3U4HA

Cd38 structure-based inhibitor design using the n1-cyclic inosine 5'-diphosphate ribose template
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
245
Chain Sequence
b'QTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title CD38 Structure-Based Inhibitor Design Using the N1-Cyclic Inosine 5'-Diphosphate Ribose Template
pubmed doi rcsb
total genus 81
structure length 245
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2011-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3u4hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u4hA02
1ZK3A 2GN9A 5JW6A 4R41A 3ICPA 4MJLA 5EQDA 5ENVA 2X58A 3G79A 3UCXA 5T5QA 1K3TA 1LA2A 4IZHA 4Y8VA 3UF0A 1D8AA 3H5NA 2DTEA 3ZHYA 1GPDG 4DUPA 1W0CA 3RJ5A 1DXYA 3GOHA 3K96A 3RFTA 3Q1LA 5L51A 3VPGA 3O26A 4KP7A 4PLHA 5I7EA 4BNXA 4E0BA 4IDDA 2GR9A 2ZYDA 3VAZA 3L4SO 4MVJD 4E5KA 1VKNA 4RLHA 4IQ0A 1A7KA 1TT5B 5JY6A 3UXYA 1UZMA 1NHWA 2EHDA 1YL7A 1E7MA 4GX2A 2O3TA 5DBGA 5JCXA 3VH4A 3GDOA 1RM3A 4Q3NA 2CF5A 3GNSA 5JAMA 3WSWA 4DBZA 5LC1A 3CH6A 1OMOA 1KVTA 4K9DA 4BHTA 1HRDA 4ALJA 1VC2A 1XU7A 4K6CA 4I8XA 4DVJA 5F5NA 3WB9A 1GZ6A 1UR5A 3E18A 4W4TA 2B4QA 4DC1A 2O4UX 3I3OA 4CQMB 1EUZA 4IS2A 1B26A 4RVFA 4EITA 4XYLA 2AQ8A 3ROQA 2XXBA 5T8KC 5L4SA 5BSEA 3O8QA 3E5RA 3QW2A 3DR3A 4JIGA 5T6BA 3JQ7A 2BELA 1NR1A 1B0AA 2ZKLA 2VOJA 3M6IA 3LC2O 1XGKA 4HV4A 2FWMX 1PJQA 2I9PA 3OMLA 4R5HA 1QYWA 3WQQA 4IXWA 3UCFA 3QWHA 4L4XA 1AE1A 1EBFA 1EDZA 4Q39A 4NFHA 4YVFA 4WLFA 5DCWA 3WGGA 4PVCA 5BT9A 4DLLA 1VJ1A 1U2GA 1NFQA 1KYQA 4UVIA 1E6WA 3U0BA 4B3JA 3GR6A 2AMFA 5JNLA 4AJ4A 2PTGA 1YVEI 2B83A 2P2SA 1GV1A 1MXFA 1FDVA 3JQ8A 4TQGA 1TLTA 4E2ZA 4IMPA 3ST7A 4OMUA 1R16A 4MDHA 4P22A 4BMSA 4F3YA 4IDCA 4LRTB 4CLEA 3RSHA 5AXCA 1Y5RA 4EBFA 2E48A 4ZRNA 2BFMA 2JD1A 4TZKA 2H63A 4JN6B 4YYZA 4ND1A 1M6WA 1X7HA 2LDBA 2YFQA 6LDHA 4BO6A 1ZXLA 4BNUA 3WICA 1YB4A 4IDAA 2PNFA 3G17A 4BVAA 2D1YA 1UJMA 4IZIA 5EESA 4L75A 4NQZA 4IIVA 4J9UE 4NR0A 3PZRA 1IYZA 5FYDA 2VT2A 4BGVA 2A92A 4XD2A 3JQ9C 4FGSA 3ZV4A 1SOWA 3HN2A 4E5MA 3WGZA 1A4IA 4J7CA 1ISFA 1XR3A 4Z9FA 2IYPA 2Y67A 2Z1MA 1ZJYA 3BMNB 4FPXA 3JD0A 4BKUA 3VVBA 3FN4A 3WWZA 2CNBA 5EPOA 4BO9A 3ZU5A 2RBEA 4ROSA 4DGSA 4XGKA 2DTXA 3ZV3A 1LSUA 4MP6A 1PQPA 1HYEA 1QG6A 4EJMA 1XSEA 1MA0A 4RLSA 4FFPA 4R01A 4XDYA 4E4YA 2EKLA 3ETGA 4BNJA 2PLAA 2EF1A 3PDUA 3H9QA 4JLWA 1HTBA 4YT4A 5C7LO 2QQ5A 4MVJG 2EJWA 4OOEA 2DUWA 2EV9A 3TOXA 1HDYA 5TSDA 2PZMA 1N1GA 2HMWA 4L74A 1TEHA 4BNZA 2CVOA 1TT5A 4W82A 2P9CA 4PG8A 1IOLA 1Y1PA 5H83A 1LDMA 4ND2A 2VRCA 3NT2A 2QHXA 3DHNA 1HE5A 1ZSVA 2GF2A 2IZ1A 5JS6A 3OQBA 3GC6A 2QX7A 4CMIB 4CV1A 2B37A 4R1UA 6ADHA 1N8KA 3JYQA 4AFNA 3HDYA 2QG4A 3U49A 2HUNA 2XXJA 4ZICA 3L9XA 3WLEA 3KYBA 4HY3A 1MC4A 3DTTA 4QFDA 5T8KA 4CR7A 3JQAB 4NPCA 1DBVO 4XKJA 3WFJA 1YBAA 1M2WA 4UVHA 1PS8A 1YOVB 1ML3A 3RD5A 4GMFA 4CUZA 4DPLA 1YKFA 1K0UA 3KHUA 2B36A 3W4JA 1H6BA 2WEKA 4I5GA 3I6IA 3RKUA 1GYQA 4B79A 2GYYA 3SBOA 2QZZA 3JQFA 3VTZA 4E33A 3CTMA 5CDUA 1Y8RB 4GLLA 1GCUA 3QVTA 3RC1A 1HE4A 1LLDA 2UDPA 4GWKA 3ZWPA 1J49A 1W6UA 2P91A 2X5KO 1VPDA 1ZZEA 1NM5A 2ZB8A 3NT5A 4W7HA 3RCBA 4EYEA 5A06A 4WUVA 2ZTVA 2CVQA 4BNYA 4CL8A 1UZLA 3RFXA 1N9GB 4S1VA 2YHIB 1CRWG 1M67A 2Q4EA 5K6AC 4AJIA 1MFZA 3QY9A 4OOFA 4DIBA 3MWEB 2NACA 5COQA 4MVJA 5JY1A 3F1LA 4I5DA 3ZNQA 1FF9A 5IJZA 3DDNA 4B4UA 3JSAA 1IZ9A 3D3EA 4YTEA 4CMKA 2Y68A 2PH5A 3B20A 4J4BA 4XIJA 4CLRA 3NUGA 1AN9A 5ILGA 1Q7GA 4DWVA 3EMKA 4R68A 3ZU4A 4QT0A 1IB6A 3DQPA 2J6IA 2CMDA 3E03A 1OI7A 3KEQA 2NNLD 3OETA 4KUHA 1B8UA 1Y81A 1EVZA 3D3WB 2O23A 1PWZA 3FNHA 3AUAA 1I32A 3QP9A 4UVDA 1GDHA 2OP0A 4WASA 1YH3A 3RC9A 4M49A 4N5MA 4RF4A 3H7AA 4GWGA 4YAIA 1N5DA 1NXQA 1K5HA 1YDEA 2DQ4A 3BMQA 4I08A 4J4TA 1YQDA 2G5CA 1C1DA 2V6MA 5F1KA 4PN3A 3B1KA 4JBGA 5C7OO 4EJ0A 3NTQA 2CVZA 2GNAA 1EDOA 3VH3A 3GFGA 3NV9A 4QO7A 1HE2A 1H6AA 1KERA 2AA3A 5EN4A 1PJBA 3RUHA 2V6FA 3DBLB 1PZFA 3NGXA 4DQVA 3ZV6A 4OSOA 4AJNA 1WPQA 3DAPA 3U09A 4XJSA 2O3RA 3JQBC 4D41A 3GEMA 4IDGA 3VDQA 4CMJA 2Y1FA 1Y5MA 3I9OA 1VJTA 3ENKA 2GRAA 1P9LA 4TRJA 2DT5A 1XLTA 5CG2A 1MGOA 3K92A 3WBFA 3U9LA 1T26A 3NT4A 4J7UA 1DC3A 1NX6A 2EKPA 5TS3A 2UYYA 3N7UA 3B1JA 4U7WA 4UUOA 2AEMA 5LDGA 5KWEA 3OA2A 2IDZA 5FI5A 3LYLA 1P0FA 1ZXBA 1E3WB 3SJ7A 2GSDA 2VTEA 1U28A 1E3JA 4P38A 2RHCA 5G0WA 2IXAA 2VHYA 3HDHA 2HMVA 1LBEA 4PLGA 2JHGA 3E1KA 3FNEA 3FF4A 3IJPA 4BUCA 1NFRA 3FR8A 1MLDA 2X9VA 4F46A 1NR7A 4FC7A 4G81A 3QVOA 3LT1A 5TJ9A 3H4VA 3RROA 2HJRA 4FSHA 4A5OA 3D1LA 4R54A 1IHXA 1P1HA 1KETA 2EERA 2F1KA 2JFFA 2C5AA 3T7CA 3PDJA 1GYPA 4QQRA 4E2XA 1R6DA 3OHSX 3OJFA 1BTOA 1X0XA 2JJYA 3A1NA 3OP4A 1B14A 4RV9A 4LMPA 1FK8A 2Q2QA 1UXJA 4TSKA 1QLJA 1XIVA 4L4SA 3ZI0A 4HFMA 3DOOA 1T24A 5COAA 4MPDA 4Y6SA 5JMWA 3SVTA 3C3XA 3E48A 1GEGA 1PWXA 1GR0A 3WJ7A 3CMCO 2VOEA 4M1QA 5K6AA 3TZ6A 2ZIZA 1LTHR 1ZEJA 5EL0A 3OECA 5TT0A 3W6ZA 2AQKA 1YL5A 4W6ZA 3GLQA 3UAGA 4ZRMA 2JHFA 3BIOA 4II3A 4YAEA 2VNAA 2FN7A 3LVFO 3LT0A 4H15A 1E6UA 3WTBA 1A9ZA 1QYCA 1T2DA 3AI2A 1I3MA 4GGOA 3LF2A 3D0OA 3HJAA 4AJ1A 5A1TA 4CL3A 5I8ZA 5THKA 1R4MA 3JQEA 3QVSA 2C7VA 4ITUA 3JQ8B 1I24A 1UXKA 1SBYA 1LC3A 2EW2A 3A9WA 5AXBA 5BSGA 