 4RV9A 4W7HA 2YYYA 4XR4A 4YT4A 1F06A 3KYDB 2ZQZA 1F14A 2EHDA 3ZWAA 5CEJA 4RORA 1VM6A 2UDPA 1IULA 4Q3BA 3H7AA 3GPIA 1FMCA 1HE2A 4S3MA 3ZGYA 1ZXBA 4J49A 5T5QA 2ZJ0A 4AJ1A 2C2YA 2UUOA 4DMMA 3G49A 3DBLA 4NK5A 4DYDA 4UUNA 2UV8A 3ZNPA 2HLPA 4I9NA 3JQBA 3GQVA 1DRVA 3MZ0A 5THQA 3TN7A 4B4WA 2JD2A 4MVJF 2HO5A 2PZJA 1A72A 1OZAA 3EUWA 1HDZA 2NU7A 4GKBA 4J7CA 4K6CA 4W7IA 1MFPA 4CV0A 3H6KA 3VZSA 2O4CA 4D0RA 3Q9UA 2ILTA 4BNIA 2ZB4A 2VYVA 1ONNA 4QT0A 1K2WA 2DTXA 4DA9A 5JDCA 2X8LA 3VAZA 3V1YA 3CTMA 5KJ6A 3IS3A 4GAEA 1GEGA 4ONEA 2OO5A 3DOJA 2B4TO 3M6IA 2CVOA 1ZVMA 1I33A 1VPDA 3IDSA 4KDEA 1BDBA 3H8VA 3NDJA 1NR1A 2PD6A 4FJ2A 3GGOA 4R16A 3COSA 4D7AA 3BA1A 1B0AA 4YAIA 1GUYA 3P2OA 1V3VA 2B4QA 3GVXA 3V1UA 1LSOA 4RGBA 1A4IA 5G2OA 2E48A 4H3VA 1NAIA 1UXGA 2O3RA 2NUAA 1XSEA 5U9CA 2X7HA 4EGFA 5LC1A 4E12A 3FD8A 1M6HA 1N9GB 3JQFC 4PLWA 3FNGA 2NV6A 2VHVA 3JQ8B
chains in the Genus database with same CATH superfamily
2VAMA 4W1QA 3UJDA 4RLQA 1E9AA 2W8ZA 3OFND 5C8VA 2C7PA 1OB2A 1P45A 2R4TA 4IZOA 3OZEA 1HOTA 3ML1A 3KZCA 1KZYC 1ZIXA 4N9QA 1U8FO 4OJKA 4GPZA 1WUIS 3NO4A 4KQ1A 2PAAA 4ZAGA 4AC9A 1B3BA 3CLRD 3O1LA 4AF8A 4C7BA 2VXYA 3Q3IA 3PXUA 2R2AA 3KYCA 3MLEA 1TJ5A 2B5OA 2AXEA 2YMMA 1SD2A 3OEWA 7REQB 3DEIA 2ZE5A 4IGKA 4MUAA 4GPIB 3UFBA 3ZWNA 1BS1A 3GJ3A 3T7CA 3B36A 1WKCA 3PXAA 1V48A 3ZHYA 1Z5GA 5H68A 5TJ9A 3VR2A 3JQCA 4YAJA 1A7UA 2LV8A 3CVYA 4KSCA 4B0OA 3JYLA 2CYAA 3LGSA 3I37X 1RZRD 4IDCA 2AJBA 2YXEA 3OZSA 4TQGA 3QKUA 3GP5A 4G8JA 5FXMA 1MQ9A 4B4OA 1KEKA 1Z6TA 3O73A 4S04A 4C0XA 1RS0A 5JI3E 1VE1A 3GAFA 1PGQA 2HHLA 1KY2A 3FI9A 1L8QA 3KR2A 5F12A 4EABA 4KP7A 1NJ6A 1VJ0A 3AM4A 1V11A 4IQ4A 2WWGA 1UBOS 1A9OA 1JALA 1JVNA 3O2NA 3RHSA 5CB6A 3U6KA 4K26A 1K4KA 3QRWA 4EJ6A 1FDSA 2DJ5A 2BGIA 5F4BA 5AVWA 1SIBE 1NRIA 4KJZA 4DABA 3STHA 2FEKA 1J0DA 3F49S 5JNLA 1DC3A 2P9FA 3LXUX 3RFVA 1PZXA 2O8BA 3IAM6 3K0CC 3RFXA 3OOHA 4YYEA 2IODA 4WD3A 5T4FA 4ZI2A 5I51A 1ZJZA 1FP4A 5HBGA 2VK4A 3BHNA 1EDDA 4IIDA 4DIKA 1U1IA 3A2MA 2YFYA 1L4EA 3JS5A 4BRUA 3FOZA 1JFRA 1RZUA 3DCNA 3ZWQA 1D6MA 4TV9A 1DT3A 1LLUA 3PUWA 4JB2A 1RHKA 1JDZA 1X86B 3JRWA 5D6OA 1JFTA 3ZZ1A 1WP9A 1LNZA 1QIIA 1XDUA 4JGBA 1NU6A 5IU6A 1L5WA 4YCMA 1FZQA 2I3AA 4UHDA 1QB8A 4FIZA 2AE2A 3M49A 3Q6IA 3PHIA 3KM0A 3PKIA 1XRPA 5A3QA 1HO3A 3VZCA 4G67A 1XOIA 4R9NA 3ZOZA 5LOVF 5C80A 2W6CX 1Z4QA 1T8WA 1WQ4A 2J3IA 3C24A 3DBIA 3THXA 3KS9A 1UFQA 4I9GA 3E35A 1QBGA 1X1AA 4M88A 2WIKA 1FMLA 4XI9A 1WMDA 3GCDA 3SZLA 4CYMA 1O0BA 2Z5VA 1SQGA 1O97C 1X3LA 2OVBA 2AUMA 4MLCA 5AVOA 