3U4HA

Cd38 structure-based inhibitor design using the n1-cyclic inosine 5'-diphosphate ribose template
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
245
Chain Sequence
QTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title CD38 Structure-Based Inhibitor Design Using the N1-Cyclic Inosine 5'-Diphosphate Ribose Template
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 81
structure length 245
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2011-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3u4hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u4hA02
4YT5A 3ASUA 1XSEA 3FPLA 3RUEA 3STHA 4E30A 2AMFA 1HE3A 3WR5A 1KVUA 2PZMA 3L07A 4KOAA 4CQLB 2A9FA 2V6MA 3BHJA 4JROA 5KVVA 4FIZA 4Q3EA 4DVJA 4XD2A 3AUUA 4KTVE 2XXBA 5B1YA 2I66A 1ZVMA 4YJHB 3RASA 1IB6A 1HTBA 1GQYA 4IXTA 2QZZA 4EYEA 3IP3A 2X9VA 3ZWNA 4E21A 2RH4A 3KSUA 4WNIA 4PZDA 2BFOA 3ZHXA 2FWMX 2ZK7A 2NTVA 1A9YA 4D42A 3HQ4O 3E5MA 3HG7A 1R15A 4E5MA 1Z7BA 3VHRA 4YJFB 2BHLA 3HB5X 3V5NA 1BXKA 4IQ8A 1NHGA 2VUSA 1D3AA 4J90A 1JQBA 5KJ1A 2D8AA 1PX0A 1GUYA 1ZUD1 1QLJA 4IUYA 3VDRA 4UEKA 1QYDA 2HDHA 3KLMX 2IYPA 3QVXA 1NYTA 1ADFA 2VRBA 4EBFA 2PWZA 1HDYA 4OHUA 1A4UA 3RVDA 2GGSA 5G2OA 3GNSA 3ZV6A 4CL8A 4D7AA 4E6PA 4AJHA 3G3EA 4XKJA 1E7WA 1LRKA 2JCVA 5TS3A 2VYND 5HBRA 3WTBA 4PLHA 3TL3A 4YTEA 5JDIA 1YQGA 1BMDA 5DOVA 4DMMA 4QEDA 1KC3A 1PJ2A 2CMDA 4I08A 2J8ZA 4J0FA 3EVTA 3NV9A 5COQA 4AL4A 4DC0A 1NQOA 3K9QO 4XYGA 1PTJA 1R0LA 1SZJG 2RBEA 1FDWA 3BAZA 1G6KA 4KDFA 1UXIA 1TLTA 4JQCA 4KUEA 1SBYA 5A06A 4WK6A 2DU8A 2GSDA 5JO9A 4BGEA 3ZWBA 3WGGA 2OMEA 1JDJA 4RF2A 2X22A 2CNBA 2DBZA 3U0BA 3W4KA 2E4AA 2NTJA 2ZTLA 3TJRA 3NDJA 1Y8RB 4XQ9A 3NDIA 4FJ1A 2JFGA 2JJYA 4TZTA 1JKIA 3EMKA 4OL9A 1GDHA 1K89A 1KY4A 3AFMA 1T25A 2YUTA 2PK3A 1YJQA 2A92A 1PGOA 1VC2A 4XYEA 1LEHA 4ZRMA 1PJBA 2OORA 3NT2A 1YXMA 4DPKA 4BQPA 1OMOA 1E3IA 1G0OA 3ZWWA 3DMTA 2RCYA 4CMBA 1HDRA 3ON5A 1LTHR 1KVTA 2Q2VA 4ZN6A 4CQLA 3OJOA 4XYLA 3L77A 2PZKA 4OM8A 2AEJA 3Q2IA 5F5NA 5BNTA 4BIIA 1PQUA 4L4RA 3RIHA 4YJHA 4E33A 1B2LA 2BGLA 4F6CA 1C3VA 4PRKA 3JV7A 2HMVA 3ROQA 2IZZA 1LDGA 2G76A 4AVYA 1FMCA 3SLKA 5JCJA 1WAMA 3U9LA 4B3JA 2HMTA 4D41A 4YRBA 4TZKA 2D2IA 4CQMB 5K0ZA 1FXSA 3AWDA 3DZIA 1HDOA 4MVJE 2O3RA 3IC5A 3Q1LA 4K6CA 1H2HA 2CVQA 3I23A 3B20A 2PGDA 4BO8A 1H94A 4CLHA 3TQHA 4EUFA 4MVJD 2X58A 1B15A 4FCCA 1GEEA 4YCAA 1Y5MA 4YACA 3BHMA 5DT9A 1NP3A 1ZXBA 4IZHA 1K5HA 3ZWAA 3E6AA 5BSGA 2QHXA 3I4FA 4X54A 4GVLA 4MP3A 5G4KB 3KB6A 4FFLA 4RZHA 4Z0TA 2J3JA 5F1KA 3MJVA 4KUHA 1NPTO 4BNTA 1E1MA 4OMUA 1E1NA 3O9ZA 1YE3A 1GADO 3SXPA 1RM4A 4ZVVA 3V1UA 3MOGA 2EWMA 3CPSA 5KTKA 4GKVA 4E5NA 1I36A 5LDGA 1LSJA 3KYCB 1UDBA 5AOVA 3WGQA 1P1KA 1ZW1A 4XRGA 2HMUA 9LDTA 4EITA 5EL0A 1YL7A 4YT8A 2E6UX 3ONEA 2WEKA 1U5CA 3PHGA 4B4OA 4GVXA 3Q3CA 2EHDA 4O1MA 2GZ1A 4ESOA 1CJCA 3EC7A 3ROKA 3LSYA 4MPDA 3DBLA 3AW9A 4JJIA 3UCFA 1V35A 1YDEA 3FCOA 1QLHA 4IM7A 2HUNA 4W82A 3ZW8A 3PTZA 2OBYA 4ZD6A 2JD0A 4IJKA 5JPIA 3ZNOA 4CR7A 1WP4A 1IL0A 4O6VA 4IMRA 2VWGA 7ADHA 1Y8RA 2ZTUA 5CEFA 4OKNA 2NTNA 2EF1A 4LVCA 4IXWA 3GN2A 2QRKA 3WQRA 4IS3A 1O9BA 3A1NA 3ETDA 4GGPA 1GEGA 5TT1A 3QW2A 2A4KA 5ITVA 5JW6A 4BKUA 4I9UA 2EIHA 2Y1CA 1Y6JA 2EW2A 4TVBA 4LMPA 1PQWA 3QVTA 4YVFA 5KKCA 4J16A 3H6KA 2SCUA 1GL3A 4LK3A 4J2OA 1X7DA 1C0PA 4BOYA 3F6YA 3SJ7A 3E82A 5L4LA 2BMAA 3I9KA 4P4NA 4YAKA 1F0YA 4IZIA 3VAZA 1C14A 5T67A 3HJAA 3HE3A 4GQAA 1HF3A 3PIIA 3FNEA 2YQ5A 1M2WA 1NM5A 2ZYAA 1BTOA 3ZH2A 2D4AA 3TPCA 1NFQA 4AJKA 2DBRA 4W7HA 1NFFA 1HXHA 4B3HA 1KY5A 2GN6A 1HLDA 4AJEA 1K3TA 4G5HA 4RPLA 3LZ6A 4ZRNA 3VH1A 3WLEA 3PVZA 3B6ZA 3E8XA 2AQKA 3CZRA 3UN1A 4CQMA 3GUYA 1XWFA 1PWXA 1DIRA 3EYWA 5BNFA 3K92A 5TJHA 1P31A 4DUPA 3PDJA 1NWCA 1D4FA 5HA5A 4QX6A 1NQ5A 3T4EA 4MJLA 1X13A 4FPXA 4D43A 3H9UA 3PQFA 4H15A 4R01A 4OOEA 4J43A 4D3FA 3ENKA 2H1SA 1E3LA 3I6QA 2H6EA 1PIWA 3WTCA 1V8BA 1DJNA 4UEOA 4AJPA 4F6LA 3NTQA 1P1RA 1LXCA 4TQGA 1Y7TA 3FR7A 4XB1A 5I9NA 5IF3A 2YYYA 3FNHA 1KERA 4GGOA 1ENZA 1M76A 3WBFA 1VKNA 3RBXA 3JD3A 1G0NA 2P9EA 2WYUA 3BTVA 1LLQA 4IQ0A 4ONEA 4H3VA 3H9GA 3DBHB 1XYGA 3RC1A 3PZBA 2C5AA 3KVOA 1BVRA 4ZICA 4A73A 1GFSA 1ZO8A 2Q49A 4L75A 1VL8A 3KYCA 3C8MA 2CSUA 2FR8A 4RJTA 4BMVA 1H0KA 3ZHBA 5G4LA 3DAPA 2YV1A 3EUWA 5L3ZA 5JBIA 3D3EA 4GX0A 3LT4A 5F21A 3MTJA 2VWHA 4HUJA 5DOZA 5L45A 4IDFA 1GU7A 3NEPX 1BWSA 3PYMA 1F06A 4L4SA 1DFGA 1XQ6A 4BO2A 5T8KC 4AJLA 1EQ2A 1DAOA 5IDQA 4M1QA 1A7AA 1WMAA 2GF2A 4TVOA 3PYXA 2QRLA 3CKYA 4G65A 1P9LA 3GR6A 1VM6A 3A14A 1CQJA 2C29D 2X8LA 4DXHA 3WNVA 2LDBA 1LDYA 4M8SA 1FDVA 4AJIA 1I33A 4WCDA 3OJ0A 4Q39A 3WSVA 1IHYA 2HKIA 5IXSA 2AQHA 4PVDA 4YBZA 1K6IA 1YQXA 4ND3A 1E5QA 3L4SO 5ADHA 1P44A 3EDMA 2C0CA 1W0CA 4WLFA 2PH5A 1DRUA 2EG9A 4DPLA 3GY0A 3NAQA 4HY3A 4B7UA 5A4DA 2EJVA 1YONA 3GEGA 5JFOA 3DOJA 3C85A 4WJZA 1KVQA 1OFGA 2PD6A 1UP7A 5FYDA 4MINA 3O38A 3JTMA 5C7OO 2FSSA 3FNGA 4N7RA 1CF2O 4F45A 1T2CA 3KEQA 4GLLA 4I5DA 3CH6A 1HLPA 5KNLA 3DZGA 3DEYX 3GK3A 2O48X 1LUAA 3TFQA 4FGWA 4U0KA 3VPSA 2FZEA 1F17A 1ZSYA 1QKIA 5CPBA 3PQDA 1V0JA 4UULA 4R1SA 2G5CA 1MX3A 3FR8A 2YZ7A 3GUCA 4J2HA 5DCWA 4CM1A 2X4GA 2O23A 4WPGA 