4PZDA 1NVMB 4FC6A 2WE7A 4XQCA 4OH1A 3QLJA 5JO0A 2J3IA 4AJJA 4E13A 4J16A 4JXKA 2FR1A 2I76A 1WDKA 1S7CA 4FFOA 1R37A 4ZQBA 4YJHA 1PGNA 3ICCA 1Q0HA 3TSCA 4EGFA 3I9LA 3AM5A 3ZZNA 1DFGA 1ZBQA 3H3FA 3HFGA 3I1JA 3H2SA 3PGJA 1PQWA 3ZWNA 4QXMA 2A4KA 1E3IA 4OIMA 1EVYA 2WMDA 5TF4A 1YGYA 1I3KA 2AXQA 3BMNA 3AJRA 4GVXA 1O0SA 4IDEA 5IZCC 1PJ3A 4O5OA 2I5PO 1R0SA 2D0IA 2AE1A 4XB1A 1DC6A 3JQ6A 3ENNA 1ZW1A 2Q50A 4CMEC 5ICSA 3E6AA 1T25A 1WZIA 4NU5A 3OSUA 4RDHA 4XYBA 3GN2A 2NWQA 3AU9A 2BF7A 1LSSA 2D3TA 3IL2A 3ZWYA 4K26A 1PIWA 4J1NA 1MP0A 3OM9A 3C7DB 5B1YA 4U6SA 1B3BA 4YAGA 3UW3A 1UXIA 3HNPA 1A9YA 4D3SA 3JQGA 2GN8A 1C0IA 4RQTA 2EIHA 3VPFA 4G5HA 1S6YA 3ASUA 3W4KA 1G1AA 4ALLA 1ZK1A 1EK5A 1X15A 1E1NA 1XG5A 5KCZA 1XA0A 5L7TA 1FMCA 1PZGA 2Y1GA 4CQLB 1C3VA 1YB5A 1HWYA 2JCYA 2VQ3A 2ZCVA 3UVEA 4PRKA 1DJQA 5KOIA 4IGFA 4E6PA 4PLVA 5G2OA 2DLDA 2OHXA 1GAEO 1E3WA 3OIGA 4XGIA 3GHYA 3JD1A 4BNNA 5IAAA 1QR6A 2JCVA 1SC6A 1R4NA 4BNHA 3W8EA 4CMBA 1Q1NA 3L4BA 4KUEA 1H93A 3VH1A 3L0DA 3GZ4A 1CF2O 3DAFA 4YAKA 5KTKA 1TA4A 4Z3KA 4YA6A 2YDYA 2POQX 2WYUA 1X1TA 3GK3A 4CM9D 3UHAA 4ZHSA 7ADHA 3ITKA 1DFIA 4XGNA 2DUUA 2GN6A 4IUYA 2H5LA 2B4RO 3UOGA 3RBXA 1T1SA 4U5QA 1D1SA 3IDSA 3AI1A 3GVXA 3X2FA 2B5VA 4H7PA 3S1LA 1ZIDA 3NTRA 3RI3A 3D7LA 4I9HA 1N7GA 1SZJG 4MP8A 4OJNA 1NQOA 2Q1TA 3EY4A 4NU6A 4J91A 3FWZA 5G0VA 4ZU3A 4UAGA 2X9GA 2XOXA 5MDHA 3GG9A 4LCEA 5ITWA 1DAPA 1V3TA 3WGYA 2X7HA 4KWHA 2RCYA 3SXPA 3CXRA 1GEEA 3GY0A 3BA1A 1XDWA 2NVUB 4B8ZA 1BMDA 1E3LA 3LSYA 4CUKA 4ZA2A 4OQYA 2EJVA 1O94A 2OO5A 5I8WA 1BXKA 2W4QA 3LT2A 3R0IA 1ZKMA 5TC4A 3KYDA 3WMXA 1D3AA 3RU7A 1KEPA 4IDBA 5JLAA 2IRWA 4OHUA 4NBUA 1O6ZA 3INRA 4GX1A 1I01A 4MVJF 1QYVA 4RDIA 1ZH8A 3WX0A 1BXGA 3MJCA 3NYWA 2X0NA 2VWGA 1VSUA 4YJGB 4J7XA 1Q0QA 4NBRA 3MJEA 2EW8A 3MJTA 1DRUA 1SB8A 2PD3A 3OBBA 4QTZA 4J1TA 1LDEA 2DBQA 1B3RA 4CMEA 3U4CA 3ZV5A 4J3FA 3IMFA 1C1DB 1NVGA 3FHLA 3UN1A 4D44A 2VZ0A 3PLNA 4JP2A 1NPTO 4FJ2A 2OOSA 3C7CB 1JVBA 4FW8A 3KEOA 3W1VA 5KVVA 2FMUA 5DOVA 2J3HA 1QKIA 2VHZA 4B3HA 3TJRA 4BKOA 3ZWOA 3GF4A 5JDIC 1JN0A 1VM6A 4YACA 3F1KA 1GADO 1LX6A 4OYRA 1ZVMA 3DBLA 3OJOA 4U6QA 2B4TO 4IPTA 1BGVA 3TOZA 2ZYGA 4F45A 3GMSA 2ZJ1A 3NAQA 1Q7CA 1VKOA 3WR5A 5A02A 4BMNA 2CDAA 1V8BA 1Y6JA 2BMAA 5DZSA 1Y8QA 4ZJUA 3R1IA 4Z3DA 4CQLA 3EUWA 3WNQA 4CMGA 3G1UA 5K0ZA 4PG7A 4Q9NA 4EUEA 4Z0HO 5TGDA 2YHUA 1NPYA 2HK7A 2VWPA 1NPDA 4CM5A 2AEJA 3WGQA 1VE9A 2HK8A 1BSVA 4MVJI 1DIHA 4XDZA 4Z9YA 4WECA 3D5QA 1WZEA 3GDFA 4A27A 1KBZA 3V5NA 4ND4A 2PGLA 1Y9AA 3GVHA 4FFMA 2W2LA 4YT8A 2AG8A 4KDEA 1R0KA 1YRLA 1VL0A 2IZ0A 2SCUA 4XRGA 4RGBA 5EJ2A 2C20A 3PRJA 5JO9A 4P4LA 5G0UA 3KLMX 3IKVA 3VKUA 4TROA 1C14A 5L53A 3HQ4O 1YJQA 3NDRA 3DZGA 1QSGA 3EC7A 1LLUA 2PA3A 3ZCXA 1IY8A 3F6YA 2DFVA 4WKGA 2O3QA 1HSOA 1JU9A 1L7EA 2B69A 1G0OA 3RFVA 1DLJA 4E31A 3JQ7B 3GUYA 4HUJA 2CD9A 2ET6A 1GYRA 1Z82A 2QIOA 5T64A 2A94A 3PVZA 4WOJA 5LCXA 3RIHA 2CDCA 3KSZO 4NFSA 2Y05A 3O9ZA 1ISHA 1HSZA 2VT3A 4W99A 3H8VA 3QWIA 4TZTA 4ESOA 1TT7A 3AOGA 3TZCA 2C07A 5F5LA 4W7IA 5JC8A 3WYCA 3WLFA 2VWQA 4CM4A 1PJSA 3JQ9A 3K73O 5IXSA 2NTNA 1WMAA 4A26A 2GPTA 2NVUA 4ZN6A 1B8PA 3RQSA 2RH8A 3QJ5A 4FBGA 2H6EA 1VSVA 1YONA 2IE0A 4O6VA 5B4TA 1RJWA 2ZQZA 2HMTA 3DL2A 5DNAA 4PG5A 1P1RA 4YEDA 3RUFA 4PRLA 2GZ3A 5F3RA 4YRAA 2FR8A 4XQEA 3ZWAA 3IP1A 2FRDA 3PTZA 4KWIA 4YJGA 3WTCA 4D42A 5B12A 4UVEA 2E82A 4YJFA 1GTMA 4MINA 3TL2A 2ZJ0A 4G65A 3IP3A 8LDHA 4PVDA 2Q2WA 2Y0EA 3Q0EA 2D59A 2D8AA 3GGGA 3F3SA 3GVIA 2FR0A 2J3JA 3JD3A 3QQPA 2BGKA 5GZ3A 4R1SA 1E1LA 1HDOA 5T67A 1VRWA 2W98A 5HRUA 4QEDA 2CSUA 3TWOA 1SMKA 2X0JA 2VUUA 2NM0A 2ZATA 3D4NA 4RF5A 5ADHA 4N54A 3AI3A 5CG1A 1PS9A 5KJCA 3NX4A 4AICA 4J1QA 5JAIA 1ONPA 4YPOA 4AG3A 3OIFA 4DTIA 1SOVA 3LLVA 5C3MA 2V7PA 3UCEA 3Q9NA 4WPGA 2TMDA 3QWBA 2X5JO 3W8FA 3F46A 4OO3A 4MKRA 4AJEA 1LJ8A 2C5EA 4U0KA 1G0NA 4YB8A 4WNCA 1OZAA 1N1EA 2WD8A 3JQGB 5BNIA 2D5CA 4GMGA 3PXXA 3OIDA 1F06A 3GAZA 2VZ8A 1AHIA 5JMPA 1B8VA 3AOEA 4PLYA 2OXIA 2GZ1A 3KYCB 1BRMA 4WLUA 3F47A 2R6JA 9LDTA 2HSDA 2UV8A 1O95A 1PX0A 3EHEA 3OJLA 4FS3A 3V1YA 2R00C 4GGPA 2HRBA 2ZYAA 2FPIA 1HXHA 4PLWA 1ADGA 3AM4A 3AW9A 3ZHXA 1RPNA 1LC0A 3PQEA 1NWCA 1IZ0A 4GL4A 1VJ0A 2I3GA 4CMCA 1ENPA 4BO3A 1Z73A 1R4NB 4PCVA 1YJ8A 1NBOA 5IDXA 3AY7A 3IJRA 3NDIA 3MJ4A 1JQBA 4JX8A 4WLVA 2C59A 5IN4A 4X54A 4LSWA 3PQFA 5GMOA 4Q3EA 1LI4A 2DPGA 1NAHA 4R16A 1BWSA 3H9EO 2FZEA 4I1IA 3ROPA 2FSSA 1XKQA 5CAEA 2LDXA 3GN1A 2AG5A 3EVNA 1P77A 2WDZA 2ZB4A 4EJ6A 1ADCA 4BS9A 4UEOA 4K6FA 1FXSA 3JD2A 1BG6A 3ABIA 3ASVA 3OJEA 4BNVA 4R9RA 3RJ9A 4NBWA 2HMSA 3KUXA 2JCXA 2I65A 4WCDA 4Q3AA 3G1TA 1Q0LA 5F21A 5A9SB 5KVQA 1Q2XA 4R1TA 4DL9A 3GRKA 4MKZA 1NNUA 5A5EA 1I2ZA 2B35A 2VRCD 3HZZA 4Y6PA 1H2HA 4CLOB 5KVSA 4R1NA 4WOKA 3FTNA 2RIRA 2VRBA 4KQXA 1ENZA 1J6UA 3ANNA 1HL3A 3SJUA 4DYDA 4AVYA 1Z7EA 1IHYA 3ULKA 1BXGB 4MVJP 3L77A 4M87A 4DMMA 3PFFA 2W90A 1D7OA 1W8DA 3E9QA 1GZ4A 4MIYA 1ZSNA 2YDXA 1PS0A 1OAAA 5G0TA 1Z75A 4HX5A 3MOGA 4A7PA 1EZ4A 1T2AA 2QRJA 1PU2A 2NADA 3OJ0A 1NAIA 5ICMA 4BV9A 1WDLA 3PIIA 3AWDA 4I9UA 3GZNA 5AVOA 2AE2A 2OL4A 3KOUA 4PFJA 2P5YA 3CSDA 4PLZA 4ALIA 4TWRA 1ZMOA 3PYMA 5TX7A 3GPIA 