2FRDA 2BCGY 4QDJA 3WKAA 4INPA 2O7NA 2X5KO 3NHBA 2CNNA 3I6BA 4V3BA 5KNBD 1YQ9A 1QDUA 1VRWA 1EFDN 1XCLA 2HOQA 3HYSA 1RLMA 2V0CA 3ABZA 3NEYA 4Y2XA 3SK0A 1DFGA 1MHTA 3ZDRA 3RABA 4P7KA 4QELA 3I34X 5BQPA 3O4FA 5IJ9A 2VPXA 3H2IA 4NPCA 4RUKA 1WQ1R 2HFJA 4Q47A 5K8CA 4O4IA 1XL1A 1T6BY 3K8ZA 3ZBUA 1MH9A 3U4DA 2REXB 3PT9A 3KZMA 4D02A 3CZ9A 5T6BA 1U7OA 1RLIA 1XQVA 3WBKA 2H52A 1ZXXA 1VYHA 1GV1A 2PUVA 4PZYA 3AGPA 4Q7EA 3R23A 4FCCA 4BRWA 1JE0A 1OZHA 3KLPX 1D1SA 1LPOA 4UBMA 5E8RA 4EHLA 4WZAE 1Y7LA 3H4IA 1CPYA 2TMDA 1RVDA 5TEVA 1MEOA 3CUSA 5EE1A 3S1AB 3WNDA 2WIDA 3I0ZA 3G6KA 1FFDA 1VIYA 4YH1A 3JQGA 2C4UA 4HFNA 4RVFA 4FZ3A 3VGPA 5KWVA 2IH2A 1KE1A 1G5TA 2FDXA 3CX4A 5T67A 2OSBA 3BZBA 1P0PA 1CYDA 2LRHA 2WILA 1FDWA 2IWHA 4M83A 4TZ6A 3K9HA 3F3MA 1R16A 4MEJA 1T8RA 1ZITA 2GF0A 2JGAA 1F3LA 4RF4A 1LW7A 1LPMA 4RAQA 2O5VA 1SCJA 4UZSA 4RPKA 4F9GA 4HUTA 3KYCB 4JR1A 1EWVA 4IQFA 1NHWA 3LCUA 2PKQO 1XJ0A 2RAPA 4HOYA 2DQYA 3DSRA 4X3CA 1IG3A 4CQMD 3P7MA 2EP5A 4E4TA 5IJ0A 4RDHA 4R05A 3DDOA 1F7UA 5KNCA 1J49A 2ZAYA 3ZNNA 4WKOA 1JFVA 3FCCA 3D02A 4HH4A 3DLBA 2VIIA 2XUIA 2HNAA 4D8XA 5K0LA 1AKWA 1T2VA 4OK6A 3RO7A 1QIMA 5ECDA 2Q0SA 2XNDA 1Y6ZA 1XE3A 2VJQA 4JEHA 1OASA 2WNHA 3G5LA 1WPQA 3LXXA 4QRDA 2KPOA 5DNUA 4X64B 5K8IA 4Y9UA 1GFSA 3L1VA 3RRXA 1OUMA 2X58A 2XMCA 3DTVB 5K1ZA 5CCDA 3WNZA 5LM3A 4L6AA 3IRVA 3NVDA 4UPDA 2B2XA 4HWKA 3EMDA 1U0OC 2AR9A 5H70A 1WUKS 2HWWA 2BFDB 2QD4A 3GXOA 2QG4A 4PGFA 3PPWA 4RZ2A 4W1RA 3H3FA 4XDHA 4F46A 3WZMA 3PUXA 4L73A 2G0TA 3DCIA 1U3DA 2BCEA 4PANA 1QYVA 2ZS8A 3OAAA 4FYWA 5FP0A 2WYHA 3L7IA 5GGYA 1E79A 2P6RA 3FM9A 4RIIA 1XG5A 2CD7A 3L7BA 1FFCA 3WV5A 4DLVA 4HEA1 3CV3A 4NRDA 4RH1A 4D9KA 1G5FA 3LHKA 1Q0HA 2C7GA 3HVIA 1QZXA 5DH9A 3VI3B 5AHOA 1FC0A 4DR5B 4A0RA 3JPYA 4HX2A 1I9GA 2EKLA 4HSEA 3VR3D 3T15A 5BVHA 1NF3A 5C1BA 1FQJA 1PK7A 4YQFA 1TT5B 3EG9A 4QL3A 2I2XB 4AJNA 3I6ZA 1RM5A 2PX8A 1TCBA 4WVLA 3B1XA 4F4UA 1OXXK 2HPZA 1DZ3A 2CY0A 1XUOA 4W6ZA 2VDRB 3I5MA 1SULA 1YDWA 1KWGA 1BU8A 3EXEB 1AKNA 2PL5A 3D4IA 1YR2A 4D8YA 1O5IA 1ZK0A 3M4YA 4D56A 3PNYA 2OAP1 3V7YA 1SBNE 3I83A 2OOKA 2PXAA 2E7ZA 4AJ9A 1Z0DA 5B2ZA 2PH1A 1FUEA 4YYZA 1XTKA 1TZKA 4E1AA 2DPMA 3ZXIA 3U7JA 3AIOA 2XMPA 2CDNA 2NYRA 4M7RA 2OB1A 2HXYA 2OUKA 5A5VA 4LJ9A 5BNZA 4TRRA 1JDVA 2OYSA 2X15A 4CLHA 4W8GA 2J9RA 1R9MA 5F21A 1U5BA 2VDQB 1IQRA 3HBNA 3JASB 1SZPA 2A84A 3WTCA 3ROMA 4EK9A 1NNUA 4H0CA 4TOIA 3LW7A 4KNYA 5DEIA 3RLIA 3HSYA 3TO5A 1IXKA 4Q9AA 2LTAA 4HNRA 1VJ1A 4CMBA 4NZPA 5I8WA 3BORA 2G40A 1H6AA 2OXTA 5EJ9A 4PLPA 4PNZA 