3U4HA

Cd38 structure-based inhibitor design using the n1-cyclic inosine 5'-diphosphate ribose template
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
245
Chain Sequence
QTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD38 Structure-Based Inhibitor Design Using the N1-Cyclic Inosine 5'-Diphosphate Ribose Template
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ADP-ribosyl cyclase 1
total genus 81
structure length 245
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2011-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3u4hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u4hA02
3WYBA 1E1KA 5JC1A 3ZWXA 4YQZA 2BFOA 5L7WA 3IIEA 2EV9A 4NBTA 1HXHA 4BNHA 2AQKA 4U6SA 5DDIP 1BDBA 4N5NA 3QHAA 1F12A 1VPDA 4I9NA 1VC2A 2RBEA 3VZSA 3P2OA 1VRWA 1ZCJA 3P19A 4WGGA 3M6IA 4JIGA 2EGHA 4CQLA 3F1KA 3RC2A 3F5QA 1RJWA 3INRA 4IS3A 4YVFA 5TJ9A 4BNFA 4IDCA 3IUSA 2D3TA 3PP8A 4DIFA 3A14A 3D4PA 3EW7A 4CMKA 2O4CA 1CQJA 2QIOA 1DC5A 4I5EA 4JK3A 5GY7A 5IN4A 3JQEA 1IYZA 4XJSA 2O2SA 4FJ2A 3I1JA 2VYVA 1YDEA 2Q99A 2GASA 2JCYA 3UCFA 1R4MA 2J3JA 1SB9A 4INAA 3ZDFA 3ON5A 4TROA 1DOHA 1YQDA 1C0KA 2AG8A 1DFHA 4B8ZA 4Z0TA 1HE3A 5C5IA 3UN1A 3FNGA 1AHIA 1ONPA 1F0YA 2Q1TA 5F5LA 4BGVA 1NASA 5KVSA 4IDDA 4AJEA 3GPDG 1J0XO 1Q1NA 2BF7A 1M2WA 1M6WA 1VJ0A 3ONFA 5CEJA 1HE2A 1UXHA 4LW8A 3G17A 3I23A 5CG1A 3K8ZA 1K2WA 4JQCA 3QA9A 2BHLA 4YAJA 4HV4A 1JVBA 3VZQA 1IB6A 2GERA 2G5CA 2V6MA 1HDXA 4BNVA 4E0BA 2OZPA 5JMPA 2H5LA 2NUAA 2DBZA 2CFCA 2ILTA 3PZBA 4RF2A 1I2BA 2GN4A 2IODA 3KLMX 3SLKA 3WMWA 4AJIA 5JXWA 4J49A 1GR0A 1DBVO 2BGLA 4L8VA 3Q9UA 3HADA 3C7AA 4CV1A 1RYDA 1T24A 3JTMA 2W2KA 4XIYA 5F5NA 4BKPA 4ITUA 4KWHA 1X7HA 3OBBA 5A5EA 5CP8A 1LQTA 2FOIA 1RM3A 1N92A 1GZ3A 4IJWA 3NDJA 1YL5A 2DTEA 1YBAA 2NWQA 2NACA 4J1NA 4CQMA 4K6CA 3ZI0A 5ER6A 3DBRB 1ZUD1 4CR8A 1NXQA 1J5PA 1NQ5A 1QG6A 4UUOA 4N54A 4DLBA 4Z0HO 3RUIA 5ICSA 3MOIA 2W98A 1UDBA 4IY1A 1JTVA 4C7JA 4L0QA 2EKQA 2FN7A 2W2LA 1CWUA 5JAMA 3ZN2A 3BMNB 5DP2A 1A71A 4YPOA 2VYND 1BGVA 1LDNA 4XYLA 2JHGA 4I5FA 3ANMA 2XPCA 3GN1A 1BWSA 3RUEA 3DFUA 3TL3A 4YRAA 1EVIA 4BNJA 4FFRA 2ZYDA 4W99A 1Q0QA 1B26A 3ZHYA 2NVUA 1T1SA 2HMTA 2Y66A 2VTEA 3OETA 5KJ1A 4CUZA 4EJ6A 3I3OA 4MOWA 4CMIB 3F46A 3ZNOA 4L75A 2P5YA 3ITKA 1E0DA 3KYDB 2Y1OA 3IAHA 3WTCA 3I9KA 5L51A 1D1TA 1SB8A 4BV9A 5IG2A 3DEYX 1DB3A 1HDYA 2Q3EA 3NV9A 3GVXA 3JQFC 1KETA 1PGPA 2Y1EA 3TDKA 3B20A 3QWAA 3D64A 1X1TA 2JFHA 3WGGA 3DC2A 6ADHA 3VKUA 3W4KA 1T4BA 3D4NA 4NG5A 3ZU5A 2D5CA 3LF1A 5LCXA 1Y5RA 5DNAA 1U9JA 4OXKA 2UUPA 3ENKA 4W6ZA 4BHTA 1T25A 4GKVA 3AFMA 4JGBA 4W7IA 4JXKA 3ST7A 2FPGA 4D42A 1Z45A 4O63O 5G0UA 5T8KC 1DLJA 4PG6A 4MVJM 1I33A 2CVQA 3PWKA 1P33A 1QMGA 1NP3A 3JQ8B 4RLHA 1GCUA 3DOJA 1MC4A 4MO2A 3WWZA 4G5HA 3QV1A 3ZHBA 3M1LA 4CLXA 1YWGO 2WD7A 4YJGB 4ROSA 2EWMA 5CDYA 1SZJG 4PLGA 4Z9XA 1YQGA 3LT0A 3C8MA 3JYNA 1IPEA 1PIWA 3KSZO 2VRBA 2X5JO 3H7AA 1C0LA 1D3AA 1UZNA 3S2IA 2UVDA 3FTNA 3FSRA 1M66A 4UEOA 4ZQFA 2Q1UA 3ZW9A 1W8DA 5A3VA 3NJ8A 3FTPA 2C2XA 1P77A 3OICA 5A9SA 4R9SA 3ZHXA 4FSHA 3COSA 2HCTA 4B4OA 1NAHA 3WFJA 3WYEA 1I32A 2YJZA 4L4XA 4WCFA 2Q45A 2OOSA 3WNQA 2X9NA 2FZWA 3I83A 4J7UA 4XQCA 3UCXA 1T1RA 1I3LA 3BHIA 5THKA 2OL4A 1ZNQO 3F9IA 2IEBA 2Q2WA 1UZMA 4XDZA 5KWEA 3ZGYA 5A03A 5JYEA 4UVDA 4RZHA 4CV0A 3ANLA 4RORA 3PTZA 4XGIA 4ZQEA 2VTDA 4B4VA 3WG9A 5A9TA 4F3YA 3S8MA 3M2TA 3NT4A 1GUZA 1P1HA 1R4NB 4F46A 4GGPA 1EVZA 1R15A 3H5AA 2Y0CA 3KOUA 1GEEA 3HDQA 2QYSA 3R3JA 2X22A 5ILOA 5KKAA 1N7HA 4MIOA 1P1KA 3TZ6A 5JBIA 3A9WA 2PNFA 4BNLA 4KDFA 2WJPA 2E4AA 3L6EA 3L6OO 4Z9YA 2B69A 3VZPA 3RU9A 2VNAA 4JJGA 2NU9A 3TZKA 2IZ0A 3GAZA 1GPDG 3LDHA 3OEYA 4XJTA 3CEAA 1TVEA 4BNYA 4DC1A 1D1SA 4IXWA 4YWJA 1Y8RB 2RH4A 5JSFA 1HLDA 3W8DA 4A10A 3SLGA 3OA2A 3F1LA 3PWSA 2Q4EA 1V0JA 1UP6A 1LDBA 1QP8A 4YXFA 5BSEA 5A3JA 3OQ6A 4J91A 4RV9A 3RJ9A 4CLDA 3NT5A 1PGOA 2J5QA 4CQMD 4PZDA 1SOVA 1BXGA 8LDHA 2I66A 4RZIA 3CUKA 3D3EA 1YRLA 3AI1A 3OQBA 1JA9A 3O9ZA 3S2FA 3W1VA 2AW5A 1XEAA 4ZN6A 5FI5A 4R9RA 5IXSA 3G3EA 3MJVA 3LYLA 3WGOA 3ITDA 2Y67A 3HNPA 4EITA 4Q39A 4FJ0A 2B4RO 2BKAA 3GZNB 3OA0A 1CETA 4XB2A 2OP1A 3GUYA 3ZV4A 3I9JA 2PGDA 4EUHA 3EK2A 3EZLA 3PXXA 3ZNQA 4CUJA 4BKRA 3E9QA 2HAEA 4WOKA 1I0ZA 1U8FO 4P22A 2FR1A 2I3AA 3BHMA 4DMMA 5U4QA 3GVHA 4ND4A 4B7XA 4O6VA 2TMDA 2HDHA 5L53A 1TT5A 1XKQA 1VLLA 4I5DA 2JFGA 4E5YA 5BNIA 4FGWA 4ZICA 2GGSA 4X54A 3ZWAA 1DC3A 4PCVA 5KJCA 1ISJA 1IPFA 5FEUA 2EJVA 1QYCA 4ALLA 1H6DA 2O3SA 3Q3CA 1LC0A 3ONDA 2ZYAA 3LC1O 5KNLA 1VM6A 2PGJA 1ZSVA 3DBVO 1ZH8A 1O95A 1LEHA 2PA3A 1FJHA 3WBBA 5AXDA 3E82A 3RBXA 2WD7B 4YJGA 4TKLA 4RPLA 3E5MA 1OZAA 3FNHA 3BTVA 3DOCA 4OKNA 1HDCA 3DAPA 3GVIA 4CODB 3JQBC 2POQX 1KC1A 2DUWA 4EUFA 1S7CA 3A1NA 1ORRA 1Q7GA 4FGSA 5ER9A 4DREA 5IJZA 3E1KA 5COAA 3EC7A 5H83A 1B8VA 1PJ4A 4JP2A 1XA0A 3JQGA 4MVJG 4R1SA 2DPHA 3ADOA 2YQ5A 4IDEA 3PLRA 1A4IA 1LXCA 1AXEA 3JQBA 5EQDA 4CLRB 5A9SB 3V5NA 4PRKA 3KZVA 2JHFA 4KTVE 2YHIB 1FDVA 5DZSA 3PDJA 2DVMA 4HNGA 4QT0A 2CMDA 4YJDA 3SX2A 4KDEA 3F4LA 1AUPA 5G0SA 3ROMA 5HA5A 2O48X 3SJUA 1ZK2A 2V6FA 4NR0A 4Q9NA 4D46A 1HL3A 1F14A 1ZK0A 5HS6A 3NYWA 1Q2XA 2EKPA 3FPLA 