3U55A

Crystal structure (type-2) of saicar synthetase from pyrococcus horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
227
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Structure of SAICAR synthetase from Pyrococcus horikoshii OT3: insights into thermal stability
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 227
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3u55A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3u55A02
2ZMCA 2IP4A 3ORKA 3BHYA 4V0GA 3Q2MA 1OUYA 3QX4A 4O7RA 5DT4A 4AFJA 4J8NA 3SE7A 1PXOA 2VTAA 4DTKA 3ORQA 3AW8A 2J0IA 3JR1A 1GIHA 3U51A 2ITPA 3FI8A 3MTFA 4RIXA 5G6VA 3UC4A 4DINA 2I1MA 4HGLA 4HNIA 1KJ9A 4ZTNA 2GNHA 3PLSA 5ANKA 2HW6A 4NL0A 2R87A 4QP6A 2RF9A 5AUXA 5JGDA 3KGAA 3NCGA 4XG2A 4Y85A 4O27B 4F99A 3BX5A 4MNFA 1OPLA 2O65A 2G01A 1OIYA 1U4DA 2XBAA 3HV3A 1ZYDA 3FMMA 4GSBA 1B6CB 3EQRA 3KCKA 5CB4F 5TT7A 1I7NA 4L67A 4LOPA 4BCJA 4EORA 4B7TA 4CFWA 2CDZA 1Q99A 2B54A 2PVNA 3DBEA 4FE2A 4H1JA 4XX9A 4ZZMA 3UZTA 3U4UA 3UOLA 4JAJA 4DYMA 2H6DA 2X9EA 3QGYA 2VX1A 2QOQA 4BTJA 4EHEA 1GSHA 3BE9A 2C00A 5CX9A 2V59A 4C5CA 3E7OA 2IVVA 4HYIA 3VPCA 4BDFA 3SX9A 4ID7A 4AG8A 2H9VA 2RL5A 2XB7A 5K3YA 1EHIA 3GVUA 5DRBA 3RV4A 3T9TA 4Z7GA 5BMVF 2ITUA 1B6RA 3IO7A 4ANSA 1SZMA 2FP4B 4IHPA 3CKXA 1ZMWA 2X7GA 3WYYA 5AAGA 3HBLA 2YHVA 4IJPA 4UEUA 3S4QA 5EK7A 3QUEA 1H08A 3CS9A 4EYMA 1ZRZA 4G5PA 4EZ7A 5FTGA 2VTHA 4YUQA 2C0OA 3FLSA 5FQDC 4ACCA 2ZB0A 1PKDA 2I6LA 4ZSAA 5IQHA 4D0XA 1OUKA 3HYHA 3LFQA 4CQEA 4JIKA 3FSKA 4S33A 4ALWA 2YACA 2OJJA 4RZWA 4N57A 4B8LA 4GK2A 1KUTA 3RINA 4HR7A 2B9JA 3V8WA 2JEDA 3JUHA 3KEXA 4G6OA 3WBLA 4BC6A 2Z60A 3C13A 3AXWA 5GIPE 2GHLA 2HYYA 2OG8A 2W5BA 3C50A 2W1HA 3EQFA 3QGWA 3ATTA 1XH6A 4OBOA 4RWLA 5AIKA 3VUKA 4ZY4A 1XBAA 5JFXA 2B53A 1RE8A 1UWHA 4UYNA 4AQCA 5B2LA 1KE8A 4AOTA 3IQ7A 4CKRA 5I0BA 3K3IA 4EOQA 4DF3A 1YDSE 1DAYA 1YHWA 3BKBA 3W33A 3HUBA 4EZ3A 1KOAA 5TF9A 2WZJA 1O6KA 5M06A 3F5GA 2W1GA 2EWAA 3JY9A 2X8IA 4XYFA 4I94A 4EG0A 3O0GA 3UE4A 2W1DA 5J1WA 3E8CA 2O0UA 3TDWA 4WNKA 2ZDTA 4PDYA 1KJJA 3CXWA 3DJ5A 5CXHA 4EYJA 1J91A 3L9NA 4H3BA 4I6FA 5J2TF 4X6RA 2EVAA 3C0HA 4FEWA 4OLIA 3HNGA 2Q83A 4EOLA 5IPJA 3NUNA 3ZLXA 4C4IA 3DBCA 2R0UA 4DG3E 3VF9A 2H96A 2OF2A 4QYFA 5DT0A 3VUHA 4D55A 3KULB 2YIXA 3SXFA 4FV3A 4GFOA 1OBGA 3PA4A 4EOJA 2V58A 4I5PA 2YWPA 2PWLA 3R7UA 4U43A 4AGCA 4YBZB 4EH4A 5HKMA 4Z3VA 4O0YA 2Y8OA 3Q60A 4XX0B 2WTVA 1SVGA 2XIXA 3PXQA 2GU8A 2YM6A 3BLRA 3FZTA 3Q4CA 4FSZA 2R5TA 1QPCA 3QRTA 4CRLA 4RX8A 5DA3A 2IW6A 2P55A 3HVCA 2ZV8A 3IG7A 5AIRA 3WZUA 3MWEA 1KE7A 2I0VA 3UDBA 4FC0A 2ITZA 5C9CA 3PG3A 4LL5A 5AV4A 1NVRA 1P5EA 2E9UA 5AV0A 3S2PA 5AX9A 5AP0A 3FWQA 3CPCA 4CRSA 4C4GA 3KMMA 3SKCA 2VR1A 4HJOA 3QZGA 4GV1A 3F61A 4GW8A 4TWCA 5BVNA 1QPDA 3K3PA 3WI6A 4MWHA 4Y72A 3GUBA 1XQZA 2JDTA 3BU3A 3KF7A 4M7IA 2UW0A 4TUYF 1W96A 1PF8A 2ZM3A 2CLQA 4EK5A 5BVEA 4AAAA 4MQ1A 4YGAA 3I12A 1FBNA 3MIAA 3UIUA 1SM2A 4LGHA 4CTCA 2IW9A 3CCNA 3WOWA 3LFCA 4NM7A 3KK8A 3R2YA 1LPUA 2WO6A 4LI5A 4PF4A 4W4VA 5E1EA 2PU8A 4QMXA 5AP2A 1I09A 4OT6A 5FBNC 2C5YA 3SRVB 4EC8A 5AWMA 5HX6A 3WZDA 3H0ZA 3SAYA 3HV6A 4TYIA 5HCXA 4YB8B 4EEVA 3NLBA 3P7CA 2QQ7A 4RFMA 2XIRA 3I7BA 4AT4A 5GIOE 3E88A 3E63A 3OCSA 1S9JA 2IPXA 3P79A 3JZIA 4FTIA 2P3GX 3GEQA 3P7BA 3ZFYA 3GP0A 4RIYB 4WG4A 1WBOA 2Y0AA 3KRWA 2CN8A 4S32A 5CU6A 5E8XA 4FIIA 3OVVA 3MA3A 3ETAA 4U80A 4JNWA 3MPMA 2YM7A 3OMVA 3FMHA 3KN6A 1UKHA 4I22A 3GU5A 2R3HA 4FT0A 4GJ3A 4L53A 4MK0A 2VTRA 4MTAA 4DEDA 3KXXA 2R3KA 2O63A 3C4WA 2WXVA 3LFFA 5AMNA 1H28A 3E3BX 2F7EE 3NUSA 2ZMDA 5AAEA 3E5NA 3H30A 2JFLA 2QONA 4C3RA 2FSOX 3BGPA 2QO7A 2F9GA 5GINE 4H3QA 1H4LA 3FZ1A 3R30A 4U8ZA 2XS0A 2LGCA 2XBJA 2O3PA 3T8OA 2QO2A 5DOSA 3N8DA 1Y6AA 1IG1A 1P2AA 3F3TA 2R3QA 4EHGA 2BVAA 2QK4A 5C01A 5FTOA 1YXSA 2OZAB 2VTLA 