4R84A 5IJ9B 4B3RB 4DR2B 4P34A 2NUPB 1Q7TA 1R9JA 2PKQP 3L1JA 4PLCA 1XDZA 3V1MA 2RI6A 1I2DA 4P2GA 5COAA 4Q93A 3OCXA 5H9VA 1G3QA 2EGHA 4I55B 4RY2A 1NW6A 2QTZA 5HILA 2GZ2A 1Q6ZA 3T0IA 5IANA 5FA6A 4EUFA 3V1KA 1QYRA 2E1PA 3W6UA 4PXSA 3E53A 4MH0R 3FIJA 4CIBA 2Q3HA 2QE6A 4LOHA 4X20A 1E2LA 3IUQA 2RGDA 4QBKA 3ZZMA 4DMHA 7GPBA 1D9ZA 1MAHA 1T9AA 3LNCA 2R86A 4HQKA 2K87A 3ZJ4A 4FWIB 2VH2A 5HK8A 2VF7A 3UJ7A 1EFVA 4TQ9A 1IUKA 4OXXA 3RFCA 1ICEA 3SAJA 3DL7A 2R1VA 2GN2A 2YXBA 4C4PA 5AVZA 1DBQA 4GW3A 4C88A 4YJ3A 5EHGA 1RIFA 5IC5A 4A0HA 4BP9A 1SKYE 3KSAC 4WY5A 1OH6A 3ZWYA 3QVUA 4BU1A 1KY3A 4BGUA 1UBFA 3GH1A 5CVVA 5AKLA 4KG7A 3GPCA 1OBHA 4MLDA 1RJ9A 2JC3A 4X6YA 4CKEA 1DWQA 2G6BA 4MWOA 4GUAA 1NAHA 4L16A 1TQ8A 4LHSA 5CH8A 2AN9A 2ERCA 2I3GA 4YRPA 4AJPA 2X5XA 2VATA 4HVLA 3AUFA 3DOUA 3QXHA 2W8BA 2X0KA 3L93A 5KYGA 4JI7B 2BGGA 4C2TA 2AYYA 1G5IA 1MFZA 5JFGA 3QFHA 2EZTA 2Q1XA 3GW8A 1DP4A 1ZH0A 1PZGA 3GEGA 1PTKA 4LJ4A 3M83A 2OHVA 2XRYA 3SLGA 4BLQA 4AQDA 3AK4A 1WX1A 1T5LA 1AU9A 2EDCA 3IOEA 1PJRA 3KDSE 2LP4Y 3QE4A 4HDAA 2FGKA 3ELYA 1E62A 4QLAA 1H1DA 2Y1CA 1UC9A 1YB1A 2V7VA 1SOMA 2VLBA 2DKFA 1RJGA 3P9YA 5B58C 3U81A 3AR9A 4J4TA 4DY6A 2D62A 3HU5A 3B60A 1K98A 4IV0A 1EZ1A 1USGA 1G5RA 1NVAA 4IS2A 2NSJA 1BWPA 1LRKA 4CF3A 3QEMA 4K9RA 4E88A 3IHKA 4QHTA 3RK0A 1EINA 1CD5A 3SZOA 1B73A 3M7IA 5DM1A 3HEMA 4Y6PA 4WLNA 2Q5HA 4RPJA 4MRRA 1ABBA 1CVRA 5B3JA 2FVXA 2NV0A 3N0TA 4G1CA 4JB8A 5IVPA 4D9CA 5I6DA 3PE6A 2ZE8A 4GE0A 2J67A 3GMDA 3AHHA 3FZEA 4REMA 1XCGB 2ZJ8A 5FIUA 4CMKA 4H7FA 5IRCD 2GSWA 4FK8A 1ATZA 1Z39A 3E23A 3FSGD 3KHSA 3M3HA 3AM3A 2WZQA 2R751 2VYVD 4MICA 2WIJA 4N65A 5L3SB 4XCVA 3K16A 1YVUA 3SBEA 4EZIA 2GT1A 4TMYA 2GTIA 2QTRA 3D5TA 3EXHC 3RUHA 3WDKA 3BAZA 1Z75A 3HUUA 4B3JA 2QYHA 4HN9A 1EI9A 4REQA 1RWPA 3O93A 3EGWA 4JENA 1KQ3A 2R4QA 2PA3A 2Y71A 3OEYA 3B7GA 4FCWA 3R7NA 2P6NA 4F6CA 4KACA 4L5CA 1DAKA 4LJLA 1RAGA 1W52X 3F1LA 4IJMA 5JEDA 2HW8A 1TKRA 1YJ8A 1SVNA 4CPDA 1SC1A 2EP8A 1MQSA 5HKOA 1IJBA 2XB6A 3AB8A 4EPYA 1P1KA 3G2IA 1L3BA 3PRKE 4RD6A 5AVKA 2Y92A 5AW6A 2GXUA 4PAQA 1CZUA 1P39A 1DAPA 1W36B 3COWA 4GF5A 4MUIA 1NOKA 2VVTA 3HR8A 2BMVA 1P9WA 5LYJF 2GPJA 4PXAA 1AUQA 3LK7A 4YCNA 4DJFC 3B5EA 5JXJA 3FTFA 2GEBA 4GLLA 2BMDA 1BE0A 5CB0A 5AVVA 2EX1A 3PRHA 3U26A 2E5LB 3STTA 1BA2A 3SQNA 4B43A 4FMDF 3EDRA 5AJVB 2YJZA 1U65A 2CBGA 1ZK1A 2OOSA 2AW3A 2YRFA 1IY9A 2RGNC 3FVWA 4H7JA 5HQ3A 5D3QA 1RABA 1KZ9A 5AESA 3SHOA 3H1PA 4M0KA 4QXOA 1N7GA 2WZBA 3LPNA 2QN8A 4GC5A 3DLIA 1IYZA 4QYWA 3JWGA 2ZYIA 2VNHA 3EGXB 3MJ4A 