4YJFA 5THQA 1BW9B 3BTOA 3L4BC 4FFMA 4FFNA 2OGUA 2CUKA 3P2YA 3UOGA 4YEDA 3PRJA 1WNTA 4AICA 1R16A 3HHPA 1C1XB 1T4DA 4RVDA 4XB1A 1QV6A 2Y1CA 2BGKA 4BNIA 4BO0A 3OJLA 5C3MA 1U7TA 1HLPA 3OH8A 4I9HA 4QO7A 1KEPA 4WCFC 1LDGA 2VZ8A 1ZEMA 1UH5A 2IXBA 1U4SA 2NM0A 3M2PA 4OHUA 3DBHB 1A5ZA 2DFVA 4FOSA 7ADHA 1WMAA 1KVUA 3HDHA 4UVHA 3O4RA 3BMOB 1BTOA 4MVJF 4LISA 1V35A 2ZTVA 1A7AA 1ULSA 4UUPA 5JY6A 4YAIA 3RBZA 2UDPA 3UXYA 3WBFA 4LSWA 3I9LA 1OOEA 5B4UA 5TJHA 2IXAA 2ZCUA 4JCOA 1KEUA 2WDZA 4JJFA 3AFNA 1I3KA 4ZU3A 2D59A 1SO8A 1EFKA 3DZFA 2X86A 4HY3A 4CM8A 1V3TA 1XR3A 4FC6A 3BMQA 2CNBA 4BKOA 1B3RA 5TT0A 5HM8A 4H3VA 4E31A 4RPKA 1YQXA 5B37A 4QQRA 2PWZA 3DOOA 4YRBA 5HWSA 3BAZA 1ZMOA 3O03A 3TL2A 2X0JA 1NFFA 1O8CA 1EK5A 4LGVA 4WNIA 3RC1A 2GRAA 2VYNA 3DONA 3RCBA 4GKBA 3JQAD 2PH5A 5KJ6A 1CYDA 4UVIA 5DCWA 1KOLA 1I30A 3Q1LA 1G0OA 2DTDA 4CMCA 3ZHZA 3K6JA 5BSFA 3FBGA 1OMOA 1E6WA 4CQLB 1DAPA 5CDUA 4Q3EA 4RDHA 3RC7A 4BNZA 2D5AA 1UXIA 3WQQA 3ZWWA 1DIHA 4O5OA 2HRZA 3IP3A 3W8FA 1E3EA 2X58A 2AQHA 1AGNA 3G79A 1PX0A 2XXBA 5G0VA 1P3DA 4XGKA 5IAAA 3O8QA 1LRLA 1I10A 1UAYA 2V7PA 3MWDB 5MGBA 3T4EA 3EYWA 3IKTA 3D4OA 3WNVA 4M8SA 3OIDA 5ILGA 3RUHA 3AUUA 1ZVMA 4M49A 3TZCA 1EUDA 1KS9A 4DMLA 3VPFA 2B36A 1C1DB 2PLAA 4HBGA 2CDCA 3I4CA 2Y99A 2BFAA 4N5LA 2G82A 1YOVB 2YW9A 3B6ZA 1T2FA 1PJ3A 4B3IA 4F45A 1SOWA 2B4QA 2ZB8A 3CMMA 1KEWA 5BSGA 4OKIA 2NVBA 1QORA 3PLNA 2JJYA 4IMPA 4PLCA 3D7LA 2VN8A 4YTEA 4E3ZA 2HMVA 1PL7A 4BNNA 4NMHA 4BO3A 4DPLA 4IINA 3LK7A 2IEDA 1GU7A 4R1NA 4JLWA 4E21A 1PZHA 1T2EA 1WDKA 4KUGA 1JLLA 2DM6A 3GGGA 1V8BA 2Q1SA 3VVBA 2R6JA 2C0CA 2QG4A 3AW9A 4D3DA 4YQYA 3DL2A 3RSHA 2Y93A 3JD0A 2Y0DA 3VAZA 3IJPA 3GDGA 5DP1A 1VL0A 1E5LA 1PJBA 3Q2IA 4PLZA 1EFLA 1UJMA 4RF3A 3TFOA 2OO5A 1BVUA 1M76A 3DZJA 3QW2A 1NVMB 4M55A 3C24A 4MJLA 1FDWA 4D43A 1Q7BA 1GZ6A 4W9NC 3VH4A 4PG4A 3HB4X 1H2HA 4EYEA 3RVDA 2DBVO 1XQ6A 2QZZA 1AXGA 1LLQA 2X0RA 2J5KA 2X1HA 4JBGA 1B8PA 1Y8QA 5T5QA 2E49A 4CMAA 2GYYA 3H9GA 2OBNA 4GSKA 3AK4A 4FFPA 4U8GA 3C1TA 2BD0A 4W82A 1MA0A 3AUAA 2DFDA 3SC6A 2AEJA 4DUPA 3RUDA 2O7QA 5DCYA 1E1NA 1DXYA 3PJDA 1OFGA 1VSVA 2P4HX 1GAEO 2X9VA 5JYDA 1WVGA 3S2GA 4CV3A 3SBOA 1OBFO 2AA3A 1V3VA 4H7PA 4BV8A 2B5VA 1ISGA 2C54A 2OORA 3RUAA 4YYZA 3GK3A 5LDHA 3PHHA 1E3SA 4XIJA 1R0KA 4GVLA 5CPFA 3JD1A 3UAGA 2C59A 3Q9NA 5JW6A 1R66A 1ONOA 1HSOA 1ZZEA 1PJ2A 4XD2A 3SXPA 3H65A 3L0DA 1B14A 5TLSA 3QVXA 4XR9A 2BLLA 5HBRA 3C7CB 5COQA 1F06A 3QWHA 4XCVA 1UXJA 3I52A 2PZKA 3MJSA 4R5MA 2X23A 4FCCA 3VKVA 3K31A 1KC3A 3DO5A 4WNCA 4L9RA 4MVJE 2AE1A 3S2EA 2GNAA 2OBYA 1GADO 2E6UX 1K0UA 1P0CA 3HDYA 4CLOA 1WLYA 3ZNPA 1NYTA 5BQFA 1XDWA 2UAGA 1BMDA 2C82A 4MKRA 4YT2A 3C7DB 2PKRA 2B0JA 3FI9A 4QTZA 3ETGA 1OC4A 4TWRA 4HFNA 4R1TA 4B3JA 3RROA 1K5HA 2HQ1A 3AOEC 1U3TA 4I08A 5F3RA 4BKQA 3W8EA 1AHHA 2GR9A 3PQEA 1SNYA 1PL6A 3GDOA 1Z74A 4KUHA 4DLAA 4B8WA 1E3JA 1DEHA 4BNXA 1Y7TA 2QX7A 3NTRA 4GAEA 1LSJA 2ZQYA 4MIYA 3HSKA 2ZB7A 5BNTA 3IC5A 1Y6JA 3OMLA 4M1QA 2O23A 1S6YA 1DC4A 3ZU4A 4FR5A 5BSHA 4ALJA 1QYXA 3PWZA 4II2A 1K6XA 3PGJA 2YQ4A 1EZ4A 2YY7A 5A1TA 3HJAA 3H4VA 2VHZA 4UEJA 1U28A 1A72A 5AVOA 4E5PA 3WGQA 3BTUA 4RL6A 4CMEA 1WW8A 1HDZA 1PS8A 5L7YA 4MKZA 4LN1A 2VRCA 1E7MA 2VOJA 2RHRA 5EQFA 5FYDA 1ISMA 5MDHA 1JAXA 2CVZA 4CM7A 1DJNA 1PZFA 4CM4A 3ICCA 4RPGA 4YDRA 2EERA 2DT5A 1EUZA 1ZIDA 4BNTA 4NBWA 1GQQA 2C07A 2V6BA 3KBOA 3OFSA 2BMAA 2O2YA 3MJEA 3GUCA 2B37A 1C3VA 2VT3A 1NPTO 4GX2A 4J2HA 1PQPA 4OO3A 1FDTA 4Q3AA 4P4LA 4GSLA 3EHEA 1X14A 3GHHA 1LU9A 3RD5A 3CH6A 2AE2A 4WCDA 5C7LO 1ZXLA 3KEOA 4BNGA 4HFMA 3CPSA 3HDJA 4S1VA 3MZ0A 1DDOA 4ID9A 3JQ9C 1N1EA 2PKQP 2NTJA 4YBZA 3KYCB 3T7EA 5F1PA 1ENYA 2JD2A 4JJIA 3VC7A 1BRMA 2YUTA 4XR4A 1E7RA 2H9IA 4E5MA 4NU5A 1SC6A 3RIHA 2ZTMA 1KYQA 3K92A 3CTMA 4UUMA 3TPCA 4QECA 4WEOA 3QP9A 1VI2A 2HKIA 4XEHA 2NLOA 3MOGA 3WB9A 4XRRA 3IMFA 1H2BA 4YT8A 3FHLA 1BW9A 2VNSA 4PZCA 1AN9A 1PL8A 3WGTA 2PKQO 4TRRA 5DCUA 3RJ5A 3RFVA 3WXBA 4E33A 2ZTUA 3N7UA 4E5NA 5JDCA 4E2ZA 3L9WA 2DU8A 4MP6A 2VOEA 4DL9A 4CMEC 1J49A 3O26A 4NJOA 5BR7A 2EW2A 4MVJI 3P5SA 2W90A 1DRWA 4PVDA 4IMRA 5AOVA 1N9GB 3W6UA 2D8AA 1ZK4A 3QJ5A 4D0SA 3PPIA 3R6DA 4BO6A 3PK0A 2G1UA 3GDFA 4JBIA 3WYCA 5KCZA 3BTSA 1P45A 1O6ZA 1A4UA 3PEFA 2NNLD 3Q6IA 4XYMA 1E3WA 3BMCB 4UUNA 4S3MA 3TZQA 4W9NA 4RVHA 1A9ZA 3PJGA 5IDYA 3FR8A 4DQVA 2C7GA 5C7IO 2GO1A 1N8KA 3KXDA 2I6TA 2O3TA 2E48A 3PJEA 3W6ZA 1UXGA 2B83A 1JWAB 2NADA 1RM0A 5ENVA 4I9UA 1DRVA 1X7DA 2CF6A 2P9GA 1H93A 3F6YA 4BO4A 4BO1A 4CQMB 1QSGA 1UZLA 1P1JA 4QUKA 5JAZA 4IIUA 1YB4A 3ZWOA 1LDMA 4CLOB 5K9ZA 2F00A 3DZBA 2Z95A 2Q50A 4TRMA 2DKNA 3U0BA 1I2ZA 4NBVA 4F6CA 3BMNA 2FZEA 4J3FA 1ZW1A 3OECA 4DXHA 5B4VA 1J6UA 5KVQA 1C14A 1DPGA 3V2HA 5L4SA 3AUSA 4Y6SA 4ZVVA 1GQYA 1SAYA 2X7HA 4DYDA 3PGXA 3JQGB 1PJCA 2FPIA 3GA0A 4CLRA 4WLNA 1NX6A 4IBOA 1U3UA 1XIVA 4K9DA 4RDIA 3HWRA 3UGKA 1E1MA 2BFPA 1IL0A 1W4ZA 3GH3A 5JNLA 4OQYA 4NIMA 3H2SA 4CMJA 4J0FA 4FFOA 3VH1A 2VHXA 4A73A 5L4LA 4I5GA 1YOVA 5GZ6A 3RUCA 5IDXA 5AXBA 4AJPA 4KWIA 5EESA 4K1LA 2Q49A 3C1AA 4DQXA 4RVGA 1K6IA 3ORFA 1Z82A 3BZUA 2OMEA 4BMVA 3JYOA 1WXDA 2C7VA 3QWFA 3F3SA 3KV3O 5KVVA 5G0TA 1T2DA 1HDOA 1B8UA 