4FN4A 2IEBA 3KRTA 1I2CA 2VYVA 1U4SA 2DFDA 1V3UA 3TZQA 1C0LA 1H6DA 2O3SA 4OSPA 4JBHA 4DRYA 2PD6A 3BHJA 3P2OA 3RUDA 1ZK2A 5L45A 3PJGA 4NJMA 1BW9B 4CR6A 3LT4A 1TB4A 1I5RA 4A2CA 2CFCA 1LRKA 4QSMA 1Y8QB 1BW9A 4BNIA 1F8GA 4WLEA 3TNLA 5FF9A 4MVJM 1T2FA 2PFGA 2DU8A 3HN7A 4ND5A 2HO5A 1ARZA 1E5LA 1CETA 3Q3CA 4DIOA 1NASA 3H6KA 2NTVA 4KTVE 4MOWA 2GDZA 1GQ2A 1YE3A 3OQ6A 3WG9A 4R5MA 3ITDA 4BO8A 1BHSA 2VTDA 3INGA 3N58A 3MWDB 4XQ9A 4DC0A 4B4OA 1HETA 2NV6A 4NH4A 3DOJA 2X6TA 1N2SA 1T4BA 2JL1A 3QSGA 1QV7A 3I5MA 3RU9A 4YCAA 3I9NA 1I36A 4WCFA 1RM4A 5HS6A 3DZJA 3ZW9A 2CF6A 2BI7A 2V65A 3F4BA 1H9AA 2HKIA 4U8GA 4QX6A 3FR7A 2X9NA 3DFZA 5GY7A 2YV1A 3V1TC 1BDBA 3Q9UA 2HMUA 5LDHA 3C85A 3VZPA 3ONEA 5AOVA 1EVJA 3KVOA 3HG7A 3GDGA 4JCOA 1ZJZA 2VWHA 3FCOA 2P5UA 3PHHA 4L4RA 4RVUA 5IDQA 5F1PA 2JAHA 5L7YA 2V6BA 4CM1A 4DBVO 5BSHA 3OA0A 2J5QA 4BB5A 1XWFA 1BDMA 4IXTA 1PGJA 4FIZA 2YUTA 4YDRA 1E6EA 2DC1A 4KQWA 5U4QA 1ZMTA 4YT5A 4ZQGA 3JYPA 3PZBA 4GX5A 2BRUA 3A28A 1R12A 4IGEA 2OZPA 3JQAD 4ALNA 3KB6A 2OFPA 3TZKA 4RO0A 2J3KA 3PYXA 4RQUA 4CM3A 5HTOA 4J4HA 3QA9A 4BV8A 3ONDA 4CLOA 4CM4B 4HKTA 3G49A 2YQ4A 3PEFA 2W8ZA 1UDCA 5GZ1A 2Y0CA 1PZEA 3ZWWA 1DEHA 4IBOA 2Y1OA 1PJ4A 1P33A 5TNXA 4FGWA 3M2TA 4ALKA 3PPIA 4PG4A 4E5NA 1A27A 1Y9EA 1F8FA 4UEJA 4FOOA 2EEZA 1HZZA 1GQQA 1SNYA 2EP7A 2PV7A 1V0JA 1QXSA 3B1FA 4GBJA 4UUNA 3MOIA 3LC7O 4YJFB 2I6TA 5EERA 1MG5A 3GZNB 4NHEA 1HT0A 1ZUD1 1QYXA 2QW8A 4JGBA 2EXXA 2VNSA 4UUPA 3F9IA 3UICA 1A71A 1CJCA 1IUKA 2Y0DA 4M55A 4NDNE 4CV3A 4CM8A 4F6LA 3KXDA 4D46A 4FDAA 3B70A 1KVQA 1M6HA 1PGQA 1EEHA 3EGOA 4KMSA 5AXAA 1EMDA 1FDTA 4BO0A 2Q2VA 1E0DA 3FWNA 4LVUA 4RPGA 1GFSA 3C24A 2O3JA 2UUPA 2DAPA 2PD4A 1GL3A 4Q3DA 1YDWA 4CLXA 3QIVA 4Y67A 3JYNA 1ONOA 1B7GO 1NP3A 3DHYA 3L6OO 3GH3A 5A4DA 4L0QA 1ISJA 1KEUA 1H6CA 3I83A 4Q3CA 3PJFA 2O4CA 4YQYA 1UP6A 1PJ2A 2G76A 3IOYA 2BKAA 3IS3A 3LF1A 3EW7A 1NWHA 3DBRA 1LRLA 3JV7A 3UKOA 3IC5A 1Z45A 2Q4BA 4J6FA 4WE3A 3PHIA 4J1SA 5J23A 3DB2A 3SLGA 2P4QA 3IUPA 1CEQA 2NU9A 3WIDA 4U0JA 4NG5A 4MP3A 3BZUA 5KIAA 1DDOA 1MFPA 3HWRA 4TKMA 3ZU2A 1GQYA 1ADBA 2OMEA 3MZ0A 3GHHA 3U5TA 2C7GA 4Z9XA 3PJEA 1E3EA 4IJWA 3TFOA 2PR2A 1CQIA 4BNLA 5I7SA 4DQUA 1PGPA 3WXBA 2Q1UA 2BH9A 4QFCA 3JQAA 3VTFA 4BQPA 3JYOA 1SPXA 5L7WA 3O8QB 3TQHA 1A7AA 3JD4A 5L4NA 3P7MA 4IJKA 3CKYA 3QWFA 3M1AA 5KKCA 5JYDA 4YAJA 1WNTA 3AUUA 3PLRA 1PTJA 1ORRA 3I23A 4RVSA 1D1TA 4XIYA 5DP2A 3WNVA 3WJAA 3P5SA 3DTYA 2YY7A 3JCZA 4EDFA 2Y1CA 1KVRA 2BFAA 3GEDA 4IJUA 4BKQA 4TRMA 4W9NA 1SCUA 2PKQP 3RASA 4LK3A 1M76A 3DAGA 1A5ZA 1LSOA 2ILTA 3QRWA 1PQUA 4HADA 1O9BA 4BGUA 4RPLA 5JDIA 3G0OA 4M86A 4AJ2A 4DIFA 4L8VA 4WLNA 4MIOA 5A3VA 1HF3A 1O5IA 1LXCA 2PKQO 2PKRA 3CZMA 5JDCA 3ZWBA 1FDWA 2YZ7A 3ZHBA 1DIAA 2PK3A 3EYWA 1U7HA 1R4MB 3CPSA 2NQTA 2ZTLA 4FFNA 3V2GA 1KY5A 4B7XA 3MTJA 3WBBA 1JAYA 3WFIA 4BIIA 1V9LA 2PWZA 3VZSA 4IIUA 4RJTA 1IL0A 4JQCA 1HE3A 1YS4A 3EVTA 3WSVA 4CM6A 3E8XA 3ONFA 1TI7A 2H9IA 1SEVA 3TDKA 2VYNA 3PWZA 2Y1DA 3PK0A 4MKXA 4A03A 4MVJE 4DA9A 3GGOA 1NYTA 3COSA 2E4AA 2FY8A 2GZ2A 1YWGO 2D4AA 3SEFA 1B16A 1PSDA 3PWKA 5DF1A 2IZZA 3UH1A 3AFMA 5KKAA 1LDBA 4QUKA 3OF2A 4B7CA 3OQ1A 3D4PA 2RAFA 2Y93A 4N5LA 1M66A 4KOAA 2J5KA 1DO8A 3FI9A 1FDSA 4CMHA 5A03A 5DOZA 1F0YA 5TQVA 5FEUA 1OFGA 3G3EA 1P1KA 2BLLA 1EQUA 1WMBA 3KBOA 1JKJA 3DXFA 1J4AA 1V6AA 2BHLA 2W2LD 3RBZA 2B5WA 2R00A 3WGHA 3RUIA 3FRJA 2H1SA 1H94A 2GLXA 4XYMA 4J90A 3WDSA 4CQMD 2W2KB 2RHRA 4CUJA 2EG9A 3U4IA 4NK5A 2EGGA 5JSFA 3DOCA 5K9ZA 4GSKA 1O89A 1YXMA 1MV8A 1PL7A 1E7SA 1QV6A 1U3UA 4I5FA 1EVIA 2IXBA 4P8RA 4AJOA 3FNGA 3FSRA 2C2XA 3JTMA 3OEWA 4GQAA 2XPCA 4D3DA 3BYZA 4FCCA 3MJVA 4AJHA 1WDMA 4WJZA 3DO5A 1R15A 3EAGA 1JKIA 2DPHA 2HLPA 4LGVA 3GMDA 3ADPA 2A9FA 3C1AA 3LLSA 4HBGA 4EEZA 1JW9B 1H9BA 5BSFA 3PI7A 3T4EA 2EGHA 3D4OA 2FP4A 1UP4A 3MTGA 4TVOA 1PJTA 1JWBB 3NJ4A 4WCFB 4B4VA 3U4DA 1OOEA 4EI2A 2Q99A 2X22A 4CLHA 2D5AA 4L76A 3L6EA 4IQGA 3LC1O 3F5QA 2IYOA 5I7FA 2BFPA 1E1MA 4EEXA 5A9TA 3BTOA 2Q45A 3DZBA 3FD8A 4URFA 3ZH2A 2WD7A 3IAHA 1HZJA 3H5RA 4HFJA 4YRBA 4YBZA 1K6IA 2Q46A 2GGSA 4E30A 1UH5A 4A0SA 4OKIA 5A9SA 3ZU3A 1J0XO 1I8TA 4INAA 3NKLA 4CLDA 2P68A 1HDZA 1XEAA 4MVJH 5H82A 3KSDO 2DBRA 1DIBA 4GVLA 3U4HA 2FOIA 3QHAA 3OH8A 4JNKA 1ENYA 1JTVA 5L95A 1RM0A 1CWUA 2QZ9A 1KS9A 1NTOA 5F1OA 2J5RA 3C7AA 3KYDB 1JWAB 2R2GA 3NTOA 5CPFA 5ES3A 5HWSA 3NEPX 1HLPA 2WYVA 3GEGA 3UUWA 3PFWO 2X8LA 2JAPA 4RCVA 4J49A 4CV2A 3AUSA 4CMAA 1R0LA 5IDWA 3BXXA 3KM0A 3Q6IA 4JBIA 2PZLA 1KVUA 2YQ5A 4XYEA 4B3IA 5IFLA 2DVMA 3I9MA 3H9UA 1JA9A 4FJ1A 4TRNA 2WWRA 2QRLA 3WMWA 5HM8A 2VN8A 4UULA 3E5MA 2O7QA 3HHPA 2HK9A 1RWBA 3BHMA 4FFRA 5THQA 2B0JA 2IODA 1KC3A 2X4GA 5DT9A 1ZNQO 1HEUA 5EIOA 4DPMA 4RF3A 5JBIA 3DBHA 1KEWA 3X2EA 3LK7A 3DMTA 3L9WA 1GUFA 4E5YA 3R6DA 4OGWA 2OBYA 1U2DA 3U62A 4BO7A 1ISGA 2GN4A 3RBVA 3KO8A 1DLIA 4R4JA 1W73A 3ZW8A 4YR9A 3IKTA 5CDSA 1T1RA 1SB9A 2P4HX 5CDTA 2QYTA 5CPBA 3PHJA 3ZWCA 3VPHA 4NJOA 3JQBA 4ZGWA 2YW9A 1E5QA 3DZFA 1E92A 2AHRA 2JFGA 2VZ9A 4QECA 1M75A 2FPGA 3ZNNA 4LSMA 3MCVA 4CM7A 1UAGA 2G1UA 1NQ5A 1YBVA 4PLTA 1LQTA 4CR8A 4AL4A 2EKQA 4Z0PA 4OKNA 2AEFA 5CEEA 5C7IO 2NVBA 3E9NA 3IUSA 