3U48A 5JV5A 1KQFA 1NUUA 2DFLA 1XNJA 4DEVA 1B6RA 3QOFA 3IEXA 2EZ9A 2OD9A 3LQRA 3DFKA 4HAUA 3KHTA 3ITNA 1A04A 2F62A 2ZJBA 3V55A 1DJQA 3A6FA 3L8ZA 4ZGBA 2JIDA 2ST1A 1NONA 3HFRA 3KZ1E 5JC1A 2H06A 1RI5A 2QXUA 3W34A 2ZU0C 2DB3A 3M4JA 3GNLA 2AQIA 3BRWD 1O0CA 3UC9A 3F3KA 2ZUDA 2FQQA 3DC2A 3ISVA 3FOAA 3WE7A 2ES4A 4AL4A 4DZTA 4QM6A 5IJAA 10MHA 3UGKA 2BUCA 2I8LA 3LHDA 4YS6A 3DBVO 1FX0B 1I36A 4MO2A 5FEMA 5J9FA 4K6MA 3KUXA 1S2LA 4XTCS 4JLMA 1XZGA 2E37A 2UXBB 5MHTA 1ZUHA 4I1PA 4QULA 4CXMA 1AE1A 4X6UA 2E87A 3NRBA 3CUEF 3DD5A 1I01A 4OJYA 4Q4AA 5FWYB 1ZN9A 2DUMA 3C1OA 4IPTA 3TDMA 3PI7A 3OU6A 5KTSA 5DN9A 2XVXA 5IW8A 4KGVA 1KBQA 3V1LA 1EUDA 4QX6A 1HWYA 4INOA 2FU5C 3RS9A 1W1IA 1QGOA 2EJCA 4C5CA 5JXGA 4R7ZA 1VP9A 3P71T 1PK9A 3RKRA 1TYBE 3SQOA 3ORQA 3CF0A 4NDAA 1KDYA 1XVVA 2HTEA 3ZYZA 1AUVA 1MC8A 1Q44A 3LHFA 4UARA 3UOWA 2C57A 2QYSA 1PV2A 1CFJA 3AJ9A 2J3EA 4AZVA 3I9LA 4A8JB 1TFUA 3QLUC 1VJ5A 3P0FA 1SD1A 5ELLA 5K3EA 4K6OA 3DVRX 2WJ4A 2YY5A 5E3HA 2B69A 1EP2B 2C2KA 4TTSA 3DFIA 4DG5A 1M3SA 3AUSA 2AOVA 3H1FA 4G26A 1H5QA 5FORA 3WIDA 4A2QA 3OLQA 2A7XA 4ARSA 4FMPA 1JHZA 3LUAA 3LXMA 2JCVA 1RCUA 5I9IA 3GJ0A 1SM4A 4MMZB 2MMCA 4U3JA 1S3IA 1NYQA 3ANSA 1ST2A 3P2KA 4TKUB 5HHTA 3W04A 4C6HA 3ZWMA 1GCUA 3A6EA 3G0BA 3KTAA 1QO0A 5KU7A 3ADCA 3LCVB 4WNAB 3UG6A 3FH0A 3V34A 4AB1A 2PSFA 4E5DA 6PFKA 4Z9BA 3T9BA 2PRKA 2B9VA 1IZYA 1YCGA 3D1JA 4WN9A 4JBXA 3M0EA 5K2MA 4MINA 1F48A 5JD3A 1ZNZA 2BKXA 1XO1A 4QGSA 1WY5A 1SCUB 1VE3A 2OBXA 2XLCA 3BK1A 2V6GA 3L2OB 2A9OA 4GGOA 4GYKA 3ZWXA 3ZCPA 1LLQA 4F8EA 1XNQB 5CG2A 1Q50A 1B0ZA 1XZCA 3AFMA 3BD9A 2W6MA 4K0RA 5A1TA 2Q1WA 1JILA 5E4YA 2PHZA 1YA4A 4BKOA 1KNXA 2P3OA 3I5XA 1NTOA 3F5FA 3UAVA 2P0EA 4ACBA 2YWDA 5GINE 3H4MA 2BT4A 3O03A 3ONNA 4G5SA 3JWHA 4OJTA 4R2MA 1JUDA 5DSXA 1C2TA 2R60A 1NIPA 1EDOA 3UAXA 3UN1A 4ARUA 1JDJA 1NIJA 2ZRPA 1MC4A 5G4LA 5IUKC 3AOEA 2X0FA 1N0UA 5JSFA 3SVLA 3RU3A 3B2EA 2XNCA 1EP3B 4IQ8A 2X3YA 3G0IA 4OSPA 1BOOA 5LLSA 2B3DA 2OG1A 1I4EB 1HK7A 4WCFB 3MTJA 1BKSB 4EJFA 4CL2A 3VBEA 1KAEA 1SQ6A 2RHTA 2W5UA 2MIIA 1U31A 4F12A 3QVWA 2GPBA 3EF3A 4PWZA 1P5RA 3AVTA 2QPLA 1DIGA 1M5UA 4OHCA 3GDWA 1DQYA 2OB2A 2CXPA 2XPCA 4QHSA 5ECGC 1KRWA 3N76A 1BXRB 4ZN6A 4KQIA 1PZNA 1YH3A 4IJ6A 1L6IA 1U8XX 1YBAA 4KQCA 4Z9AA 2VPTA 1G8MA 3IMGA 5HX7A 1KJQA 3JTEA 4GOMD 3RUFA 4EPXA 3OKPA 2EJVA 2O2XA 3WJ1A 1XZFA 5HJ5A 5AYVA 2KM1A 5HVNA 1TCUA 3REGA 2Y1WA 4RANA 2ZUSA 4WXRA 5DTIA 2D5BA 1DIAA 3SBXA 4F8YA 4Q3CA 2RGRA 1DTEA 4NFHA 4F60A 2H2FA 2Z5GA 4BGEA 4D43A 1L5NA 1L5KA 1JG7A 4WXHA 