2WWRA 3WQRA 1T2CA 4WOJA 5EMHA 3V2UA 3JQ8A 3ZWCA 1JKIA 2VRCD 3PHLA 3PI7A 4OQZA 4UVGA 4O59O 2P9EA 3V2GA 4YA6A 5EN4A 4IM7A 1HE5A 4ALMA 3SJ7A 1P74A 2P4QA 5H81A 4YAEA 2YFQA 3L77A 2HUNA 3GFGA 5EIOA 3WMXA 1LSOA 3KO8A 5CPBA 4DRYA 1G6KA 2H63A 4M89A 5EJ2A 1FK8A 2I99A 5COBA 4YCAA 2P9CA 4N5MA 5CAEA 4WASA 1XELA 1ADFA 1F8GA 2D0IA 3GMSA 3PVZA 6LDHA 5IZCA 1OAAA 2X6TA 5AXAA 4L76A 2W2KB 3N58A 3E8XA 4BB5A 1LTHR 5G0WA 4LCJA 1E3LA 4QSMA 5BT9A 1BXKA 3PDUA 5T6BA 1QV7A 3K2BA 4XZ3A 3TFQA 3ICPA 1WAMA 1SEPA 1IHYA 4AJOA 4WLVA 3IKVA 3DAGA 4GMFA 1NAIA 3GVCA 2RAFA 1DIBA 3VOSA 4BMSA 4D45A 2FMUA 5TRTA 4D79A 1E92A 4HWKA 3B1JA 1RM5A 3GNSA 3IP1A 3TN7A 2Q1WA 3GG9A 4YACA 4PN3A 3G0OA 3GC6A 4JP3A 4OJNA 3MCVA 4AG3A 4OXNA 3BHJA 1SBYA 3FWNA 4IDGA 1N9GA 3QLJA 4ZHSA 5L4NA 1SCUA 1DJQA 1EUCA 1LRJA 1ADBA 3FRJA 3HZZA 3OIFA 3U4DA 1JAYA 1R0SA 3GQVA 5ITWA 5HS4A 3JV7A 4AL4A 4RPHA 1WMBA 3OJOA 1FDSA 2SCUA 3H9QA 5F21A 5CDSA 2EF1A 2P91A 4CMIA 3AI3A 4TMFA 1NVTA 1MP0A 3KYDA 2O3QA 2X4GA 1PWZA 5ITVA 1O94A 2A35A 2QZ9A 3PHJA 2WSBA 3BYZA 5JE8A 3VTZA 2EW8A 1HDGO 4Y6RA 1E7QA 3TRIA 5TS3A 4E4YA 1C0PA 4Q3CA 3LT1A 1MG5A 2B35A 2X0NA 4Y6PA 3HB5X 4E2YA 1I36A 2UUOA 4BMNA 4PG5A 3W4JA 3F4BA 4BNUA 5B12A 2JAPA 2BFMA 1NPYA 4TVOA 1DC6A 4LRSB 2UV8A 4R3WA 3KEQA 4ND2A 2PD3A 3JD4A 1Z73A 3MEQA 3T4XA 2WD8A 5KJEA 4AJNA 2RH8A 1C0IA 1H9AA 9LDTA 4MVJA 4IPTA 4TKMA 1FMCA 4P4NA 5HTOA 3F47A 1UDCA 1YB5A 2I3GA 2RHCA 5KOIA 4IDFA 4J4TA 2DUUA 2YHUA 4B3HA 4DBZA 3DHYA 3ZWNA 3CMCO 4U5QA 1GTMA 3VPHA 3ADPA 2IZ1A 3JQ6A 1F17A 4QFDA 4KUEA 1O89A 2LDXA 4W7HA 2HO5A 1Y5MA 4CV2A 1QLJA 4AJLA 2O3UA 1GQ2A 5FWNA 1ZKMA 4RJTA 2HK9A 2DPGA 2GF2A 3IS3A 2R2GA 1DAOA 1I3NA 3E9NA 5IF3A 1PGJA 4NH4A 3TF5A 1ISHA 2DC1A 3DDNA 5K0ZA 2RIRA 3I9MA 2VWGA 3D5TA 3U49A 1GYRA 1DSSG 3ZW8A 3ROKA 4IQ0A 1LLCA 2AG5A 2BRUA 4TSKA 1PEDA 4ZQBA 4NI5A 3QRWA 4H16A 4U0KA 4NQZA 1HKUA 3V8BA 2FSVA 3HQ4O 1DIAA 2NU7A 3AU9A 1KVTA 1HYGA 4D7AA 4YJHB 5I8ZA 4URFA 2NVUB 3R1IA 4M87A 1PU2A 1FDUA 2JD0A 2NSDA 4CL8A 1IZ0A 2VWQA 1C1XA 2BELA 2NQTA 1JN0A 4HFJA 5AXCA 2E82A 4ZD6A 4J0EA 4EDFA 5JY1A 4UAGA 5IDQA 4NZ9A 2AHRA 5FI3A 1LUAA 4AJJA 5KJFA 1N2SA 5GMOA 3VPSA 3WR5A 4NK4A 3MTJA 3U4CA 1V9LA 3BXXA 1YL6A 4LVCA 1I24A 3QE3A 1SEVA 4XQGA 3S1LA 3WIDA 3X2FA 4DQUA 3CE6A 2PTGA 1IOLA 4EGFA 5JCXA 1ZK1A 5A04A 2AEMA 4WE3A 4YT4A 2HK8A 1X0VA 1XGKA 3ZWYA 1T2AA 3INTA 5ENDA 4XRGA 4KMSA 1VL8A 5CEFA 5I7VA 5B4TA 3LLSA 4XQEA 3EVTA 2EEZA 3WWYA 1MXFA 3E18A 1E6EA 3JYPA 2Q4BA 2OUIA 1GFSA 3NJ4A 4BQPA 1P0FA 1ZMTA 2DTXA 4CM8B 2AXQA 4MP8A 3GR6A 2AQ8A 4E2WA 3RC9A 2GN6A 1ISFA 1BDMA 1XG5A 3ASVA 3P7MA 1PGNA 1Y8RA 3CZMA 2FWMX 4NU6A 1H9BA 3AY7A 1DFIA 3KVOA 1A7KA 5C7OO 3DZGA 1SPXA 4TRNA 4XQ9A 1FXSA 4DIBA 5TIIA 2Y1FA 4CMBA 1MXHA 2YFHA 4R01A 2BH9A 1JU9A 2OP0A 2A94A 1VJ1A 1LLDA 1U8XX 3EAGA 1ZO8A 2VQ3A 1PWXA 2PZJA 3WOHA 1XQ1A 2IYPA 4GQAA 1ZEJA 4WJZA 3U4HA 4J1QA 4PLFA 4Z3DA 4WCFB 1NWHA 1DHTA 2JAHA 4NBRA 3ZV5A 1PZEA 4MDHA 4CL3A 4JROA 4WKGA 3DBHA 2BGMA 5L95A 3EUWA 5CG2A 4I1IA 1DO8A 1I8TA 3CSDA 3JQDA 5A5FA 5DOVA 5ICMA 1HYEA 3LVFO 2Q46A 3ZWBA 1YBMA 2NU6A 3AOGA 2VUUA 4DLLA 1SMKA 3LT4A 1WP4A 3L4BA 1CJCA 3T7CA 4OXYA 3ULKA 4FQ8A 3ZU3A 3GEMA 5ES3A 3K73O 1R0LA 4PVCA 1LJ8A 4CM6A 4J1SA 2GUGA 4MPDA 4OAQA 4DGSA 4BO7A 4YRDA 3RKUA 3WX0A 1NHGA 1WZIA 3TOZA 3VVCA 4J7CA 2HRBA 4JNKA 1XYGA 1VL6A 1U1IA 3FWZA 4CM4B 1L1FA 1G0NA 2C2YA 4G81A 4DPMA 5KTKA 2B4TO 4HFRA 1P1FA 2VWHA 1V6AA 4AFNA 2AMFA 1ADGA 1IE3A 3GHYA 3H9EO 1L7DA 1HZZA 3DMYA 3GEGA 4MIEA 3DFZA 4Y9DA 4FOOA 3C1OA 3QVTA 2JCVA 4WK6A 3AM4A 4BO2A 2ZTLA 4KQXA 3LC7O 5HRUA 1J4AA 2JKVA 1QYWA 3WGZA 4GH5A 1HE4A 4ZRNA 3PQDA 3DBRA 4GLOA 2J6IA 5AQ1A 2NV6A 4IGEA 4U6QA 1R6DA 1PJLA 1YBVA 1TI7A 4J9VA 3WLFA 4B79A 1ISIA 4E32A 4MVJH 4A03A 4BKUA 1X15A 3FNFA 4B7UA 3DBLB 1U5CA 1BXGB 1X13A 1X0XA 4EJMA 2HK7A 3JQAA 4AVYA 4P4GA 1Z7EA 3FN4A 3ROPA 3LT2A 2PH3A 5A4DA 4YB8A 1KVQA 2IRWA 4KQWA 5C37A 4OGWA 2W2LD 2HU2A 2NQ8A 3UKOA 4M54A 4GVXA 4NBUA 3DWFA 3UICA 3H8VA 2XAAA 4PGFA 3EDMA 4N7RA 1QR6A 5EL0A 4DIOA 4RQTA 3NT2A 1XHLA 4EEXA 1OC2A 4NHEA 1E1LA 2I5PO 1U4OA 4XGNA 3L6DA 1HEUA 3PIIA 1KIFA 3R0IA 2Y1DA 2E37A 4CR7A 4RO0A 4HADA 1U2DA 1AE1A 3MTGA 2CVOA 1NR1A 5I7EA 2IYOA 2VZ9A 4D0RA 1V3UA 3OJEA 1CIVA 4Y8VA 3L9XA 5F1KA 4IZHA 3VTFA 1NVGA 2VHWA 3AM3A 3SEFA 3C3XA 5JCJA 3ZZNA 1Y1PA 1XWFA 1HETA 1KVSA 4K26A 4PFJA 1I01A 1YE3A 1RPNA 4CPDA 4BS9A 3GAFA 3GNQA 4J9UE 3DMTA 3L4SO 4R16A 4DPKA 1BXZA 5F1OA 1NFRA 2C20A 1K89A 3EGOA 3K9QO 4B4WA 3DZIA 2V6GA 1ZSYA 2BI8A 2EJWA 4C4OA 4HP8A 4RF4A 4RVSA 3I6IA 4ALNA 4BNMA 2YV2A 3F5SA 3KHUA 3W4IA 4J7XA 3E6AA 1E77A 2QRLA 4CR6A 4TRJA 3VH3A 2Q2QA 3ABIA 3NDIA 1PJTA 1Y8QB 3AY3A 4UREA 4R51A 2WEKA 4A27A 3KTDA 4U7WA 3QY9A 4J43A 3IQDB 4Z0PA 5L3ZA 3U9LA 1EVYA 3GRPA 4F6LA 1PTJA 4NJMB 4FS3A 4OM8A 4IS2A 5A06A 4CLEA 1GV1A 1TXGA 3I9NA 1JKFA 4WLUA 2HMSA 4E6PA 4PG8A 4H15A 1XCBA 4O0LA 1NFQA 1NQAO 1E7WA 3BA1A 1CF2O 4GPD1 4J4HA 3JD3A 2JL1A 1MFPA 2GN8A 1DIRA 4TQGA 2X9GA 3QIVA 1Z7BA 4JBHA 2HSDA 2O4UX 4A5OA 5JAIA 3UF0A 4CM9D 2ZQZA 4DA9A 3D3WA 1ENPA 1MC5A 3I6QA 1BSVA 4FC7A 1GV0A 2IZZA 4GX5A 1TB4A 5I9LA 1P31A 4A26A 1UR5A 3EY4A 1I3MA 4PLTA 3INGA 4BUCA 5TNXA 