2PZJA 2NU8A 4XR9A 5GZ6A 3V2HA 3WYBA 1EFLA 5A9RA 4QO8A 1GPJA 1UXGA 4C7KA 2YYYA 1LRJA 1DB3A 4Y9DA 3K9QO 4NBTA 3HE3A 1MUUA 2OORA 2PZKA 2BFOA 5G4LA 4FJ0A 5BNTA 1H0KA 1I10A 3DBVO 5ENDA 3WGTA 3ON5A 3CEAA 3E82A 4H3VA 3GNTA 1CQJA 2PY6A 1K6JA 3GPDG 2O2SA 4GKBA 4WCFC 4ZQFA 1VLLA 3I52A 2HDHA 3ETEA 3LDHA 3ZWXA 1RYDA 1ZK4A 1ULSA 1JDJA 1YQXA 3IQDB 3CMMA 4RVGA 4E32A 1ULUA 2ZCUA 4C4OA 1JVSA 3VZQA 4E21A 2PGDA 2G17A 1U5CA 4D0SA 4RVDA 3BAZA 5HA5A 4TVBA 2NVWA 2VUSA 3I9JA 3AUTA 1DPGA 3HDJA 4GI2A 5FI3A 3VPXA 3I4FA 5C5IA 5KJ1A 2ZB3A 4NZ9A 4FB5A 3DMTC 3NGLA 2C2YA 3E9MA 4GPD1 2C0CA 1ISIA 5EMHA 2X86A 1XELA 2I99A 4JROA 3TZHA 3ETDA 5KJ6A 1PL6A 1P1IA 3C1TA 2E37A 3BMCB 3I4CA 5JC1A 4BKPA 2DKNA 4PGFA 3KZVA 1LDGA 2PH3A 4OAQA 1NHGA 4I9NA 1LDYA 1NVTA 1WXDA 4KDFA 4IMRA 4DPKA 4J0EA 4LCJA 5IZCA 1X1EA 1X13A 5BNFA 3K2EA 4H16A 1D4FA 1I30A 3F5SA 4HP8A 4ONEA 3ANLA 3PHGA 4B8WA 3T4XA 4DLAA 3B6ZA 1K89A 1CDOA 1DC4A 2VHXA 4OXYA 5CEFA 1LUAA 5COBA 9LDBA 4ZQHA 2F00A 3H5AA 5I9LA 3OICA 4LRSB 1UP7A 5G0SA 3GG2A 1ZFNA 2OP1A 5B4VA 4GLOA 1UDAA 1HDXA 2EP5A 4BQRA 4YQZA 4Z0TA 2DTDA 4ZVVA 5U1PA 1AHHA 1PJCA 3DHEA 7MDHA 5JFOA 5H81A 5L9AA 4BNMA 1B2LA 4O0LA 4XWYA 5JPIA 4IS3A 4BGIA 3SX2A 4EUHA 3C1OA 1K6XA 5L3ZA 1LEHA 4WK6A 3GUCA 1JKFA 1ZEMA 2GO1A 4DREA 3P2YA 5HS4A 5AXDA 4YWJA 3W4IA 1CYDA 4K28A 3FPLA 2QRKA 3QVXA 4XX0A 3VDRA 2W2KA 3S2GA 4BO4A 1C0PA 3VKVA 4JJGA 2VUTA 3DZHA 4E2YA 2Z1NA 4EZBA 3W6UA 4JJFA 4L73A 1P1JA 4YXFA 5IZ4A 1EK6A 1WWKA 4BGEA 1YB1A 3K2BA 4ID9A 4HFRA 2BGMA 4CM9A 3KYCA 1IPEA 5EINA 1A4UA 1DSSG 1WVGA 2QYSA 3DBRB 3HSKA 5ER6A 5B37A 3ROMA 5EQFA 1VL6A 4JJIA 2CY0A 2X23A 1LU9A 2YJZA 3V8BA 3ZNPA 5JE8A 1PR9A 2ZK7A 2VYVD 4DQXA 2HRZA 4KTTE 1NQAO 2VYND 1OC4A 2X0IA 3TFQA 3RKRA 3DFUA 1WW8A 1P1FA 1ENOA 5JYEA 3TF5A 1TXGA 4YRDA 3KETA 1PJLA 4O63O 3RUEA 2HJSA 5A3JA 1PL8A 4KUGA 1EUDA 5B4UA 3WIEA 4J2OA 4RL6A 3ZWVA 4W9NC 1QMGA 4FD3A 2GD1O 3PP8A 3HB5X 1Z74A 3WQRA 2UVDA 2O7SA 3PHLA 1V3VA 4PZEA 1AUPA 3VC7A 4F6CA 1F14A 3DZKA 3DC2A 2X1HA 3TL3A 4S3MA 1T4DA 4XEHA 4BKRA 2I67A 5U9CA 2AQIA 1YL6A 4FQ8A 1IULA 4NK4A 1E3SA 4XRRA 3NJ8A 4N18A 4PLFA 2WD7B 1HLDA 4BNFA 1F17A 3KTDA 4JP3A 1I3NA 1U8XX 3K6JA 1U1IA 3T7EA 1U5AA 2YHIA 1MB4A 4GAEA 5JAQA 5C37A 5A5FA 1H2BA 2BD0A 3L6DA 4HWKA 4P4NA 1MXHA 1ADFA 2PGJA 1KC1A 1P45A 3BMCA 3V2UA 3INTA 5KVCA 1J5PA 1OBFO 4LMRA 2Y99A 3GT0A 3UGKA 3R3SA 4DLBA 5MGBA 2RH4A 3VH2A 1LLQA 2IEDA 3M1LA 3ZHZA 4PLPA 4OL9A 3TPCA 2EWMA 2C82A 1U9JA 2NQ8A 3ADOA 5I7VA 2A35A 4E12A 3VHRA 4XJTA 1LSJA 4MIEA 3RVDA 2WE8A 1E7QA 3RC7A 1HDGO 5CEJA 2VHVA 3H65A 2P9GA 4ILKA 1HYHA 1LNQA 4LW8A 1C1XB 1BXZA 4NI5A 1B15A 3GNQA 4R9SA 2OUIA 4OM8A 4XCVA 5T57A 2AQHA 4IM7A 4UREA 1F12A 1E7WA 3EDMA 1GV0A 3JQFC 4CV0A 4M54A 4KZPA 4PG6A 3VOSA 2O48X 5CDGA 5DN9A 3HFSA 2OGUA 1I33A 3LQFA 2FSVA 4TRRA 1ZO8A 3CIFA 3WGIA 1WP4A 2XF8A 1YQGA 4PZCA 3A4VA 2Z95A 4NJMB 1MC5A 3KV3O 3ANMA 3DMYA 4E3ZA 1U3VA 3F4LA 3D5TA 1QLHA 1QORA 1X7GA 3WWYA 5IN5A 1IPFA 4N7RA 3S2EA 3ZWMA 1KY4A 4NMHA 4YJDA 3ZNOA 3VZRA 2I3AA 4D43A 4AJPA 2GASA 3OEYA 4GSLA 5G4KB 4G2NA 1GU7A 1VL8A 3HDQA 5AQ1A 2JFHA 1DHTA 1UXHA 1P74A 1AXEA 5TJHA 1BVUA 3M2PA 3D64A 5G4KA 4AJKA 4RPJA 4HNHA 4D0RA 1PZHA 2HCTA 1ONNA 4AJLA 1RYEA 4D7AA 3H9GA 4XA8A 2X5OA 1ZCJA 3I6QA 2ZB7A 3MJSA 5I9MA 3FBTA 4E5PA 4J9VA 3QV1A 4P4GA 1DIRA 4LN1A 4CQMA 2VHWA 4J2HA 2I66A 1X0VA 2WJPA 4BOYA 1N92A 4GH5A 1SAYA 2E49A 1MG0A 3N74A 1MX3A 1ZK0A 3H9JA 1VI2A 3PJDA 3PWSA 1LQUA 4IINA 3FPCA 5ER9A 1G6KA 3VVCA 2X0RA 4BNKA 5KNLA 2NTJA 5DCUA 4WLOA 1TVEA 3Q2KA 4ND3A 3K31A 3RWBA 3WYEA 3JQDA 1GY8A 3HB4X 4XQGA 2VCYA 3OFSA 1WAMA 1XHLA 4MO2A 3U3XA 2YV2A 4JK3A 1QRRA 3A14A 1V35A 3I9KA 1DOHA 1Y8RA 1AXGA 5CP8A 5JDCC 3S8MA 1AGNA 5KJEA 4PLCA 1UZNA 4XB2A 3WOHA 4C7JA 1EUCA 3K8ZA 2WYWA 3R3JA 4OXNA 4RZHA 2OBNA 2Y1EA 4YT2A 3GAFA 1LDNA 3GVCA 5JXWA 5DULA 4M89A 2C54A 4DXHA 3O4RA 1XU9A 4RPKA 4L9RA 5ITVA 2P9EA 5IXYA 1ZSYA 1CIVA 3AFNA 5AYVA 2Q49A 4BO2A 5DBFA 4DYVA 4CODB 1GUYA 3EK2A 1GD1O 1X14A 2WSBA 3GGPA 3H3JA 2E6UX 1T2CA 5FWNA 2GCGA 2CDBA 4HXYA 3ZGYA 4HFNA 4RZIA 3VPSA 1EBUA 4RPHA 2Q1WA 4FFLA 1HYGA 5ILOA 1DRVA 1FJHA 1IE3A 1HDCA 1QYDA 4CPDA 2UAGA 3DZIA 1A72A 4YJHB 4D79A 5JCJD 5TRTA 1KVSA 4D3FA 4PIVA 2Q1SA 4OXKA 2FPPA 3BMQB 4ZD6A 4IQ8A 3FTPA 4XYGA 1C0KA 2AW5A 4WNIA 3AM3A 4NNJA 3AY3A 3IIEA 3LU1A 5DCYA 1SO8A 3GA0A 3DBHB 1UAYA 4BNGA 4B7UA 3WGOA 5TIIA 3PYLA 1L1FA 5KJFA 1EE2A 2C29D 5L40A 1DJNA 1O8CA 1I2BA 3GFBA 3RAJA 4UEKA 1NFFA 3RC2A 4BB6A 3TN7A 2D2IA 4BNWA 1N7HA 3AOEC 3ORFA 1SEPA 1P3DA 3A06A 1GUZA 1E7RA 3FBGA 2ZQYA 5IG2A 4M8SA 3QVWA 1CERA 2G82A 4J43A 1U8FO 2HU2A 3Q2IA 3BTSA 3QE3A 3EZYA 1KIFA 5DP1A 1U7TA 5JCJA 3WQSB 1DC5A 3GRPA 3DONA 4NIMA 1DHRA 3EZLA 3SC6A 1ISMA 1U3TA 2WM3A 5IF3A 3KSUA 5JAZA 1JLLA 3HADA 3NDJA 1GZ3A 1RM5A 4UUMA 2NSDA 3PIDA 2XAAA 3KLPX 5BQFA 4FR5A 2ZTUA 3GQVA 1K2WA 1I3LA 4GX0A 4R51A 1U3WA 4NBVA 3O38A 4LVCA 2O3UA 3BTUA 2BI8A 2V6GA 3L07A 2GERA 4CMIA 5DBIA 3O03A 1PR3A 4BO1A 8ADHA 4LISA 2YFHA 1P44A 4I5EA 1DRWA 3JYLA 3AU8A 2NU6A 1GCOA 1LLCA 1JAXA 2WTBA 4IJVA 5FFFA 1RKXA 3RUCA 2TMGA 2BGLA 3QWAA 4BMVA 1XYGA 3AK4A 1P0CA 1DAOA 3K5PA 4CJXA 4B4WA 4XZ3A 4D45A 