3IQZA 3HB0A 1RAFA 2H3HA 5L4NA 1GAWA 4WKCA 1G0NA 1Z0FA 2CGEA 2EG9A 1SIOA 1FDUA 3A2LA 4UHHA 3HRHA 1HFJA 1T0BA 3WZ2A 4YPFA 5AHXA 2QL9A 4MUKA 4C29A 2GEVA 2GPNA 1V1JA 2REQB 2BBOA 4IWXA 1V5EA 1U3TA 1SURA 2ZG6A 3LO5A 4JUDX 3PEYA 1CEEA 3MLAA 1GNTA 4CGZA 3NBUA 2JEOA 1A4RA 2JJ1A 2PPVA 2XTJA 3L6UA 4JZYA 1NSYA 1D0IA 3AIMA 1PS9A 5C5IA 2BEJA 2HJRA 3IVAA 1WCIB 4FGWA 3VAYA 3W5UA 4HCJA 4KUHA 1I7NA 3LD9A 1MH1A 4YRLA 4E6EA 2CCJA 4MULA 4RULA 3WGVA 2RJ3A 1NYLA 4Y2JA 2FN8A 4GGMX 5IT4A 3URKA 2V74B 5C4GB 1MB3A 2IHKA 3TBKA 3O8BA 2D1RA 3OAAD 2XJ4A 5ARCA 2OP0A 3FZNA 5JROA 1K0FA 1EWKA 1D2MA 1JSZA 1PJ8A 5DNVA 5ITZB 5IAGA 1QFMA 2DR2A 4EUEA 4UU0A 5IUNC 3K3PA 4U3JB 2KI5A 1PIWA 2VYCA 2GN0A 2A86A 4JI8B 1M6VB 3F47A 1V96A 4N0MA 4JU8A 1DDIA 3B78A 1GIAA 3CZAA 3NMUF 1CEYA 5A71A 4EFLA 2X4IA 2JKZA 2QX6A 1XP8A 2IXGA 1KJNA 1K88A 1NMEA 3NHLA 1Z22A 4EYOA 1BROA 1NR7A 3NHJA 4DL9A 4IV5A 1FJGB 5AW2A 1MDBA 1LW6E 3EAFA 2AS0A 4B85A 5A2QA 4BWVA 4L85A 1VIDA 1QSGA 3DVSX 5M3BA 1Y4AE 1KOGA 4CMGA 2QT1A 3KXLA 2OZLA 3M1YA 1BWSA 5ALTA 4Y3UA 3AF4A 1A7JA 1B6TA 1GFZA 1Z2CA 4KXUA 3D6UA 2IDKA 4Q6BA 1CF2O 2EJBA 1K7YA 5GV8A 3LIPA 3HABA 3TIXB 2OY0A 1Q92A 2Z1MA 3OQOA 3WLPA 1Z34A 3FB1A 4TMWA 3QA9A 1WV1A 2OHIA 4KN6A 3TUJC 3V9AA 3ZYCA 5K6RA 1J56A 1Q3KA 5ER9A 4LBVA 1J2TA 1XZEA 1XZNA 4Q4LA 1VKZA 1JEEA 2GCGA 2JFOA 3L8MA 4LXHA 2X0DA 5JDIA 3CZ4A 1GRNA 1JJAA 3R6DA 2ODEA 3VZDA 4PHCA 4D45A 4EZBA 4RCVA 4IOMA 1GA1A 4JOQA 4IBOA 4KXVA 2JLSA 2VHXA 3ICPA 1NDQA 4GRAA 3V6LA 1SA0A 4ZDWA 3TR0A 5J40A 4RVNA 3ECAA 1QZZA 5H1YA 2QZZA 3A36A 3QOXA 5AUQA 4W99A 5IKOA 2OCXA 5CBKA 5LQUA 2MMGA 2IDMA 2GM4A 3KZOA 1IU9A 2F1HA 3QW4B 3HBAA 4Q4HB 3OM8A 2GFHA 4MGHA 5EVJA 3GEIA 3ZVMA 3GWZA 1NOJA 1XX6A 2X5OA 3GJRA 4B6SA 1AMUA 2LPMA 1AK1A 3RTBA 3PFGA 1KOJA 3MTGA 2QLTA 3KB6A 4ZDJA 1WPGA 1GPYA 4CTJA 4ZK2A 1K9SA 2BTEA 3A3YA 4K9MA 3SJAA 4CIDA 1NASA 2WE8A 1GUFA 1EA7A 4UAGA 4Y9RA 4R51A 1XNRB 3V00A 3SFTA 2CZQA 3ESRA 1MB9A 5DBFA 4DCUA 2GZ3A 1Y1KE 2EV9A 3FGOA 3WQRA 3FNRA 3U31A 1E3MA 3FIUA 9ABPA 5TQ0A 4ETWA 5SY6A 1A7AA 2BFFA 3S81A 2WZDA 1QS0B 5J2TF 1Z0UA 2G25A 1V41E 1Y8RB 5EQTA 2VDWB 3WXBA 4C0LA 5KNDD 1CXZA 1HF3A 4B3GA 2RHRA 3CW9A 3R9XA 3N86A 4LSMA 4P4NA 4RE6A 1XRJA 2JPDA 4G63A 2C4TA 5SYMA 3RSGA 4FFBB 2O59A 3SE7A 1VHLA 3F3YA 1A9QA 3H5AA 2VHYA 2DQZA 2P62A 3LCRA 3OZBA 4PR3A 5BSKA 5DHPA 5FUMA 4EX6A 1CULC 2CVHA 1JQ3A 5AKEA 2HCBA 4LHXA 3WIUA 1N34B 4Z7QB 2AF3C 4GNRA 2AYXA 3BHIA 4AS1A 4J1QA 5JAHA 1KSFX 4FT4A 4HYQA 2P2CA 1Y3BE 1Q22A 1NW8A 1T5BA 2JAWA 2VWPA 4F5WA 1ZI9A 1E5TA 