2WQBA 3ZUUA 2QG5A 1ZOHA 3ULZA 4RJ4A 4M69B 2GFCA 3BHHA 4MA5A 4DITA 2R86A 2QOOA 3ITZA 4S34A 4IDTA 1ZARA 3ZXZA 3DFAA 3ROYA 3JRXA 4GT5A 4EJNA 3REPA 2ERKA 5IZFA 2W1ZA 4IX5A 2V7OA 3R8PA 4YJOA 2ITYA 3ZDIA 3QTRA 3C9WA 5J95A 2VO7A 2R4BA 3KA0A 4YJ2F 5CI6A 4EK3A 2XYNA 3EL8A 3FYKX 3GI3A 3VBWA 4J97A 3U87A 5BQ0A 3L8SA 4YZNA 5FD2A 4BBEA 1PXLA 4TT7A 2UZBA 4ZLYA 4ZZNA 3OW3A 1W93A 3CTHA 2IG7A 5D10A 1H26A 4FV5A 3QTIA 1DAWA 5IU2A 3FHIA 3VJNA 1ZYSA 3V5QA 3SW7A 2GNGA 4FSQA 4IZ7A 3EMGA 2XKDA 3QC9A 1B39A 2CKQA 1NVQA 3VBXA 4EK8A 2ITNA 5I9YA 5DRDA 3MVJA 2X2LA 4IFCA 5AM6A 2ZV2A 3EQIA 3IDBA 5AV3A 1KOBA 5FDPA 1OBDA 1KWPA 4ZTQA 2G2FA 1SNUA 3N51A 1VYZA 3OEFX 4P5QA 3VS0A 4D9UA 3NVMB 2P2IA 2ETMA 4IAYA 3H9OA 3PE2A 4FKTA 4O84A 3NUPA 4TRLA 4ASEA 2ITOA 1STCE 3O23A 4YURA 2OJIA 2GDOA 3EN7A 3CP9A 4XP2A 1R0PA 4I4TF 2LAVA 4IZYA 3NW5A 3NYVA 3VBTA 2VWWA 1O6LA 4RX5A 2WMUA 5CY3A 5HORA 3U9NA 3VAPA 5JQ5A 2I7QA 2QOLA 2XJ0A 4FL1A 5EW3A 4JG8A 4XRLA 5EOBA 3GCPA 4PL4A 4DC2A 3JRWA 5CVFA 3ZDUA 4IVBA 1OVEA 2ZDHA 4XEYA 3QU0A 3PP0A 3SDJA 3DK7A 4TNDA 4BDEA 3S3IA 2W1EA 2VO0A 1Q4LA 3FLYA 4RMZA 4CV9A 2NU9B 1MQBA 1WBSA 1NVSA 2PE0A 3FMDA 4KAOA 1Z9XA 4FNXA 4DEIA 4RVTA 1KSWA 4BCKA 4M3QA 1JBPE 3H9RA 3KXNA 1M7NA 4X2KA 4QMNA 3RTPA 4P5ZA 3ZO2A 2YABA 3ORIA 3K5UA 4FV8A 3TM0A 4XRJA 4BY9E 4YHJA 4EH3A 4DFUA 4NM5A 1OKVA 4BBMA 2B7AA 4ZMEA 5JSMA 2I87A 4AZFA 4CFMA 5HD4A 1PHKA 3GFWA 4DBXA 2WB8A 3EOCA 4QMQA 4BN1A 4DH8A 2QR7A 2UZVA 2YIYA 3AC3A 5GNKA 2ZM1A 4PMMA 3TV6A 5FEQA 5KMIA 2BIYA 4BZDA 2VV9A 5EM5A 2I80A 2BROA 1YI3A 2DUVA 3K54A 4JDHA 3TXOA 3H3CA 4J95A 3RMFA 1KEEA 4KSPA 4XP0A 2W06A 4YPDA 5EQEA 4AGDA 3QWKA 4JIAA 2P2HA 2V22A 4IC7A 4ZJIA 3HRCA 2C69A 4YLJA 3TWJA 1PRYA 2J0LA 4C4EA 4OBPA 4KINA 4YPSA 3PG1A 3SV0A 4MV8A 2C0TA 3FUPA 3Q52A 3F82A 2ZVAA 3AMAA 4NFNA 2UZNA 4RBLA 5ETAA 4YSJA 1MRUA 3ORMA 3OWPA 4AW2A 2W4KA 4FSUA 4GRBA 4YTIA 3VHKA 3RPOA 4B6LA 5I9VA 1R1WA 2R7IA 1EUDB 2V7AA 2VX0A 5GONF 3Q1KA 3EN4A 3EFKA 4K0YA 2ZV9A 3R8VA 3VN9A 3A7HA 3CQEA 5BUIA 3TUCA 4OT5A 5HQ0A 2GMXA 5ACBC 3QXOA 4QPAA 5IEXA 3MN3A 3GBZA 4FOCA 1KE6A 3TUDA 4FMQA 1ZOEA 2UVYA 2GTMA 4O38A 3KRRA 4L3JA 4RIXB 3VWAA 2C68A 2E9NA 2V62A 1KV2A 1WBTA 4M15A 4MQ2A 1YXTA 3EZVA 3LQ5A 4C4JA 3R9DA 2RGPA 3O2MA 4JT3A 4RLLA 4I0SA 4TN6A 3SD0A 4YAKB 1DM2A 3DBDA 4K6ZA 3V01A 1UNLA 3BEAA 5CAEB 3LMIA 2HK5A 3GNIB 5DR6A 4LL0A 4NKAA 4F0IA 2QCSA 3C4ZA 3POZA 4AZWA 3ZRLA 5JKGA 4MBLA 4QQ5A 3SC1A 3WE8A 3EL7A 4ZLZA 3WF9A 4F7SA 3OUUA 4L6QA 2CN5A 2VWBA 4YC6A 2PUPA 2ZDUA 4ZS4A 2JDOA 3I5NA 4CG8A 5C27A 4G31A 3FL4A 4PV0A 3OT3A 4A9RA 4FT5A 4J8MA 3E62A 3FQHA 4C4HA 2GLTA 2BILB 2C5XA 1K2PA 4EQUA 4KRCA 4U40A 4FR4A 1DS5A 3D7TB 3JVRA 1XJDA 5IQEA 2XJ1A 3LW0A 3QA0A 4OUCA 5AP1A 4U42A 2C6IA 3LKMA 3IW4A 5EYMA 4CNHA 2XK7A 4ZY5A 1E4EA 5DGZA 3VW8A 3WARA 1Z57A 3FEGA 4TKSA 4E4LA 3ID6C 3MESA 3F2NA 3PP1A 4Y46A 2GQGA 3QALE 4O7SA 4IQ6A 5IQBA 2J5EA 1OMWA 5BPHA 3DGKA 5E7RA 3ZTXA 2IW8A 1W98A 1GIIA 2GNJA 3TTJA 2WAJA 2ITTA 4F0FA 5IQGA 4AT5A 3QXPA 2ITXA 3QFVA 5LMBA 1ZY5A 3FLNC 3HL7A 4GMYA 4I6HA 4I6BA 3IKAA 4AW1A 3QLFA 1Y8YA 1GJOA 3MW1A 3UZRA 4ZQIA 4ZLOA 5I5ZA 1VBHA 5DN3A 3R7OA 3VQUA 4ITJA 3OC1A 2XK9A 4H36A 3TV4A 3OHTA 4FSRA 4FKUA 3DNEA 3R21A 2VTOA 4E26A 1AQ1A 2GS2A 4YR8A 2HXQA 4J52A 3UZPA 2A0CX 3ZYAA 1ZMUA 2ERZE 3MVLA 4FK3A 3F9NA 2E9VA 4MYGA 3QZHA 3UTOA 3W2QA 4F1MA 3KRLA 3HAVA 3Q04A 1U46A 5D7VA 2GCDA 5EI2A 3W55A 4BCPA 4KABA 3KCFA 4X2NA 4RX7A 2YJRA 2J6MA 1VEBA 4ZP5A 2PVHA 3TCPA 2HENA 3W2SA 3W8LA 2R2PA 3U4WA 5LVPA 3DDQA 3A7GA 4ZOLF 5I9ZA 4NFMA 3CEKA 3LCSA 2CCIA 3MPAA 4K18A 4CVAA 2GS6A 3PY3A 4X2JA 1CQIB 5AAFA 4XG4A 3WF5A 1RQQA 3OW4A 1PJKA 2NRYA 3LAUA 4CZUA 3DAJA 2FPIB 2YZMA 3L9LA 4J98A 3SA0A 2R3RA 2XF0A 4Q5HA 4D28A 4X3FB 4AGUA 2J0JA 2YM8A 4YJNA 3FMJA 4LUEA 4FZFB 3AD4A 4U41A 3RPYA 2VTJA 