3L07A 1KEVA 3LC2O 2CDAA 2CF5A 3TQHA 1BG6A 1GEGA 2FR8A 3RKRA 3EVNA 1TEHA 3RWBA 1EMDA 3MJ4A 5BNFA 3VZRA 1NQTA 4XYGA 2XF8A 4GL4A 1KVRA 1MV8A 4BIIA 3AUTA 1CQIA 1KY4A 2VHVA 3DAFA 4BGEA 1UXKA 1ZBQA 4P8RA 4EJ0A 1GUYA 3GGOA 1LNQA 3PHIA 4CUKA 5I7FA 5LDGA 1QLHA 4K28A 4J90A 1E5QA 1U7HA 1VKNA 4NPCA 4EZBA 4R69A 3I5MA 2WYVA 3GMDA 4E30A 3QWIA 5IFLA 4HKTA 3PFWO 4GGOA 2LDBA 2NU8A 2EKLA 1E6UA 3ZH2A 3ZWVA 1CRWG 3TOXA 4YAKA 3PYMA 3RUFA 3OJ0A 2Q2VA 4P38A 1YH3A 1Y9AA 3JCZA 2IDZA 1HDRA 1R37A 1WWKA 2FY8A 3UW3A 1HYHA 3BIOA 1P1RA 2PV7A 1ULUA 4BNKA 5IXYA 3CINA 3JQ9A 1RKXA 5CHEA 5EINA 2O7SA 5I7SA 3FPCA 3SC4A 4FBGA 4WUVA 2WYUA 5H82A 3DTTA 4WLEA 1K3TA 4ILKA 1P44A 2FR0A 4Z9FA 2DAPA 1LSSA 4PZEA 2DBQA 3DTYA 1RM4A 3AOEA 2CZCA 5FF9A 5JDIA 3OQ1A 3V1TC 3HUDA 3RAJA 5CDGA 1EEHA 4ZA2A 3JQCA 2Z1NA 9LDBA 1DFGA 2ZKLA 2TMGA 4WLOA 3LU1A 5JLAA 1HWYA 1PR3A 3X2EA 5DN9A 1Y9EA 4FW8A 2PD6A 1A27A 3VH2A 4II3A 4YAGA 3OM9A 4Z3KA 8ADHA 4OMUA 4CM5A 4IGFA 1TT5B 1GYPA 1E3WB 2PZMA 3BMCA 2HMWA 2B5WA 4UVEA 5JPIA 3UH1A 2W8ZA 1PQWA 3E48A 4L4SA 3D5QA 1XLTA 1ONNA 3CXRA 2WM3A 3KLPX 4EEZA 3RU7A 5B1YA 1B2LA 4LMRA 5JFOA 4DBVO 2ZB4A 5DBFA 3ZU2A 1PS0A 5L9AA 1K6JA 1ML3A 1PGQA 3H9JA 2Y05A 3KYCA 3WLEA 1T26A 4RGBA 2P2SA 3WJAA 4G65A 1GL3A 2Y0EA 4ALKA 2O3JA 4GWKA 3JYQA 1H0KA 2CDBA 2R00C 2EHDA 3AI2A 4L74A 4PRLA 1HTBA 1JW9B 3WTBA 3NAQA 4RQUA 3HN2A 3QVWA 1Z75A 1HZJA 4MKXA 4YR9A 1NPDA 5T64A 1LX6A 5IZCC 3UUWA 5IDWA 1LRKA 3QVSA 1EK6A 3RBVA 2HMUA 4UEKA 4AJKA 4IXTA 2GSDA 3K96A 4BGIA 4QO8A 3RASA 3GLQA 3GPIA 4NFHA 4EUEA 2Y1GA 2A4KA 3WSVA 4GX0A 4FD3A 2ZB3A 3K30A 4Y67A 1GY8A 4NDNE 1BVRA 3ETEA 1DLIA 4DC0A 1HF3A 3TWOA 4IUYA 3D0OA 4ESOA 1YVEI 5G4KB 1VSUA 3S55A 1I5RA 1D4FA 1R4MB 5K6AA 2CD9A 2ZYGA 3ENNA 3GEDA 3HE3A 1IULA 4MVJD 1IUKA 3NTOA 3PHGA 4XX0A 1Y81A 4GMGA 1LC3A 2GPTA 3TSCA 1QXSA 2JD1A 3WGYA 4RF5A 4LK3A 4D41A 3DHNA 1U2GA 5KKCA 4AJ1A 2Z5LA 1EBUA 4Y98A 1ENZA 1GCOA 4XDYA 4AJ4A 2EG9A 1UUFA 4B4UA 4I8XA 4R54A 1IY8A 4E2XA 2Z1MA 4J1TA 2G17A 3DR3A 1GD1O 3U62A 4BGUA 2J3IA 2HJRA 3RFTA 5L7TA 5AYVA 2NTNA 3A06A 2YYYA 1UAGA 1C1DA 2C5EA 2Y68A 4D3FA 1KERA 3KSUA 3RFXA 4EBFA 1B16A 3OF2A 3U4IA 4CMGA 3R3SA 4E12A 2HLPA 3JSAA 2JCXA 1ZK3A 4MINA 3WICA 3IJRA 2ZJ0A 2IE0A 1B3BA 2RCYA 1NWCA 2O3RA 5JAQA 1EE2A 3HN7A 2H6EA 1H5QA 1EBFA 2GZ3A 3EMKA 1MGOA 4IZIA 5G4LA 4WECA 5A9RA 1OI7A 4NK5A 3Q0EA 3ZWPA 1ADCA 4FFLA 3E5RA 4K6FA 3HFGA 3I9OA 2FHSA 4OYRA 2O50A 4TVBA 1U3WA 3OP4A 4RCVA 1Q0HA 1G1AA 4MVJP 3RQSA 2J3KA 4BVAA 1X1EA 4IIVA 1NHWA 1O0SA 4NFSA 2WTBA 3VPGA 3H3FA 4BL5A 3CKYA 3GF4A 1L7EA 1UDAA 2DBRA 1QYDA 4LMPA 3LLVA 1B7GO 1MFZA 3JQAB 3ANNA 4HX5A 4ND1A 3HFSA 4BNWA 2PR2A 4UULA 3NRCA 3WQSB 1GYQA 5JO0A 3FNEA 1TT7A 5I9NA 5DT9A 2ZJ1A 2FSSA 3NGXA 3DZKA 3MJTA 2H1SA 3DB2A 4GLLA 3NTQA 4AJHA 2ZCVA 5L45A 4WLFA 4IDBA 2R00A 2XXJA 3KRTA 4OOFA 1LQUA 2W4QA 3E03A 5T57A 2FPPA 4XKJA 1QRRA 2JFFA 2QRKA 1W6UA 2BI7A 1D8AA 3O8QB 2AEFA 2G0TA 1TLTA 2GZ2A 5TGDA 1H6CA 1F8FA 4C7KA 3G1UA 1EDOA 4PIVA 3IOYA 2VWPA 3ONEA 4M86A 5JS6A 2VZ0A 1LDYA 3K5PA 2GDZA 5TX7A 4BO9A 3DZHA 4KZPA 4O1MA 3FCOA 5JCJD 3EZYA 1HT0A 2NTVA 2YV1A 3H6KA 3MWEB 4NFYA 3DXFA 5DULA 5K6AC 3NDRA 2WMDA 2FP4A 3IUPA 4YJFB 1NQOA 3OIGA 2XOXA 4OL9A 3RI3A 4Q3DA 5A05A 3V1UA 3FF4A 5JDIC 4ZRMA 5I9MA 1P1IA 4N18A 5TQVA 5TT1A 4J6FA 4PLPA 2PGLA 1NNUA 1IHXA 3OHSX 5I8WA 1EE9A 3CIFA 1P9LA 4KTTE 3VHRA 4OH1A 4CM9A 3FBTA 4XYBA 3NUGA 5IN5A 1R4NA 4RVUA 1M67A 5U9CA 1QKIA 1YGYA 3GGPA 1GDHA 1R12A 1JDJA 4WEQA 3IL2A 3JYLA 3KSDO 4CM3A 3BMOA 3LSYA 4QEDA 3G49A 4BB6A 1NM5A 1PSDA 2QYTA 7MDHA 3WFIA 2ET6A 2ZIZA 3B1FA 1YB1A 5TC4A 4PLYA 2NVWA 4FN4A 1FF9A 3UFXA 2QHXA 3NEPX 1HSZA 4RVFA 1EDZA 4J4BA 3JQ7A 1A9YA 2OHXA 4J16A 1LI4A 1WDMA 1ZJZA 4HNHA 3H5RA 4R41A 5G4KA 4R68A 4WPGA 2VHYA 3BMQB 5L40A 4E5KA 4PG7A 4Q3NA 1YS4A 1XU9A 3WIEA 3GT0A 5LC1A 3PZRA 2YDXA 2VCYA 3OSUA 3WDSA 2A9FA 2D4AA 1MX3A 1E3IA 3AJRA 3B70A 4BO5A 1PQUA 1YL7A 3H2ZA 4E13A 1IZ9A 1ZFNA 1NTOA 4YT5A 1Z6ZA 5T67A 3GRKA 1M75A 3M1AA 3AWDA 4FPXA 1W73A 1LLUA 4L73A 3LQFA 5KVCA 3K2EA 3ZNNA 3AM5A 2EIHA 5TSDA 3ROQA 3NX4A 5ADHA 3GOHA 1B0AA 4ZJUA 2X0IA 5IZ4A 4A2CA 4YJHA 1RYEA 3ZV6A 5TF4A 2PY6A 5EERA 2QQ5A 1YJQA 3WJ7A 2C5AA 3A28A 2J3HA 1MLDA 5DBGA 3JD2A 2D1YA 2QRJA 2PK3A 4R3NA 4CM1A 4LSMA 2QW8A 1LA2A 1YKFA 4D44A 1MUUA 3QVOA 3LF2A 1W0CA 3GY0A 4OSOA 3PYLA 4FB5A 4DTIA 2VUTA 1HRDA 1ARZA 1WZEA 3SVTA 4U0JA 1M6HA 4PLWA 1PS9A 3CZRA 4KP7A 3ETDA 3N74A 1NBOA 2HJSA 1O5IA 4DYVA 2X5OA 3U3XA 1MB4A 2EXXA 2I76A 3OJFA 4IJUA 2J8ZA 3H3JA 3KYBA 1BHSA 2YZ7A 3C85A 5GZ1A 1YJ8A 1DHRA 2GCGA 3QQPA 4BQRA 1EVJA 3U09A 1JKJA 5CEEA 4W4TA 4BOYA 1LBEA 2CY0A 3DBLA 1CDOA 1ENOA 5JO9A 3TNLA 2G76A 3H5NA 1JVSA 2P68A 3WSWA 1E7YA 4IQ8A 3D1LA 4XYEA 2I67A 4QFCA 2J5RA 5DBIA 3PQFA 2UYYA 4IQGA 4J2OA 1RWBA 1X7GA 4QXMA 5EPOA 1EQ2A 3ZCXA 4RPJA 3LZ6A 3GFBA 5DF1A 4JX8A 2X5KO 5CDTA 3GZNA 4NJMA 1WDLA 3AU8A 4RLSA 2PZLA 2GN9A 3GN2A 3TZHA 4GX1A 2ZK7A 4ND5A 4HXYA 4IJKA 3PFFA 4GBJA 4ZGWA 4TZTA 4B7CA 1U5AA 1JWBB 4XA8A 1B15A 3PJFA 2GZ1A 4GI2A 3E9MA 4ND3A 2I65A 2ZATA 3FR7A 5GZ3A 3ASUA 4FJ1A 3VPXA 3WGIA 4FDAA 1JQBA 4CJXA 2CSUA 2I9PA 4OSPA 1CEQA 1H6AA 4DWVA 3KM0A 3B1KA 4MP3A 