3T3IA 3VO1A 3WJAA 1ABFA 5TQ2B 1GNVA 4D6YA 4EJSA 1QBKC 1V1RA 2XTAA 3DBRA 4ER3A 1GYPA 5I7WA 1BW9B 2BGJA 3W5AA 1XRSB 1KYZA 2MINA 2O1XA 3LFTA 2BFBB 2G71A 1HDEA 1R4ZA 1Y42X 1CHDA 3BG5A 4LV8B 1KAGA 4RTPA 2QORA 4LJSA 4O3MA 1D5CA 1T5DX 1PV1A 4BYMA 1UC5B 4CNBA 1H0RA 4RTQA 3HY4A 4AKTA 3V32A 2PH5A 4IIGA 1QQ6A 4X93A 5KNBH 3MT9A 2H4HA 4GMKA 5I4BA 1F8XA 5JQGB 4CL8A 5CJPA 4EA9A 1M8GA 1Q12A 5T64A 4AY5A 1Q14A 5GGXA 2IGTA 5I7EA 1DDGA 5BYAA 4J0KA 4LDNA 3KQHA 2GCOA 3W9BA 3GLQA 1FMTA 1B2RA 3GFVA 2VZ9A 1ZEJA 1QHNA 5BWNA 2EJUA 1R00A 3C43A 2XNSA 4ENVA 4KFSA 3DO8A 1R5OA 1BS2A 1N6IA 1QF7A 3PR1A 4YLGA 1QG6A 1MORA 1VPLA 2PUWA 3DBHB 4LYDA 1LQUA 4HQFA 5KAPA 4K3VA 3TTUA 2C20A 1OC2A 1ORIA 1DUSA 1J0BA 1X0XA 5AJXA 5K05A 1S9DA 4C7VA 2RHJA 4EZEA 5JWHA 2FK8A 5AM4A 4ZVPA 1H2RS 1G7TA 2F00A 2KHZA 2R6HA 4GQIA 4B32A 4CETA 5CFLA 2WG1A 4K7JA 1BTOA 4KC0A 5IKEA 2GPAA 3PFKA 5L3RA 2B3TA 3GRZA 3N70A 4R1UA 2XYRA 3LVBA 2X0RA 2QLNA 4KR7A 2G36A 1M83A 3UKJA 1PYOA 1CJMA 2VBFA 3N2EA 2GD6A 4JOCA 2OQRA 3H1BA 2B20A 4UM9D 4DQUA 4ENSA 4LBZA 4E1BA 2FSFA 3P8ZA 4XQ9A 3WWOA 1FYXA 1PEYA 2JCBA 2GPTA 1SHJA 3NBKA 4IOJA 3U3RA 4A10A 2ERXA 3S44A 3VKWA 2XMZA 3THWB 1YNOA 1ONSA 4ZCTA 4BWFB 4OK3A 2WJIA 3KJEA 4IL5A 3CSSA 1ONBA 2B8TA 4JUCA 3R1IA 1QF9A 4L75A 1E2QA 3MGBA 5CFMA 4WACA 5MGBA 5IASA 4Q39A 4DJ5X 4YAFA 2XT9A 4UOEA 4BVHA 2J6HA 3B7WA 3OPNA 3JASA 1J21A 1NXOA 4DPKA 4C4SA 4I1UA 3WKBA 3C3XA 2YJ5A 1SD5A 1MF7A 1ZRSA 3NORA 4HDMB 5JFTA 1IRIA 5JH7B 3D4BA 5ICCA 2EVWX 5AKHA 1YL7A 1Z8FA 4Z2AA 3QKIA 1N92A 2BFFB 4O02B 3KL2A 1QS0A 5KQLA 1TF2A 3LVFO 1EHYA 1X42A 3M6MD 1UEXC 1DX6A 3SFVA 4RA6A 3FZGA 4OF4A 1NP6A 2YWXA 2AXNA 3OZCA 1L5YA 3QLUA 1UAAA 1X1TA 3QQPA 2JLRA 2WE7A 3DZCA 5AXAA 4KO4S 2AEJA 2P5SA 1GM5A 2EJWA 3LPCA 5CFZA 3DKRA 1G8YA 3NC1C 4G0VA 4AUEA 2ENWA 2DQSA 4BVJA 4FFDA 1GR0A 1Q2UA 1HG0A 1EE2A 2IBMA 2QSZA 4NCJA 4COKA 1A96A 1U7UA 1SIUA 2FWRA 2WHPA 1VKRA 4IUCS 3ZW8A 3SJBA 2EKDA 4ZAZA 2V7XA 3SR4A 3GFTA 2ATEA 3O0TA 4TWBA 2PKCA 2OM6A 2GRAA 3DT8A 4MYSA 3S68A 3OFSA 1BN6A 1E8DA 2A78A 4P7JA 4DXDA 1NHGA 4PG4A 1K86A 3CR3C 4S1VA 3WB0A 2H00A 1XRQA 3N7TA 4MW2A 3BF8A 4XYGA 4OLFA 5D3ZA 2V54A 2B8NA 1KRXA 2G1AA 3CIOA 5AK6A 2VO1A 4ZT7A 4I8IA 2X86A 1EGMB 1HFEL 1P4AA 5E1BA 3TW8B 3LRPA 3G8YA 2C78A 1GGNA 4K5QA 5D8DA 4YV1A 4DV6B 1C7QA 1KSHA 2ISCA 1NG9A 1M7HA 5G0TA 1E0DA 4KYIB 3TTVA 4E51A 2XGSA 1ODKA 2QUZA 1KIMA 4MPJA 3EWAA 5CGQB 5FFFA 3TSOA 4CKWB 4MPDA 5JISA 4MUGA 4AYXA 1T35A 3BDIA 4DAEA 2FHSA 2H8GA 3BIWA 3U44B 3X2EA 5AI5A 1UM9A 5A62A 4Q7KA 1TLFA 1VLLA 