3VZPA 1JVBA 1LSSA 1TA4A 1ZKMA 2DC1A 2PY6A 3ONFA 1SEPA 3GHYA 2FPGA 2UUPA 3C1AA 1KETA 4L0QA 1L1FA 3WIDA 5CFZA 3HUDA 4KWHA 4TSKA 1DRWA 1T2AA 1VJ0A 3EGOA 4TMFA 3LT0A 3QIVA 3WGYA 1A27A 2W2LD 1CDOA 3BYZA 4C7KA 2GNAA 3WMWA 1NFRA 4NJMB 2VHWA 5AXAA 3AI3A 2YDXA 1SB8A 4NK5A 4OOFA 2HK7A 3K31A 2FPIA 4HNGA 1K6XA 4HP8A 2CVOA 3VPFA 4C7JA 3AU9A 3SLGA 1K0UA 2C82A 5IN4A 1DC5A 3ST7A 3JYPA 2Q3EA 4FGSA 4URFA 3UAGA 5L4SA 2C59A 1NPDA 2AE2A 4LN1A 3U4HA 2OP0A 1U9JA 1WDMA 2NLOA 3AOEA 1AHIA 4D44A 1U4OA 1QG6A 4DMLA 4Z9FA 2V7PA 2ZCVA 1P1JA 2FY8A 2DUWA 3IQDB 3RUDA 3VTFA 4R3NA 4XEHA 1I3KA 3HFSA 5T8KA 3FWNA 4FC6A 3NJ4A 4NBTA 4DBVO 4RGBA 1UUFA 2BF7A 4J49A 3RUAA 3WMXA 3MZ0A 3NUGA 2P9CA 3L6DA 3KM0A 4N5LA 4UVIA 5KJCA 3IUSA 4E4YA 1PZEA 1VPDA 2WYVA 3FPCA 2P2SA 4EGFA 3ETGA 2PFGA 1SMKA 3OA0A 3PP8A 4FOOA 4CV3A 3UCEA 1ISMA 3WWYA 1IOLA 2I6TA 3D0OA 3DFUA 3GN1A 3WGTA 4BO9A 2PGLA 3QP9A 1ADBA 2VCYA 2V6FA 3RFXA 3E9NA 3ITKA 2PGJA 3DQPA 4BGUA 2PNFA 1P33A 3NT5A 3NGXA 1IYZA 5U9CA 1J49A 1RYEA 3MJ4A 3FF4A 3WICA 1WWKA 3DHYA 4B4WA 4B3IA 1ADGA 1A71A 4RPGA 3X2FA 2JFFA 3C7CB 1QMGA 1U3WA 3H9QA 4Q3BA 4XQGA 3G0OA 1H9BA 2FR0A 1EQUA 3RD5A 4CM8A 3PHJA 1EDZA 2WSBA 4YAEA 1NHWA 3KXDA 1AN9A 1FDTA 2J3KA 4BNZA 1Q0HA 3RUIA 1WMBA 1Y9AA 2JAPA 2X7HA 1PJLA 2PKQP 3QVSA 3JQCA 3AY3A 3HDYA 1DXYA 3U4DA 1QYCA 1ZK0A 5JCXA 4Z0HO 1RYDA 3JQFC 3ZWVA 2DKNA 1EE2A 2IDZA 2X5KO 1YH3A 1NVMB 2B4TO 4WEQA 1DDOA 4II3A 4CLRA 1VSUA 2FN7A 2NU7A 3OIGA 1ID1A 4IQGA 4CV0A 5MGBA 1HZZA 2BRUA 2C20A 2I65A 2NWQA 3RUCA 4UVEA 2B4QA 3U5TA 2GASA 3H3JA 1KOLA 4BO5A 2DUUA 4NJMA 2Y67A 3NJ8A 4DIOA 1VL6A 1H2BA 1B7GO 3JQ9A 2ET6A 5GY7A 4BO0A 2EKLA 2UYYA 4R51A 3OF2A 3GG2A 2AG8A 3BMOB 1NQTA 1UDCA 2NQTA 4J3FA 3VZQA 3AM4A 1B3RA 5G0WA 4CLOB 4R69A 1YO6A 1BXZA 2DTXA 3U49A 2EP7A 5L40A 1U28A 1WZEA 1VLLA 4JCOA 1O89A 2C2YA 2ZB3A 1R12A 5KJ6A 2IXBA 3JQBA 2CY0A 2VHXA 2OUIA 3H65A 4TRJA 1UZLA 1ISGA 2TMGA 4E2WA 3JYLA 3VOSA 2NV6A 3GZ4A 3OBBA 2VHVA 1CRWG 3B1FA 1BHSA 3DTTA 5H81A 2DBVO 1EUZA 1BRMA 1U2GA 4NIMA 4ZQHA 5A3VA 5TIIA 3K6JA 4IBOA 3TOXA 4CLEA 3ICCA 3WLFA 2H63A 3EVNA 3H5RA 2EKQA 5TX7A 4EEXA 3V8BA 1LDBA 3I9MA 4YAGA 1H5QA 2X6TA 4JLWA 1RM3A 1RM5A 2BGKA 1IE3A 5AXDA 3S2GA 4WKGA 1YBMA 2HRZA 3RKRA 3QVOA 5A9RA 4WECA 4XGKA 5IG2A 1TI7A 4MIYA 3V2HA 4EEZA 2YFQA 3OETA 4BMSA 3K96A 4LCJA 1N1GA 5IDXA 2JHFA 1EFLA 2FHSA 2P91A 2HCTA 1B8UA 2GERA 3GF4A 3JSAA 5DBIA 2GN8A 3KYDB 1PGQA 5ENVA 2VRCA 1CETA 4F46A 4J9UE 1PS9A 2J3IA 4N54A 4HFNA 3W6ZA 1EK6A 3K2EA 5HWSA 5JYEA 5ICSA 1ZZEA 3O26A 3H4VA 4EDFA 3DAGA 4R1TA 1LRJA 4ID9A 3VH3A 5JMPA 4HWKA 4DLAA 1NWHA 1XQ1A 1JKFA 2WDZA 4O0LA 4O63O 3WGZA 4YXFA 4Y6PA 3O03A 1MV8A 5G0UA 5A9TA 1U3TA 3ZU3A 5HTOA 1ZCJA 2YW9A 2EEZA 2E49A 3D7LA 3FRJA 4U6SA 1T26A 4IJVA 3GVXA 3BHIA 1HZJA 2X9NA 2P9GA 3TRIA 1CIVA 5EQFA 1EMDA 3C1TA 4QO8A 3JQFA 2NUAA 2I99A 1C0LA 3I4CA 4FFPA 1PS0A 2VYVD 2HRBA 3H2SA 2DVMA 1EEHA 1ZK1A 4LRTB 2RHCA 1Y8QB 4DQXA 3PIDA 1UZMA 2VHZA 5EMHA 5GZ6A 3DBRA 3PK0A 5JMWA 4HBGA 5TT0A 4QUKA 4JBHA 4WGGA 1W4ZA 3DZBA 1CERA 2Y1EA 2W2KB 5ILGA 2IEDA 1NAHA 5B4UA 3BMOA 3G79A 4HV4A 4D79A 3BXXA 3ZWXA 3LQFA 4PIVA 4MIOA 4MOWA 3LC2O 1IZ9A 4YJGB 4CLOA 4II2A 4JJFA 2PZLA 1I01A 2FZWA 1H6BA 2Z95A 4BKPA 1KYQA 2CFCA 3E1KA 3F1LA 5EN4A 5FI3A 4BNUA 2O4UX 4I1IA 1YB1A 2VWQA 1LLDA 3GG9A 4D45A 5IAAA 1HYEA 3Q9UA 4CM9A 3QWIA 5K9ZA 1V3TA 4A5OA 1J0XO 4INAA 3I83A 5JAZA 1AGNA 3INRA 4FFOA 4XGIA 3AUAA 1C1XB 2Y0DA 1LLUA 4I5EA 3FBTA 4YRAA 1DFHA 4MVJI 5BT9A 3TOZA 1GR0A 2DBQA 3HN2A 4UUOA 1YRLA 3KRTA 4QT0A 4HNHA 1MLDA 1LU9A 2Q2QA 4DRYA 5KJEA 3A4VA 2DT5A 4LSWA 4NFYA 3W8EA 1LX6A 4PFJA 1BSVA 2BD0A 1IY8A 3KYDA 3GVPA 3B1KA 4CMEC 1WNTA 1T24A 1YL6A 2VHYA 4DWVA 1BG6A 1B8PA 2P68A 3H9JA 4XQEA 1GQ2A 3JQ8B 3L9WA 1LJ8A 4RVFA 5CG2A 2E37A 3FN4A 2IEBA 4R3WA 4YQZA 3MJCA 4W99A 1SOWA 4L76A 2V6BA 4WLEA 4BL5A 4ALIA 3Q11A 4A0SA 3PI7A 2PV7A 1NR7A 4B79A 1GPDG 4BKRA 4RZIA 5T57A 5JDCC 4BNHA 3DTYA 5L51A 4OYRA 2NVBA 5A3JA 2Z5LA 1XEAA 2YV2A 3OJLA 4PN3A 2AHRA 4NDNE 1HE2A 1J4AA 4OQZA 5KVSA 3MOIA 5DNAA 1UXGA 3AI1A 4R9SA 3GH3A 2DFDA 4FR5A 2X86A 1UR5A 5HS6A 1Y8QA 1I3LA 1Q7BA 3GRPA 3M2PA 4PLZA 4FW8A 2BLLA 2PKRA 4OAQA 4N5NA 1EUDA 1VL0A 2BH9A 4BNVA 4CMCA 5B37A 1LNQA 4QO7A 2W2KA 4KDEA 3HB4X 3L6OO 4CPDA 4YJFA 5L7WA 5JE8A 4YJGA 5JY6A 1SNYA 1PGNA 2UDPA 4IDDA 4ALKA 4CMGA 4OXKA 4QSMA 1CEQA 3WFIA 3WNQA 4YB8A 2ILTA 3WXBA 2QQ5A 3ZNPA 2X9GA 5TSDA 1IHXA 2RAFA 1WW8A 1OBFO 4NMHA 5EPOA 3RWBA 3VDQA 3ZWOA 1FF9A 1U7HA 3BTOA 1H6DA 1VRWA 1NTOA 3OA2A 4NBWA 4BB6A 2JFHA 4Z9YA 1PS8A 1YKFA 1RWBA 5JLAA 4IDEA 5DCYA 5TGDA 2A35A 5KVCA 2ZJ1A 7MDHA 1B0AA 4GX1A 1C1XA 3L0DA 5U1PA 4L4XA 1NPYA 2UV8A 3PJDA 4Z3KA 4B4VA 5CG1A 3AM5A 4J7UA 4BNNA 3BMNB 2Q45A 2VUUA 4NBRA 3RC9A 3JQAD 2DTDA 3L4BC 3PQEA 3TZQA 2IE0A 3WX0A 1GV1A 2F00A 3C7DB 4IY1A 1E5LA 4YDRA 4U5QA 4BMNA 3UUWA 3NTRA 4J4HA 1DAPA 4QTZA 3OECA 3UFXA 3IP1A 2NACA 1Z75A 4GMFA 4BNJA 1FDSA 1GAEO 1N5DA 2RIRA 4FSHA 4XIJA 3JYQA 1TEHA 1ISFA 2JAHA 1JAXA 1T2EA 4JIGA 1N1EA 2D5CA 3I5MA 1HDZA 1TB4A 3IIEA 1H6AA 4M49A 5I7VA 2O3SA 3JQ8A 3OQBA 1ENPA 4CMEA 4XQCA 4Y98A 4BHTA 2NM0A 4BGVA 1OAAA 1UJMA 2PLAA 3K2BA 4RVGA 3KO8A 3QLJA 4NFSA 