3ZV3A 2F1KA 1N1GA 3DHEA 2A92A 1I2CA 2WYWA 4LRTB 5J23A 3WGHA 5DOZA 2EGGA 1XSEA 4R4JA 2VUSA 2OXIA 3WS7A 1UP7A 1GUFA 3Q11A 4XWYA 2AQIA 3UCEA 4ALIA 1TA4A 5KIAA 4EW6A 2YDYA 3GVPA 3HG7A 4NNJA 2X8LA 2PD4A 4ZQHA 1PR9A 4EI2A 3Q2KA 2GLXA 3UVEA 1N5DA 3JQ7B 1XU7A 3NKLA 4TZKA 4A0SA 1H6BA 4A7PA 1KY5A 3DMTC 1O9BA 1ID1A 1U3VA 5U1PA 4G2NA 3UHAA 2YHIA 4BO8A 1YXMA 2DQ4A 1VE9A 1N7GA 1PJQA 3DQPA 1VKOA 1DRUA 4R1UA 2EP5A 1H94A 4Q3BA 4IDAA 2P5UA 1ZJYA 4LVUA 3TJRA 1CERA 4IJVA 2GD1O 5CFZA 1LSUA 5FFFA 3PIDA 1E7SA 4KOAA 4R5HA 3GZ4A 4FIZA 4OOEA 4QX6A 5JDCC 2VT2A 3D3WB 3V1YA 1GPJA 4AJ2A 3VDQA 1ZXBA 2DLDA 2EP7A 1ZSNA 3A4VA 1EQUA 4D3SA 2VYVD 2PFGA 4OIMA 1YDWA 3MJCA 4LCEA 3OEWA 3GNTA 3PYXA 3IDSA 1PZGA 3JQFA 1Q0LA 3O38A 3STHA 3KETA 3FD8A 1VJTA 2D2IA 3I4FA 4GWGA 4ONEA 4DVJA 5JMWA 1KBZA 2YV3A 2OFPA 5G2OA 3U5TA 3QSGA 1NR7A 1Q7CA 5A02A 1DIGA 1WPQA 1UP4A 4PLHA 4JN6B 3GG2A 3NGLA 4Z6KA 5JC8A 2FRDA 4L4RA 2C29D 2WE7A 1MG0A 1YO6A 5T8KA 3ZWMA 1YONA 2V65A 3AY6A 3VDRA 3G1TA 4PLVA 1QYVA 4CLHA 1LDEA 1GZ4A 1D7OA 1PJSA 2WE8A 3KUXA 3QWBA 3KB6A 3H9UA 4ZQGA 4CMHA 4HUJA
chains in the Genus database with same CATH superfamily
4N82A 2P6UA 2XYRA 1ODLA 1T6ZA 1QRDA 2EX0A 4F06A 1V7QA 3OPMA 3G0HA 1YZUA 1DKRA 2EV9A 4MQ6A 4NBTA 4OA5A 4URUR 5DYIA 3STVA 4FWIB 1BDBA 1DBPA 3OOJA 3AB3A 2FJ0A 2RK6A 4FGKA 4N5NA 3MTDA 4O4LF 3VTAA 3G5TA 2Y27A 3L6BA 5KQLA 3KQSA 2V9CA 2IYFA 3TLCA 3FPKA 1EPUA 4Q4CA 1EQAA 3DJYA 3SNHA 1PR5A 4KO1S 3EUEA 3VZSA 1U3GA 3P2OA 4U2DA 2FEMA 4Z8YA 3LWBA 3QBVA 4HYTA 3R8CA 1THGA 3U7RA 3NM4A 4YVFA 2IDJA 3RSZA 2VQDA 4B9AA 2I6SA 2NT3A 3H1PA 1NUSA 2ZBPA 4IZOA 4DIFA 1W1UA 3D4PA 4CMKA 1CYEA 5ARDA 3EDYA 3KAQA 4QC2A 1YZHA 4JK3A 2YMLA 2ZRKA 4TYQA 1IYZA 5GY7A 4XJSA 4FJ2A 2Q3MA 1XK6A 1ZX1A 4L5YA 3KDSE 2G72A 3I1JA 4G1BA 4KR2A 2Q99A 2B2CA 3FLMA 3IUNA 3SP1A 4OHMA 2JCYA 3EQ7A 1SB9A 4INAA 4L5CA 2PMCA 3ON5A 4KN6A 1VA5A 1ZCFA 2XTMA 2AG8A 2VTKA 1RXCA 3FFTA 4M9ZA 5H0IA 3HXPA 4RGYA 1DFHA 2CZQA 1ND5A 3DDSA 3IIKA 2FFJA 1XI2A 1AO3A 2G08A 3L05A 2VJPA 3GLVA 3NQ41 1LPPA 5ESDA 2GAIA 2AHOA 3P9RA 3FNGA 1ONPA 2E6KA 5HOQA 3T7SA 1B6GA 1S01A 2Q62A 1BGWA 4KGXA 3BWBA 1M2WA 5E7MA 1YCGA 3HKCA 3QLTA 5IANA 3QFSA 5CEJA 1HE2A 2IC5A 5AJVB 5KX5A 1SHLA 3DM9B 4Y0NA 4OPMA 2GVNA 1TADA 2HDNB 2OENG 3LOPA 4HNVA 4KYVA 5J3JA 4HAZA 4IIYA 3QU5A 4IFTA 4IXNA 1YBHA 4JQCA 4MUJA 2ISSD 5HR5A 3FSEA 3DWEX 1AS2A 1NBHA 1CXZA 2XWPA 4LYDA 5JXIA 3TOCA 1OH7A 2QTMA 3DB1A 3RSQA 2J0UA 3E3MA 3SLKA 2CYBA 1D7AA 3NFYA 1T0PA 3FOWA 3TMKA 2W6JA 2WHPA 1IUOA 3KELA 4J49A 4POAA 4LAFA 4X7RA 4YC7A 5CB6A 1DBVO 3B53X 3OPNA 1ZJ4A 3O3NB 1Z2OX 2YCLA 2CXQA 2QAGB 5KNBA 3MT8A 5KYGA 4OJTA 2XB8A 5FTKA 1M6YA 4JHLA 4XIYA 4X84A 4BKPA 4KWHA 3OBBA 4C7BA 5JQWA 1OLOA 5A5EA 1X3LA 2UYQA 1LQTA 3ELBA 3FUTA 1CR1A 1BS1A 2WMYA 1RM3A 1N92A 2GETA 3VSEA 5DYYA 3QEOA 5FYQA 3NDJA 4EUSA 5I47A 4KE9A 4QE3A 1N2CA 1W75A 2DTEA 2NWQA 2PZAA 1SBCA 4CN8A 5GIOE 2CLOB 2ID4A 3UGQA 4CQMA 2QZSA 4J1NA 4DE5A 5DI3A 2FF5A 3FPHA 4OLHA 3TSZA 4M7OA 5AIAA 5KOHB 1VMEA 1NQ5A 1RI5A 3G7UA 1LV7A 1RDFA 4N54A 5LDDC 2YXBA 4Z0HO 1OFUX 1ANKA 3HYRA 3K0HA 1UDBA 1QG0A 2J33A 4FBMA 4FFWA 3UMSA 4C7JA 2BM0A 3UMYA 4L0QA 1CF9A 3CW9A 2EKQA 2YR0A 2OD9A 4B3BA 2ZRFA 2YXLA 1NQXA 5EJ5A 4ZI2A 4YPOA 4QGFA 2FEKA 3MJFA 5CX1A 1UMDA 5JUWA 3LLCA 4RY8A 3RH0A 2AXPA 5JZBA 5FLKA 3E0QA 5KU7A 3JVIA 4JYMA 5KWSA 1UKYA 4LWOA 1R9GA 2XT9A 1FA9A 1XZDA 1YQUA 3M6XA 4MV3A 3JARA 3ELUA 5CB8A 5D84A 5IJ0B 5EZ5A 2O14A 1W36C 2A0XA 1G5TA 1HT2E 3FUUA 3IUBA 2CHQA 1V43A 4KBGA 4W99A 3NHBA 5C4GB 1Q0QA 5DLDA 4MWBA 2NVUA 5KSWB 2B4AA 2Y66A 2BZ1A 4ZYVA 4RH1A 4I8DA 1I3CA 3IB6A 2ANBA 3TNYA 4L75A 1WB4A 4XFJA 2FWBA 3ITKA 3AVYA 1K68A 2I2WA 1AX9A 4TV9B 2FE4A 3E22B 5L51A 3LFHA 4BTEA 1H23A 5IFKA 4BV9A 4FDUA 5IG2A 1IBSA 4MWCA 1DB3A 1S0UA 4I4NA 4ZDIA 4Y30A 5J5VA 1SOAA 1T2UA 2BMWA 1PGPA 3O90A 3QWAA 4FN5A 1EZ1A 1K7CA 2BI4A 3D64A 1A50B 3RVMA 4TN1A 2KB0A 2JFHA 2Z6UA 1J0EA 3IHWA 3W4KA 1PWHA 4YJKA 3D4NA 1Z4QA 2Q5QA 5E6UB 3OKCA 1DAKA 2BFCA 5LCXA 1Y5RA 3TTYA 1M8PA 3NBAA 1WW3A 5LJLA 3DV2A 1NXWA 3RM3A 3OWHA 3KJHA 3ST7A 3OQJA 3ZGOA 3AETA 3A6ZA 3BJRA 1GVHA 3TRJA 5A6SB 4O3MA 1G21A 2J48A 1T8UA 1Q7RA 1Z45A 4FINA 4C2UA 4LNUB 4MVJM 3Q72A 5K20A 3P9YA 1BN6A 4JC5A 4JV5B 3WB0A 3JQ8B 3BOSA 3FIUA 4LF6B 4AP9A 3L4KA 4NOMA 3IILA 3WWZA 1N34B 1N2GA 1TM1E 2R6GA 2X0FA 3WMGA 3HWWA 4E07A 3QV1A 4LECA 3V3KA 4URYR 1YWGO 4YMUA 4ROSA 2EWMA 5CDYA 1SZJG 4PLGA 5CGZA 4DNQA 1I6WA 2YZMA 1K4KA 1YQGA 3KKLA 4Z9XA 3HTXA 5L3QA 4N48A 5A7FA 2FQXA 1V8OA 1QPZA 2A3NA 2KBEA 1NGSA 3EA0A 3M4YA 5EE1A 1OVMA 4JLPA 5E4FA 1IPEA 1CQJB 1C30B 3UJDA 1UFRA 3AG5A 4ZZ0A 2X5JO 3AESB 2BCEA 5CVDA 3VOAA 2ZUBA 5CXSA 1D3AA 2YJTD 5EZYA 3S2IA 4QZVA 3FTNA 3SVLA 3FSRA 1ZOSA 3FDZA 1M66A 4ZQIA 2J09A 4QXRA 5LQAA 4TLBA 2OILA 3ZW9A 4W8GA 5A3VA 1RIIA 1D5WA 3FTPA 1K3UB 4R9SA 2VAPA 4FWTA 1QTNA 1Y33E 2J85A 3LPAA 4KQGA 4X5OA 1TNDA 4B4OA 2B8EA 2IZ7A 2PEZA 3P2KA 5FNVA 4BVJA 3UV3A 1GPH1 3AC0A 3E8SA 3MTBA 3TKLA 1XDGA 2REXB 2OOSA 3GJ7A 3N2EA 3RFUA 3I83A 5LU8A 2ASEA 4XQCA 3UCXA 3SY8A 2ZUCA 5AKLA 3SF8B 1XF9A 1RU3A 3VO8A 5GAJA 2Z4RA 4H3SA 1A9PA 1E9EA 3O8BA 4NABA 4RCYA 3CF4G 3TTUA 2H51A 3X3HA 