3RHXA 1IOVA 1JNKA 4EOKA 3V51A 2E2BA 5L8KA 3PE1A 4CFUA 2XEZA 2C3JA 3LMHA 4CFFA 3JZFA 1JLLB 4XYMB 1OPKA 3OBGA 4EH6A 3E8EA 3LHJA 2WMSA 2PBZA 3CIKA 4O4JF 1P4OA 3ZBFA 5L8JA 4YU2A 4YLKA 3QYZA 3DNDA 3PIXA 2QHNA 3NVKI 5I9WA 4Y83A 2WHBA 1PY5A 3ALOA 2VWXA 4HVGA 2NO3A 5HCZA 4AW5A 5CEKA 4FZ6A 4MXAA 1YOMA 2R3JA 2UZEA 4RPVA 4I4FA 2HZNA 3VS2A 4J7BA 2JGZA 3DXPA 4BB4A 3OOGA 5AUYA 3CGFA 3G15A 4D2SA 2C6KA 1PYEA 4FTTA 4IAKA 4EOPA 4IH8A 5CAVA 3UO4A 3ZLWA 4FKOA 2XIZA 3QX2A 2FVDA 3P1AA 4BCGA 3CD8A 4DAWA 3CBLA 4BYIA 3V4SA 2BDWA 3ACKA 2IO6A 5CS6A 5CU2A 4ASZA 1EUCB 1Q5KA 2XVDA 3HZTA 3W2PA 3CR0A 5CEOA 5HBEA 1WBPA 4L44A 3HKOA 4CV8A 1REJA 3KL8A 4R7HA 5JT2A 5LCKA 3PUPA 4R5YA 2YCSA 3RK9A 4F65A 3FI3A 4JBVA 3A61A 4C33A 3I0OA 4JBQA 4GH2A 5IISA 2XKCA 2ITQA 3AMYA 4S31A 2CGVA 4H05A 2W6OA 3I7CA 1H00A 1A48A 2VTMA 2P4IA 1JSVA 2OIBA 3FC1X 4BYJA 5E1SA 2WMTA 3N4VA 4JRNA 3BELA 3E87A 3RV3A 4HNTA 4EBVA 2W05A 4HYHA 1VR2A 4AZVA 3UO6A 1YHSA 3U55A 3QC4A 4O4HF 4BKJA 4FSTA 4LV5A 4RIWB 4E6AA 4C5AA 4JBPA 1TQMA 1W8CA 2QOHA 2HCKA 2GS7A 2QVSE 4K2RA 3IGOA 3R7YA 2NNWB 1JKTA 3R04A 3MPTA 1OECA 3QCXA 1KE5A 3ZM9A 3TNPC 3QFFA 5C1PA 3FZRA 3II5A 3DDPA 2EXMA 3Q9XA 4E4MA 1M0TA 2QG7A 4E6CA 2Y4PA 2WU6A 3CY3A 3P4KA 3QTWA 3ZRMA 4EOOA 1YWVA 3Q5IA 3VQHA 3HB9A 2ONLA 1YW2A 1LEWA 3I5ZA 4WIHA 2R7KA 3LIJA 3OROA 4M97A 2PMOX 3BHVA 2CCHA 3ZSHA 4KIOA 1U5QA 4KSQA 2OJGA 3VULA 4FFNA 3CJGA 4BGHA 5CZIA 1LEZA 2GSFA 5AA9A 3MVHA 5JQGF 2F4JA 2IZRA 4DFXE 3PVBA 3HP5A 3F3UA 5GJGA 5KMNA 1GZNA 2YIWA 4F64A 4FTOA 4MXCA 5F1ZA 4EK6A 4E1ZA 5IEVA 4DEBA 4U97A 4FV0A 4DH7A 5DH3A 1ND4A 2B55A 3TZ7A 5IUGA 2WTDA 5IQAA 3R7IA 4IANA 4PDSA 1XWSA 4IB5A 2YITA 4ENXA 2PPQA 4DFYA 3Q4TA 3GGFA 1YHVA 2YDKA 5EI6A 4TYEA 3THBA 1GZKA 3K3JA 4GT3A 3NGAA 2BAQA 2GNFA 4FKRA 3FKNA 3ZO1A 4BICA 4GYIA 3ZSIA 1DV2A 3KMUA 3VW6A 3JVSA 5IH6A 5FUTA 1H24A 3M2WA 5D9HA 4O0SA 5E8SA 1YOLA 5HO8A 4LM5A 3F66A 2X6EA 3VJOA 5EKOA 3GLKA 1TKIA 2C3IB 3ODYX 4FV1A 3FMLA 1G8AA 3Q9YA 4NYEA 4MEDA 2JDSA 1OIQA 5E8UA 2OXXA 3R7EA 1XH7A 3I81A 2ACXA 5M51A 2JDVA 5LP6F 1BLXA 3QAME 1R0EA 3U54A 3WILA 4CXAA 2WFYA 4QP8A 4OTHA 3QKMA 4F08A 3PZHA 2OBJA 4ZHQF 2PVYA 1PMUA 2C0IA 4PP7A 2YS7A 4ALUA 4O7ZA 4R77A 4L00A 4ZJJA 5T3QA 4RRVA 3WIGA 5FP6A 4FSNA 5AP7A 2WTJA 4XG3A 3S1HA 5M08A 2RIOA 4GIHA 4JQ7A 2CPKE 5CWZA 5AP3A 4IAIA 4CSVA 1C30A 2R7MA 4YJTA 1QCFA 4G5JA 4O91A 5BYLA 4RJ8A 2VUWA 2BTSA 2C5VA 3R1YA 2YAKA 3BLQA 4FKGA 5DBXA 3R83A 3O50A 3HRFA 5CNNA 2HZ4A 3IDPA 3RP9A 3ZSGA 1QL6A 4TTHB 5DFPA 2W6ZA 3HDMA 2GQSA 2PZPA 2X4ZA 5IA4A 4G1WA 2BKKA 1H1RA 4PY1A 3KC3A 3KRXA 5EH0A 3QQKA 4DEHA 4QQCA 3QCYA 4GCJA 3AQVA 1I44A 4C61A 4UYAA 4FL2A 5J87A 1JSTA 1K3AA 5AV2A 1KJ8A 3BQCA 3T3UA 2CGXA 1HCLA 4J71A 4D1SA 2UZDA 4KB8A 5BPYA 5BPFA 3EHAA 3V5LA 3Q3BA 3PXYA 3R73A 5IUHA 3HMMA 1XO2B 1J3HA 4YTFA 2WMWA 3HMOA 4HCUA 2W6PA 3QCSA 1CMKE 2XUUA 3HUCA 3EN5A 3O96A 4UB7A 3D7ZA 5DYJA 5ANEA 5IA0A 2ZDQA 3C4FA 5CU0A 3P23A 2W6NA 2GNLA 4F7LA 4E5AX 3W16A 3C5IA 4QNAA 2B1PA 3UMXA 3BWJA 3R63A 4JR7A 4FICA 4QMUA 3KXHA 3NYNA 4GK4A 4TZRA 1CKJA 3OS3A 4TL0A 3AC2A 3PJ1A 5ITAA 1UU8A 3G2FA 3IONA 2DZDA 5CZHA 1Q3WA 4ACHA 1OL5A 2OU7A 4FIHA 2Z7RA 3TIZA 2CNUA 3UGCA 3UO5A 2XYUA 2WELA 2WIHA 3UNJA 3H0YA 2R3LA 2Q0NA 3RALA 3NUYA 3TTIA 1H25A 2CLXA 1M6VA 2WIPA 3F88A 2GQRA 1IRKA 4X3JA 2HW7A 4BCOA 4PNKA 2DYLA 4UN0C 3UC3A 4I5HA 3FMNA 4KS7A 3DCVA 4U81A 5M56A 4I23A 2ZOQA 2ZV7A 3A2CA 3L8PA 4JDKA 3ZXTA 3BWFA 3TACA 2R3NA 2QOCA 1PMVA 3BBTB 2C4GA 2W1FA 4IVDA 5HNBA 2X7FA 4W4YA 1T46A 4XLVA 4WSYA 3IECA 3ETHA 4DCEA 2BRHA 5AFVA 3O7LB 4IE9A 3DQWA 5JRSA 2OLSA 2GHGA 5CA0F 2RG6A 1HCKA 2SRCA 4YHFA 5ANGA 4R3RA 4AS0A 2QKWB 3FXXA 2VNYA 4FT7A 4RWJA 4AXAA 4BHNA 4C59A 4DG2E 4EKKA 5DG5A 5CAQA 3UQCA 4L01A 3SLSA 2OH4A 4DFLA 4HZSA 1OKWA 1VJYA 4CFVA 4IX6A 1W0XC 3KRJA 4LOOA 4FZDB 