3AY6A 1YOVA 1T2EA 4N5NA 2ZTMA 1I0ZA 1Z7BA 5IDYA 2NU7A 3ROKA 3CUKA 2Z5LA 4R3NA 3V1UA 2CUKA 3NRCA 1XQ1A 3K30A 3ZDFA 1Z6ZA 2JD0A 3STHA 5DDIP 2JKVA 4Q3BA 5CFZA 4O59O 1DFHA 2JD2A 4E2WA 3CINA 4GKVA 1E1KA 1E7YA 3DWFA 1H5QA 2FHSA 5L4LA 2YV3A 5A04A 2Q3EA 1PEDA 4XR4A 3L4BC 1NQTA 4BO5A 2G0TA 4RF2A 3Q11A 1HKUA 1QP8A 4WEQA 1E77A 3LZ6A 2Y66A 2DBZA 1N9GA 4EW6A 3UFXA 3FNFA 3GVPA 4CLRB 3HUDA 4A73A 2NLOA 3BMOA 2NUAA 4WEOA 4ZQEA 2O2YA 4II2A 2FZWA 1Y7TA 1R66A 1XQ6A 1YO6A 4Z6KA 3BMOB 2GUGA 2HQ1A 3CE6A 4A10A 2HAEA 1L7DA 4J0FA 1KOLA 4RVHA 4UVGA 4IDFA 1WLYA 3SLKA 3S2IA 4O1MA 3CZRA 2J8ZA 1KEVA 5BR7A 1OC2A 1PGOA 3BTVA 1DIGA 3JQCA 3TRIA 1UUFA 4IY1A 3D3WA 4Y6RA 4BNTA 3PGXA 1YBMA 4K1LA 3C8MA 4HNGA 1C1XA 1EE9A 3DEYX 3SC4A 5I9NA 1HDRA 1XCBA 4NFYA 4OQZA 1ID1A 1EQ2A 3ZN2A 1UDBA 4WGGA 3WS7A 2O50A 4BL5A 5TLSA 1Q7BA 3RUAA 3PQDA 4RORA 1EFKA 1W4ZA 3H2ZA 4Y98A 5HBRA 4EUFA 4TKLA 5CHEA 5A05A 4FOSA 4R3WA 1FDUA 4DMLA 4TMFA 3P19A 1U4OA 5TT1A 4R69A 1P31A 2DBVO 5CDYA 2UUOA 3MEQA 3W8DA 4ALMA 4CM8B 1BVRA 3S55A 2CZCA 1X7DA 2DM6A 3S2FA 3BHIA
chains in the Genus database with same CATH superfamily
5JW6A 5M29A 4BFTA 3Q3VA 1JEQA 3V4LA 1N5IA 2PZGA 5H5JA 1E9CA 5T5QA 4X66B 1LA2A 4LE0A 4Y8VA 1S7GA 2QX6A 2W6QA 2X7XA 4BWYA 1G18A 1W0CA 4DUPA 1E0SA 5DLEA 5I3ZA 1CC1S 4QVGA 3PSHA 4D5EA 3TRFA 3VPGA 4ZKEA 4AKSA 4DNFA 3Q41A 5I7EA 1U63A 1WB5A 2L42A 4KRFA 4ZTZB 2GR9A 1NZJA 2J9RA 2ZYDA 2YKGA 1ZC3A 3A6EA 3E61A 4PPGA 2Q5LA 5DXJA 4Q18A 3UC5A 1NN0A 1P7YA 1TAHA 1X8KA 4FMCF 4E5KA 4IQ0A 1A7KA 4QJ5A 4GPIB 3U60B 4Q37A 4NCIA 3A1UA 2EHDA 2JEZA 2QENA 1P4RA 2W6ZA 4LVOA 2O3TA 4WY5A 3JXEA 3VH4A 1J56A 2C97A 2ASEA 2J0EA 1TC2A 3GDOA 4HGPA 3TW6A 5C4GB 3F67A 1UFKA 1XC7A 4LYJA 4DBZA 4JGGA 4CFSA 2MMCA 1DO0A 1I3CA 2BGRA 2VJAA 2AZMA 3TBFA 4G5QA 1OMOA 4I19A 5LOVF 4P5PA 1DX4A 5TQJA 1J8MF 1OJLA 3LYHA 3CX6A 2IEAA 4I8XA 4RC9A 3KOXA 5TMPA 4RWEA 1TJ4A 2WF7A 4B47A 2I2BA 4E46A 2AF4C 3O1LA 5NULA 3E18A 3AERA 3P0RA 2O4UX 4K6OA 3E9DA 1AQJA 4IS2A 1B26A 4EITA 2WOJA 3SHWA 4TT3A 1UT6A 3HU2A 2BJVA 1E5VA 3QW4B 2DETA 4G5XA 2IYRA 1KO7A 5BSEA 1U8EA 1ESZA 3O8QA 2QLBA 3TKYA 3O4HA 4AMUA 3SR3A 3T12A 2D1SA 1F8UA 2RMKA 3AR5A 5T6BA 3WKCA 3JQ7A 3O8OB 2ZKLA 1MVNA 1T3TA 2UYQA 2CNKA 4R5HA 4W5HA 4DDUA 4KITB 2AMVA 4QPJC 1MU0A 1W94A 4IXWA 4XTRA 3X1KA 8GPBA 1PWYE 3B3FA 3QWHA 2BHRA 4L7VA 1MB0A 4CU2A 2Z8XA 3Q5DA 1EDZA 5K51A 3PEVA 2APJA 3COVA 3R3XA 2QRUA 1C9EA 4NFHA 4WLFA 3ROZA 1D6NA 4GMDA 1E3MA 3N2ZB 4IFIA 1CX9B 1K8QA 1RHQA 2UZ0A 4NOKA 3T7IA 4DLLA 3FCUB 1U2GA 2DQSA 5HILA 2ZRPA 3MF4A 1SQGA 4MAAA 1TECE 4UMFA 3WGLA 4UVIA 3WK4A 3GR6A 2AMFA 1XQWA 3DKVA 1W36D 3FFWA 4HH3C 3UJHA 1CUXA 3OTOB 1FDVA 1GZVA 3AVXA 2GZAA 1AM4D 2I1VB 2QNIA 4FU0A 4GE3A 4WY2A 4KQ1A 2PUJA 1CJBA 2C5HA 3LWBA 4MTLA 4OP3A 3ST7A 2O8DA 1OTXA 1Z7YA 4P22A 4BMSA 2HM7A 1QZXA 4BB9A 3RSHA 1E5DA 4RSGA 5I8PA 2JZCA 3PUVA 5SV2A 2W9XA 4EBFA 1QAMA 2E48A 3C5WP 1JR3A 1NVFA 1QHIA 1QR2A 2CHEA 3DCNA 1M9NA 3G5AA 3LBNA 2OFWA 2PAFA 4FMCB 1T5BA 4JN6B 4JUDX 4LG1A 2ZOSA 1EFHA 1X7HA 6LDHA 2YFQA 4G5SA 4BO6A 2E1RA 4AZTA 1JDZA 1YB4A 4GGMX 4IDAA 5DHPA 3TEFA 1QH1B 1FNCA 2BP7B 3G17A 4P3XA 4RH0A 2ZJ5A 1RI5A 4FBMA 1IEQA 5GOTA 5JNTA 3G9TA 3ILHA 4L75A 4NMMA 4II7A 4X6UA 4O25A 2PUCA 2JF0A 2PGXA 1RWKA 4P54A 5FYDA 4D9CA 2FRVA 5JXGA 1Y6RA 3WHKA 2A92A 4AMZA 2FMXA 4FGSA 1CUEA 3I61A 2FFJA 2FG5A 4UBJA 1ZCZA 2R8PA 3WGZA 4E5MA 3JQRA 4RSHA 3WHPA 4WOCA 1L4HA 4H3HB 3WL5A 1Z2NX 2IYFA 3IPLA 3O3CA 4RADA 1TGVA 2Y4OA 3MD0A 1JZTA 2VAMA 1AGYA 1EFPB 4X63A 5CGQB 4TTIA 2NP7A 2JDID 1FVOA 2Z0MA 3K9FC 4QFBA 4Z51A 1UCFA 4CIYA 1OH8A 3QSYA 5JXHA 4BO9A 3ZU5A 3PFNA 1A8QA 3FNBA 3VRHA 3DMDA 4OM7A 1M1ZA 2C5BA 3E2PA 4MP6A 3ZV3A 3IEVA 1CR6A 1PQPA 1Z08A 3CUYA 3VR3A 1FNSA 1MQSA 4NZZA 4E1BA 5F2OA 3QITA 1T4GA 3FROA 3ADCA 1R0BA 4BNJA 3EG9B 2PLAA 1DC8A 3ESYA 1NYRA 2ZT5A 1FB5A 4I4TB 5KYGA 3MTEA 4YT4A 3I4LA 1LZLA 3RR2A 3DL7A 4M76B 1K4KA 5LOVA 1HDYA 3DR5A 2ZBEA 2XVMA 4JXJA 1N1GA 4DCVA 2JCBA 2R65A 4B5KA 2CVOA 3HFRA 3ELWA 2PJZA 3EZ9A 1TT5A 1Y3AA 5J2TF 1YDMA 4OUKX 2ECFA 1Y1PA 5H83A 1L0BA 5KSPA 2IIQA 2QMHA 3DLIA 3ITEA 4ND2A 2QHXA 5M04A 3DQZA 1HE5A 4YECA 1F6DA 3JWHA 2IDKA 3OQBA 4O3MA 4CMIB 3M3HA 4GM4A 4R1UA 5ELLA 3OKFA 1MHPA 3DV9A 1Q57A 1PNOA 2CV0A 3HDYA 1L5NA 3MTIA 4M1EA 3U49A 3HVUA 4LWQA 2HU8A 3LDUA 5CB4F 1E18A 3KYBA 3FUXA 4XJVA 2MSDB 3PEUA 5ALPA 1XDBA 4CHGA 4DHEA 4EVRA 4EK9A 5T8KA 4BWVA 2CEKA 1G6HA 1KZHA 3JRXA 4H3KB 3S29A 3BILA 4X6LA 2XCRB 4XKJA 1YBAA 4ENVA 2VF2A 3WWDA 1OBCA 4GMFA 1JLSA 2B36A 3W4JA 4R9VA 1PYDA 1OR8A 4J2TA 4I5GA 5AI4A 4M53A 4BWFB 2D74A 4NENB 2I1QA 4LQLA 2GYYA 2QZZA 3JQFA 3KLBA 4GP9A 1CS0B 1SC3A 4E94A 4E33A 1FNBA 4INJA 4DLUA 2PANA 4L08A 5CDUA 2ACKA 4GLLA 2Q29A 1GCUA 4TXHA 4C6RA 4HSGA 5FT9A 5CVJA 3RC1A 4KNVA 1HE4A 2ISSD 4BZQA 2H7CA 1J49A 1W6UA 1KFJB 1IHDA 2X5KO 3B1XA 3EEQA 1CUGA 1Z88A 1NM5A 1B2RA 1VBMA 1ZZEA 4R05A 4W7HA 1OBVA 1NW7A 5DEIA 3JX9A 4WUVA 2OXTA 5DBOA 4BNYA 1UZLA 4QELA 3RFXA 1N9GB 1S8NA 4S1VA 4ZV7A 3K1AA 1QF9A 1USWA 1OIWA 2FEKA 2H7XA 3AJDA 2HK6A 4XSGA 4Y6QA 1Z4MA 2UKDA 2ZU0C 3FNIA 2GCOB 2QSZA 3ZDXB 3LRPA 5SYAA 1NNSA 4O2AA 1M2KA 1ABFA 4MVJA 5COQA 4F97A 5JY1A 