3OM8A 4Y6QA 3SHQA 1UZMA 2H1FA 1D2RA 3V1KA 5KWEA 1JPVA 2PH7A 4I4TB 5JYEA 2GM4A 2PYDA 3IB3A 3PEVA 4RZHA 5EWLB 1XTQA 4DDVA 1EFUA 3ANLA 3WHIA 5ILQA 2VTDA 4ZREA 3AH8A 4M0CA 1W19A 3QOFA 5A9TA 4F3YA 1L5YA 1QOPB 3S8MA 4IO1A 2HZBA 5IC4A 4DT1A 1V41E 5FT9A 4LOIA 2D4HA 2JAQA 4UNNA 3ZY4A 1R15A 2LWIA 2VBIA 3DL4A 2FHPA 3HP7A 3RABA 3ZGXA 5LR6A 3IR5A 5F3WB 3HO6A 3P0HA 3TS1A 4BZPA 3HDQA 3IMEA 4MLPA 4YNBA 1B0UA 3TH5A 3M3DA 2X22A 4TYMA 4PGMA 1M2FA 4TV8A 4URVR 1W48A 5KKAA 3R5KA 4RW0A 1N6LA 4O2BA 4F86A 4BNLA 3ZDEA 4F5EA 3L5KA 3KK0A 2IS1A 3O2JA 1VRCA 1KYWA 3B36A 5ELMA 3L6EA 3KUKA 1IVNA 1UKEA 3L6OO 2C31A 1FZQA 2B69A 3QE4A 5CBPB 5ETJA 1QZTA 3NIBA 2XUKA 4D0GA 3TZKA 1JDPA 4REQB 2DE0X 5D51S 2RJOA 1B8NA 4XJTA 3OEYA 3V1NA 1SXIA 2ZVJA 1D5CA 1JQEA 4B17A 4BNYA 3VSAA 3UA3A 2XA2A 4YWJA 5A4AA 1Y8RB 1J9GA 1JIIA 1R64A 4OYLA 1HLDA 2CJWB 2QUHA 3WWCA 1YI0A 4EB6A 3BK2A 2OCBA 4RTRA 2Q4EA 1V0JA 3X1YA 4QT4A 4K9SA 5A3JA 1UOQA 5K01A 4TV9F 4J91A 4RK7A 4RV9A 1JWLA 2GWHA 3UK0A 3WK4A 4CLDA 4EAAA 2OXEA 3NT5A 3QYPA 5G02A 4KGDA 3RIGA 2W6ZA 4KLAA 4D2IA 1EFAA 1SKMA 3SQMA 1H8HD 1SXJB 2I66A 1BZYA 4RZIA 2WJJA 1CVRA 3W9BA 4DA8A 1AHNA 2OAEA 3HFRA 1YRLA 3GFVA 3Q8LA 1IY2A 3WRVA 3AI1A 1P2TA 3O9ZA 4AURA 1Z28A 4P4SA 1CUZA 3CSSA 5EZSA 3W1VA 3TRKA 3A32A 3QEMA 3WJ2A 4ZN6A 2CE7A 3LYLA 3ITDA 2Y67A 3OPVA 3HNPA 4I46A 1QVRA 4B3DA 1F4VA 3DDWA 5ECYA 2DY0A 2B4RO 3OA0A 3G6KA 3GZNB 1CETA 3LCUA 1U8ZA 4U7GA 4TV9A 4BB9A 4US0R 4IOMA 3GUYA 3HDVA 3QU7A 3L93A 1FP4B 4E4RA 2I62A 5JAPA 4LY9A 1WB9A 3GLUA 1QNLA 3OO0A 2ZE7A 1GPMA 3EZLA 2X2EA 4XH9B 3ETCA 3ZNQA 3E3NA 4C0HA 1GCAA 3L40A 4M22A 4BKRA 4K6OA 5LL6P 4E2FA 5E7IA 3A8TA 3H5TA 3BJIC 1UDXA 1U8FO 1Z06A 2D6FA 4BQNA 3IBSA 4Z5XA 4WA8A 4IMIB 1SIUA 3BHMA 3SDBA 4DMMA 3M1IA 4BTVA 4ND4A 1TC2A 4B7XA 2O0MA 4Q1VA 5L53A 1TT5A 3GCXA 1BQ3A 1EYZA 3L7LA 2IUTA 3M6UA 2XB4A 2JFGA 4M46A 5T41A 4HH4A 4FFVA 3ZWAA 4PCVA 1IPFA 2ZI5A 2ATEA 2EJVA 1QYCA 4L02A 2FSGA 3SJCA 3C41J 2O3SA 1JIKA 4BVHA 3ONDA 1MRNA 5KTYA 4ZWNA 1QBKC 1ZSVA 1KORA 3DBVO 2QX9A 1L8XA 4DEVA 1IN7A 2ACVA 4BFYA 2WD7B 3DLIA 2XNSA 3N5KA 5D6OA 1FTYA 1OZAA 4TVKA 1AQIA 2BLNA 5JSUA 4O4IB 5B7PA 1UFQA 1E5DA 3GVIA 1CY7A 4RHFA 2YKGA 1ZUHA 3MUOA 1G3UA 1BEUB 2WZDA 4ZYZA 1DPFA 4IAOA 4PGAA 4MQUA 1MTZA 3Q40A 3EC7A 3OCZA 4DSAA 5GINE 1YFJA 3JQGA 3OT1A 1VLVA 2SECE 3ADOA 3NXSA 4FWBA 2QXUA 3PLRA 4IDEA 4C6TB 1M2VB 1AXEA 2EFHB 3BKXA 2YX1A 4MRPA 3NALA 4F7DA 1PEYA 1HTTA 1PO7A 1FDVA 2YHIB 5KMGA 1XNHA 4HNGA 4FYXA 4ENVA 4UXJA 4QT0A 4BEJA 2W9XA 3LPMA 3F8TA 3JSAA 3QBDA 3NAGA 4AB1A 4F2GA 1MJ5A 2CMDA 1D9ZA 3HLKA 3ND6A 4GD3Q 2EZTA 4HGNA 4YJDA 2JI4A 3T3EA 2ZWPA 2FWIA 5G0SA 4WKPA 2AOVA 3FWHA 3IEVA 4IP0A 3L8FA 4YP7A 1JQDA 2R66A 2EQ5A 4R8RA 2I54A 5C5EA 1Q2XA 4HK4A 5DJ5A 2EKPA 2R47A 4Q48A 5B6JA 4BX2A 2FV8A 3DVLA 3RTGA 1BW9B 2H8GA 2OGWA 3BTOA 2QRHA 1R9NA 4FFMA 2C42A 4GWLA 4QUHA 4RLFA 1BWPA 4AICA 1JUDA 3MTAA 1V9CA 1BEEA 4PBTA 4S0XA 1PBNA 1XUOA 1ONBA 3OLXA 2C88A 3JR7A 4I4CA 4FDVA 4YRJA 2VJKA 3LYUA 4BNIA 3OJLA 1ZIXA 2J0VA 3I61A 3A70A 1HLPA 3OH8A 4QO7A 5BYJA 4X93A 3UQZA 4CU5A 1LDGA 1RVV1 4E5SA 1OE0A 1KY2A 2OKCA 2P9BA 2VZ8A 5I51A 1HNXB 4FDTA 2NM0A 1G7SA 4OHUA 1H3EA 4OM7A 3DBHB 1VPEA 2R8PA 3HJRA 1A5ZA 4FOSA 2JC3A 1KAMA 1KVUA 3HDHA 4UEQA 4MUGA 3DFMA 3BMOB 5JZMA 3L06A 4FT4A 1RE0A 3ZIAD 3QU9A 2HN9A 2ZTVA 4IDOA 1ULSA 5BW5A 1Z83A 2O2EA 3X1DA 4D8UA 2G1JA 2AI2A 1OOEA 1ZPDA 3CLRD 2PUVA 3GGSA 3TQTA 5K0NA 1O95D 2HWXA 2IXAA 4QTUB 3N8DA 5B4UA 4JCOA 1KEUA 1KAGA 5AM0A 2C5HA 5DHUA 3TX2A 4QBFA 3AFNA 3OCVA 3UHFA 1GAXA 3KL2A 3DWGA 3ZCTA 4Z7OB 4DB2A 3NYRA 3G13A 1EFKA 1XV5A 1NF8A 1AZWA 3BWCA 1V3TA 1XR3A 8ATCA 1KGSA 2QTTA 3BMQA 5EHQA 5K3EA 1C5KA 2NV2B 1KKLA 3S4YA 4F11A 3C3KA 5J47A 1OH8A 1E6MA 1YA8A 2YJ5A 3FCXA 4KQJA 4YUYA 1Q1ZA 1JKJB 1R5JA 4QQRA 3DOOA 3MAJA 4YRBA 4ZZIA 2CMGA 3BAZA 3BCSA 3O03A 4EPTA 1ZVQA 5LD2C 3NZEA 2QD2A 1EK5A 1C4XA 3BJEA 2W70A 4PINA 4A6XA 1ZD5A 1NXOA 4EY6A 5K6RA 1KDPA 2C5SA 3RCBA 2AI3A 3B13B 5KJ6A 4FMDB 1SUAA 1E2JA 2HL6A 2ISCA 4AM8A 4BMYA 3T1TA 1NV9A 2ZT5A 4QGHA 5AVXA 1JG1A 5DCWA 3IEMA 3D7MA 1JR3E 4D9BA 3PS9A 3CNHA 5BSFA 3FBGA 3FZNA 4MA5A 5ALDA 4CQLB 3HV2A 2P8SA 3IEKA 1L7RA 4Q3EA 1J8VA 4NMXB 2JGLA 3UMRA 2CNWD 4RDHA 3KVYA 4BNZA 3THRA 1ELOA 5CA1B 1TAGA 1DIHA 2JKYA 2HRZA 3EXG2 3W8FA 3G79A 1AGNA 1G19A 4HN9A 2XQKA 2BFEB 1I10A 3E58A 2CBGA 4LUCA 4MMZB 5H8WA 1GFIA 3IKTA 2OV1A 2V98A 3AR8A 4IWNA 4P9NA 2QXTA 4M8SA 1YD7A 1M2OB 5ILGA 4Y9RA 4B3RB 5LQRA 5AVYA 3AUUA 3C6XA 3DPIA 3UK6A 1H1LA 4YH1A 4LHEA 1EUDA 1L5SA 2ZWAA 4I9GA 2P3QA 2QMHA 3VPFA 2B36A 3AF4A 3WK9A 1C1DB 5IJWA 4DKJA 4EA6A 2OYCA 4YJ3A 2OG2A 4Z1MA 2G82A 2GJAA 5FX2A 4B35A 4BV2A 1IWBB 1ZH2A 5K0GA 1MAAA 2IW3A 2Q4RA 4RV5A 1NVDA 2NVBA 1QORA 4IMPA 3DYBA 4PLCA 3WL4A 3RVBA 1GZDA 4TTVA 3G1WA 1OU0A 2QOEA 2RCNA 2H5EA 2C5FA 4FYKA 3AY0A 4BNNA 3ORQA 1ZNXA 5D3ZA 1N8SA 3GCGA 1N6KA 4R1NA 4JLWA 4FBLA 1PZHA 1T2EA 2BHSA 3CNQS 1TYAE 2E4WA 4E21A 3V4PB 4EB0A 3NH6A 3DVAA 3TW4A 2DM6A 1U7OA 1V8BA 3GGGA 4Y18A 4TTAA 3CLHA 2C0CA 2QG4A 1KP9A 3E27A 4KVGA 5K8JB 1H65A 3S1AA 4IXMA 1D2MA 2X2PA 4NYJQ 5TPWB 1C9YA 1VHJA 3T7TA 4LBYA 3TBHA 4DABA 2O05A 5I6DA 4HO1X 1N6HA 