4BNIA 1ONPA 1DSSG 3P19A 3TZCA 5JAIA 1LDMA 3KUXA 4R54A 4BO6A 4Y8VA 1Y81A 4DL9A 4ALLA 4NBVA 3MJTA 3HHPA 3WYBA 1XKQA 1BXGB 3R6DA 2DTEA 5IFLA 1U7TA 5JDCA 3ZV4A 5A9SB 4E2XA 3DAFA 4E3ZA 5DULA 4E2YA 2XPCA 3INTA 3H5NA 1UP4A 5T64A 3IKTA 4XYBA 5THQA 3DDNA 1PJ3A 1EK5A 2W4QA 3P2OA 5BNIA 5C7IO 3LF1A 4DPMA 1LRLA 1ZMTA 2VUTA 5JXWA 5TNXA 4GX5A 4NI5A 1RM0A 4PG6A 5MDHA 2XAAA 3I52A 3NDRA 4ALNA 1P45A 5ER6A 4PG5A 3ROMA 1UAYA 5LDHA 4M55A 4AG3A 1DC3A 3KZVA 4BNLA 3HN7A 1GV0A 2VN8A 3TSCA 2VTDA 4GSLA 3M1LA 4EJ6A 3CSDA 3GFBA 2HK8A 3PPIA 2D5AA 4CR6A 2PKQO 1GY8A 3DZJA 5J23A 3CINA 4CR8A 2HJRA 4PZCA 4XZ3A 4PLYA 1QYVA 4Q9NA 4Y9DA 4W6ZA 5G4KA 2HMWA 3PJGA 1BDBA 1QP8A 4ND1A 1FK8A 3B70A 1KEWA 1Z82A 4JXKA 3LC7O 1ZIDA 3LT2A 4BGIA 2YFHA 3RBZA 3S55A 3WGHA 4BV8A 4EJMA 1DPGA 4O5OA 1KVSA 3OH8A 2Q1WA 2Y1DA 3BZUA 3BMNA 4A2CA 1V3VA 5HRUA 1HT0A 3OIFA 3GRKA 4MVJF 5BQFA 1X0XA 4GAEA 3HDJA 4XR9A 3L4BA 5TLSA 4HX5A 1LSOA 3RSHA 3DL2A 3NKLA 3PYLA 4I9NA 4TRNA 3ETEA 1MXFA 5TJ9A 3A06A 1F8FA 1YDWA 3IJRA 1KEPA 2V65A 1A4IA 4FDAA 5I9MA 4CJXA 1Z74A 3ANMA 4JK3A 1HDCA 1VSVA 1YB4A 1Q1NA 3DO5A 3ONDA 5DN9A 2Y05A 4BNFA 1HSOA 3ANLA 2O3TA 3OQ1A 4YRDA 5IJZA 3M1AA 3ZWMA 3S1LA 3F3SA 1D8AA 1E6WA 4BNXA 3UGKA 4UVDA 2ZQYA 3AK4A 3NT4A 3X2EA 1DO8A 2NU9A 3PWZA 1AXEA 1JU9A 1PL8A 3EY4A 3SBOA 3I3OA 2GCGA 2NVWA 2BI7A 1BXGA 2ZB4A 1LA2A 3QSGA 2Y1OA 3ORFA 4J7CA 5A9SA 4BB5A 1A72A 3WYCA 5CDGA 1TVEA 4MVJG 4UVHA 1MA0A 2Q46A 3Q0EA 4TKLA 2JD2A 2JL1A 5F1OA 4K9DA 3AJRA 4WLOA 3P2YA 4U7WA 1JLLA 2PZJA 4ITUA 5JCJD 1M75A 1J6UA 1LDEA 3KBOA 2B5WA 2NU8A 1DFIA 4GWGA 3I9NA 1WDLA 2AA3A 4CMAA 1BDMA 2XOXA 3JQ7B 2RHRA 4B7XA 4UAGA 4JX8A 2PD4A 3G49A 1MXHA 4DBZA 5C7LO 3HDQA 5A5EA 5IZCC 4I9HA 3C1OA 4QFCA 4W9NC 1RPNA 4G2NA 4GWKA 3E18A 4MIEA 5ES3A 2VZ9A 3H9EO 4CV1A 1U1IA 1N9GB 5FI5A 2VTEA 2X5OA 1HYGA 1EBFA 1Q7CA 2WMDA 3ADPA 3FI9A 2WJPA 3COSA 1GZ6A 3PLNA 3GEDA 2AEFA 1LQTA 2B69A 4DLBA 4XDZA 4CLDA 5JO0A 3F5QA 3BMQB 2GDZA 4A27A 1KEVA 4UVGA 1PSDA 3LVFO 3VZRA 1LBEA 4R5HA 4RLSA 1P1FA 5A04A 2HO5A 1ZNQO 2ZB8A 1GYPA 3GMDA 1E6UA 3DZKA 1D1SA 2FOIA 2GZ3A 1VE9A 3DBHA 4NU6A 1GPJA 1JAYA 4CL3A 3VTZA 1PGJA 3PRJA 3UCXA 1MB4A 5EIOA 1AE1A 1E0DA 3HDHA 3VPHA 1C1DB 5A05A 4CMHA 3U4IA 4IGFA 4DYDA 4OJNA 4B4UA 5I7EA 1UH5A 3MJSA 4AFNA 5BSEA 3R1IA 3OSUA 4Z0PA 5BSHA 4IINA 4R5MA 5IDWA 3BTSA 3LLVA 1E92A 4CV2A 4P22A 3GGPA 1PL7A 5BR7A 2Q4BA 1WDKA 3KLPX 5C5IA 4AJJA 4TRRA 2GN4A 2OP1A 1E7QA 3VKVA 1M66A 3LC1O 4RDIA 3WGOA 1K6JA 1DLJA 4FB5A 5T5QA 1B26A 4HFMA 1ULSA 4DLLA 2R00C 4Y67A 1B3BA 3ZGYA 3UW3A 1NVGA 3FBGA 3UKOA 1KVRA 1DBVO 1OZAA 1ADCA 2CUKA 4XB2A 4CUZA 2QX7A 5LCXA 3RC2A 3GA0A 1D1TA 2PH3A 4DREA 1P1HA 3MTGA 4XWYA 2J3HA 1I2ZA 2CZCA 2CF5A 3ZWCA 1QORA 2FR1A 4BV9A 2DFVA 4TKMA 2VYNA 4FJ2A 3GLQA 1SB9A 4CQMD 3GOHA 3JQ7A 4YA6A 2IXAA 4FFNA 3BMCB 4E31A 4NU5A 1ZSNA 4J4TA 3GDOA 5LC1A 4QQRA 3ZU4A 2YHIB 1N9GA 3JD0A 3PDUA 1NQAO 4LGVA 4W9NA 4U6QA 3H2ZA 2O7QA 5L9AA 2BGMA 2J6IA 2G0TA 2ZYGA 2P5UA 4Q3CA 3SJUA 3GPDG 4L74A 3RAJA 2QIOA 1M6HA 1EBUA 4DQVA 2W90A 1R37A 2PR2A 5IZ4A 1NXQA 4ZJUA 1KS9A 2D59A 4WNCA 1XDWA 2IZ1A 2VNSA 3EZLA 1ZXLA 2HU2A 4CMJA 1ARZA 1N92A 1QRRA 2C54A 3PJEA 1SAYA 1EDOA 4M86A 4UUPA 3LLSA 1YVEI 1RJWA 3F9IA 4XCVA 4RPJA 5I8WA 4KMSA 3WG9A 1HDGO 3TZHA 1BW9B 5A5FA 4BO3A 2ZQZA 4BNKA 3LDHA 1C1DA 1PWZA 4CMIB 3GAFA 4MO2A 5DZSA 4KP7A 5B4TA 1XG5A 4N5MA 1NNUA 3ZU2A 3G1UA 3L6EA 3KV3O 4GI2A 4J1SA 2GLXA 3CTMA 1MG5A 3OMLA 4D0RA 4RCVA 5DF1A 2J5KA 1JW9B 5CHEA 1MC4A 4E32A 4ALMA 3A9WA 5CDTA 1MUUA 3AFNA 2Z1NA 4J1QA 3KEOA 6LDHA 2B35A 4LVUA 1M6WA 2VZ8A 5CEEA 5GMOA 3ANNA 2HJSA 4BKQA 1QYWA 1UXHA 3GQVA 2YHUA 4BO4A 4FD3A 3FNFA 1O5IA 3GNQA 2EERA 4A7PA 4BS9A 4PCVA 5L95A 2EJWA 4WOKA 3JQGB 3OIDA 4GMGA 1PJTA 3WDSA 5EERA 3AUTA 4QFDA 3F47A 3RU7A 4Q3AA 1FDUA 4GH5A 1H9AA 3PHHA 2W8ZA 2R00A 4MVJM 1Y5RA 1O8CA 1UP6A 1XU9A 1JWBB 4MVJA 4RDHA 2W98A 1ZBQA 2FRDA 3K73O 4JP3A 3T7CA 2NNLD 1EUCA 3ROPA 3RQSA 3CMCO 5AXCA 2GD1O 3WYEA 3E9MA 4CMKA 3NTOA 3UF0A 4IDAA 2CDBA 3BIOA 2PD3A 4MKZA 4FQ8A 2CF6A 5AXBA 3WJAA 5K6AC 3FHLA 4IIUA 5DBGA 4OH1A 1XR3A 3HADA 3VKUA 2FSVA 3AM3A 4BO7A 4Z6KA 1XELA 1LC0A 4LISA 5THKA 3TF5A 4XGNA 3BMCA 1K2WA 1E1KA 4I8XA 5GZ1A 3QJ5A 4RPKA 2YHIA 3JYOA 4BQRA 1GUFA 1I3NA 3IOYA 5CPFA 1DIGA 3EW7A 1ISJA 3N7UA 3ZCXA 1R66A 1YQDA 2OO5A 4GLOA 4D3SA 4I5FA 1GYQA 2V6GA 4IS2A 2HSDA 1LDNA 5HM8A 4EUHA 5FEUA 4ZQGA 4PVCA 1MG0A 1XA0A 2ZATA 1SCUA 3IJPA 4AJ2A 1N2SA 5B4VA 2GYYA 3PEFA 4R16A 5KVQA 1YWGO 4WLUA 2OZPA 4TRMA 4L8VA 2OXIA 3HZZA 1Q7GA 3GC6A 3GAZA 1BW9A 9LDBA 3OHSX 1I5RA 3VC7A 3IAHA 4OGWA 2O7SA 3WQSB 4HFJA 1JN0A 4YYZA 1GZ4A 1P77A 3F1KA 4CMIA 2Y99A 4KQXA 2QZ9A 1U5AA 4KQWA 1P0FA 1WLYA 2NU6A 1DC4A 1ISIA 5ILOA 3GHHA 1QV6A 2IYOA 1JVSA 1PR3A 3CUKA 1LSUA 2J5QA 4L73A 1ULUA 2BFAA 3ULKA 1PQPA 3ZHZA 5EQDA 5C37A 3AUSA 3QVWA 4J4BA 1AHHA 4RF4A 4B7CA 3T4XA 1E3WB 1VKOA 4CUJA 1PGPA 4GL4A 4HFRA 1U3UA 3R3JA 4K6FA 3E9QA 3U09A 2O2YA 4R4JA 2B83A 1J5PA 2UAGA 2VOEA 3JQGA 2X0RA 2AQ8A 4OIMA 3IDSA 4EZBA 2DM6A 1PZFA 1LLCA 3KETA 3AOGA 4JBIA 4JP2A 2GO1A 4GBJA 2I3GA 2IZ0A 2VNAA 4DYVA 1VJ1A 2HQ1A 3D4NA 3ZN2A 1IPEA 5ER9A 2OFPA 3F5SA 3GVCA 5JAQA 2IODA 1JA9A 1ZK3A 