5L8VA 4RFLA 3RSCA 1BWRA 1FVHA 2HQRA 2C2HA 1OU4A 3IEPA 1H05A 2XODA 3M0EA 3N07A 4B4UA 4FYWA 4F3TA 2XLCA 2HZBA 2GFIA 4JSYA 3B20A 4J4BA 2WLSA 4KN8A 4PZUA 1PG2A 4YUXA 1J90A 1AN9A 1FVXA 3NUGA 3BB1A 1TMGE 2WAMA 4R68A 1ZAKA 3ZK9A 3ZU4A 2JJ1A 3ND7A 4F2DA 4EI8A 1L4BA 3DQPA 5B64A 1TYCA 2CMDA 1AQNA 2NNLD 1GR1A 3BVPA 3OETA 4KXQA 5CYOA 3WK8A 1B8UA 5D1NA 3UAVA 2XTNA 1U5BB 2OXEA 1BE0A 3B53X 3ETJA 2VRNA 1OAKA 1BQ3A 3W9BA 3ZBPA 3SYLA 2P2LA 4N5MA 1IJFA 4F12A 3CF0A 3ZGNA 4JUFA 1TZBA 1GPAA 2G0NA 2HIHA 4GWGA 5JXJA 2IH2A 2OWEA 1YDEA 1E98A 1NN5A 4F3KA 1FU4A 1Q3HA 4X3OA 5JJ5A 3EZ2A 3P2JA 3K0FA 2V6MA 5EXSA 3ZDCA 3F3YA 5F1KA 4JLPA 3G9QA 1LK5A 3CR8A 4PZLA 1M73E 1RR6A 1C1YA 5EWJB 3P9QA 4GOLD 5KINB 1B8NA 5D5HA 1II0A 2CJFA 1SKBA 2D0PB 5C7OO 5LJIA 2AS0A 2WJZB 3F9CA 4UATA 2C57A 2X3UA 3VH3A 4LDQA 4RJKA 1XL1A 2FW1A 3NV9A 2CMHA 5JNUA 3ZBQA 4ZHQA 4DCGA 4PZAA 5AVTA 2PTHA 2B61A 3EZNA 3LQ4A 2A9VA 1PZFA 5BNZA 1ULAA 3OOSA 3ZV6A 4OSOA 4DGQA 2QAGC 2QLFA 4OJKA 1WPQA 2QM7A 2ZSIA 1QIFA 3DAPA 4A1OA 1V37A 4XJSA 2O3RA 3E23A 1FUEA 3ET5A 2HC9A 4IDGA 1RLTA 3VDQA 2CLEB 4LTNA 4PYMA 2Y1FA 2VR1A 2I3BA 3CSSA 4V0LA 3U31A 1B43A 2YNMA 3AONB 4K88A 1QF7A 4TRJA 3WOVA 5JYCA 4UNQA 2WYIA 2YMQA 4G1VA 4HDKA 3A2NA 2IQ5A 2OQ2A 2WDPA 1JEYA 2H3EA 4R1MA 3NT4A 5EKSA 1DC3A 1RBMA 3MWYW 4KPUA 3B1JA 2VK2A 4GEGA 5KWEA 2XKKA 2JLWA 2D1FA 3ZHQA 3LYLA 1S9HA 1P0FA 3MWGA 3WGVA 2DPLA 1AO3A 2VTEA 2ZIXA 1U28A 4G24A 4N7MA 4BBZA 1OLOA 3ZDZB 1QC5B 4PLGA 3NBYC 3R7LA 3E1KA 3FNEA 3IJPA 1CZLA 1GLNA 1MLDA 2IEIA 4QM7A 5IYZA 3D6JA 1ECLA 4G81A 1V43A 3X1ZA 1SU7A 3IR5A 1TKAA 3EWNA 4QPDA 4A5OA 1C8VB 3D1LA 2JFOA 2P6NA 5F7OA 3ZLJA 1U99A 1YZFA 1KETA 1JHQA 2EERA 3NFRA 2VF4X 3BHNA 5LA6B 3X1XA 2JFFA 3WKAA 3QNUA 4V03A 1GYPA 3JZIA 5LWQA 3GLVA 2QT9A 1W76A 1X0XA 2YVLA 3AERB 3O5AA 4L7QA 4DUGA 3UJAA 4NWIA 3HZOA 1VA5A 5AM0A 2DPXA 2XUAA 3CWQA 4EATA 5IVPA 1LLFA 2E3JA 5FO0A 1XO1A 2FKAA 1UXJA 4GOJA 1K4MA 4KK4A 4TSKA 4ZVRA 5TS2A 3RSQA 5HUHA 5JAOA 3D8BA 2JZOA 1VLJA 4KL8S 4DY4A 4EHHA 4EY4A 5A1TA 5G3ZA 4MPDA 1K5PA 3M6AA 4KFSA 3TNJA 3C3XA 1LKZA 2L69A 1GEGA 4FNGA 2QL9A 2YXEA 4D92A 1L7PA 2I4MA 2VOEA 5EJGA 1XCLA 1LTHR 1U6IA 3DTVA 3IH5A 1JYSA 5C5EA 1YL5A 1XVLA 2YN4A 3ZBUA 2WJVA 2H18A 4W6ZA 4N12A 2JFQA 821PA 3UAGA 5HQJA 4L4ZA 4LTMA 2ZW9A 1NVDA 2JHFA 1KTIA 4II3A 4OHRA 2WF6A 4KNYA 1WV0A 2FZCA 4YHBA 1Z2EA 1SVNA 2IOFK 1DWUA 1GA4A 4C4PA 1T2DA 2ZDGA 3QU5A 3AIIA 4HNTA 3I45A 1KORA 4RLFA 5I8ZA 3IT0A 1R4MA 2C7VA 4B7AA 2ARKA 3FPSA 4U3JB 1SBYA 2EW2A 5IKOA 2JJ1D 1HQKA 4FC6A 1VJRA 4IIBA 3OOWA 1KOGA 1LX7A 5EHQA 4OPMA 1MORA 2B94A 2J0UA 1C5KA 1FSPA 1VZ2A 2FQ1A 4X64B 4YYEA 3QVJA 2J3IA 4AJJA 1LPMA 4C6SA 2Q1XA 3O7MA 1R6AA 2QVCA 1TAUA 2I2DA 1WDKA 2I76A 4QEZA 5EWLA 3ZCRA 3V48A 5J9FA 2R62A 1OT3A 4ZQBA 2FZ5A 4HQLA 3T54A 3QELB 1VBNA 1Q0HA 1QH1A 1Q77A 2CL5A 1SXGA 2BP7A 5JT1A 1ESNA 1W2GA 1DFGA 3QXGA 1ZNYA 3IAAA 2I33A 3QXSA 3WNBA 5E1DA 5CGZA 4MR7B 3WV4A 4C03A 5HZKA 2A4KA 2AOVA 1M6VA 4OIMA 1Z6YA 2TECE 2GFHA 3ECAA 3ZK8A 4C22A 3H75A 1O0SA 3K70D 2NG1A 1ZD3A 4JELA 1NV8A 2BMDA 3CF6R 2D0IA 4O5OA 2AE1A 3VO2A 2CB0A 1UOOA 2AT1A 1Z4PX 3KUCA 2Q50A 2C5GA 2QA5A 4CMEC 1M1UA 1YB6A 4IKOA 1O97C 1PHRA 1RYBA 4D4KA 1T25A 3TRHA 2VSOA 3K5HA 1QH8B 3OSUA 2ZUWA 1FNNA 4H1UA 4XYBA 4TQ9A 4JDPA 1Q15A 5JNSA 4WY8A 2P78A 7REQB 1C7RA 1FFDA 1YNOA 3LUPA 1VA4A 3C45A 4ZCLA 4BQNA 5B1YA 4YAGA 1UXIA 4C76A 2QPOA 2ATVA 4D3SA 2GN8A 5CXQA 3D7RA 1YHZA 2OAQ1 4RQTA 5DMHA 3EG9A 4G5HA 1JV2B 1PW5A 1N2JA 1O5OA 3E0QA 3HKDB 1G1AA 4MHOA 1EK5A 1YUNA 2AD1A 4L3VA 4R0NA 3DKPA 5KCZA 2GX6A 1T29A 3TQCA 2ODWA 3MBKA 5D00A 1ML4A 4AM8A 3KQSA 4RQBA 1KYWA 5E9WA 2VQ3A 1DT3A 3VJLA 3OCCA 1GNQA 1MMFB 1M6YA 1POXA 2OZLB 4PRKA 3BG5A 1DJQA 4IGFA 3T0FA 2DLDA 2IW1A 3HVHA 2WUWE 2H1RA 3UIEA 1AKTA 2AFHA 1B93A 3IDZA 4U00A 4BNNA 1CUHA 4WBXC 3PPVA 2ZSJA 4B71A 3NIFB 1W34A 2IFTA 2A5FA 4F5YA 4QNMA 2EATA 3G59A 5BN3B 1ZRSA 4BNHA 1Z6QA 3CUSA 3LDFA 3W8EA 1E0AA 4MV4A 2A33A 3AETB 3VH1A 4DSZA 4IYRA 1V8OA 3M9WA 1XNJA 5D6OA 4R2MA 3V33A 4GKAA 3TR5A 1H8HA 3OE7D 2POQX 2JLAA 3AJAA 5A7GA 1W9HA 1Y1SA 3L05A 1KEZA 1TKRA 5GGXA 3ESZA 4GKKB 1COWD 1WB6A 4RTJA 2PEYA 3KS9A 5CJ2A 4YJ2A 2DUUA 2GN6A 3MCAA 2WKWA 2DCUA 2A1IA 2J5BA 1RLUA 2I3ZA 3LUDA 1GU1A 2UU9B 3RBXA 1T1SA 1XCPA 4U5QA 3A1TA 4FOLA 3Q87B 1OE0A 4HQRA 1E3TA 1ZUWA 2YASA 1ZIDA 2GTIA 5I4IA 4PQRA 3RI3A 4H1WA 3D7LA 2YWHA 3IPAA 4MP8A 4OJNA 2PWPA 3FVVA 1Z6GA 5G02A 2QJWA 1NQOA 2XZTA 1NQVA 3IALA 1QIHA 4DR3B 4EYOA 4ETNA 4PQGA 5ECWA 3R7WA 3CM0A 1CZUA 5F3DA 5MDHA 3EA4A 3Q7RA 4X61A 5JCJA 1PHPA 4A3SA 3CEPB 4E7PA 4PNPA 1RHUA 1MABA 1V3TA 2EKZA 3R7DA 1XZAA 4DW8A 1WUTA 5JBNA 4O8ZA 2NO7A 3U44B 3BMXA 3CXRA 2Z3VA 2GN0A 4BX8A 4ETMA 1UBKS 4B8ZA 3V3KA 4WXRA 2HV9A 2QX4A 2J4FA 3EXHC 3SM9A 1BXKA 4FYYA 1T0JB 1ZKMA 3LMKA 3PNSA 4QEKA 2FJ0A 1IQRA 1D3AA 5TC4A 3RU7A 1KEPA 2QTMA 3HTXA 2DULA 3F3KA 3ZKAA 2R7NA 3PBKA 3HL4A 1D2EA 3GT3A 4OHUA 5FBVB 1XJ0A 1YJXA 2IUSA 4NBUA 1JYFA 1Y33E 1T3GA 1YR8A 2JLBA 2O05A 3WLIA 3UBTA 1BXGA 4HAVA 2BFBB 1YFKA 1SCIA 5CTJA 2QORA 3MJCA 1ONSA 2W5UA 2IYQA 3AF2A 3I39X 2VWGA 1VSUA 4FP9A 1RJFA 1P61B 2QTWB 4WN9B 1Q0QA 5I5GA 1VHDA 1IBRA 4TV8B 