4FB4A 1E5LA 5JCPA 4RXTA 1ODJA 1UJMA 4BPBA 3UWDA 2GQ0A 1DE0A 3Q3VA 1ZR4A 5SZHB 1WQ4A 2OO5A 4HZIA 1M2GA 3DZJA 2FPUA 1YOBA 3AHCA 5HDQA 4BJ1A 1CS0B 3C24A 4MJLA 4UMFA 3AF6A 5HILA 5EIBD 1QHNA 1O4VA 4GXNA 3L0OA 2WG0A 3CRVA 3TBKA 4PG4A 3F2IA 3SEAA 4G09A 2FN4A 2CLDX 3II6X 4O2RA 2J0QA 3B48A 4Y6GB 1X8XA 1URPA 1QZZA 1UPAA 4QPZA 5H59A 3CZ5A 4ZAVA 3TX6A 2BGTA 2X15A 2DBVO 3DNFA 4MR9B 1AXGA 2RIPA 1LLQA 3BX1A 5SV2A 3ND8A 2J5KA 2X1HA 3OURA 3T95A 2OLKA 3O31A 4UDYX 1NUUA 2GB4A 2GYYA 2OBNA 3H9GA 5GM1A 2VK8A 3PQ2A 4P0TA 1KYZA 4U8GA 1EJ2A 5ICCA 1CS4C 2BD0A 2BGIA 1QRSA 1ILWA 4Q1DA 3SC6A 4PCAA 4YAUA 3W04A 5BV1A 2AEJA 3NVAA 2EJCA 3KOOA 1ONSA 4O25A 1NG9A 1RJ9B 4R2HA 1OWMA 4YRRA 5EI5A 4H60A 4F2DA 1OFGA 5IAJA 4BE9A 1VSVA 2P4HX 1GAEO 1NMYA 1THMA 2NZ2A 2AOXA 5GWXA 4DEYA 4LIPD 3SBOA 5FO1A 2C1XA 3VDMA 4H7PA 4ZT6A 3H17A 4QLBA 4XIJA 1OT5A 3HM2A 3GLIA 2C8VA 2P27A 2C97A 1NG1A 1JL3A 5CPFA 3FKJA 5JW6A 3VSCA 1R66A 1SC9A 1LPSA 4ESVA 5AW4A 5TPZA 4R9VA 4ECEA 1C2YA 1G98A 1PJ2A 2ADMA 3HYLA 4RJKA 3NXKA 3KOWA 2JIPA 2ONCA 3LA8A 2XKBA 3QVXA 5CH8A 1FLAA 2BLLA 2Z8XA 5BQ3A 5L3VA 1Z6TA 3CLUC 4HDRA 1IBLB 4B2PA 4U5XA 5COQA 4R71A 3GLGA 2H3EA 4XCVA 3ZE8A 2J4CA 1WRBA 4U2KA 5BSUA 1A04A 4JR2A 4KLCA 3E8MA 2WPNA 1QIFA 3IBYA 3D3JA 3MRXA 5HKOA 4YCDA 1T3ZA 5IWAB 3BXGA 4BLRA 1G8MA 1O58A 3DO5A 1X38A 3ZXXA 2PTHA 4G97A 3Q12A 2AE1A 2V7QA 5AKKA 3LZDA 1GADO 4XW2A 4CKBA 2G0NA 3OPXA 1IQ0A 1XKXA 4WNYA 1XZEA 3BKWA 5FUBA 1YS1X 1NBMA 1NYTA 1GRQA 1JIVA 2WIAA 3SJZA 2O0HA 1FX0B 1BMDA 3SSAA 1MQ8B 4MKRA 3EEYA 3FIJA 4ZVPA 4QTZA 5H02A 2O07A 1OC4A 4TWRA 4WD3A 5KDDA 1K5HA 2F64A 1Y3DE 4KPUA 5BMVA 3VHQA 3H1FA 1KJWA 5JALA 1ACMA 1AHHA 3DVRX 3EA4A 1SC1A 5FBLB 2XTNA 5J2TA 4KUHA 1PL6A 3V9PA 1OB2A 4DIDA 1Y7TA 2RONA 2QX7A 3B9RA 5LP1A 4YREA 2BPOA 4DUGD 3QIAA 5C4IA 2VDOB 3U7JA 4MIYA 4CEJA 2XVZA 4CKCB 3THWB 5TMEA 3TIIA 3VSDA 2Q5HA 3U7QA 2QUIA 3OMLA 3Q5GA 2O23A 521PA 3ZU4A 3OQPA 1X8LA 1HQCA 4X1KA 4JKYA 2PXXA 3PWZA 2UXDB 2B61A 3W9UA 4TMYA 3U40A 1TO1E 1KIAA 1FMTA 5KEIA 3T99A 5A1TA 4V03A 1R0RE 3O83A 1GZSA 4YDQA 1MT0A 1GGNA 1U2EA 2Q4TA 2MSDB 2B8JA 5AVOA 4E5PA 5HZMA 3BTUA 2CB9A 3P9IA 2NZUG 5TQ0A 2CJFA 1Z7GA 1PS8A 3CNNA 4B4DA 4ZK2A 3PQ8A 1TUGA 4MKZA 2J3DA 1B43A 3A1SA 2EFJA 5BPFA 2VRCA 2RHRA 4G1VA 1OBHA 3TEFA 4F1KA 3GQBB 4CM7A 1DJNA 3V4OA 1AGPA 1RQ7A 1SQ6A 1U2SA 1QH9A 1TF2A 3MCZA 4X6XA 4CM4A 5AESA 2G5TA 2PPLA 2WU1A 4OFBA 4J3NA 4RPGA 1N8NA 4FMCB 2EERA 1NU6A 4J0CA 4PZYA 2PUAA 1JR2A 2BR3A 2C2ZA 3H87A 3GJ5A 3OFSA 2BMAA 2O2YA 3MJEA 4Q05A 3WGNA 1C3VA 3FW1A 4CFYA 4US2R 1NX9A 4OO3A 1A82A 3KBBA 1FDTA 2DY1A 3EGXB 4JSTA 4P4LA 3RHFA 4O33A 2AE2A 3HR4A 4MR7B 4PNEA 3AKEA 3LM8A 2F1OA 3FOFC 4C76A 3A6LA 3UQYS 3WNZA 1NJ6A 3UT0A 2DHRA 2XVYA 1P2GA 3MZ0A 4HS4A 3B1XA 3W1WA 1G1MA 1N1EA 4UOQA 3GEBA 2H00A 2H52A 1CEXA 4FP9A 1ENYA 4LDNA 4JJIA 4A8TA 1GPYA 1TJYA 1BRMA 2PH1A 4XR4A 5CT8A 2QT1A 3WYAA 4HRYA 4BMZA 1TLFA 3DW1X 1CUHA 1N5RA 2H3HA 1I1QB 2EFCB 5FI0B 4QECA 4WEOA 4D96A 1SK9A 3LZCA 3EIUA 4L8WB 5CVUA 4A0RA 4EG6A 3U4QB 3IKJA 4ZEOA 3FHLA 4P2BA 2G1AA 2VNSA 4YT8A 2NXWA 4JLJA 1S2MA 3BL5A 1PL8A 3PGVA 3TLXA 5KQPA 2GCIA 1UM9A 2OCGA 3EOBI 3X1MA 5DCUA 1W49A 3R6WA 5LSAA 4E33A 2ZTUA 3BSYA 5JBNA 4MWEA 4E2ZA 1BD4A 3L9WA 1MX5A 4DL9A 4JNCA 2IXTA 2GBPA 5A7GA 5AJTA 3O26A 3PITA 3HABA 1TA0A 3UENA 4Z4EA 2COEA 3OOHA 2C83A 4JMPA 4PF1A 2LUOA 1AKWA 1DRWA 4IHJA 2JKZA 2W58A 4CNBA 4CIAA 5L3RA 4DW8A 4ZIRB 1M8KA 3AMVA 5JYCA 4OSEA 2Z08A 4ER0A 5EFZA 1CBUA 4Q01A 1QKKA 5FWAA 3BTSA 2WT9A 3TQOA 1P45A 3H5IA 1O6ZA 3K0CA 4LPKA 4E15A 3Q6IA 4EQ6A 1OAOA 4P86A 4Q6BA 1W36B 3A6EA 4UUNA 1U9CA 3EASA 4OJQA 1RQPA 3CPEA 1PN3A 2XUHA 5HIKA 3K0FB 2DJIA 2OZKA 4BN4A 2W2TA 3BFVA 3L7IA 4W7SA 4QTYA 1Q16A 5C7IO 1K9SA 1N8KA 4C3UA 5FL7D 2I6TA 2V0CA 1PL0A 3ZVMA 5MHTA 2ZSDA 3RO7A 4CWAA 1N1DA 4HDCA 1A69A 3BCHA 1CJVC 3ZLJA 1RM0A 3UB4A 4A16A 4BJ5A 3EAFA 1EWKA 3NBUA 2A0UA 1DRVA 4ZCTA 2P9GA 2Y2VA 4ISBA 3F6YA 4MI9A 3D8HA 1YR7A 2DKFA 2HUPA 2IEGA 3T5DA 2GUWA 2XT0A 1QSGA 4LZWA 1P1JA 1OFUA 3QNMA 3AETB 3C3AA 1F8XA 3OUZA 3MLEA 3LCMA 2X1MA 1K88A 1LDMA 2FG5A 2RI1A 2PMEA 3T5GA 4CLOB 4OREX 5K9ZA 2R68A 4INPA 2CSXA 3AB8A 2Z95A 1L4FA 3NNDA 3COWA 2P2CA 4IQ4A 1OJLA 4Q82A 2ZRPA 721PA 4TRMA 2KE5A 3U0BA 3TRHA 4EHKA 3IKLA 1A7JA 5DI9A 1YQEA 4D74A 4F6CA 4RTMA 1GTJ1 2BHTA 3BMNA 5AW2A 3OECA 1XRLA 4HSGA 1ZOOA 2X0EA 2XRZA 4DARA 2CXXA 1XD8A 3V2HA 2VBGA 1E59A 2BEWA 5L4SA 3AUSA 1NY5A 4Y6SA 4ZVVA 4F4UA 1SAYA 2PS9A 3PGXA 3ZPXA 1TZBA 5AW6A 3UAVA 4G0PA 1JIQA 2O1EA 3GA0A 4CLRA 4WLNA 5F51A 3RAFC 3TLKA 4XX0B 1QG2A 1U3UA 1XIVA 3PENA 3B3QA 2ERCA 4KAFA 3HWRA 2HMYB 3L1IA 3T9DA 2IHJA 4MWTA 3VNAA 2JJQA 1E1MA 1QZ3A 4AZ0B 2OLEA 1VRVA 1VBMA 3NKFA 4MEJA 1ZY2A 3RVPA 1JEEA 5EKDA 2QLLA 4ZEXA 5JNLA 2WVAA 1N2BA 5JIBA 1JEOA 4FT2A 4R2MA 5EGNA 3WKCA 2DCMA 4W8OA 2C2WA 1WD5A 1ZOLA 3OF5A 4TKUA 1FFWA 1OX4A 1X80B 2VHXA 3V46A 4ZAWA 2Y0PA 1KQFA 3R0ZA 2E5FA 4YRTA 3STWA 2IZ6A 5IDXA 1P2DA 5H5JA 3Q7SA 5EESA 3SF8A 3ICQB 2IY9A 3BQ9A 2Q49A 4DRXA 1IHPA 1B0ZA 2IK8A 3KFXA 3LY9A 1BDIA 1XLWA 3KZNA 2QN9A 3VQTA 2QG9A 4KKXB 4RVGA 1U2GC 1W1IA 1THTA 1Z82A 3BZUA 3FOBA 2EU8A 1W88A 2C7VA 3QWFA 3F3SA 4I1YA 3EZ2A 