1SC6A 3L9XA 4WASA 3RKUA 2C2XA 5L53A 2E48A 3I6IA 2AEMA 1XCBA 3RC7A 1MC5A 3WBBA 2QYTA 4RF3A 4MDHA 3UXYA 3KSZO 1A9ZA 4NJOA 2QW8A 1DIBA 5K6AA 5JC8A 2EXXA 1ISHA 2EP5A 4L9RA 4DTIA 1L7DA 1QYXA 4ZQFA 5F1PA 4AJNA 4YR9A 4R9RA 4AJ4A 2EGGA 4ND5A 3GMSA 3PJFA 2O3QA 1UZNA 2DPHA 4ND4A 5U4QA 1I10A 2P4QA 2VQ3A 3JQ6A 4YAIA 4N18A 1FJHA 4P8RA 1GUZA 4RQTA 1DEHA 3DBLB 4CM5A 1P3DA 1EVIA 4W7IA 5KWEA 1RKXA 1R0KA 3QY9A 3RUHA 5IN5A 2IRWA 4CM4B 5G0VA 5H83A 4NG5A 1O6ZA 4KWIA 1TXGA 1QSGA 5ITWA 1E7RA 3DHNA 1ENOA 3Q2KA 1X1EA 1C0IA 5L7YA 3I9JA 3I1JA 3GT0A 1I3MA 2D1YA 4NR0A 4EW6A 1PU2A 3RFTA 4ROSA 3IKVA 1ZSVA 1GD1O 1HETA 3V2GA 4ND2A 1I8TA 1UXJA 3H5AA 2VZ0A 2O2SA 5TF4A 3TL2A 4PRLA 4Z9XA 4D3DA 4EJ0A 3SVTA 4A26A 1I24A 3OJFA 1S7CA 4LSMA 2BFPA 2G1UA 2R2GA 1DOHA 1E3WA 1SOVA 4M87A 2Y0EA 3MCVA 1ZEMA 2WD8A 3JYNA 3Q6IA 4M89A 1YOVB 4WLNA 2C7GA 4CODB 3P7MA 4YEDA 3DMYA 3GVIA 4WLVA 4AJ1A 3ZWYA 1VI2A 4WOJA 1G1AA 3SC6A 4MVJH 4RV9A 4PLPA 3VH4A 3U62A 1V6AA 3NYWA 2GZ2A 4J9VA 1M67A 2AE1A 4ALJA 2B4RO 3JD1A 3LK7A 3K8ZA 4LW8A 2YY7A 2VT2A 3PGJA 4FC7A 1JKJA 2O4CA 5A03A 1Z7EA 3OICA 5G0SA 4E5PA 1SO8A 3GNTA 3ABIA 1C0KA 2WD7B 5EJ2A 3WWZA 2C07A 3RFVA 5CP8A 3UICA 1SEVA 2XXJA 3K5PA 1E1LA 2VRCD 1Z6ZA 4XR4A 3B1JA 1HRDA 3V1TC 4B8WA 4HKTA 3FTPA 4U0JA 3TWOA 1HKUA 3RJ5A 5AYVA 2B5VA 1NX6A 2W2LA 4NNJA 3DBVO 5I9LA 4E5KA 3E03A 4ZQEA 3HNPA 4WE3A 4WEOA 3EZYA 4PLGA 4P4GA 5DCUA 5DP2A 3AU8A 2EKPA 1NASA 2O3UA 1U4SA 2BI8A 3D5QA 5TRTA 3JQDA 3JCZA 2AW5A 5F5LA 1PJSA 2ZKLA 4IGEA 4FOSA 2YJZA 4GPD1 3WB9A 1ZMOA 3O8QB 3QQPA 1GCOA 3RJ9A 1GQQA 1IULA 3DOOA 1U2DA 4R41A 1BGVA 4PG4A 3F4LA 1DIHA 1YBAA 2GRAA 5I8ZA 4C4OA 4CM4A 2Q1UA 3F4BA 4IJUA 4S3MA 4ILKA 1HSZA 2Y1GA 2POQX 4HXYA 3D3WB 3UOGA 1WXDA 3ZHYA 4MVJP 4UUNA 1PR9A 5IDYA 4BNMA 3ZI0A 4DA9A 3GFGA 3OEWA 5TC4A 2D3TA 3PXXA 1ZK4A 2TMDA 1JWAB 3G1TA 4PZEA 1DC6A 5IXYA 4RLHA 3RU9A 1MGOA 3QWFA 1I2CA 1LI4A 1E6EA 4RF5A 4E12A 1N7GA 5EESA 1DJQA 4WCFC 2DAPA 1T4DA 5A02A 2B36A 4QECA 1U8XX 4BVAA 4NPCA 2C7VA 4WCFB 1E7SA 4KZPA 1X14A 2OBNA 2JHGA 4H7PA 1XIVA 2FPPA 2DLDA 3AI2A 1AXGA 1YS4A 1UXKA 2JCXA 4CM7A 4YT4A 1O0SA 4P4LA 4A03A 3CE6A 1DHRA 2CDCA 4K28A 4NH4A 3N58A 3ZV3A 4R68A 2D0IA 2O50A 4OKIA 3ZZNA 4CM9D 1YOVA 4H16A 2NQ8A 4RVHA 4MP6A 2FP4A 2A94A 1A5ZA 1O95A 2DQ4A 3DZHA 4CLXA 3TDKA 3WOHA 3DB2A 2ZTVA 1ML3A 1ZJZA 3DOCA 3QHAA 3M6IA 3LF2A 3LU1A 4WUVA 1NAIA 1F8GA 4LCEA 3W1VA 2ZB7A 2HAEA 4FFRA 4MKXA 3WQQA 4ZU3A 4KTTE 4Y6RA 5JY1A 1TT5B 4G81A 1R6DA 1T1SA 4RQUA 3TFOA 3BTUA 3C24A 3D4OA 2WD7A 3UVEA 4ZGWA 1DB3A 1DHTA 1GYRA 1I2BA 3PFFA 3D64A 4B8ZA 3Q9NA 2R6JA 4J91A 4CM3A 2I67A 3AY7A 4Z3DA 4RVDA 2GN9A 4GX2A 3S2EA 3MWDB 4IIVA 5EINA 2NADA 2I9PA 4YQYA 1R4NB 1UAGA 1R0SA 4NFHA 3T7EA 1EVZA 1BVUA 1MP0A 1NBOA 2UUOA 3EAGA 4IDGA 4NQZA 2QRJA 5DDIP 4RL6A 1GTMA 4Q3DA 2B0JA 2FMUA 3M2TA 3O8QA 1X15A 4R1UA 3VH2A 1X0VA 3AOEC 2G17A 4K26A 3ZNQA 2CVZA 2AQIA 1E7MA 2RH8A 1ORRA 2BFMA 3PFWO 1DLIA 1EFKA 1W8DA 4KUGA 4EUEA 5FWNA 3CIFA 4XYMA 2OGUA 1ZFNA 3D3WA 3UH1A 3GPIA 2WYWA 5AQ1A 5CDYA 3WJ7A 5KOIA 1NR1A 3ENNA 3AY6A 3DONA 3INGA 5CEJA 4OQYA 3KSDO 5CDSA 3GGOA 3ZW9A 1LC3A 4BO1A 5CAEA 2AXQA 1XLTA 4P38A 1T1RA 3ZWPA 4LRSB 1OI7A 5AVOA 4PGFA 3GVHA 5T6BA 4E13A 3MJEA 3QWAA 3R0IA 2G82A 1I32A 2HK9A 3DC2A 1IPFA 1KC1A 1TT7A 4J0EA 3DHEA 3G17A 3NGLA 1R4MB 2C5EA 3GDGA 4ZA2A 2YQ4A 3HWRA 3OJEA 5G0TA 4JBGA 4E5YA 4WCFA 3QA9A 8ADHA 1I30A 4PLCA 3ZDFA 3FTNA 4GSKA 2E82A 4BKOA 4PG8A 2QG4A 1XU7A 4YPOA 2X23A 4UEJA 4PLVA 1OC4A 1EZ4A 1Z73A 2P4HX 5F3RA 5FF9A 4E0BA 3ASVA 1YGYA 3KTDA 3VPGA 2PTGA 3P5SA 1PJQA 2WE7A 3PWKA 3RROA 3HSKA 1HE5A 3ZU5A 1SPXA 5ENDA 1QXSA 4FS3A 1GZ3A 4PG7A 2Y0CA 3W4IA 1PJ4A 1ZJYA 2H5LA 3OEYA 4IDBA 3MEQA 3FD8A 3N74A 4CM8B 4JNKA 2GUGA 3D5TA 4A10A 4IPTA 1E7YA 2VWPA 4F3YA 3KYBA 1CWUA 1HE4A 4JGBA 3WIEA 5TQVA 1P1IA 3PHIA 3S8MA 5GZ3A 3S2FA 3DXFA 5JYDA 3D1LA 1TT5A 3QE3A 1H6CA 2Q99A 3RI3A 4BNGA 3ZNNA 5C3MA 4MP8A 1U8FO 4DIBA 3VVBA 1MFPA 2I76A 4CLRB 4I5GA 3SC4A 1ZEJA 2BKAA 1DRVA 3SX2A 3DZFA 1HL3A 1P0CA 4J1NA 5JSFA 3FSRA 2O3JA 4JN6B 3RCBA 2VYVA 4M54A 2Q1TA 3A28A 3ITDA 3FWZA 3JQ9C 1QV7A 2X1HA 1YBVA 2WE8A 1N7HA 1R4NA 1X7HA 3IUPA 4RVUA 2HMSA 5A1TA 1Z45A 1OC2A 2ZJ0A 3TN7A 3ZV5A 4O59O 4XIYA 3C3XA 3E48A 1IUKA 4YAJA 3IL2A 2EGHA 2UVDA 5KIAA 1E77A 2ZIZA 4OSPA 2I5PO 5JNLA 3IS3A 3H3FA 5HS4A 1T2FA 3JQBC 1WPQA 3QRWA 1F14A 3R3SA 4OO3A 3EHEA 3ICPA 1R16A 4CM6A 3QWHA 4RO0A 1OOEA 4PLFA 1EVYA 3NRCA 1AUPA 2NSDA 3KOUA 1Q0LA 1PL6A 1CYDA 2NVUB 4D0SA 1N8KA 3K30A 5L4NA 4CUKA 1T4BA 1ZK2A 1YB5A 1P74A 1R4MA 3V2UA 4XJSA 1D7OA 4J7XA 4DIFA 3HFGA 2CD9A 1H93A 3WFJA 4RORA 2Q50A 4BUCA 2ZYDA 2I3AA 1Y9EA 5IZCA 1PEDA 3JQAB 3MWEB 3PZRA 3RBVA 4RVSA 3GEMA 5DBFA 4OXNA 2PA3A 2P5YA 3BA1A 3U3XA 3DR3A 1E3SA 2GPTA 3RUFA 5ICMA 2VOJA 4XRRA 3W4JA 1VJTA 3BMQA 4W4TA 4XDYA 1W6UA 1X7GA 3V1YA 4BNYA 2Z1MA 2DPGA 2EV9A 2JCYA 3OP4A 3LT1A 1ONNA 1X1TA 3VZSA 1YL5A 2Y68A 4FBGA 5B12A 1KEUA 5H82A 1U3VA 3CEAA 3U4CA 2ZCUA 6ADHA 4MKRA 5KKAA 3GZNB 1JTVA 2AG5A 4EI2A 1KIFA 1V3UA 1B14A 4U8GA 1Q0QA 3VVCA 1ENYA 2YV3A 3D4PA 3H7AA 3F46A 1S6YA 4NK4A 1WZIA 3H8VA 4IJWA 4FN4A 4NZ9A 4IMPA 3GGGA 2Y66A 2F1KA 4FFMA 3NX4A 4XA8A 3VPXA 1DIAA 