1C30A 4CW7A 2O8CA 4IZ6A 3G1WA 2EW8A 1BJRE 1C3OA 1YTLA 3F4KA 1I4EB 2N46A 3PUWA 4UMDA 3SC2B 4EWLA 1LDEA 1XQVA 2PMDA 4GU5A 4JLJA 4YUAA 4DMHA 4LDJA 4Z4FA 4HQNA 4DUYB 2WPDD 4YONB 3UWOA 3ZV5A 5BOSA 3IMFA 4PGGA 1RI2A 3B6IA 3FHLA 3K8YA 1KJ8A 5G40A 3PLNA 3K7EA 3W1VA 1Y9ZA 4BLTA 1T9CA 4DJTA 4NV3A 4TTSA 2FMUA 2D06A 4DWOA 2FTKE 2Q5HA 2Z08A 3QFSA 4CTOA 2ZRAA 2J85A 4B3HA 4TQAA 1MA3A 1XTBA 5ULLA 1L3IA 1GADO 3A6LA 3A9VA 1AGXA 3HN6A 3CNHA 3IGFA 4OYRA 3VX4A 1SVKA 1GCAA 1JEQB 2P1DA 4D74A 1IH8A 3OJOA 2DHDA 4U6QA 2B4TO 3HYSA 2NO5A 1BGVA 1J70A 2D0DA 4B32A 3DM9B 5C81A 1R6VA 4W8OA 5GVSA 5LFAA 1YFZA 1NR5A 4KQHA 3KJHA 2O19A 1K7FB 3RS3A 3VR4A 1Q7CA 4CKEB 1VKOA 1SCKA 3WR5A 4QDXA 1Y6JA 5DZSA 2DFLA 4PEVA 4ZJUA 1D6JA 2BTQA 3ILSA 1G42A 1KP2A 1YJAA 2HGZA 3P96A 3U3KA 5HNKA 3OQMA 2CCJA 4B7ZA 3CLVA 3GUZA 1PFVA 3HBNA 3G9XA 4NCKA 2B9VA 5KTMA 2IYYA 4CM5A 2HO4A 2W4IA 2NT4A 2YHBA 4ENSA 3VYVA 3PICA 5L6MB 1T8TA 3BXZA 2ONJA 1JIKA 2O7NA 2XUQA 5FJIA 4CKZA 4ND4A 4YMGA 1FOEB 3D02A 3VR6A 1JHYA 4I6GA 3SIRA 1DXQA 4YT8A 1E9DA 2WZCA 2YV5A 2P0EA 1PR6A 2PMFA 3A04A 2SCUA 5HMMA 5JFGA 2Z6UA 3RRXA 1GWNA 4RGBA 2W2NA 2C20A 3PRJA 4WXPA 4Q05A 4OHMA 2QNBA 2ZETA 3IKVA 2IGTA 3VKUA 3KUUA 5L53A 1AZWA 1MENA 1P5JA 3E15A 5LP6A 1YR7A 2O5CA 3WAKA 2CJXA 1PTJC 3H84A 3NDRA 4F9FA 2FW7A 1LLUA 2GK4A 3A1VA 3CLSD 4FMPA 1NG9A 3E3OA 5E6UA 4U63A 2Q5JA 3UQYS 3BK7A 3TX6A 1IY8A 2P30A 3HCCA 5K3DA 2O3QA 1G8GA 1SCDA 1L7EA 1U1CA 1S02A 1BIFA 1FNMA 1NKVA 3A7EA 3DDWA 4X8LA 2AJDA 3N3BC 3R3VA 3JQ7B 3O8OA 3CPEA 1TTPB 4G4SP 4TSRA 5FTNA 4RDCA 1X70A 1S3GA 1L5KA 3PVZA 4BCBA 1XMOB 2ZVDA 5EQJB 3K1TA 3WP1B 2CDCA 3JASB 3KSZO 4EUSA 4NFSA 1ISHA 2VT3A 4W99A 2R87A 4TZTA 4BCDA 1KRWA 1TT7A 2PQMA 4X1IB 4LPKA 5EGNA 3U3ZA 1UWVA 5DSZA 3HV0A 3KTAB 3ENZA 3JQ9A 1F4PA 1H2WA 3I73A 3K73O 2NTNA 3NG1A 3KJZA 4TTVA 2I6SA 2XB6A 3MUEA 4O2BF 4HK4A 4A26A 2P3LA 3L18A 4HGZA 2NSHA 2ZS8A 2W48A 3PGLA 1JAIA 1GNPA 4FBGA 4OA5A 4V0NA 5I5EA 2IXDA 1RKQA 2JLRA 2Z5GA 2B8NA 4IRXA 2ACEA 3ZHUA 4F0JA 3DL2A 4PG5A 2CLMB 1NVAA 3I9FA 4YEDA 3BSSA 1P0IA 4LYAA 3WIBA 2FR8A 3GCGA 4XQEA 2FRDA 3IXMA 3PTZA 4KWIA 3WTCA 3HNRA 2BGTA 1X7WA 1LVHA 1GTMA 4YJFA 5IC4A 4DV0B 1RDFA 4G65A 3U9SA 4PVDA 3RYIA 2Y0EA 3MIIA 2D59A 2NO1A 1H22A 3Q0EA 1EKXA 4OVKA 3GVIA 1DEAA 1XBTA 2L17A 2FR0A 5A2QA 2FSGA 2J3JA 2V3WA 2HW8A 4C4ZA 2BGKA 4OFBA 2QJRA 4G89A 5K7SA 2BFEB 2R1TB 1Q95A 5T67A 1W4LA 1QAQA 3HABA 4QEDA 2ZUCA 3ZK7A 5HRUA 3TWOA 1AH2A 1SMKA 4KODA 4MJ3A 1A9PA 2NM0A 2RBKA 5UKDA 3GCDA 4HWSA 3VX3A 1WXXA 1IDN1 4EMTA 1Z63A 1FL9A 3C97A 2WM8A 2A88A 1ONPA 1QB8A 2WU3A 3FHJA 2FNAA 5H02A 4AG3A 2IS2A 4FX2A 1H2EA 4D9GA 3FBWA 4Z1MD 4DTIA 1X94A 3AR7A 4G5OA 5T41A 1ZL2A 4RCZA 3DE1X 5JCZA 4DMCA 5BW4A 2HWWA 3F71A 4OREX 7REQA 2Q3FA 2QXTA 2ZIFA 5AQEA 5I7AA 2C5EA 2FW9A 1G0NA 3FKQA 4WNCA 2XDQB 4YB8A 1K86A 4ZYUA 3JQGB 5BNIA 2D5CA 1FMFA 3TQFA 4FHGA 5B1HA 1F06A 4M0PA 1AHIA 2G83A 2H2FA 4JEIA 5LOVB 3GLIE 2A1UA 1Z9BA 1UFOA 3BWVA 4K0RA 2B6HA 4I14A 2X6RA 3F47A 1O94D 4IVQA 4LNUB 4MW7A 4RZSA 2NU8B 1XRLA 4AK9A 4U39A 3CISA 2Q4TA 1EGQA 1FXWF 3ETNA 3OZSA 3DPSA 2H1VA 1Z07A 1ZMRA 1HXHA 1I1OA 1FLNA 1M3SA 3AM4A 3AW9A 1LC0A 1B0UA 1O54A 4GYKA 4ZDKA 2XCLA 2UVPB 3EHDA 1JPVA 1W29A 1XFAA 4ZOAA 1NOJA 1UEIA 1VI6A 3V4OA 4BO3A 1FUUA 1PVVA 2VQSA 2ZRIA 2JAQA 2RB4A 4UXHA 4LF6B 1YJ8A 3IA2A 1EK0A 3EA5A 1IRXA 1NKSA 1CQJB 2WWWA 1NBOA 3K0BA 5FNZA 3ZIDA 5IN4A 4WLVA 2C59A 1N36B 1JQ5A 2Q3MA 3I09A 3MAGA 1OI3A 4NZNA 3QJGA 4K6KA 1BE1A 4LSWA 1D0VA 1LI4A 3DFMA 3EN0A 4Q3EA 4TZKA 5GMOA 3W8NA 5JANA 4KQJA 1SHZA 4FNAA 4BN0A 4HNVA 1SUSA 2Z30A 3H9EO 4HB0A 3ER9A 2FSSA 1XKQA 3A1EA 1MVLA 4JLMA 5SYMA 1NLZA 1T6XA 3THXA 1RHMA 4DJFC 1TX4B 1L8LA 2WDZA 3QENA 3T99A 1GTSA 5TEVA 3LA6A 3RHSA 1KDRA 1EIWA 3BWMA 3OOHA 1D4ZA 3PL1A 3C16C 2OCPA 2QQFA 1T6ZA 3GWGA 4FXPA 5TDHA 2HJGA 1XRQA 3D0QA 1JHXA 2I65A 1T9GS 4FYHA 4MW1A 4WCDA 2X0FA 4A8JC 4CG1A 2CHQA 2ZE6A 3EBPA 3R77A 4P3OA 4UUQA 3UOWA 2I91A 4NPAA 2NZUG 3GEBA 1NBMA 3O8BA 4PY2A 3LUBA 4BXOA 1LB1B 2XJ9A 4JJ8A 2DCMA 1OD6A 4NTZA 4TS9A 1F0KA 1PP4A 3K1AB 2IS6A 4IAOA 1NKTA 1H2HA 3ZLTA 2PUAA 4V38A 3NUZA 1N6HA 1YJBA 3QXJA 3FTNA 4JX9A 4O2AB 5TPWB 4Q03A 3DLHA 2VRBA 4NYMR 1J6UA 3BRWD 4KXXA 1JDBB 2AHOA 1OWPA 2PLRA 1SCNE 5AKKA 4Z1MA 1B23P 4U3JA 2XUPA 4OXRA 4DNQA 3RYHB 1OTYA 3H5WA 1F6WA 1Z7EA 4FM9A 1IHYA 1YDGA 2J7KA 5JVDA 4MQLA 4S2EA 3PFFA 2W90A 1PW7A 4Q3KA 4C7VA 2VXYA 2PSEA 1GTRA 1W8DA 4M46A 2I4LA 2QJOA 3D4LA 3E9QA 2PE5A 4NPHA 1DG3A 1WMSA 5TMDA 3ND9A 3O8DA 1ZSNA 2CHVA 2MIIA 2ZI3A 2YDXA 4TV9F 1PS0A 1OAAA 3DE0X 3MOGA 3RS4A 2IYSA 3CF4A 3HSSA 5DK6A 1PU2A 2Q27A 1Q7RA 3GMIA 3OJ0A 4FLMA 3V7WA 4P7BA 4QDKA 4BJ3A 3GBVA 3H13A 3HVRA 1CFZA 3X1JA 5AVOA 1Q0TA 1W19A 2A0FA 3WLOA 5EJ8A 2JLUA 3IHLA 1YB2A 1GNTA 2H2WA 3KOUA 1DAIA 2FPWA 2OXRA 4PFJA 3V97A 4X7BA 5DYTA 1UC5B 2GJSA 1X6VA 2HF8A 3MPUA 4NNPA 5KPDA 3G2QA 4FGJA 1RRPA 3OD1A 1P9NA 4LVNA 4ARVA 4GICA 2IEBA 2G04A 5JS8A 2CGEA 2XEDA 2DH6A 3K8OE 2GA8A 3O7WA 4KSBA 4MPJA 2Z3ZA 2XTJA 3SDZA 3MELA 4Z86A 2OCGA 3JWIA 1MF7A 2FX5A 4GG1A 5KYTA 4HF7A 3VNRA 5L45A 2ZAMA 1TL7C 3LH5A 3N0VA 4KXNA 2WQ6A 1G8JA 3F7OA 4N39A 3PX3A 4OQFA 4CR6A 4C0WA 1CUWA 