4H58A 2XK4A 1H0WA 2VWVA 1KE9A 1R3CA 3A60A 3WF7A 4AWIA 2NP8A 3JY0A 1R78A 2OO8X 4AP7A 4EHZA 3MH0A 2PE2A 2XH5A 2PK9A 2CGWA 4ANBA 4MBIA 3GOPA 5D41A 3TW6A 5H8GA 4JQ8A 3PWYA 1AUVA 4BI2A 5AUVA 1H1PA 2O2UA 1PXJA 2RG5A 3QUDA 2UZOA 4RWIA 4TW9A 4V01A 4UXQA 3ZZWA 5KCVA 5CA1F 4AGWA 5FBOA 4CT1A 5CEPA 4ZAUA 3QRKA 5EG3A 3A62A 3L9PA 2W70A 3KREA 3BPRA 3SG9A 5CALA 3FC2A 5E4HA 3GCVA 3BHUA 1Z2PX 1NA7A 1GAGA 1PXPA 2AC3A 2PY3A 3FJQE 4DGMA 2VRXA 5E9EA 3R28A 4AA4A 5AP4A 5FEDA 4MXXA 3ATSA 3P86A 1CS0A 4RJ7A 3D94A 1YI6A 2V0DA 3TJCA 3C51A 4G9RA 4YC3A 2VGOA 1GOLA 3DZOA 5CXZA 4IADA 1XR1A 3O8TA 3ORPA 2C6EA 3HLLA 3ORZA 5BVOA 3Q6WA 5HVJA 5FLFA 2OGVA 2BHHA 2VNWA 3OUNB 2BRGA 5JVDF 3NYXA 5KZ0A 4MXYA 4EL9A 2P0AA 4GG5A 2BAJA 2W4JA 1B38A 4CTBA 1BXRA 5JFSA 2XNBA 1SNXA 2HAKA 2OKRA 3IGGA 4M84A 4OBQA 4FIGA 3PIYA 5CEMA 5K4IA 3KALA 3NX8A 4RT7A 1Q24A 2BAKA 4K8AA 4JL9A 4QOXA 1M14A 2DS1A 4NK9A 5E8YA 3PVWA 3E93A 2ETKA 3MY5A 4R3CA 2FSMX 4E5BA 3G8DA 4O7VA 2R7BA 3OCTA 4NSTA 4BTFA 2YCFA 5IDPA 2C6DA 3HX4A 3GC0A 3QHWA 2FB9A 3COHA 3MB6A 3ANQA 5B0XA 4DEAA 1E4EB 1WCCA 3BGQA 2ZYBA 2A27A 3BYMA 1YI4A 3MBLA 2E9OA 4N0SA 3UIXA 4CCBA 4AF3A 4DEGA 4YJUA 3FY2A 4FUYA 1H1QA 4FODA 5I9UA 2JAVA 3NUXA 3QD3A 2OFUA 4IAAA 4IM3A 1PX2A 2F2CB 5EM6A 5C26A 1PXNA 3P78A 3A7FA 2ITWA 3R1QA 5JZJA 4FTMA 3R9NA 4BRXA 3IPHA 5J9YA 1REKA 1Z5MA 3UVPA 4M0ZA 2XJ2A 2QO9A 2W96B 2W5HA 4WBNF 3TKHA 4EC9A 2XNGA 4CG9A 3UODA 5AJQA 2YFXA 4F6UA 5LVLA 2VWIA 1Q97A 3H10A 4J96A 3MY0A 4ZSJA 2BRMA 2HZIA 5L2SA 1ZMVA 4M14A 2C1BA 1XBCA 3RZBA 3BYVA 3OTUA 4G16A 4G3DA 3GU4A 5GHVA 5CAUA 3KU2A 3LE6A 2OLCA 4FZ7A 3CQWA 5LXTF 3OWJA 3L8VA 4USFA 5IA1A 1YDRE 2C30A 3OCBA 2YL2A 2WGJA 2BRNA 4GJ2A 4MV4A 4BCNA 4FKWA 3DB8A 3OF0A 3L8XA 3R0TA 2VU3A 4J53A 4W8EA 5FDXA 3KKVA 3B2TA 3COKA 3VS3A 2AYPA 4JBOA 4I93A 2H8HA 3ZLSA 1M2QA 3QTXA 4CMTA 4XV1A 4KS8A 4O2ZA 5M4UA 3Q2OA 4F1TA 4FVPA 4IDVA 3WO0A 2FO0A 2VO3A 3H4JA 5C4LA 3OEZA 3HO8A 2NU8B 1PXMA 3TJDA 1ATPE 1NXKA 4JX7A 3LM0A 3RWPA 2XRUA 4ZTLA 4JG6A 4PL5A 2I8CA 1FINA 1SMHA 3LLTA 3R71A 3DK3A 5EHYA 4QMVA 3TNQB 3RK5A 1M17A 3LFNA 4NIFB 3M42A 4XLIA 4QP7A 3ORRA 3BCEA 5M4IA 3G9LX 1GLVA 4E20A 3GXLA 3TINA 2BMCA 5AX3A 4F70A 3VUGA 1KC7A 4HVIA 3UIMA 1B6SA 4UZHA 5CQUA 4DEEA 2PHKA 4RJ5A 3AOXA 4BI0A 4DE4A 5JGAA 2QLUA 3PJ8A 2FPPB 1OIUA 3O8UA 3PY0A 3EH9A 4FEQA 3OXIA 4GKHA 4MH7A 4QO9A 4ZY6A 4MA0A 4U3ZA 1FMOE 4WHZA 5IQIA 3FSFA 4X6QC 4CEGA 4AZEA 2GNIA 4YMJA 4BDIA 4U0IA 4F9BA 2J9MA 5CASA 2PSQA 2HY81 3GB2A 1YDTE 3DXNA 4ZXTA 3TDVA 5JQ8A 1FVTA 4P90A 3EQGA 4CKIA 3AC8A 4E6QA 3AD5A 3SW4A 1WR2A 4JS8A 2EUFB 4DHFA 5ETFA 4I92A 5KNJA 3SGCA 1O6YA 3LXPA 3Q32A 4FVQA 4R3PA 3OG7A 1PXKA 4D9TA 2X2MA 3T9IA 5J2UF 3WZKA 3QL8A 1P14A 4MD9E 1OL7A 4U5JA 5HU3A 1UNHA 5E90A 3BQRA 4FK6A 3V8SA 1XBBA 3U6HA 4LUDA 2NU6B 1L8TA 3LQ8A 3ORLA 4O0RA 1ZLTA 4X3FC 2VWUA 2OI4X 4HGEA 3R8LA 2VTTA 1V1KA 1UU7A 5LVOA 1C3OA 3QD0A 4I1ZA 3R8UA 1K9AA 3IOKA 3MFSA 2PMLX 2YIQA 3AC5A 4O2BF 4I5CA 2CSNA 3ZO3A 1CKPA 3OWLA 5LJJA 3NAYA 3ORNA 1A06A 4PNIA 2IZUA 3VS5A 4DLJA 4EOIA 4WBBB 2RFSA 2VTSA 2NPQA 4MF1A 2O64A 4KA3A 3V6RA 1IEPA 2R9SA 3E7VA 5FGKA 3Q2JA 2PE1A 4QMLA 3UJGA 3QD2B 4AACA 4CZTA 4EQCA 3NNXA 3WO1A 4UZDA 1KV1A 2XZSA 3F2AA 4KIQA 5CSVA 3V8TA 2WNTA 5IEYA 5EDRA 3DBQA 1YRPA 3KB7A 2ZB1A 4KBAA 3JYAA 3BU6A 2X8EA 1WBWA 1TQIA 3PA5A 2G9XA 3DFCB 4ITIA 4ORKA 4XNEA 3ODZX 2HELA 4GYGA 4YTHA 2BR1A 4R5SA 2X6DA 4EWHA 4QP3A 2YRXA 4Q9SA 4XHKB 2GPWA 4O21A 2F7XE 4TWOA 2W6QA 3RVGA 2WMQA 4XOYA 1XH5A 4DFNA 3VOTA 3IW7A 1F0QA 4KD1A 4IVCA 4ZK5A 3TKUA 3GFEA 5BYYA 1JDBB 3FPQA 4FV2A 3ZMMA 1WBVA 5F9EA 3S00A 4C35A 2F49A 3D14A 3PSDA 4L52A 2UZWE 4L45A 3AC1A 1UV5A 5I9XA 3MB7A 5EW9A 5AP6A 4F7NA 4FKSA 4XG7A 3DTCA 4FI1A 4RSSA 5LMKA 4L46A 2NUAB 4E8AA 4TWNA 3COMA 2J51A 2Z7LA 3ELJA 3G33A 4F7JA 4MV6A 3IW6A 1OGUA 