2F1RA 5DN6D 2O1EA 3R3XA 4ARBA 5AICA 1OPRA 1FY2A 2ONZA 3ED1A 3G0OA 3BMCB 3UK7A 2YIJA 1JLKA 1WCWA 4ZCLA 1CUHA 5GIOE 2PY6A 3P96A 3IEKA 3EX7C 4ZXFA 4X0EA 1TU4A 4H6XA 1R15A 2VF2A 3ME5A 3ZD7A 3T4XA 2ZS7A 1DUIA 1RHMA 2OK7A 2L82A 3AEQB 3LY5A 1R0YA 4ZDKA 2YV1A 4JU9A 4BNTA 2XCQA 4KPFC 2J85A 2PS3A 4BP3A 3PPYA 3S2EA 1RQ2A 1MO2A 3ILHA 4U0JA 2HQ1A 3ENVA 4GZ5A 4EF5A 1SH7A 2R6R1 1H0SA 1H2ZA 4WXMA 3GLIE 4B2YA 1HQYE 4OBBA 2IU0A 3EG5A 5JMTA 3RAJA 3IFSA 4NH4A 4KE6A 4G4JA 2Y67A 3KZXA 2BONA 5L95A 3IBFA 2E4AA 3JQAA 4IJVA 3HB9A 1XLUA 4EQZA 1JIVA 2BUAA 2B30A 1HY3A 2N1MA 3CBGA 3HEAA 3G82C 2OMKA 3K2BA 3Q41A 4JH0A 1SG6A 1DWUA 5DW0A 1XZQA 3U49A 1LDYA 3VZQA 1AZTA 2Z6AA 1WETA 2FPKA 4CWAA 4M0LA 3BIFA 3D8BA 2B4KA 3MUNA 4B7CA 2CF6A 3GGCA 3OY2A 3OOJA 3CVWA 1K66A 2G7ZA 3Q8KA 2NU7B 2XTMA 4OP1A 4KR9A 4I99A 3K0CA 1F7VA 4QPCA 3HCOA 3KCQA 1RHQA 3PSHA 4QDKA 3FNFA 3C98A 2BR4A 3QP9A 1HQKA 4L3OA 5LA6F 3N0XA 1Y8QA 1YS2X 3DHYA 2WJJA 3UM9A 4MI6A 3VR1A 5JJIA 2DUNA 3D6AA 2X2OA 1QFYA 4QYIB 4Y2HA 4L95C 3ZDYB 4KO3S 1GG9A 2O0LA 5DXJA 4F1WA 1RWKA 1AOXA 2N1BA 2OBFA 4KK4A 3EBOA 1E1KA 1U1CA 1U0TA 2PNJA 4MVWA 1VHJA 4AUKA 4AW9A 4HEJA 1NQUA 3KTDA 4NXMB 4Z0TA 1XFAA 1CRWG 3ZGXA 2FRXA 5FCDA 4WKGA 2GHQA 3BTSA 2G88A 3S2YA 1KBOA 1G8JA 4LDJA 1JLMA 4LXTA 4R2IA 3OTWA 1DAFA 4YP9A 1KMMA 2IEAA 5EINA 5C46F 1QNLA 1TJPB 4EGJA 5C9ZA 4X97A 1KYXA 1C29B 4MRVA 5ADWA 2XUOA 1UF9A 3IQGX 4DNFA 1BGWA 1WLSA 4DRZA 1H85A 2H48A 3E84A 4RZSA 3F74A 3JQGB 2B0JA 4JC5A 1QRAA 3I9FA 2Q4TA 3W2GA 1Z5VA 2XYQA 4CKZA 4DR4B 4H7HA 2NUBA 3E9ZA 4I1YA 3BM5A 1KYIA 1UFRA 3VISA 1CDZA 2WLSA 2DFVA 1O94C 2WD9A 5DGTA 3SIRA 1VLQA 4FHCA 1HYEA 3IURA 3M5WA 3W7BA 4WCFC 4CV1A 2QB5A 4WKPA 2H11A 1M75A 1RZRA 2AN5A 2CFIA 2DPLA 2I87A 4Q34A 4M9QA 3BX1A 2Y1EA 1TAHA 3GQBA 5AW3A 1QX3A 1WJGA 1T9BA 3D6MA 3E9YA 2I1VB 4IUBS 4W5HA 3HVRA 3OCWA 1QP7A 2NVWA 1RXYA 1GCIA 1HLFA 1M6WA 5EMNA 3WGZA 3ZWDA 3IR7A 3VA7A 3NPMA 2HMSA 2WP0A 3AHEA 4JXKA 4RZXA 2WEKA 4QBTA 1CEXA 2PPLA 3VDRA 4Y9SA 3G0HA 5BNIA 1DGQA 1ZWKA 1E2UA 3AR6A 1TEZA 3A1FA 3CMCO 4XCXA 1NVVR 2ZJ2A 3DDZX 3IXLA 3QTLA 1E2EA 3E4CA 4B4VA 2VS1A 4Y2GA 3TJRA 2PZEA 3GRPA 3SVZA 4C6RA 1I2CA 5E38A 4RTSA 2FMIA 3LKZA 1RXVA 4HWTA 1NVTA 4MKIA 3O9VA 4R40A 2OMEA 3AWDA 1W88A 3RBXA 1TYCA 1USIA 3UJ6A 3FHTA 3WP0A 3A3PA 3ND5A 2Q21A 2JDID 1W0CA 2OGZA 3GEMA 1PZMA 4QYMA 4YP7A 1Z63A 4RHYA 1OBCA 4D92A 3Q11A 3CPHA 2P69A 3SLKA 5CHYA 1YULA 4LF9B 4YRIA 4B47A 2GBFA 5FNVF 1U2ZA 3WY9A 1YIDA 3HLTA 4FE3A 4JJ6A 1MZVA 1VDZA 1ZKMA 2QT0A 3KSDO 3KU1A 4QOSA 3WBBA 3BSFA 