1DUIA 1LRKA 4A6EA 4Z7OB 1Y8QB 1M0WA 2RGRA 1BW9A 2E18A 4C3ZA 2ZZNA 3GL9A 3JATB 1F8GA 3O2NA 5HF6A 4CG0A 3T3NA 3BIXA 2NUTB 2BCJQ 5HE9A 2Z56A 3AJ8A 3VAYA 1XN1A 4MVJM 1J7JA 1KQFA 3DBOB 2CK3A 4ANFA 1F7UA 3SF8B 3G2MA 1QS0A 3Q3CA 4XPZA 4MW2A 4RVOA 3RG8A 4DIOA 5EJ4A 3CC8A 4FYVA 2HA5A 4MRRA 4QVKA 5KNDA 3K0EA 3W7AA 5BYJA 4P83A 1GQ2A 1G2IA 3AR9A 2YUIA 3FYUC 4P98A 3P9XA 5ESRA 2EG5A 4Q4HB 2V7VA 2H31A 4RYDA 4BO8A 4YDQA 1BHSA 5DM70 2J3EA 1UL1X 4XQ9A 3ZLVA 5K3CA 2A58A 3RC8A 3W5IA 1UKCA 1Z7WA 6AT1A 1HMYA 4LF9B 1LV7A 1X3LA 2G07A 3GJZA 2JG3A 4Q7EA 1N2SA 5IK2D 3GP8A 2JL1A 2BHSA 1QV7A 2EKDA 4KQEA 2OCBA 3MXOA 3I9NA 4QOHA 4U2CA 3ZXXA 4DSUA 1DAFA 1Y1QA 3PX2A 5ESWA 3KWJA 4HNUA 2V65A 5G1PA 1MC8A 3F4BA 1AIPA 1YIOA 4QICA 5BMVF 4QX6A 2JFYA 3N8DA 1IOZA 4B43A 1Y1RA 2X9NA 3OKCA 2C7QA 1BDBA 3OPQA 2FKNA 2BSAA 2HMUA 2MWMA 2ZI5A 3Q9UA 3ER6A 1Z6TA 4QXAA 2E5WA 1KR5A 5GONA 1VP3A 1A5SB 4YV7A 5C31A 1NUUA 2R5FA 2OHFA 3OLZA 2P5UA 3UHJA 2JAHA 3DP7A 4HZUA 2XLBA 1NF2A 4CM1A 4YY3B 1SBTA 1CUZA 3LLUA 4DBVO 4OKIA 1D09A 1N2EA 1NSFA 2Z3WA 4RCYA 2NQ2C 5H4HA 3JZAA 3K05A 3QX8A 4URHA 4ZT7A 4F1JA 4M8NE 4BB5A 3ICOA 3PC2A 2RG7A 1DQYA 4F7WA 1SU4A 1PGJA 3ETLA 5ECYA 2YUTA 1DDIA 2EBFX 2HNKA 4R2LA 4YDRA 1E6EA 1WCIA 4Q1AA 4LV8B 4X60A 4QBHA 5KSOA 1XNHA 3PVSA 5JIBA 2X8WA 3WDKA 3CRNA 1SZPA 4K9QA 1MB3A 3WL7A 5KX5B 3A25A 2ZUTA 1RI4A 3IX7A 4GPAA 1LFAA 4ALNA 1Q16A 3V55A 4RO0A 4CM3A 4RQUA 3KZXA 4J4HA 3KQPA 1CY0A 3UMGA 3ONDA 2VJMB 3KTAA 4WA8A 4CLOA 4MGHA 2YQ4A 3VSEA 4DSTA 4BE4A 4LYEA 1KZ1A 2CLLB 3KQUA 1WCXA 5EQTA 3PQ4A 1QE5A 2J9XB 2W8ZA 3DKIA 1ESMA 1PZEA 4KOEC 1XKXA 3EVGA 1PJ4A 2R66A 2RHOA 4OYYA 3S7ZA 3AR4A 1H0SA 4E22A 4AQYB 2YXDA 3FUUA 4FONA 5AW7A 2ECPA 4F85A 1M0SA 3F2IA 4PG4A 1ZD1A 3KJNA 4WK0B 1A27A 1Y9EA 1F8FA 1AG9A 5MN5A 1JSRA 4UU0A 1W59A 4LRWA 2LKCA 1G41A 2HHAA 3NYRA 1EK1A 5HKOA 3OJCA 3DEZA 3KFLA 2YY5A 4N3CA 1X7WB 3HLTA 3LC7O 1DOAA 1AK1A 3MOIA 4HB4A 4YJFB 3W5JA 4ARBA 1Y6GA 3LCJA 1WQ4A 3RVOA 4L6IA 5HDBB 1ZUD1 1QYXA 2LGJA 3H5TA 3NHWA 4UUPA 4L78A 4DR6B 2G63A 3N9IA 3RM3A 3FHTA 4F6LA 4DLYA 2ID7A 4KDRA 4OU5A 3NC0C 4FDAA 4RY8A 2RHLA 1KVQA 2LV8A 2W70A 4DLTA 4Y3UA 4MUNA 4DR2B 3CLTC 3A0RB 5T7BA 1E0DA 3FWNA 5NLLA 1GFSA 2WV9A 4DXAA 2O3JA 4MUMA 4EG5A 4S24A 3EODA 2VAWA 2TMYA 2PD4A 1PVOA 5DWDA 1K27A 2B7LA 3PF8A 2HDNB 3OIWA 2I6FA 4PHTA 4XD7D 3QIVA 5FLYA 1RI3A 2UYHA 3ZVKA 2R8BA 3AHIA 5K8CA 1B7GO 1TZKA 2SBTA 4IWYA 1U8YA 1BHO1 4O4HA 3IYLW 1W85A 2F62A 4MV5A 5A4DA 2H85A 4U02A 3TINA 1KEUA 4NYIR 1MR3F 1HUQA 3OY2A 3TJMA 2DE0X 4WMLA 1AKRA 1PJ2A 2G76A 2NPFA 2IDMA 4N0EA 5DX8A 1H5NA 2BBOA 3PPXA 3IS3A 2GEBA 1XZLA 1JFVA 4Z4EA 3EW7A 5K5EA 3AFHA 1H8EA 1L5YA 5IJXA 3OMXA 4WXYB 3HKBB 4WE3A 2Q4BA 2VATA 4LXQA 5B2ZA 3DB2A 1UMDB 3SLGA 1QGZA 2CXTA 1CEQA 2QM0A 2QQEA 5J47A 5ALGA 1BDJA 3INNA 2V7QA 3ORYA 1TQ6A 1DDOA 1BKDR 1NYQA 3HWRA 1PQYA 1ADBA 4MUJA 1WZNA 3U5TA 2A1TR 1U9IA 1TNDA 5B3JC 1RAEA 3L1HA 4NC9A 1GOTA 2AXEA 3H5OA 1E3EA 1O08A 3NWEA 3PJEA 4IJWA 4O2BA 2FPXA 4JBNA 5ITSA 2PR2A 3ZS9A 2CLIB 3W3AD 1BE8A 3WL8A 4L5BA 4BNLA 4DQUA 3CVOA 2JFNA 4H7JA 5M2QA 2IP2A 2BH9A 3L6BA 2JIDA 1UMBA 3JQAA 3SXUA 2F9MA 1ZRMA 1H1LA 1P17A 1XFDA 1SPXA 1QIIA 1Z68A 3FPHA 3I1FA 1B41A 1GPMA 1UKAA 2PU7A 3OQIA 2BSXA 1F8YA 2C5SA 1VI5A 2WPDA 3JD4A 4H77A 1KSJA 2FGJA 3CKYA 3PQ6A 2I4IA 4TYMA 1G20A 1SN7A 3A2MA 4LC9A 3HCBA 1O1YA 3AUUA 1PTJA 3I23A 1U81A 3VUFA 2WIKA 1U1EA 3DEJA 3FIUA 3EDRA 5FOVA 2YY7A 1EG2A 4ND8B 3JCZA 1YFJA 2QL6A 5JEDA 1BCRA 2ZWMA 4TRMA 3SEZA 1WF6A 2BR5A 1E64A 2PKQP 1SFRA 2LR0A 4WERA 1L8OA 2ZP1A 2J45A 4NF2A 4OP1A 1GVHA 1XCOA 4H0NA 3QRWA 1PQUA 1K7SN 2FPRA 2CJPA 3JAKB 1GGEA 1O9BA 3N39C 4RPLA 1NUQA 1Q12A 4WOBA 4BGUA 5KSZA 4G85A 4M86A 3R7WB 4AJ2A 4Y0AA 4CDGA 2GN1A 2MSKA 4LAFA 5JU6A 1XMQB 3USES 4MIOA 1FP4B 4MR8A 4X85A 2OESA 5JISA 3GQBB 3KHTA 4KLRA 1OXBB 1QZ3A 2ODQA 3IBGA 4Y7DA 4M7RA 2P6RA 4Y0NA 2YZ7A 3ZHBA 2QVBA 3EBLA 5HX7A 5KDDA 5F7XA 1TW3A 2NQTA 2ZTLA 4HH4A 3BE5A 4MWGA 3UXMA 4B7XA 5HTKA 3IQXA 2KS6A 1V9LA 2PWZA 4IIUA 4JQCA 2KI5A 5EUBA 4JR2A 4LZZA 2J1LA 4AKIA 3CX3A 1VG0B 2Z9BA 1TI7A 2Q6TA 4LOLA 3M1YA 3IHKA 3P4YA 4D81A 3L2OB 5LVAA 3K32A 3MWJA 4ISCA 4MV8A 2NOAA 1BMTA 4EHKA 1E20A 1U0NA 2YWXA 4A36A 5E3HA 2WU4A 3COSA 3WDLA 5JWOA 2D3WA 1V16B 2GZ2A 3TQIA 1M5RA 4ILEA 3ZIUA 4RTOA 2P9HA 1A8PA 2IZZA 2F17A 3ZQKA 3R7FA 3EA0A 4F6RB 4YR7A 1KQPA 2YWBA 4DDKA 2JNWA 2LNDA 3ZCSA 1JIUA 1QTNA 2O0JA 3DE3X 4KGVA 5FBQB 3TTTA 4MCAA 1KY3A 3VKWA 2FSUA 2FEXA 3OQ1A 4I4NA 4JB8A 4BE9A 4G63A 3B2EA 4CMHA 2F3PA 2UYCA 3RAPR 1E0KA 3HA7A 3S70A 3MQFA 1Z3CA 4ZKDA 3G3EA 1DX6A 1I0LA 1EQUA 4DR4B 5BMVB 4EVQA 3B5EA 3RRBA 1L5SA 1S1CA 1ZI6A 3IAUA 4IJQA 1IY1A 4DQDA 4KBYA 2JW5A 3GLIB 3SJZA 3VC2A 3KEMA 4JYZA 3G8AA 3JPYA 2B5WA 1J2EA 2YL2A 4I1RA 4ML3A 5CNJA 4OUDB 3WGHA 2CV2A 2Q9BA 1DE0A 4FB4A 1J06A 5DTJA 4TMVA 4FKZA 4XB6B 1QQ7A 4OI0A 1U0OC 3IVGA 4G25A 4IO1A 2W2KB 2Z8YM 3H16A 4Q47A 3WDSA 1XYVA 2EG9A 2EKBA 2EGGA 2WKQA 3DOCA 1M83A 4WNAA 4GSKA 4RKQA 2G71A 221PA 4XLTA 1NW5A 5JSYA 2ZG6A 1NW9B 1E7SA 3KZMA 2PRSA 4RH1A 4P8RA 3IXQA 1C9NA 2QP9X 4HGQA 3F90A 5DHQA 2CBZA 5DU2A 4DJJA 2P7HA 3DA8A 1KYTA 2Y2VA 3I0ZA 3FNGA 5CK5A </