2R3GA 3FXZA 5M07A 4QMZA 4NWMA 4N4SA 2JKQA 3UOJA 5CAPA 4H39A 2ITVA 4KBCA 3ZEPA 1FMKA 1H0VA 3QZIA 3ZOSA 2J50A 4F6SA 3GCSA 4EWQA 2BKZA 3KMWA 4QRCA 3FPMA 5D11A 1UU3A 2VN9A 4MAOA 4FG9A 4PWNA 2UW4A 4Y5QA 4NCTA 5CF6A 3UYSA 4U9AA 3HEGA 2W1IA 3QTQA 4DGLC 4I41A 1DV1A 3RNIA 2VX3A 4A07A 4I24A 4EH9A 5LVNA 4QMPA 4YZMA 2J5FA 3D5WA 3QKLA 4NTSA 4MX9A 4AN2A 3MFUA 4V0GB 4DFBA 4WUNA 5FRIA 5BVKA 3CE3A 3NRMA 1OZ1A 3MJ1A 5G1XA 3V6SA 2FGIA 4YBJA 4B9DA 2WOTA 1UU9A 1BMKA 1UNGA 1Q61A 3R1SA 1Q3DA 4LFIA 4X2FA 4HCVA 4G34A 3NR9A 2GTNA 4XMOA 1PYXA 4W4XA 5AV1A 3V5JA 3V5WA 5KBQA 2BZJA 1CE8A 1Q62A 3BYOA 3UYTA 1SYKA 1AGWA 4GU9A 3VPBA 5IYZF 3DBFA 1ERKA 3F5UA 3VUDA 4IW0A 5JGBA 3OT8A 5F94A 1WBNA 4MV9A 1PW2A 2BRBA 4FYOA 4D2RA 3HMPA 3POOA 3IK3A 3BG5A 2EXCX 1CQJB 4KUJA 2A1AB 2PUNA 4L1KA 4ZJVA 2XM8A 3KULA 3P9JA 3DJ6A 3MYGA 4G2FA 4X2GA 4XV9A 5E8TA 1CTPE 5HE0A 4ZMFA 3NNUA 3R9RA 2KTYA 2JIUA 2FSLX 2OZOA 3MDYA 5HHWA 5JRQA 3GCQA 2PZYA 5BUEA 5CT7A 5TR6A 1H07A 4ZIMA 1H1SA 2C1AA 5BMMA 2W7XA 5D12A 2FB8A 4RC2A 3MVMA 5KZIA 5FM3A 4QTEA 5LOHA 4IB0A 4ANLA 2WPAA 4QMOA 4YZBA 4K9YA 3PLAE 3RJCA 2B9FA 2BZIB 4L7FA 2ZM4A 3JPVA 4FSYA 3QUPA 5E8ZA 4D4RA 3PVGA 2C5OA 5K4JA 2HY0A 2A19B 3R8MA 4G6LA 2I0YA 2XNEA 1JKLA 4JDJA 2RKUA 3NUUA 4F9YA 3LOKA 1BL7A 2R85A 4N70A 2XCLA 4XCUA 4FIEA 1YWNA 5DR2A 3VS1A 4YTCA 3W8QA 4NT4A 3Q4ZA 2OK1A 4KNBA 5L3AA 5HIBA 4F9AA 4FKJA 5HEZA 3VBYA 4TXCA 2XRWA 2IZTA 1VKZA 5ANDA 4E5WA 2YEXA 5DI1A 1KJIA 4O0WA 2G1TA 5DE2A 3MJFA 3QF9A 4I4EA 4MXOA 1P4FA 4X0MA 3TIYA 5LMAA 4ALVA 4ZTRA 3TG1A 4EH7A 2G15A 4GS6A 4FTUA 4FVRA 4OTQA 2UZTA 3WZEA 4UBAA 4JLCA 4BDJA 5J9LA 2YM3A 3FE3A 3D2KA 3QKKA 2V55A 4QYYA 3CKWA 1IA8A 3TZ9A 2QR8A 4JAIA 3Q5ZA 5EYKA 3DJ7A 5F20A 4BIBA 2B4SB 4DA5A 3R23A 3LQ3A 3H9FA 3O8PA 4IZOA 3ZONA 4CT2A 3E5AA 3Q53A 3ALNA 3ANRA 1NW1A 3FKOA 3QCQA 5KMKA 3LFDA 3U6JA 3OP5A 5KKRB 4PTCA 3UQFA 3FQEA 3S95A 4TNBA 5HIDA 4C02A 3PFQA 4YNOA 1Z2OX 2W6MA 4BHZA 3PSCA 3I4BA 5CSXA 2BDJA 2OICA 4PDPA 4WA9A 1JAMA 3CD3A 2ESMA 4UV0A 4Z9LA 4HW7A 4OTWA 5A4TA 5LXMA 3Q6UA 5JZNA 3QQHA 3LCTA 3LPBA 4O0VA 3D9VA 4O82A 5EM8A 4D0WA 3QHRA 2ZDGA 3F5XA 1GGOA 3JS2A 3NPCA 4HPUE 4QTDA 4IBMA 5CNOA 3ZH8A 1U54A 5A4EA 5TOZA 3TIIA 4FTCA 1J7LA 3PJCA 5CSWA 4LRKA 2UZLA 2PL0A 3D5UA 5C8MA 2UW3A 5LARA 3VS6A 4Y73A 4PL3A 4EZ5A 2VPQA 5H80A 5IH4A 3AGLA 4WO5A 2PZ5A 4FOBA 3KVXA 1XHAA 5EQPA 4AZSA 4RC3A 5JEBA 3NCZA 4C34A 2XNPA 4B8MA 1H01A 4EONA 3QTUA 4Y95A 3W1FA 4N6ZA 3R6XA 2X2KA 5A54A 2YDIA 3VBQA 3ZZEA 3BV2A 4GEOA 4FFLA 4RC4A 4C0TA 3NW7A 5AEPA 3N4UA 1OB3A 4BR3A 3ZC5A 3BYSA 2R3PA 4WKQA 4YLLA 3LP8A 2Z7SA 3LXKA 1Q41A 2BUJA 4FV9A 2QHMA 5HE1A 4S2ZA 4BCIA 4IZ5A 3B8QA 3PPJA 1NY3A 3MH1A 4JDIA 3R5HA 3PYYA 3UP2A 5BVFA 3OUKA 4D1ZA 4FV7A 3N9XA 3DAEA 3GU6A 1BI7A 1V0BA 4BDKA 1G8SA 3A4OX 4TPTA 3RGFA 3PXFA 4RG0A 4D4VA 3PZEA 3PRFA 5EYDA 4IB3A 4GIIA 2DIKA 5EHLA 5L2WA 5HBJA 3OOMA 5KBRA 2RFEA 3G5DA 3LJ0A 5B7VA 2BPMA 4XJ0A 5HCYA 2YJSA 5M4FA 2BALA 1LR4A 2JKMA 1WMKA 3UIBA 1ZAOA 1Y57A 2WMXA 4OGRA 2BFXA 3DA6A 4FEXA 3MH3A 4G9CA 4IHJF 4K77A 4A4LA 3GC8A 3SG8A 3NEWA 4F1OA 3O71A 2B0QA 3L1SA 2UW8A 3U9SA 4YBKA 5AADA 3NIEA 3DF7A 4J99A 5K9IA 4LRJA 4APPA 1OL1A 1YVJA 3MFRA 1J1CA 5HZNA 3QA8A 4HYSA 4FSWA 3G6HA 1JOWB 3UG1A 4E4XA 3MV5A 1FVRA 4FTLA 3RM6A 4BDBA 3KXZA 4ACGA 3M11A 4JI9A 4EJ7A 3QQFA 2A4LA 5HG7A 1GZ8A 3G9NA 4GUEA 4ZZOA 2V5QA 2WQEA 3C5UA 3PVUA 3QBNA 4NKSA 3FI4A 4IACA 5AUTA 1UA2A 3V5PA 5JH7F 4DBNA 4YNEA 5IG1A 4PMSA 1VZOA 4I5MA 5F4NA 1IR3A 5M09A 3E92A 1BKXA 2PZIA 3LVPA 3LM5A 5KHXA 2XM9A 4P7EA 4NJ3A 3I1AA 1EYZA 2YZNA 3EN9A 3RAKA 5HBHA 4BCFA 4AU8A 4O7WA 1BNCA 4AFEA 4YJ3F 1IA9A 2E9PA 4Z55A 5HI2A 4XH6A 5IA2A 4G3GA 4KIPA 4Q5EA 4ZSEA 3W32A 1V0PA 4FTAA 4ITHA 3RAWA 4NU1A 4BTKA 5HG8A 4APCA 2JFMA 5CLPA 4AW0A 3BE2A 2R84A 3O51A 4QYEA 3HMNA 2Q0BA 3FV8A 4D1XA 