4Q4AB 1CV2A 1T2DA 3WK5A 1VYTA 2IDMA 2XCUA 3QEJA 2O20A 3P9XA 4JL8A 3L82B 3X1KA 4LJKA 1HZZC 4G26A 2HSJA 4NBKA 5DCLA 1JKIA 2C2OA 3PHLA 2WV9A 3PI7A 4MYHA 4OQZA 4B32A 4B9EA 2P9EA 3IP6A 1GA6A 3C6BA 1ECJA 2O57A 4YA6A 4MWGA 3V2GA 4NBLA 8AT1A 1HE5A 1UBSB 2P65A 2PQMA 4M1OA 4RD3A 3A3NA 1P74A 2P4QA 2PKWA 2QE7A 3SJ7A 1V6CA 3H5LA 4TV8B 5EIOA 5LZ7A 3WMXA 4HF7A 2NSHA 4B82A 1JXOA 3USCS 1G6KA 2BKUA 3LNTA 2ZBVA 5EJ2A 4CKEB 5HKBA 5COBA 1EX7A 2GHQA 4YCAA 3I6MA 4M1WA 4LJ6A 4COOA 1DARA 1BGXT 3QG1A 1YA4A 2PT9A 4OQFA 4RE5A 1UBRS 2V74B 2BHNA 1E9SA 3E8XA 1E60A 4S05A 2DRIA 1ZJ6A 3VJLA 4BB5A 1E3LA 4NNPA 3R6GA 4OB7A 2IWRA 1VE7A 3M5DA 1SVLA 2DFLA 3GGDA 4M1ZA 3QFCA 3ZIAA 1QV7A 4G4IA 2GXQA 3H4TA 4RSHA 5LXTF 4CCYB 2F4NA 5BSKA 3K53A 3I37X 3PHBE 1SEPA 4JR1A 4X0EA 1IHYA 3B3JA 3AKYA 4C78A 2FWAA 5E6SB 3ZU6A 1SVKA 1NAIA 4G1MB 2O5CA 2HLNA 1DUSA 1RXSA 2FMKA 1U2TA 3KPVA 5TRTA 4D79A 5CT4A 3HDTA 5AO9A 4HWKA 1WMFA 4F4IA 1BX0A 4ZC1A 3GNSA 2VHCA 5GJWC 3GG9A 4PFSA 3OUTA 1E2IA 4PN3A 1Z62A 1GRNA 3GC6A 4K3VA 4ZVKA 3P26A 2YVQA 2HOQA 2MOKA 3MCVA 4G5FA 1AKRA 2KPOA 4EX7A 4LGCA 2AJCA 2JHPA 3RRYA 2DXIA 4X90A 1VJGA 4R2KA 1WJGA 2C5GA 1N9GA 1C2TA 5L4NA 3IA7A 2ZUFA 4BXOB 1DJQA 1TJ3A 1M5UA 1OGYA 1CJMA 1EUCA 1QX4A 2Q0XA 3CVJA 3O2SB 3AXSA 1DS6A 4NPHA 3OX2A 4TL6A 4WVLA 3DULA 1R0SA 3BGIA 4JC0A 1UKAA 4NVRA 2WFAA 4AL4A 5FNZA 4L07A 1OIWA 1NJFA 5E9WA 4MIKA 3KLBA 1WMBA 2X8JA 3RLIA 2SCUA 4FX5A 4K87A 1JG7A 3VC2A 1KAOA 1Q3TA 2EF1A 3B2NA 1TCBA 2P91A 1G4HA 5M3BA 4EARA 1R8QA 2ZDQA 3P0FA 4RL4A 3OZUA 2QRVB 1PT9A 3C4QA 3FVWA 1PNVA 1XYVA 1YB6A 4HDNA 4AX4A 3A36A 5ITVA 2A35A 1M0TA 2WYHA 3IEPA 2BIFA 2WSBA 4MQFB 5JE8A 4D8WA 2DHCA 2EW8A 2HK6A 1E7QA 5KYWB 1B4DA 1T2NA 5CM8B 3QYFA 1ZRMA 1KOFA 4ADSG 4Q3CA 1MG5A 4UDXX 3D3NA 2ICAA 1JNYA 1I36A 3ZOKA 1JFRA 3HGQA 3OZIA 2N0SA 2W43A 3QTLA 3F4BA 1M2EA 2BGJA 2NXEA 4BNUA 3WHPA 2YHAA 5AM3A 5GJBA 3A9UA 5HBGA 1P7PA 5IEBA 2VT7A 3KHTA 4HJXA 2GYVA 4JZYA 1RADA 1DC6A 4OHBA 1VZ3A 4R3WA 1CDZA 3M5CA 2OO5C 3PKZA 2GBIA 1AK9A 2AN1A 4RFSB 4JU9A 3W5IA 1XEXB 4ZDJA 5AJUA 1QU3A 1UFVA 4AJNA 4QBIA 1C0IA 4Q9JA 1H9AA 1ZGAA 1W0KA 4IPTA 1XHEA 1UQTA 3N8KA 4J3JA 4BMDA 1NW8A 1YASA 1ZD3A 2V6JA 1EWYA 2NPFA 2BEWB 1X74A 1WB6A 1QX3A 2RHCA 4UM7A 3TM5A 5KOIA 3GP8A 2YS6A 2ATVA 3DUFB 2C9OA 4UEWA 4AYWA 4B3HA 4DBZA 1NMEA 1OBVA 3VPHA 3CMCO 4U5QA 1OVGA 2GXUA 1ORTA 1OY1A 2YYAA 3LPNA 2GS9A 4ZAXA 3S0JA 2HIGA 3W3AA 2HO5A 3H16A 3L7MA 1VBFA 3CT4A 4Q21A 4AJLA 4C6TA 2LW7A 2B1QA 1TKAA 4XB6B 3EIOA 1PEKE 4ZJZA 3OZXA 1KJ9A 1I3NA 1GAQA 2WAXA 5DHQA 2PUGA 4E09A 3BRWA 2CL6X 2Z5FA 4UBMA 1ISHA 3ORSA 4EHBA 1RYFA 2FPKA 3Q8WA 4PC2A 4TL7A 3TF5A 2R5NA 3I9MA 3CT6A 3U49A 4YIHA 3ROKA 4V39A 3I64A 4Z9AA 1LLCA 1JZQA 1VPLA 2QP9X 3D0RA 3ESDA 1F2VA 1CNMA 2L82A 5JNUA 5JTTA 4U0KA 5B36A 1BE0A 4N4AA 1JEAA 3V8BA 2BHRA 2FZCA 2NU7A 3G23A 4FLEA 2FK8A 2W2OA 4WDRA 2VJBA 3IBGA 3ZX4A 1Z4MA 3FCSB 3GD5A 2E85A 3A6FA 4RY2A 2CJXA 2EKDA 2YMMA 1LJLA 2VAVA 1O8BA 3KOMA 4M87A 1IXKA 2AYYA 1C1XA 2NQTA 4HFJA 3QMVA 1RHMA 4G1FA 2YN0A 3BIFA 1TFRA 4WZBA 4D57A 3IT1A 1NT4A 1YRQA 2PGIA 5A3SA 6GPBA 3UJ6A 2DQZA 5DNEA 1WKCA 4BJ3A 2B4KA 2R11A 4LF9B 3IPXA 3VPSA 1N33B 1SM4A 2I2DA 4BEWA 3HJHA 3UG7A 1IXYA 1I24A 1R8XA 2OBFA 1YF3A 4XQGA 2G9VA 4UTXA 1VDZA 2NUBA 2PTGA 4MW2A 4YV1A 5JCXA 1COWA 2IYZA 2RKWA 3L46A 1BRTA 1RKBA 1DAIA 4M60A 4R05A 4AMGA 5A04A 3ER9A 1RAEA 4UTOA 1V16A 3CF0A 4MV1A 1T2AA 3CBGA 1FXWA 2C3MA 1XO1A 3INTA 4FNOA 4BDTA 3SEZA 4KMSA 4XSVA 5CEFA 5I7VA 2C61A 1WVMA 4XQEA 3EVTA 2PANA 3SQLA 1MXFA 4GR4A 3E18A 3LRPA 1E6EA 4DTCA 1N0VC 2OUIA 5E4YA 1KHHA 5HUHA 1XP8A 4I50B 4BQPA 1P0FA 1U1EA 2DTXA 2VPWA 3GDWA 4AY2A 4ZU6X 4U7HA 4HN4B 1CHNA 2VTVA 4TS1A 2CLEB 4E2WA 5EEHA 4E1VA 1BDMA 2IXFA 3IDQA 1F2UB 4P31A 1TK3A 4G37A 2XOKD 1H9BA 2Y6UA 3EXFB 4KV9A 4O4LB 3KVOA 1A7KA 5C7OO 1FY2A 4ZI3A 5BVGA 4F7WA 3VZBA 1WM1A 2XR1A 4DIBA 5TIIA 1JLRA 4CMBA 1E6KA 2HYDA 4MPTA 5E9AA 4S1NA 2Y6VA 1JU9A 3F74A 2OP0A 1H05A 2RG7A 2OBBA 1LLDA 4LEIA 3VR1A 4C06A 2Q6TA 3EAGA 4KCGA 4HR7A 1J06A 4EY4A 3EXG1 2J67A 3E81A 2VQ3A 1W59A 1PWXA 2PZJA 1BMQA 1ADYA 2IKQA 1BH6A 3OC0A 3NTLA 4ZVQA 1NI3A 4J1QA 4LC9A 4WCFB 1FFEA 1OGJA 2H2DA 3HKBA 4NBRA 5JZ9A 2JRCA 1H9CA 1SIBE 1M2NA 1N25A 3OU6A 2BBTA 2AZTA 1VPWA 3OJCA 1DO8A 2P75A 5EYPA 5DOVA 4OXXA 1HYEA 3G2PA 1YBMA 5HCIA 2VUUA 4JS0A 4RSRA 4DLLA 4AS1A 1TUEA 1V1JA 3PKIA 4Z7JA 2ECQA 3PEUA 1OI3A 2QV7A 3IKMB 3L4BA 5T7BA 4OXYA 1QPBA 1SIWA 1UANA 3BK1A 3FYTA 3M5PA 3OMWA 4R83A 1SUWA 1EE1A 5BXYA 1MJNA 1RAHA 4P98A 1NATA 4J1SA 2B0CA 5AJWA 3KR1A 4OAQA 4DY6A 2WWFA 4KLNA 3TMAA 2RH5A 3RKUA 4JB3A 4ZHQB 5K4AA 2AJTA 4QASA 3TLGB 4M9QA 3TEJA 4LZOA 1NHGA 2EP8A 1X2BA 3JZAA 3VUEA 4CXMA 4QJIA 4P3PA 1YS7A 4RA9B 5FWYB 4DFDA 2HYIC 3DLBA 4J7CA 5AM5A 2IV2X 4CCAA 3D5EA 1R74A 2H4XA 2DWUA 2Q5IA 1I2MA 3W78A 2G1PA 1G21E 2WWWA 1DCKA 1FW8A 2B4TO 1KI9A 2O52A 4O08A 4PSKA 2VI5A 1V6AA 1S4MA 4KR9A 2R8EA 1GNTA 2W2VA 1ADGA 2AMFA 2WIGA 4B6FA 5TEWA 2FZ4A 1WPRA 3C3BA 3C1OA 1R4ZA 3QVTA 1SFRA 3CUTA 4NZNA 2XA1A 5FWXB 1VGQA 2WZQA 3M6LA 1OFIA 3LC7O 1J4AA 2BUAA 4H6VA 4WQMA 121PA 4Z4QA 3WGZA 3GLFB 5JLJA 2AL7A 5C81A 3N0WA 2ZUDA 5T4HA 4YR7A 4KRYA 3DBRA 4RESA