5DCYA 5G40A 4HAWA 4R0NA 2LGJA 5KEIA 3PEEA 4G9GA 1O6FA 4GWKA 1NM5C 4N41A 2UYHA 1N0IA 4JY7A 5H5JA 1Q20A 2MOKA 2X22A 2DLDA 4RM2A 2V59A 4PIVA 1DIBA 1U0LA 1WMSA 1EFPA 3SKVA 1GTG1 2HLNA 2V6BA 5D5QA 3WWDA 2FNAA 3T7SA 1H93A 3AONB 1VGQA 3X1YA 2ZTUA 2JIPA 3KAPA 4IY1A 1QXSA 3CF6R 1E6KA 2AV6A 3NGMA 1YS9A 2JH9A 2RHWA 2JLYA 1I6KA 4CIVA 5K2OA 2IYNA 2PMBA 1ZM4A 4ZTUB 2IZ7A 2EW8A 3B6IA 3LE8A 1XPUA 3U4MA 2DSNA 2GWHA 2FUG6 1YRYE 1LD3A 3PFWO 4LGMA 1ISFA 3ZWCA 1Q91A 2H9YA 2P2ZA 2W2QA 4PGHA 5EJ7A 2FPPA 3ROGA 1NKVA 3MQ4A 1GUBA 3NTXA 4N3GA 1E3WA 3R5FA 4V0NA 2BMJA 4DLRA 4DZZA 4MP3A 3ZHSA 2VG8A 2BFCB 3X1DA 5BN4A 3U61B 5JRJA 4XEHA 2L18A 1Z4OA 3HBJA 1UADA 2JI6A 3LC7O 4J2HA 4FGLA 1T25A 2WY2D 3T3EA 1UP7A 1MJ5A 1XF9A 2JI9A 2QENA 3I64A 1JR3A 4FHZA 5BUZA 3QUSA 8MHTA 3DYBA 4H4CA 5BSTA 4BV2A 2AT1A 2Q2WA 1T36B 3IT1A 5GZ6A 3OUZA 2NQTA 2G9NA 1I6LA 1UMCA 4P4GA 3TLJA 4X5OA 3EOZA 2ZJ1A 1EK0A 3K20A 3TXYA 3W6PA 3ZUPA 4WZZA 2WPDA 1B1CA 3B51X 4MUXA 3W8RA 1CE8A 3NDRA 2CDBA 2DULA 4FSHA 1C14A 2YWEA 5AD1A 5ESDA 4Z9FA 1M1NB 4EMUA 3EZLA 1N5OX 1I1OA 1E7WA 1FNDA 1R0BA 1ZOPA 2I03A 4HNGA 1DTWA 2JCXA 2P9JA 4MNTA 4QWWA 4X60A 5H16A 2YJNA 4EO4A 3F9RA 4F9EA 5ADHA 4FBMA 1YL5A 5J43A 1Z2EA 2IQ5A 1G98A 3ORSA 3A6JA 3HCEA 4ZOLA 2HYIC 1YQUA 3ONWA 5GJWC 1FU8A 1CR0A 4EB6B 5D5PA 4E1VA 3C3MA 3PIIA 1TO6A 3OTHA 4GH5A 2N47A 1NATA 1P4JA 4RQBA 4K8RB 3E7DA 1BU5A 2XIJA 4DARA 5BQXA 4EUSA 1E6EA 1PG0A 3DMDA 1HYGA 1Q17A 1NBMA 2ADMA 2GILA 3GLGE 1WW8A 4G0WA 2CXNA 2AMYA 2FQXA 3G9QA 4MLPA 1L7MA 1UODA 2B1GA 2VRCD 3K70D 5HCUA 2C4NA 5LMZA 2HU2A 2WAYA 4WUVA 2IA5A 4GRIA 4OBEA 1G8AA 3ADKA 3O3MB 4ZO7A 3TCNA 3WLJA 5JYEA 2OAEA 2D7JA 4CKCA 4I4CA 3GFRA 2JD1A 3O4RA 3N8DA 3TTXA 4DQKA 1JLLB 2X1LA 4ZHSA 2EBHX 3T8YA 1K27A 1CUSA 1Y37A 4KQ2A 2JFWA 1SXJB 2OBLA 4IIYA 1EFKA 4L7QA 1E5VA 5IMSA 4MAAA 4ERNA 3IKTA 1QJCA 2ZIXA 4GSKA 5ERGB 1Z6YA 3ODGA 1SB9A 2H31A 4RW0A 2JA2A 2QNBA 3QFTA 3R3JA 5JAIA 2EYQA 4YRKA 4S12A 3WWEA 1RMQA 1JXMA 4Y30A 2QLFA 5EE5B 1RKBA 3AHFA 3BH6A 1MVLA 4DV2B 3OJCA 2IL1A 3KEQA 1RKXA 1UCFA 2IEIA 2R8PA 2ZYVX 2BPOA 3EIFA 3KQOA 3DT9A 4MIYA 4J03A 3E9DA 1C4OA 1GLNA 4LRTB 5L3QA 3EPPA 2CLSA 2Z8ZA 1NLYA 1NUHA 1B74A 3CX8A 4R1MA 3WFJA 2BOVA 3RVOA 5JZVA 4G8CA 1L4HA 4MKFA 1MX5A 2Y2VA 1AK9A 2QN2A 2K6GA 4GP9A 3I1IA 4OIMA 4J0FA 5JPIA 3RS7A 3CWQA 3GA7A 4QOIA 3TLMA 3UWDA 3BGIA 1XAGA 4MQMA 4QICA 4ARCA 1IBCA 3IEVA 2O2GA 4DQVA 1PJ2A 4MRAA 4P3OA 1WXFA 3K8YA 1JWLA 4CLOA 2FWAA 1MW8X 3SHFA 3TMKA 2DX7A 1BWRA 2IYYA 2P3QA 4ZAXA 2NSYA 4YONB 5IK2A 2PU5A 3P9SA 4PZUA