4ZQBA 2X0IA 1PJCA 3EK2A 1HWYA 5FFFA 2X0JA 4BNWA 3GDFA 1Y1PA 3IMFA 3W8DA 3TZ6A 1WVGA 4AICA 3DBRB 2EW8A 4DGSA 4YJDA 1O94A 1QR6A 4FJ0A 5JAMA 1T2DA 4Q3NA 5I7SA 2HLPA 4DC1A 1ONOA 1V9LA 3LYLA 1EE9A 2X5JO 5BSFA 1EVJA 4XX0A 5DP1A 2ZTMA 2VT3A 1A7KA 2OL4A 3JQEA 1PZHA 5COBA 4HADA 1XHLA 2Y93A 4OSOA 4IDCA 3PGXA 1NVTA 4TROA 2B37A 4QXMA 2CDAA 4ZHSA 3UHAA 4TWRA 1I0ZA 2Q2WA 3CXRA 3PLRA 2Q4EA 3E5RA 4PLTA 4Y6SA 2H9IA 3SEFA 2Q1SA 4E2ZA 5CDUA 3TZKA 4UREA 4LMRA 5COAA 5L7TA 3TNLA 1PZGA 1UDAA 5JC1A 5JDIC 3ADOA 1E3EA 3W6UA 4PLWA 2Y1FA 3DWFA 2OHXA 1ZH8A 2NVUA 2WWRA 1CQIA 4DQUA 4JJGA 3DFZA 3PWSA 3OFSA 4RPHA 3QWBA 8LDHA 2JKVA 4AJOA 1F12A 3JD4A 4OXYA 4YWJA 3CMMA 2LDXA 1GCUA 3C7AA 1L7EA 1Q2XA 5KJFA 3JQAA 3W8FA 2J5RA 3PHLA 2BELA 1HEUA 4GKBA 2WM3A 2X0NA 2WTBA 3OQ6A 3KHUA 3S2IA 2GR9A 3JD2A 1B16A 3WGIA 2OOSA 4J1TA 1W73A 5KCZA 1E3JA 3CZMA 3WS7A 3OM9A 4UUMA 3I9OA 4J6FA 4K1LA 1KBZA 5I7FA 4NHEA 3I9LA 4XJTA 5JS6A 1IZ0A 3QV1A 4NBUA 2XF8A 2QYSA 1B8VA 3GZNA 2YDYA 1LQUA 3DMTC 4D46A 4YT2A 4R1NA 4S1VA 1HDXA 1XGKA 1MFZA 1HYHA 1YJ8A 3WSWA 2JD1A 3O4RA
chains in the Genus database with same CATH superfamily
4YT5A 3ASUA 4DR4B 5CVEA 5HUJA 3FPLA 3STHA 4B34A 4E30A 1I7QB 1HE3A 1PWYE 1LNSA 4KVZA 3WR5A 2ZRJA 3B6IA 4IIJF 3G7NA 4JROA 1GGVA 1GXSB 4FIZA 4DNFA 1PNVA 2ADFA 4RGVA 4RETA 3AUUA 4KZKA 3QMPA 3V2IA 3EG5A 5JR3A 2D8MA 2PX3A 1WP9A 5LB4A 4IHJB 4N8DA 1OTHA 4DTCA 3TRKA 4Y2XA 4YMWA 1NG9A 3L0ZA 4JB2A 5IUKC 2PMFA 3AG5A 2MSKA 4I5IA 4MQFA 2WD9A 3DNMA 3ZWNA 1OZFA 2RH4A 4B71A 4E5VA 3NDBB 2B8EA 2BFOA 1Z28A 4RFSB 1ZHOA 4B3GA 2ZK7A 1A9YA 3EB9A 2V5UA 4LF6B 3DMNA 2ST1A 2QNIA 4FWBA 2PRZA 4Z4GA 3E5MA 4H7FA 3LXMA 3VV3A 1UEJA 2NUPA 1MH1A 4IH9A 1DTWA 2J31A 3NH9A 2BHLA 5FR1A 1UOEA 2H06A 2I4TA 2YFKA 3OT5A 3RQIA 1Q1ZA 2VUSA 3ZH9B 1ORWA 2Y2UA 4MRAA 5HM6A 4RESA 3HEAA 1GUYA 5CU7A 4D4GA 1Z62A 3RU3A 4NRDA 1L4UA 4IUYA 1DKQA 2WT9A 3DMGA 4PQYA 3VDRA 1WZNA 2YJNA 3KLMX 4YLGA 1NYTA 1ORIA 1ADFA 5JSKA 3PHCA 2JHCA 1KDZA 3O90A 1UQRA 4OHUA 2WAOA 4UMFA 1A4UA 3WLQA 4HDSA 3GNSA 4JLMA 4CL8A 1KRXA 4LY0A 4KPYA 4I50A 4Q4JB 1RVDA 2G72A 4CZ2A 3P52A 1UBNA 3TL3A 1Q0SA 3PDCA 3KUCA 1XXHA 1U0BB 1RWXA 2Y3IA 3FJ1A 1EINA 1U0LA 2PX8A 5NLLA 1YCHA 5DOVA 2Q6KA 4RY0A 1CUJA 4G0ZA 5CT4A 4QEDA 1KC3A 1U9ZA 1QRUA 1GAXA 2LVBA 3R3HA 3IRVA 1QOPB 3SF8A 1NQOA 4I1SA 1SD5A 3U37A 1W49A 1PTJA 2FTKE 3ZPXA 4AS2A 3UMMA 4RH0A 4FE3A 4J0GA 1FDWA 4OQNA 1R5OA 2X2EA 1Q91A 2NYVA 4MCAA 2P8JA 1DX9A 3GGCA 4R8VA 2C9CA 3I42A 5AJYA 2HHAA 2C78A 3LUGA 5AVKA 1E4YA 5D5PA 4RDCA 1WCXA 3N6VA 1ZP6A 2GSDA 4K8RB 5JO9A 5LP1A 1Y6FA 2YMQA 5L3QA 4EG7A 2JJ2A 2YHBA 1V8PA 2BI4A 2REQB 3TOSA 2R6R1 2COEA 1MO3A 3U0BA 2E4AA 3IVRA 4V0MA 1G60A 1GTG1 4X8LA 3NALA 4ZCQA 3U4AA 1T4GA 2IY8A 4D4IA 2JLSA 1FLDA 3R9WA 1K5DA 3EMKA 1VPLA 2QRQA 3VQTA 1VPWA 2YUTA 2QENA 2XJ9A 3EX7C 5KQLA 1PJBA 3OPQA 4D98A 2R8OA 1YXMA 3N05A 5DMHA 1J0EA 1QOZA 4CU2A 4U2EA 1J39A 4JYBA 2G1PA 4CMBA 2F3SA 2UXBB 1ZUWA 2IVZA 3LWZA 1LTHR 3UEOA 1I80A 2Q2VA 2ZAYA 3CN9A 1QF7A 3LQRA 4ZN6A 1CD5A 2ODWA 2PZKA 5BV7A 2QTNA 4LOKA 4M0UA 4BIIA 1U2PA 3QFCA 1JE1A 2XNHA 1W36C 4GEGA 2J33A 4PRKA 1RMQA 2G9NA 3FVWA 2AOVA 4E07A 2IZZA 3H2KA 3MRTA 2G76A 1BZYA 2XUQA 1FMCA 4OQXA 1WAMA 2ES4A 1YNOA 3KOMA 5CJPA 5TY0A 1BX0A 2C4WA 1CULC 1BS1A 4JBNA 3SI7A 3PD1A 1F8YA 2QRVA 2M6RA 2QV0A 5K0ZA 4NYJQ 3TVYA 2OHGA 3KV1A 3EULA 2OAGA 4K2AA 2WUGA 5AUPB 1HDOA 2H59A 3CJQA 3L6BA 4MVJE 2B20A 3K20A 3SR4A 3VR3D 2A9PA 4H31A 1LBQA 2NXJA 2PGDA 4BO8A 1HV8A 4JUFA 2G07A 4ZJZA 3NC4A 5JNWA 5I4CA 1RRMA 1UJ2A 1CJBA 2PN1A 2J7KA 2P69A 3SE0A 1B15A 4I4CA 2K87A 3O4JA 4FXPA 2A33A 2B2XA 2QXUA 4FZVA 4WVLA 1Y5MA 4NXMB 4Q9DA 1SR8A 2PXCA 1W87A 3KAKA 2HT6A 3ESCA 4QYTA 3TI7A 3WHIA 3ZWAA 5BSGA 3HL4A 4X54A 4GVLA 1P19A 4MP3A 1TU3A 4RZHA 1CUFA 4F5EA 4Q4LA 2EFHB 4PYJA 1RBMA 1VMAA 5JQGF 1NPTO 3G89A 4OMUA 4EQ6B 1MB9A 4H0CA 1E1NA 3UWMA 1YE3A 2PS0A 5GONF 1XDBA 2XDYA 4XXHA 5CH8A 1RM4A 4RV5A 2KB0A 3V1UA 2EWMA 1L5VA 2G0NA 2GAJA 3EOZA 4GKVA 3SG0A 2XZDA 2ZSBA 4FI3C 1T91A 3GLHB 2JBWA 4I9GA 1YA6A 3FVQA 2C9MA 2BN4A 4JUDX 3F49S 3KYCB 2Z43A 4PQRA 5K3FA 2QUZA 1ZW1A 3A2KA 1Q21A 5CXSA 1GCIA 3PUVA 3ZCRA 2C1XA 2E6UX 3AGPA 3ILHA 3ANXA 4QGFA 2ZYWX 5BV1A 4B4OA 4GVXA 3Q3CA 1KHHA 2WTNA 1C29B 2GZ1A 2ABWA 1CJCA 4ESOA 4XJXA 3TGPA 3EC7A 1GR1A 4MV4A 4GOJA 4NONA 3IODA 1SCBA 4JJIA 2R5NA 1P60A 1YDEA 5GINE 3GRFA 4IM7A 2UZ1A 3ZW8A 1K8RA 2F8TA 1Z25A 3NHWA 4EL5A 3W5HA 4IMJB 4OG2A 2VWGA 7ADHA 2N42A 4BUZA 1KXJA 1A9XA 4OKNA 1EG7A 3K6KA 3S8YA 2O7RA 3W5CA 3RNLA 3B13B 4IXWA 5FAXA 4D8YA 3EZXA 4D56A 3HWWA 1E32A 3FLEA 3A3OA 1U02A 1B73A 3N2GA 5C8YA 2JJQA 1QZUA 4LUCA 1Q15A 1QP4A 1GKIA 3MVEA 4I9UA 4EVQA 3IPAA 2EIHA 2Y1CA 3QTBA 2EW2A 2QAGA 1KQPA 1PQWA 4RUKA 4Z2YA 3U9SA 1ESNA 1EWTA 5HJ7A 3DWIA 1YASA 5TS2A 3H6KA 2SCUA 1ZCFA 2A0KA 3SZOA 2P9YA 1C0PA 4OXRA 3F6YA 3SJ7A 3QSYA 2PUGA 3CRVA 3I9KA 1QGAA 3GJ6A 1F0YA 2ZUFA 2J85A 4XTCS 2NXEA 3R3WA 2H4WA 1TM4E 4FDTA 4U9HS 1Z5OA 2PNJA 4OA5A 3ZJ5A 1MHPA 3QYPA 4OHWA 1BTOA 3HVJA 5HOQA 1PQYA 3HA5A 2WJ4A 1L3BA 1N2OA 1E96A 4YDQA 3CC8A 1P7ZA 1RXSA 2P9JA 4KAAA 3PGLA 4W7HA 5LA6F 1K4MA 1C4XA 3USZA 3VR6A 4G0PA 3QVLA 5ARBA 4AJEA 1ZH6A 