3TT0A 5DMXA 3GQIA 2X0SA 1YXVA 5CT0A 4N6YA 4IJ9A 3LLAA 3LCDA 3FDNA 3QLGA 3FLQA 2WMRA 5E91A 3PY1A 4O96A 4Q2AA 4E73A 4JR3A 4XS2A 4I6QA 3W2RA 4GT4A 3ZBXA 3UPZA 2WTCA 4ZI7F 4QQJA 5KKNB 3OY3A 4K11A 4RQKA 2OXYA 5HNGA 3GCUA 3PXKA 2QOKA 4BTMA 3FL5A 4NW5A 4EOMA 3LJ1A 4IEBA 2R82A 1JVPP 2DQ7X 2Y4IB 4ZSGA 5D8DA 3F6XA 2JDRA 4M13A 4RA4A 5CU3A 5KMMA 2C6LA 5CANA 4B0GA 3RCJA 4C3FA 4RA5A 1PKGA 5L2TA 4FG8A 2W9FB 4QQTA 4ME6A 4QP9A 2XCHA 4RFZA 2DLNA 1JQHA 4O83A 3EQHA 3O7LD 1XH9A 3SOAA 2XK8A 1FQ1B 3HRBA 3Q9ZA 5FXRA 4WNMA 4I3ZA 4KKEA 5A6OA 2PVFA 3FXWA 3QZFA 4II5A 4RWKA 4JX3A 4DH3A 5KMLA 1ULZA 3LFAA 4IAZA 4C36A 1PMEA 4O86A 4NM0A 5CVGA 1Q8ZA 4EQMA 1FOTA 5TKDA 4RJ3A 3ETJA 4MD8E 4HNUA 5HE3A 4HZRA 2R3OA 4FBXA 5KMJA 2VD5A 3SOCA 2V5AA 3NWWA 1UKIA 3BZ3A 5C8NA 5DR9A 4TWPA 5D7AA 4GFMA 4HVSA 2PUUA 2XEYA 4I0RA 3WYXA 2JIIA 1CSNA 2OW3A 5ETCA 4AN3A 2WMAA 4LYNA 3ZS5A 1W83A 3EQDA 3HGKA 5DIAA 4CFNA 3PJ3A 4BIDA 4XYLB 4EH8A 4LOQA 3D0EA 2HGSA 3DPKA 2VGPA 3KFAA 3KAKA 3TQTA 4USEA 3E8DA 3OXZA 3ZEWA 3ZLYA 3CC6A 2KULA 5ANOA 5LCJA 4PP9A 3BEGA 4UWCA 2QOIA 1M52A 3EFJA 4DIMA 3DXQA 3LFSA 5A3XA 3GT8A 2ETRA 3F5PA 1I7LA 5H3QA 3C4XA 4WNOA 3R9OA 2VAGA 4R6VA 3LCKA 3ORTA 5KMOA 3NMUF 3TNWA 2YS6A 1Z2NX 4O6LA 3PPZA 2VO6A 3NDMA 1S9IA 3D7TA 3NW6A 3CSVA 3CLYA 2XK6A 2Y6OA 3R02A 3VO3A 2G2HA 2YAAA 3QD4A 2OIDA 3PTGA 1RW8A 5CVHA 4U79A 1M0WA 1TQPA 5CU4A 3W18A 4ANMA 2EU9A 4FKPA 4EH5A 2VWYA 2W0JA 3R1NA 3U9TA 1LUFA 2PULA 3W2CA 4BDCA 1ZXEA 2AC5A 2X7OA 3HP2A 4YJVA 1QPEA 4Q9ZA 2GFSA 1SCUB 2XNNA 4ARKA 4M12A 4FUXA 3UOKA 4K1BA 4I21A 1OKZA 2J7TA 5EDPA 2EB2A 2R64A 4FEUA 4EKLA 4RQVA 4WG3A 3IS5A 4DN5A 2CMWA 5E8VA 5HGIA 4AX8A 3TN8A 4G17A 1NT2A 5HO7A 4GVJA 3RAHA 2YCQA 4OW8A 4YO6A 4B99A 1XH4A 1F5QA 2W5AA 4QPSA 5IA5A 2XNOA 2YZGA 5E8WA 3OZ6A 2ONLC 2OJFE 3ENHA 5DT3A 3ZUTA 3KAJA 3R9HA 4HVDA 5EM7A 4UALA 5CSHA 1M7QA 2PUIA 2BDFA 3HMIA 4KRDA 2JIVA 5FM2A 2YZLA 5T6KA 4IWQA 3NNWA 4BF2A 4U6RA 4BDHA 2VTIA 2XNMA 3AT3A 1H1WA 1OITA 1G5SA 2OF4A 2Z2WA 3QQJA 4XG6A 3TL8A 5IQCA 4HVHA 1GSAA 4A06A 4D5HA 3FQSA 3PXRA 2WMBA 2XIKA 3K2LA 1VBGA 2OWBA 3AT2A 5JMSA 4Y8VB 5DEWA 4RVLA 2R7LA 1SVEA 3NAXA 2BHEA 4XUFA 2WU7A 4IMYA 4R78A 5KE0A 3R8ZA 3BYUA 5J1VA 4X3FA 2PVPA 4BCMA 4MHAA 4YJRA 1OPJA 5BMSA 2I40A 3GU8A 1PK8A 4BCHA 3UNZA 2QD9A 3PSBA 1KJQA 5HLWA 2NU7B 3Q96A 3PJ2A 4HNVA 4M9UA 3KK9A 3EIDA 4BVUA 2YW2A 3AX6A 1OI9A 5J9ZA 5CSPA 2JC6A 2J0KA 2YIRA 5CF5A 1FGIA 5FNVF 3F7ZA 3EQCA 4GUBA 3CPBA 3BI6A 3ET7A 3DKCA 3UNKA 4QMMA 4FKLA 2QF7A 2GPHA 3L9MA 5EQYA 3VS4A 3RK7A 4R1YA 5B2MA 2XCKA 4XP3A 2DWCA 2YWVA 3SXSA 4HQ6A 5EHOA 2HXLA 3CGOA 2YZAA 5DWRA 3MY1A 3C0GA 1H8FA 3A4PA 2I0EA 5FG8A 4PUZA 4RVKA 5CEQA 5HX8A 5HVYA 4JG7A 4WBOA 3VRZA 5C4KA 3A8WA 5JQWA 5L6OA 3G51A 4ANQA 4Y5HA 2J4ZA 2REIA 1M2PA 4ZTSA 2OSCA 1BYGA 3HAMA 2UUEA 3F7WA 3D2IA 4O7NA 3DZQA 4E4NA 1JSUA 4F09A 4FG7A 1ZYCA 4GU6A 4OTRA 2WTKB 4FA2A 3R01A 4YJSA 1E1VA 2WQMA 5HV6A 2PMIA 4L8MA 2F2UA 3DS6A 4IFGA 2UVXA 2WOUA 3TKIA 3VMMA 3D15A 5AUUA 1AD5A 5CQWA 2PMNX 1YXUA 2BFYA 4C3PA 1UWJA 4XBUA 1G3NA 4ONAA 2QU6A 5M44A 4MNEA 3SQQA 4QNYA 4FNWA 3MFTA 3F3VA 5ETIA 3VC4A 1Q8UA 3DT1A 2OFVA 2Y7JA 4RZVA 3WF6A 3TV7A 4RIWA 2XP2A 5A4CA 4R7IA 3EQBA 4GVAA 2F57A 4CGAA 4CKJA 3SVVA 1ZWSA 3DQXA 2WMVA 2BTRA 3GIDA 1CKIA 5HD7A 4DT8A 2XKEA 4IAFA 4FKQA 3VIDA 4S30A 3K5HA 4FU0A 4WRSA 4YZ9A 5HICA 2FSTX 2JLDA 3RAIA 4HOKA 4L3PA 5CTPA 3M1SA 2YERA 5DHJA 4BI1A 3NZ0A 3UVRA 2R0IA 3A7JA 3MGYA 2W17A 3FLWA 5ANJA 3ACJA 5ICPA 4X21A 4I20A 3UPXA 4ERKA 3OWKA 5JN2A 4FV6A 4IWOA 4IIRA 4C5BA 2R3FA 4QYHA 3LJ2A 5DPVA 2C6OA 2PTKA 4PX6A 4TYHA 2IJMA 4C37A 4DCAA 4MBJA 3ERKA 2BZHB 2UV2A 3EYGA 4FT9A 5M57A 3DLZA 4WUAA 4C38A 4F0GA 3GQLA 1GY3A 1U54B 5IF1A 4CMOA 1JWHA 4BZNA 3IW8A 4GK3A 4EBWA 2Z7QA 5DLSA 3R22A 4A9YA 4V05A 3KVWA 4C62A 4EUUA 5B2KA 3GENA 5IUIA 