4RPLA 1CRLA 3VH1A 5SZJA 2AQKA 3CZRA 3OO1A 1GTL1 1WVIA 1DCFA 4OCZA 1YRQA 4NENA 1W0KD 1DIRA 3FNRA 3K92A 4E51A 1OLUB 1SZDA 4K88A 4XFDA 2NPOA 3KDSE 3PTLA 2IA5A 3F71A 3MERA 3MQFA 4QU9A 5J4LA 3T4EA 1C3XA 1X13A 4BP9A 5T7BA 1MAUA 3FOCA 3FCYA 3GJZA 4H15A 4OB7A 5FDFA 1OASA 5I7UA 2CXSA 2QTCA 1XWIA 3TTUA 1QAMA 3BREA 4N6GA 4GPEA 5ERXA 1M5UA 4TWZA 1JH9A 4CXMA 4BXOA 4IIJA 3ERCA 5JS8A 4C4SA 4UEOA 3ZBUA 4ZVMA 1WXXA 2IV7A 2W6JA 4IOKA 5CT8A 3DE3X 1Y7TA 3FR7A 4XB1A 3P94A 2FXIA 5IF3A 2FPGB 3D8UA 3E0XA 1KERA 3FNHA 1VLZA 2FSFA 1G0NA 2WYUA 3I28A 4ONEA 5FRDA 3RBXA 1KEEB 4CDNA 5NULA 3H9GA 4C1BA 1JFFA 3AQIA 3JVVA 2C5AA 3HO8A 3MYYA 4KODA 4MV6A 1J5EB 4M6WA 4L6CA 3C6KA 2R7NA 2WQZA 1EGVB 3EGWA 3AZPA 1RKBA 4H77A 3UXEA 4PBTA 1LX7A 2IUUA 1QFZA 3QEMA 5DYIA 3V8RA 2Q3JA 1EFPB 3MGKA 2FR8A 4BRUA 4ETWA 2LP4Y 1H0KA 2J9YB 4P4SA 3ZHBA 1DBSA 1JEDA 4D3XA 4W5RA 4UXHA 3LYHA 5GJCA 3JAWB 2NUTB 4ZXFA 2EIXA 4A4DA 5JBIA 3MTJA 1QHHB 4HN2A 4KIGA 2IGBA 2JFXA 3A4YA 4D1YA 1QS0B 3BXZA 4BX9A 5C3UA 1KZHA 3R77A 5F4ZA 2QTVB 4G1FA 1CUIA 1F06A 4Z7JA 3HFRA 2VT6A 1B8NA 4AJLA 3K8OE 1DAOA 4OTZA 5CYOA 1Z5VA 1WMAA 4S2EA 4WKPA 2NZ2A 4NBLA 4DLVA 4F1WA 2ODBA 2KJQA 4G65A 3UT6A 2ZVQX 5G1NA 2VP0A 1CUZA 3FIUA 1VM6A 4DCOA 2YWHA 1UEXC 1X7XA 3EEFA 4RKQA 1KOGA 2C29D 5C9ZA 1WXWA 3RSSA 3F5DA 3NP7A 4OSEA 4RX1A 4Q3KA 4TPKA 3RM3A 4HK4A 1UPFA 1I33A 1L7BA 2WZDA 3OEHD 3OTHA 3OJ0A 4WCDA 2AHOA 3KX2A 3O4HA 4HF7A 1AG9A 4MAMA 2WQ7A 2P27A 3WSVA 4AKIA 4MRMA 3Q4GA 1UBEA 5IJZA 1UFKA 4PVDA 4TYNA 4GRIA 2BZSA 4F4FA 1E5QA 1XDSA 4MEAA 1UBGA 1WM1A 1P44A 3HZRA 4IGIA 4UCQA 1QMPA 1AVTA 5C5EA 3LE8A 3BXEA 1TEXA 1TJ3A 1TAQA 3IQZA 2ZM6B 3NAGA 1MIOB 2MSWA 4QWWA 2EG9A 4QOIA 4XWKA 1NI3A 1SN7A 3A58B 4HY3A 3I0NA 2QR2A 1V11B 2WF7A 3ZTYA 1XD2A 2QI9C 4JQZA 1Q1BA 3DOJA 1X94A 4ARZB 4MINA 1OJ7A 2FK7A 3P2IA 3QKTA 3DZ8A 3L8EA 1S2OA 1BJTA 3FNGA 5HZHA 3NOOA 1Z06A 3MJDA 6CHYA 3DLPX 4RIEA 1J9GA 3OZSA 3GK3A 4WXEA 4YI5A 3D7RA 2O48X 4H6PA 3VPSA 2IEGA 4Z7NB 4ZDKA 1U2QA 1F17A 4A23A 2IZ5A 1JH8A 4PN7A 3GBVA 1T9GS 1V0JA 4UULA 3C5VA 3COVA 5DHSA 2G5CA 2RHHA 2YZ7A 3CPEA 4BFWA 4M9UA 1Z5ZA 2OCAA 1U7ZA 4G1EB 4D97A 2AZXA 5DCWA 4J2HA 4CM1A 3AR7A 2X4GA 4N9WA 3WGKA 3PEWA 1V43A 1G2PA 1B4DA 4KFTA 4RBNA 4WESA 1A4RA 3VZPA 4YRKA 1NVEA 1R27A 1SEPA 1D4AA 3GCWA 2F64A 4H6XA 2VPZA 2BRUC 1O9HA 4I4IA 3WIDA 4MA5A 3CF2A 2A9RA 5FOQA 5KSOA 3HHEA 2N0SA 2P9ZA 1T2AA 2NU7B 4RIFA 1W4AA 2BW0A 5EJGA 3EGOA 1QFYA 5F33A 1ZIXA 4QA9A 2DHQA 3TUJC 3ZGXA 4F97A 1AQJA 3BYZA 2CYBA 1ULAA 1DUIA 4HYEA 2D1RA 5TPZD 4WACA 3INYA 4DR5B 3K0BA 1NFRA 1XU4A 5KYTA 1IN4A 5EJIA 3AI3A 2YDXA 4HNUA 2ZSAA 3K31A 2FPIA 4Y2YA 4I4TF 2O8CA 1GVNB 3AVQA 5AP9A 4G8DA 1NKTA 2ZYVX 1NMXA 3GYGA 3M5CA 5J5AA 1KE1A 1ZN8A 4TXMA 4RH1A 4C7JA 1K0UA 1RR6A 3H0KA 3ST7A 3W9SA 3PEYA 4AB1A 2FG6C 1H1LB 4J0DA 1ISPA 1NURA 2C4VA 3K5WA 5CBKA 3AIMA 4P98A 4GRAA 4FN5A 2YZNA 5EHZA 5K7SA 3HVKA 5L4SA 4TMZA 1NPDA 1ZUHA 5FA5A 1U28C 2N46A 2AE2A 3PSHA 4LN1A 5CLFA 3TGLA 3IQIX 3PC3A 3E3LA 2OP0A 4U6NA 5CB4F 5BP7A 2AFHA 5A71A 3TLBA 1WPXA 1Y7PA 2FVXA 1B6TA 2PO5A 5I9SA 1C3LA 4DUYB 3IMGA 2V7PA 1TD9A 3ZI7A 3RUDA 3VTFA 1RYFA 4BMOB 2QTAA 4R3NA 5TMBA 3O1IC 5T8KA 4WY8A 4IWNA 4JP5A 3HKBA 1ND5A 1ZA1A 4KRYA 4DBVO 5JQGA 1UUFA 4KO1S 4J49A 1OAKA 4ROTA 3DAHA 5LOVB 5GONA 1EE1A 1M1NA 3MBIA 2XTMA 2PYIA 1S9DA 1UXOA 2VHEA 4FOPA 4YAOA 4LYEA 5IMBA 2IWHA 4DRZA 1DMRA 4FFDA 3JWHA 4JHXA 4NJEA 4DW8A 4YRZA 1SU7A 2EU8A 3BJRA 3ETHA 3KR0A 4NF2A 1C80A 1XLWA 1WL8A 5HHTA 1PZEA 4UU0A 3SSMA 3ABRB 4AF6A 1CUGA 3ECAA 4TTIA 2EGUA 2QROA 1GAJA 1TZBA 5A5VA 4KH0A 4V0LA 1JDVA 3DFUA 3GN1A 3MBKA 3FUCA 5TR9A 5I51A 3UHJA 1EFDN 2Q5QA 2BMJA 2VCYA 3BQ9A 3O0DA 5AK6A 1X80B 5JH7B 1G5TA 1BD4A 1IEVA 1C7IA 2PNFA 3NT5A 3NGXA 4M7WA 4Q05A 1RSZA 1IYZA 2BCJQ 1SUAA 1L1QA 1Z2CA 2XMDA 3TNJA 1KPGA 4EPWA 1N0UA 3FF4A 3GD5A 1A88A 3WICA 5K8JB 3K70D 2PAFA 4XWGA 4LKRA 1ZNYA 1GZHB 4JLUA 4RHXA 2IPXA 2LWIA 2JFFA 3C7CB 4JUAA 4MGEA 4RPGA 3OFVA 4UZFA 5CIWA 3SQWA 1OGYA 1YR2A 2IEYA 5AKXA 3K4QA 3IALA 1C1HA 4NOJA 4WZBE 2I1QA 1E2JA 3DCJA 2HTEA 3KXDA 3KZOA 1MJHA 3UJNA 4W5OA 1J90A 3VXKA 1I94B 3CNEA 2Y2VA 4F04A 5E95A 1RQ2A 3SLRA 5JZOA 1PJLA 1UBFA 5KPDA 1WOYA 5ED0A 1YFZA 1VKHA 4P84A 4MGZR 1VL2A 3P0RA 4ADSG 3PIRA 3ZBTA 5C80A 1PYDA 1DXYA 1VPEA 1VZ3A 2GPYA 2PS3A 1QQAA 4QJIA 2ZZNA 5F52A 3NTVA 4OXXA 1V7PC 1RYDA 1TTQB 1NW8A 1CJKC 1XMJA 2XGSA 3JQFC 1JEYB 1YS1X 3I73A 3RG2A 4AS1A 2RGAA 1OH8A 1YH3A 3GLKA 1SCDA 2GJ9A 3NNNA 2TECE 4II3A 2ZWVA 2QY9A 2FN7A 4OD0A 3LFUA 5IAGA 1Q1QA 3GCGA 2M6KA 3NWBA 3TX6A 3PC8C 3KIPA 5LA6A 2X41A 3OIGA 1ID1A 1GQOA 1RHMA 4CEJA 3ZS8A 2C20A 2AH5A 1I1QB 2I65A 4KR9A 4MWBA 1SQSA 2GASA 4AJ9A 4DR2B 4Q1EA 2O0HA 3ZZMA 2X2OA 3T5BA 4PYLA 1OROA 2OZKA 4DIOA 4RVOA 1NX9A 3QOWA 3WXMA 1T5TA 1QIJA 3KU1A 3S27A 5GY7A 1VE3A 2KQUA 4BIMA 5LU8A 4MV7A 1IN6A 4NEQA 5IW8A 1T3GA 5J1TB 3D7SA 5LDDC 3GG2A 4C5AA 2W7TA 1YS6A 3KLNA 2D5LA 2NQTA 3D3JA 3VZQA 4HRXA 2PZGA 3UAYA 1ZIOA 3CJRA 1MAWA 1MEOA 2VF5X 2C3PA 3MMNA 3U49A 1ZGZA 2XZLA 1JQEA 1NVVR 3EZ7A 3GZTB 1TKCA 4A8JA 1Q0TA 2C2YA 2R84A 1R12A 5KJ6A 1PN3A 2AMLA 5JSHA 3A11A 4MYDA 2VHXA 3OPVA 3H65A 1UC5B 7YASA 1GVHA 4JLVA 3RYCB 2HA5A 4DAEA 2DPYA 3FHJA 1ISGA 3TQIA 3KJIA 3JYLA 3R3UA 3WA6A 1W44A 1M8KA 2VNIA 3BRWD 3G9QA 5B7NA 3LY9A 3G6KA 4ZQHA 1C3OB 1QFXA 1U2GA 2HWKA 5A3VA 4BNTA 3K6JA 2Q9CA 3VR3A 4ER7A 3GDHA 3ICCA 3V3KA 2H63A 3QMMA 1XTKA 4JBLA 2X2PA 2IY9A 1DWQA 1DXQA 4R1PA 4JLWA 2X6TA 5IEJA 1G3QA 2P1ZA 4NULA 1HYBA 2VNJA 1BFUA 1IY9A 2HRZA 4QYSA 3R7SA 3RK1A 4WZAE 1TI7A 1QB8A 2C9OA 1P6UA 3OETA 1JAHA 1NP6A 4KKXB 4ASUD 3K96A 1CY4A 3MT8A 4GLJA 4LCJA 4E3WA 4YJ3F 1NGSA 2QTTA 3ISVA 3HCCA 2Q5FA 4QULA 1CY2A 5IUNC 4JWKA 4L15A 2GERA 3GF4A 1C2YA 2VYCA 3JSAA 3KYDB 2PHZA 4LBWA 3HP4A 2R4UA 2VRCA 1Q1GA 1QGDA 3ZKAA 1EX6A 1HQDA 4AMVA 2J0SA 5D86A 4RK6A 3L8MA 4TQ9A 4N54A 4HFNA 1TZJA 3K2EA 3W6ZA 3C14C 3RVQA 3B36A 1VLJA 3HJGA 1AQIA 4F0JA 1IPHA 1LRJA 2HWUA 3HUEA 1BH2A 1Z56C 4ID9A 4KRXA 4MO9A 1H8ED 4ZANA 4BJ6A 1JKFA 1QK3A 2WDZA 4O0LA 4B6FA 3WGZA 5JZMA 4URYR 2XYHA 1QRAA 16PKA 2AFIA 4KC0A 1MV8A 3DWEX 3ZU3A 2EEZA 2RDMA 3GCZA 3D7LA 2P6UA 2R6GA 4U6SA 5FOWA 4QJ4A 3UV6A 4FFVA 3C4JA 1E89A 2XUJA 3GVXA 4DLZA 2X9NA 2P9GA 4L85A 5E3HA 5DNCA 1OF1A 3TRIA 4IJMA 5F3DA 2ZPTX 5EQFA 1V41E 1EMDA 2F90A 2H07A 2XV1A 2QTHA 1PFKA 5BW6B 2YJ6A 4DUGD 4YFYA 3IYLW 5L7TA 2RARA 1A7UA 3I4CA 3WKDA 1W6RA 2AOUB 3TKAA 2WIFA 3IBYA 5JXIA 2FI1A 2DVMA 4B0OA 1P4RA 3W8NA 3VYVA 1J8VA 1HE8B 1CFJA 1ZK1A 5AI9A 1WULS 1XQYA 1TM2A 3LNCA 1ZR4A 4KXLA 1RLJA 1I9CA 2OZLA 2DUMA 3L7AA 3PK0A 4G8CA 5D3MA 3KQTA 1EUDB 5GJBA 2GTIA 1CHDA 3I72A 5LQKA 1XNHA 4DKXA 1M7BA 4Q37A 2DERA 4FI3F 2Y0BA 2IEDA 3DM9B 4NP6A 2AWNA 4O25A 2E1RA 3QXXA 4IXMA 3G79A 4QYIA 4RXTA 3RODA 4BNDB 4CHTA 2ORVA 1TQ4A 2BBTA 4PIVA 2WJGA 5LXTB 3N0RA 1IZ9A 4ENTA 1YACA 3LRPA 4II2A 3MRVA 2CJWB 2X15A 2I2AA 3AR2A 1YNSA 1D09A 3Q7TA 4BKPA 5SZHB 1VYUA 1ESCA 2CFCA 1V16A 2AUNA 3DCNA 2O4UX 2R6CA 2VK2A 1YB1A 3NW9A 5AWFC 4EH1A 3HJFA 1ZHFA 4OHBA 4BLSA 4CGZA 2C2BA 3FAZA 1QH9A 4MUEA 1J0XO 4INAA 3LLMA 5FOXA 5I47A 1R2QA 1NBME 1WX1A 3I83A 2H1LA 3IA7A 4CI0B 3GLGA 1CUCA 4DDUA 2J9RA 1AGNA 3I32A 3O3NB 1B8OA 3WRYC 4RZSA 1LH0A 1U0RA 4XGIA 4WIAA 1QX4A 2XWSA 3VKFA 4HNAB 5LXTF 3G5UA 1LLUA 2QP4A 3FBTA 2H2HA 1DFHA 1HM5A 4G41A 1JQAA 4I4TA 1XNJA 4MVJI 2Q29A 4W9MC 4MV5A 3Q3GE 3TJZA 2GBFA 3TOZA 4UUOA 1VXRA 2Z5VA 3OCJA 4QT0A 4AUEA 2QVBA 2EQBA 2OMKA 1IOWA 2J4CA 4MVCA 4Q48A 3M4JA 1DUSA 2IV2X 4CF3A 4X00A 2PEYA 3ZVMA 5ITZB 4V0QA 4FT2A 1N6RA 4MTLA 5CB4A 3P9YA 3W8EA 5AW8A 1BSVA 1BYUA 1LFAA 2BD0A 1W4CA 4XPIB 2ZW9A 3GVPA 1M73E 1WNTA 3AETB 3FLBA 1T24A 1YL6A 3AT1A 4QGGA 1P72A 4XCXA 1BG6A 3KKQA 3N1UA 4R1QA 5TGZA 5H70A 1CYEA 1TNDA 2F9MA 1N77A 1YKGA 2XMCA 3JQ8B 1WCIB 3L9WA 4L8YA 1LJ8A 4AQDA 1Q0RA 4K9MA 2V97A 3V3TA 3N75A 3BFPA 5B6JA 2IEBA 2JAUA 2QJTA 3UT5B 2OCBA 2JLBA 5CYPA 1GG5A 1SOWA 2VTVA 3NVAA 2CXUA 4WLEA 4O5AA 2YIDA 4ALIA 3Q11A 3DVRX 4JVMA 4ZYZA 1N3BA 1XCJA 1G5RA 3AVPA 3FJOA 1QX3A 5JDCC 5EKXA 4KLAA 2DQZA 4PC7A 2QRUA 3EFHA 4AWXA 3W05A 3K1AB 2Q0SA 1XEAA 3OJLA 5AKKA 2XCSB 1UFVA 1VB3A 3O82A 2VJMA 5AKJA 5GV7A 4PN3A 2XDQA 3DEHA 2C57A 2ATEA 2H7VA 5EXSA 3I8SA 1DBRA 5DNAA 4R9SA 5KTOA 1LWOA 3HGQA 4FR5A 3BFKA 3NCHA 3VPAA 2JLXA 4TT3D 1O0CA 4LHXA 1HH4A 2BDTA 1P7CA 2J3DA 1Q7BA 3J81k 4BLOA 3V34A 4PLZA 4UFOA 1QWOA 4EB3A 2BLLA 4OAQA 1ES9A 1O4VA 1VL0A 3DMDA 3Q7IA 2G7MC 3GJ7A 2JNWA 4V24A 1E64A 4HG2A 2RK4A 2VNHA 4CPDA 2VDWA 2ZAGA 1IHOA 3HVHA 4HGOA 1L6IA 4YJFA 1YR1A 3ZDAA 5CB8A 3F3KA 2KHZA 3TQQA 1M1YA 1UMBA 1SNYA 2RGYA 1AUQA 2MSNA 1OI2A 1Z5GA 2AYXA 3JATB 5A2GA 3U7FB 4WBXC 1I7NA 1XZIA 2HBQA 5DLDA 3BB4A 3WNQA 3C3JA 3IVMA 3CSSA 1P5HA 1XI2A 3LIIA 5EZSA 4OQMA 2N75A 3RREA 3RWBA 1T35A 2UUBB 4NMHA 3O6VA 1QE3A 4N5DA 5EPOA 4I55B 4QDKA 4TQUS 5FR2A 1H6DA 3QE4A 1D6NA 1JLKA 2P65A 4FMCF 4H1UA 4WFJA 2O8FB 4NBWA 4Q34A 4IFIA 1SIOA 4QQ8A 5JLAA 3PSAA 1JBQA 2G04A 5TGDA 3ZCSA 4RPIA 1OWPA 2ZJ1A 3GA5A 4FYWA 4HAZA 1OV4A 2VLIA 2R1TA 3H8WA 3LQ2A 4INJA 4S24A 2IOYA 4NMMA 2O6HA 5U1PA 2JGJA 3PJDA 2FN3A 4ON9A 3S7ZA 3TLGB 5K6TA 2FW8A 3HBNA 5EKTA 4B4VA 1K8XB 4J7UA 2QGZA 4BNNA 2Q45A 2QZJA 4WKCA 3TZQA 3JQAD 1TQHA 2DTDA 3L4BC 3PQEA 1WOMA 1PF7E 1H23A 2IE0A 2LGJA 3NHAA 1KI8A 3TNDA 4Z1OA 5LUAA 4YCDA 4YDRA 4D4LA 1E5LA 1GRCA 3UUWA 1KEZA 1COZA 4L5AA 1UDWA 1W1IA 3PQ3A 1OXXK 3OECA 2O8NA 4EFNA 1J7JA 4GMFA 1JVNA 4WBSA 2HY7A 3WRVA 1GAEO 1TMYA 2OBMA 1NBWB 1TEHA 3TEJA 4LHZA 3I5MA 4H27A 2FHPA 5HYVA 1P9RA 5I7VA 1R8JA 1QZTA 1D07A 4UJ5A 3ROEA 5JCOC 4Y98A 2NSJA 2Z2IA 3BGIA 1OAAA 4BGEA 1JQDA 3K2BA 2P11A 3HU5A 2HK6A 3QLJA 4BYGA 5JRJA 4DJJA 2UYHA 1YHYA 3OPXA 3BGWA 3L7DA 2QX8A 1QCDA 4AX8A 4EJFA 4A2QA 1A96A 1CEYA 1C3JA 1N6OA 5JXJA 2ORED 1Y81A 4MV0A 4OHOA 4KK3A 1EFVB 1GLNA 1V8OA 2VKTA 3ELBA 3EVBA 4YXWA 4IXDA 5FWYB 1GGMA 1P2SA 2B8TA 3ZV4A 3HN6A 4ARIA 3GGJA 4E2XA 1T3ZA 1URPA 3LY5A 2CJPA 3DAFA 3QU4A 1EX7A 4MR9B 1LY1A 4TMTA 5KTNA 3K6SA 1TVCA 3GFFA 3A6HA 1UP4A 4PTZA 4YJ3A 1TF2A 3DTVD 2W58A 4Z86A 3IKTA 2OSVA 2X40A 3O8NA 1ADJA 2C3UA 1W85B 5THQA 2ZYIA 1SKYE 4CRWB 2XUGA 3QG5A 4YRSA 4JJAA 1XVUA 1EWRA 2E7ZA 4Z4HA 2NU8B 1XK7A 4A0QA 1G7CA 1PBNA 5HUHA 3LF1A 5BUQA 2C2ZA 4WMLA 4M0DA 1LRLA 4DCMA 3SJZA 2IWRA 5T4FA 2WR8A 2CFOA 3UK1A 1TCCA 1BVYF 4UHCA 2GFHA 2PSEA 3FSGA 1AZWA 4GPIB 3WAKA 5KYYB 1ZM4A 3NDRA 1Q3TA 3A4LA 2YBDA 1BHQ1 