3LZBA 4MAMA 4A9SA 4C2WA 1JPAA 3HV5A 4USDA 3W10A 4A4XA 2A2AA 4BBFA 5IMXA 2QI8A 3QWJA 1URWA 2B9HA 5L2IA 3CJFA 1MRVA 1E9HA 4IVAA 2O8YA 4YHTA 3QQUA 5TO8A 3UG2A 4F9WA 3G8CA 1KBLA 4BDAA 4BDGA 3E3PA 1X8BA 3CY2A 4DTAA 5HLNA 4X7QA 4YZDA 2EB3A 2OIQA 4RJ6A 3V5TA 4QTCA 2AUHA 3ZU7A 3TNHA 4MD7E 3BRBA 5HESA 5DEYA 4XZ3B 3U9CA 1UVRA 5C1QB 4Z7HA 1URCA 4YJPA 3BLHA 2I0HA 2BCJA 3RPVA 2UW5A 1WVYA 3I0QA 5BNJA 2HJWA 2VWZA 3DLSA 1OM1A 2QOFA 3IOPA 2GHMA 4QP1A 1H27A 5AA8A 5KKRC 3OXTA 4RVMA 3W2OA 4AT3A 2IVUA 4L68A 2J2IB 4ENYA 4QT1A 1YWRA 2X0GA 4HPTE 2IWIA 3MWDA 4PTEA 5H8EA 2CJMA 4ERWA 2GPSA 4ACMA 1A9XA 5CYIA 2CGUA 2XKFA 4PMTA 4EK4A 3DKGA 4FTKA 4ASXA 2PVJA 4MCVA 5FXSA 4DTBA 5JK3A 1U5RA 4H3PA 1R39A 4HYUA 2OJ9A 3UP7A 1U59A 1WZYA 4DLKA 4FX3A 1W82A 3ZO4A 3E8NA 3DV3A 3U6IA 2QLQA 1PMNA 3EFWA 3R5FA 5BYZA 5GJDA 4PTGA 3QRJA 1J1BA 2CKOA 2WKMA 2X4FA 3R00A 4E6DA 2JD5A 1PXIA 3BHTA 1YKRA 5A4LA 3I79A 2CNQA 3EB0A 5HE2A 1M2RA 1IASA 3RFCA 3G0EA 3TEIA 5LQFA 1Y8GA 4FYNA 5C8YF 1WVWA 4IX4A 3VRYA 3HECA 3LXLA 1MUOA 4IZAA 4Z16A 1OL2A 4OTGA 3BU5A 4NH1A 5HNIX 4RLKA 2OXDA 4A9TA 2VTQA 4ACDA 2YRWA 3LWBA 1APME 2ZJWA 2WQNA 1ZZLA 4CD0A 2Y9QA 3U8WA 1DI8A 3WNZA 3D5XA 4OTFA 1YOJA 2WYOA 1GNGA 2C5NA 5BX0A 2QU5A 5BVWA 5BVDA 3EKKA 4FFRA 3DOGA 3NUAA 1Q8YA 5FP5A 3BBWA 3FYJX 4FEVA 3QRIA 4D4YA 4G3EA 2CKEA 5LOVF 4YZCA 2Y6MA 4B4LA 3V4ZA 4R7BA 3LFEA 5HTCA 4O2AF 2XA4A 4IX3A 4AUAA 1W7HA 5DNRA 3HA8A 3ZM4A 2FA2A 1F3MC 4F9CA 4Y8DA 1BUHA 4EOSA 4RFYA 4W8DA 4JVGA 1T36A 4JJRA 4I55F 1WFCA 5IDNA 2UZUE 1OL6A 2HZ0A 2YM5A 5M55A 2PYWA 4HGTA 2PZRA 2X9FA 3FMKA 2W9ZB 3HDNA 4C7TA 5LVMA 4G3CA 3C0IA 3TI1A 1GSOA 2SCUB 5JVLA 2VQDA 3BIZA 5L6WL 3EKNA 4FFPA 5K5NA 4UY9A 3DB6A 4WNPA 3F2RA 3VUMA 3PA3A 2PVRA 3HV4A 1JKSA 4KBKA 2YDJA 3AMBA 4CFXA 4WT6A 3WIKA 3PXZA 3RI1A 4MXZA 2H34A 2QNJA 4QTAA 2FYSA 5KHWA 5KUPA 3VS7A 3RPRA 4FFOA 4F63A 3QQGA 4C58A 4MV7A 4FFMA 4O81A 3QRUA 3EFLA 4FL3A 4L42A 4ZTHA 2Z02A 3R2BA 3C1XA 3DAKA 3GC9A 3HA6A 3MH2A 4FIFA 4DFZE 2JBPA 4KKGA 4LGGA 4MKCA 5HBRB 1Y91A 2RFNA 2YN8A 4OR5A 4RGJA 3T3VA 4ASDA 3F3WA 5AM7A 2ZAZA 5EI8A 2PVKA 3Q9WA 4AA0A 5KX5F 3OFMA 2FUMA 5HLPA 3UMWA 4YJQA 4OTDA 3GOKA 5A4QA 3TZ8A 5T68A 3ORXA 4EH2A 4UWYA 3UOHA 4J1RA 3FHRA 5A46A 2O5KA 3G6GA 1J7IA 5M4CA 4P4CA 4WOVA 3CTQA 5HG5A 1FPUA 3G90X 5CEIA 3RPSA 5JFVA 5LYJF 2UW9A 1XKKA 3I60A 3MWUA 1YQJA 4K33A 5C1OA 3D5VA 3FMEA 3VF8A 4AOJA 3WZJA 2X39A 3KXMA 2PVLA 4XV2A 1EH4A 3ROCA 4M8TA 3DTWA 2HWPA 2C6TA 4JQEA 3ZUVA 4CMUA 4AOIA 5H2UA 4EGJA 5FXQA 3O17A 1Q8TA 4NZWB 3FZPA 1O9UA 4YAJB 2W4OA 2QURA 4IM2A 2WEVA 4ZS0A 5ANIA 2Z04A 5L8LA 4O4LF 2Y4IC 1A9UA 2R3MA 2R3IA 2YISA 4FT3A 4O0TA 5AUWA 1OIRA 1Y6BA 4NM3A 4FKVA 4DH1A 5CAOA 5I4NA 3FAAA 4RZQA 4TYGA 4W4WA 4BGGA 3MSSA 5A9UA 5LWNA 3LXNA 2QODA 4MWIA 4D5KA 4IM0A 4RIOA 4TY1A 5M53A 3FBVA 4RX9A 5GJFA 4TV9F 5A14A 4FGBA 1QPJA 4O0XA 5EFQA 4YO4A 1ZYJA 4C2VA 4DH5A 5CF4A 2UW7A 4AN9A 3GU7A 2UW6A 4PRJA 4CLJA 4G6NA 1SVHA 4JOAA 5HIEA 2Z8CA 3FKLA 3OCGA 4HNFA 1VYWA 4O7LA 2W99B 4M0YA 4QMTA 4AE9A 3RM7A 5BUJA 3OTVA 3ULIA 4TV8F 3I6WA 5F95A 3G0FA 4FNYA 3KQ7A 4FTQA 3VHEA 4A4OA 4FGRA 5H8BA 5C8KA 5EYCA 4BIEA 1YXXA 3C4EA 2CHLA 4QMSA 3OUZA 4I50F 1W84A 4IIJF 1V0OA 5CI7A 2DWBA 3RKBA 4IC8A 4MV3A 1T45A 4YP8A 3AC4A 2C3LA 1JKJB 4U45A 4EGQA 3EYHA 3CQUA 4D4SA 3SRVA 3ENMA 2B9IA 4O7TA 2X1NA 5IQDA 1EZ1A 3EQPA 2C3KA 4O22A 3R7VA 3A8XA 1MQ4A 4E93A 4EI4A 3JXWA 3FZOA 4C4FA 4DGNA 3RCDA 3N6RA 1ZOGA 4U3YA 3K5VA 4RIYA 2HIWA 3LMGA 2G2IA 1WAKA 4O2PA 2CNVA 4QP4A 5LA6F 2C6MA 3OY1A 1Q8WA 3UFXB 2C47A 2XMYA 3AGMA 3WE4A 3DY7A 3NNVA 3F69A 4XG8A 3ZRKA 2J0MB 4FNZA 2W1CA 4HCTA 5EZYF 1TVOA 4QMWA 2VZ6A 3R5XA 3EJ1A 3S0OA 2BZKB 3ZC6A 3E64A 5CENA 5K5XA 4LMUA 3VA7A 1IOWA 2QC6A 5LMKC 4PDOA 5J7HA 1RJBA 4YSMA 2WTIA 2CZGA 5HG9A 4QP2A 2OZAA 3RHKA 3FI2A 5EDQA 4U7ZA 