2C5SA 4PG5A 3FWYA 3VC1A 2H5IA 3BFJA 1GRNA 4M55A 4I46A 3TLAA 1SIUA 4BMYA 3KZVA 3OQIB 3HCFA 4NC9A 4CT5A 4Z7OB 3UAVA 1Y1SA 1Q0UA 1T0JB 3TSCA 3SKVA 2W0MA 5CYFA 1FY2A 1LBTA 5KYNA 1Y7IA 1WY5A 2PKXA 2WV9A 3V7WA 2HK8A 3PPIA 4WZAB 2PKQO 2OCKA 3ONNA 3KELA 1GY8A 3DZJA 5J23A 4LNUA 2RHTA 3CINA 3PL1A 3NIDB 1AGPA 2GB4A 2MIIA 5JAOA 3OZXA 1TOAA 4G0VA 1XXHE 4TN1A 4DCNA 4AM8A 2X5NA 5G4KA 1NE2A 1T1IA 3D5EA 2HMWA 4CF7A 5GADl 3CH7A 4ND1A 2A5GA 1T4CB 1FK8A 2CNLA 4QM7A 5PGMA 1KEWA 2MSLA 5FBQB 1W88A 3H2IA 4F1JA 2BEWB 4OI2A 3P9CA 2B6HA 4KW7A 3O1JC 3REGA 3LT2A 4BGIA 2OENG 3RT7A 2X14A 2YFHA 1E2IA 3GB9A 4DJDC 3R0VA 1CNMA 4B74A 1TYAE 1T9CA 3OH8A 3JARB 2Q1WA 2C2GA 2Y1DA 3BMNA 3H11B 4DDTA 1NF9A 4ZVKA 1SG0A 5HRUA 2Z09A 3CKMA 5FI0B 1ZJWA 2D7CA 3QEOA 4YS6A 3ZBPA 3CLSC 4DMCA 1AV6A 5TLSA 2YIMA 3F7NA 1R6UA 3COJA 1G66A 4V0ME 1BN7A 2H2DA 5AVXA 4LF9B 2FA9A 2R7LA 4DA8A 3QEKA 3QU5A 2QGNA 1KEKA 1T43A 1SVMA 1V5WA 5LMCA 1TVKB 4AW9A 3AL0C 1A4IA 3ANMA 4JK3A 1TK3A 4PC3A 2VQ6A 1Q1NA 4TV8B 1YFJA 1WZCA 5DN9A 4ERXA 2Y05A 4WA8A 3SEAA 1Y48E 2H29A 2VCHA 3OQ1A 3M1AA 4JI1B 4JI4B 2SKDA 4MLCA 2VAXA 1E6WA 4BNXA 1C5KA 2ZQYA 4LF5B 4KXVA 3X2EA 1NVAA 2JFWA 4IUCS 2AR7A 1JU9A 2UVQA 2YCLA 3CGGA 4HDMB 5LXTA 2GCGA 2QRGA 4OMFG 2RB5A 4R0VA 2JBAB 1F3OA 3D0QA 3FPEA 3X43A 5ERGB 3ORFA 3WQBA 1WF6A 3AFHA 3IAS6 4QGAA 1ZWKA 4QG3A 4U7TB 3WYCA 4OU4A 3IT0A 5E9AA 1SU6A 2OILA 5AW0A 1LK0A 1YRBA 1ONBA 3B6MA 4TKLA 1K97A 2JD2A 4X1YA 3VTKA 3BFXA 3AJRA 3GEPA 3IT1A 3KWLA 3P2YA 3OMXA 2I7TA 4ILEA 3NPMA 2ZJFA 3S2YA 4R0NA 1OR8A 3R3ZA 3GQBB 3C87A 5I9BA 1FUUA 1M74A 2HJHA 2J0UA 1ZGCA 4RA9B 3U3DA 1OLSB 1WDLA 1Z7WA 4JHLA 1TLFA 1S8NA 3HV2A 4MYCA 5HCIA 4BMDA 5EZYF 4PHCA 1BDMA 3JQ7B 1OFUX 3I6ZA 4MPTA 2PD4A 4HDRA 4J76A 4DBZA 4PX2A 1Y3FE 3MGGA 2VHJA 3RTDA 1N5IA 1DTSA 1RPNA 1WXGA 3E18A 4G2NA 1CQZA 2FK8A 2NT4A 2OO7A 3H9EO 3COYA 2MYPA 3C6MA 1WCV1 3JWGA 3MFYA 3UAXA 1EBFA 3WAGA 4LZAA 4D9MA 3COSA 4EA6A 3H1FA 5JZBA 1VBMA 5CXQA 3I3SR 4IOJA 1YU6A 2PXAA 4XDZA 4CLDA 4OQFA 5F7JA 2GDZA 5LM3A 4LY6A 1PSDA 2WFZA 4LZJA 1SUWA 5LVAA 1BIFA 5FULA 1P1FA 1PKEA 3IEPA 2QKYA 5A04A 3SE7A 4EZIA 3JWPA 1TQ2A 1GYPA 5BSMA 1CEXA 3V4OA 1N0WA 4K87A 1AB6A 4NU6A 1JAYA 4WFIA 1LW7A 1QIFA 2P41A 4YCLA 1FP2A 4EPYA 2VQFB 3PC2A 3PRJA 3CT6A 3MTQA 3UCXA 3WGJA 1AE1A 3OFJA 3W5JA 4EY8A 2FG5A 4EGSA 2F48A 3U4IA 2Q4TA 2O9JA 4K6KA 1N3YA 3QVMA 3MJSA 1OXVA 4AFNA 7ABPA 5D6NA 2ZREA 2JCSA 2JFZA 4CYMA 3R1IA 3E4DA 4CVNA 1K3FA 4IINA 4R5MA 1FJGB 1TAUA 3Q2OA 4CIWA 2GZRA 2O59A 3REFA 4Y2QA 2OFWA 5IKMA 3U44B 3BGOS 4RYLA 4BFXA 2GEKA 1PL7A 3V9AA 3IIMA 1CE8B 2Q4BA 3OCZA 5EJ6A 4G25A 4MEJA 1E59A 5AIBA 2GN4A 3BDIA 1SXHA 3T1HB 2XQIA 3VKVA 3EXHB 4Y6QA 1SIWA 4KQ6A 4RTOA 2QQGA 1ILEA 1MMFB 5JNVA 2G28A 1PBTA 1JIVA 2CHGA 2D2FA 1K6JA 3DE4X 3PR3A 5IX8A 2GBGA 3QEBZ 1NXWA 3EGEA 4FIDA 3VRHA 4GXQA 4IV0A 1ULSA 2JFNA 3EDYA 5ED4A 1BXRB 3U17A 5ALSA 1EA7A 1N9KA 2RI0A 4QQNA 4HDNA 1NDQA 4KXFB 1DBVO 2H0RA 2Z1DA 2D6FA 1ZAKA 1ADCA 2RHGB 1FUKA 3D1VA 2MR6A 3AHJA 3V8NA 1V8FA 3FMVA 1L7MA 3FPKA 4JYPA 1D1TA 3C4VA 1CG6A 4JI6B 3OU7A 2W00A 4XWYA 1SHUX 2J3HA 3I64A 1NZJA 4DLYA 3BX1A 2MWMA 3L1KA 4AKTA 2B4KA 1IMOA 3DHWC 4A2PA 5A6VA 4HNQA 4P4UA 3WK5A 3ZXUB 3PQ8A 1HG1A 1CZNA 1DMSA 2FDXA 1YQWA 4HWPA 4R9NA 2J5BA 2A6PA 4YA6A 2REOA 4FFNA 4ZAWA 4PNHA 5BQ3A 2IYTA 1BS2A 1NF2A 1ZNWA 1RCFA 1ORTA 2X8BA 3FVRA 4FNOA 3DR5A 3RK0A 1DGQA 1PW7A 4F91B 3EF0A 3ZU4A 9MHTA 5HQ3B 2YHIB 4W9NA 4LGVA 1FSZA 5H3CA 3H2ZA 3KUDA 5AJTA 2H51A 2YNMD 4NY1A 1ZJ5A 1ORDA 2CXHA 2BT4A 3L84A 4C7XA 4KFRA 4H4CA 3MHPA 2BCEA 2QIOA 1JL3A 4DQVA 1R37A 3BWDD 4PCUA 2D59A 2C0QA 3ZIAD 2FWPA 3I04M 1FYWA 3K0FB 4R2HA 3ZUPA 2OY0A 5CD1A 3I04A 5DGHA 1RVV1 1RAIA 1F4LA 1DC7A 1SCUB 1K8YB 3O74A 3PJEA 1KYZA 3KHKA 3AVOA 3LLSA 1YVEI 1ESEA 4EHJA 4RPJA 3C3EA 4AZWA 1JHAA 5J5CA 1BW9B 5A5FA 3NBFA 4LJAA 2QX4A 1EB9A 2H52A 1J0CA 2PU5A 2F43B 1VBFA 1J24A 3GW8A 2EDAA 2XKJE 5HDBB 4CMIB 4MO2A 3SKXA 3IIKA 4DDHA 1UKZA 2NU6B 4R40A 4YRRA 1F5SA 1IQUA 3ZU2A 4BWYA 3QKSA 2P75A 4B2IA 2WJ6A 4C0QC 4COOA 1G7RA 2GLXA 2G4VA 4TWIA 2CMGA 1W5EA 3CTMA 4XGQA 4RCVA 1SHZA 1JHOA 1JLMA 2XY4A 3CISA 4BZXA 3DULA 2GKOA 2I4IA 2IHBA 1FNCA 2PGOA 2IIBA 2I2XB 1MUUA 4JP8A 4E5UA 4YROA 1JQLB 3OHPA 1KAOA 4HL6A 5GMOA 3BSSA 5IS2A 2BEUB 1SKYB 1QANA 4BKQA 1YIOA 2YHUA 2LXNA 3AR8A 4RKFA 3WGMA 4IKOA 5AM3A 1NRIA 3GNQA 4KIWA 1BYIA 4NFLA 3JQGB 2GCPA 1TD1A 1PJTA 2H4ZA 4Q7EA 3O8OA 5AM4A 4QFDA 2ZWPA 4JC4A 3RU7A 2P4UA 3QV2A 3S4YA 1I4TD 3EBLA 2R00A 3D7KA 1K06A 1Y5RA 2C0PA 2AC7A 1T8TA 1UP6A 1JWBB 1NJ1A 1NW9B 1XU9A 2GETA 2WSMA 3OBIA 3U1VA 4JSYA 3T7CA 3AF6A 1RCUA 2NNLD 4KBGA 1EUCA 5DK6A 3ZGNA 3X1DA 2ZPUA 4PPYA 5ALUA 4GM4A 4RELA 3PKIA 2GLUA 3CZQA 5JHHB 4UAVA 2HXSA 1DKLA 3MXOA 4IDAA 2C1EA 2JGFA 2QVGA 3H5IA 1J0DA 3H18A 4CTMA 1EGHA 3BIWA 3WJAA 3FHLA 4IIUA 2PFKA 2GRUA 2KX7A 4Q24A 1AH2A 2QY6A 1O3YA 1UM9A 1QNFA 2JFBA 2QQ0A 1AGYA 3HM2A 1O57A 3IV6A 4Y0AA 4LISA 4Z6KA 4ANFA 4GOOD 4XGNA 3BMCA 4WDQA 4OK3A 1K2WA 1BFKA 2P2DA 2RH9B 3DMFA 3QY0A 4LQ4A 3USES 4H7DA 4PX5A 5ALJA 5HTKA 5JZVA 4EPXA 2EC5A 1SKAA 1SUPA 3VR2A 4EZEA 1CZUA 5FO1A 3FKQA 3JYOA 3VTAA 4GBMA 2R68A 4JT4A 3UWPA 3ELWA 1X86