5FEEA 5IMEA 3GC7A 4TYJA 3QTSA 2YYAA 3EWHA 4BCQA 4GG7A 3EN6A 3PWDA 4KKHA 1E1XA 4KWPA 3V3VA 5JH6A 2FH9A 4NW6A 4PQNA 3FLZA 1GIJA 2OH0E 4QTBA 2JITA 3QTZA 5C03A 3ZHPC 2HOGA 2YA9A 3FY0A 4GKIA 3ZCLA 3AD6A 3V04A 4OTIA 5JFWA 4GL9A 3C7QA 2XD4A 5CF8A 4XV3A 5L6PA 3KY2A 2UVZA 5ACKA 4XG9A 4JXFA 4NCTC 4FV4A 1GZOA 3I6UA 2JKOA 2X8DA 2YCRA 4FZAB 4M67A 5AP5A 4YC8A 4LRMA 1WVXA 3UQGA 4UX9A 2PVMA 4IWPA 3OBJA 4O6EA 5DVRA 2IN6A 3IDCA 4WD5A 1MRYA 3A7IA 4ZTMA 4DG0E 4AE6A 3PRIA 2NRUA 4AZTA 3AG9A 3VUIA 4LQMA 3RUPA 4WG5A 4ZEGA 3B2WA 3A99A 3QYWA 4NUSA 5IA3A 4BDDA 3SXRA 4BGQA 1OKYA 3SHEA 4P2KA 4R1VA 4LG4A 4UWBA 4DGOA 4XOZA 4E4TA 3D83A 4NTTA 4FIJA 4MNEB 4IB1A 4BZOA 4HGSA 5EKNA 3DKFA 3COIA 1BX6A 3P0MA 2XK3A 4XBRA 1MP8A 2WTWA 3NYOA 4F4PA 3RWQA 2PN1A 5A6NA 5HVKA 4O0UA 4F6WA 4ZOGA 4A9UA 3LFBA 3HV7A 4L3LA 4MVFA 4CCUA 1IAHA 1AUXA 3LCOA 2XIYA 3EZRA 1JLUE 1HOWA 2HWOA 2IVTA 4FTNA 5EOLA 3TUBA 2FPGB 2CKPA 1QMZA 4G3FA 4ZSLA 4PMPA 4FSMA 2IZSA 3BGZA 1CDKA 4H1MA 3C4CA 3WF8A 5E92A 4QSHA 2BIKB 3AT4A 3MTLA 4FTRA 3PPKA 4DT9A 2P0CA 5HTBA 4FKIA 5FTQA 3ZFXA 4QYGA 5AUZA 3MIYA 3UVQA 2QOBA 2RFDA 4TYHB 2J90A 3K5IA 2QKRA 4V04A 5LWMA 4CLIA 3KF4A 3N4TA 3BV3A 3DKOA 4I0TA 3VBVA 3NS9A 2WTKC 1JKKA 2WQOA 3KN5A 2P33A 4WRGA 5KO1A 3TZMA 2WEIA 3MJ2A 5J5SA 1DIKA 1FGKA 1FVVA 3OD6X 5H9BA 5IH5A 4UXLA 4LMNA 4EUTA 3FZSA 3PIZA 4E7WA 4LV8A 5HU9A 1LP4A 2W71A 2JAMA 5J8IA 1CM8A 4O7YA 4EHVA 3MS9A 2VTPA 1XH8A 1BL6A 1RDQE 4JRVA 1JDEA 3DK6A 4U44A 3TNIA 1L3RE 4FTJA 3NSZA 3IW5A 4L9IA 3PDTA 3TIGA 3MA6A 4DLIA 2B52A 1ZY4A 2IVSA 3QQLA 5D1JA 4MV1A 3P7AA 3UBDA 2JKKA 2J9GA 1IAJA 4L7SA 3P08A 3DU8A 3KXGA 3P5KA 4IWDA 4NJDA 4QMYA 5IQFA 2R7NA 3Q4UA 5EW8A 4GFGA 4AA5A 3VVHA 1ZZ2A 2JBOA 3VNTA 2X81A 2F7ZE 3MI9A 3ZFMA 5KX8A 4DGGA 1DI9A 3D4QA 4M68A 1BI8A 4D58A 3F3ZA 2WD1A 4A7CA 4L43A 2YM4A 3CTJA 4O4IF 3B8RA 3NIZA 2VTNA 1J7UA
chains in the Genus database with same CATH superfamily
2ZMCA 2IP4A 3ORKA 3BHYA 4V0GA 3Q2MA 1OUYA 3QX4A 4O7RA 5DT4A 4AFJA 4J8NA 2QB5A 1PXOA 4IWXA 3SE7A 2VTAA 4DTKA 3ORQA 3AW8A 2J0IA 3JR1A 1GIHA 3U51A 2ITPA 3FI8A 3MTFA 4RIXA 5G6VA 3UC4A 3W0NA 2I1MA 4HGLA 4HNIA 4DINA 4ZTNA 2GNHA 3PLSA 5ANKA 2HW6A 4NL0A 5DGIA 2R87A 4QP6A 2RF9A 5AUXA 5JGDA 3KGAA 3NCGA 4XG2A 4Y85A 4O27B 4F99A 3WWJA 3BX5A 4MNFA 1OPLA 2O65A 2G01A 1S68A 1OIYA 1U4DA 2XBAA 4Q4DA 3HV3A 1ZYDA 3FMMA 4GSBA 1B6CB 3EQRA 3KCKA 5CB4F 5TT7A 1I7NA 4L67A 4LOPA 4BCJA 4EORA 4B7TA 4CFWA 2CDZA 1Q99A 2B54A 2PVNA 3DBEA 4FE2A 4H1JA 4XX9A 4ZZMA 3UZTA 3U4UA 3UOLA 4JAJA 4UUGA 4DYMA 2H6DA 2X9EA 3QGYA 2VX1A 2QOQA 4BTJA 4EHEA 1GSHA 3BE9A 2C00A 5CX9A 2V59A 2Q7DA 4C5CA 3E7OA 2IVVA 4HYIA 3VPCA 4BDFA 3SX9A 4ID7A 4AG8A 2H9VA 2RL5A 2XB7A 5K3YA 1EHIA 3GVUA 5DRBA 3RV4A 3T9TA 4Z7GA 5BMVF 2ITUA 1B6RA 3IO7A 4ANSA 1SZMA 2FP4B 4IHPA 3CKXA 1ZMWA 2X7GA 3UDZA 3WYYA 5AAGA 3HBLA 2YHVA 4IJPA 4UEUA 3S4QA 5EK7A 3QUEA 1H08A 3CS9A 4EYMA 1ZRZA 4G5PA 4EZ7A 5FTGA 2VTHA 2XANA 4YUQA 2C0OA 3FLSA 5FQDC 4ACCA 2ZB0A 1PKDA 2I6LA 4ZSAA 5IQHA 4D0XA 1OUKA 3HYHA 3LFQA 4CQEA 3W0OA 4JIKA 3FSKA 4S33A 4ALWA 2YACA 2OJJA 4RZWA 3NC0B 4N57A 4B8LA 4GK2A 1KUTA 3RINA 4HR7A 2B9JA 3V8WA 2JEDA 3JUHA 3KEXA 4G6OA 3WBLA 4BC6A 2Z60A 3C13A 3AXWA 5GIPE 2GHLA 2HYYA 2OG8A 2W5BA 3C50A 2W1HA 3EQFA 3QGWA 3ATTA 1XH6A 4OBOA 4RWLA 3ML1A 3VUKA 1UC8A 4ZY4A 1XBAA 5JFXA 2B53A 1RE8A 1UWHA 4UYNA 4AQCA 5B2LA 1KE8A 4AOTA 3IQ7A 4CKRA 5I0BA 3K3IA 4EOQA 4DF3A 4GLWA 1YDSE 1DAYA 1YHWA 3BKBA 3W33A 3HUBA 4EZ3A 1KOAA 5TF9A 3S24A 2WZJA 1O6KA 5M06A 3F5GA 2W1GA 4FJVA 2EWAA 3JY9A 1VS0A 2X8IA 4XYFA 4I94A 4EG0A 3O0GA 3UE4A 2W1DA 5J1WA 3E8CA 2O0UA 3TDWA 3T54A 4WNKA 2ZDTA 4PDYA 1KJJA 3CXWA 3DJ5A 5CXHA 4EYJA 1J91A 3L9NA 4H3BA 4I6FA 5J2TF 4X6RA 2EVAA 3C0HA 4FEWA 4OLIA 3HNGA 2Q83A 4EOLA 5IPJA 3NUNA 3ZLXA 4C4IA 3DBCA 2R0UA 4DG3E 3VF9A 2H96A 2OF2A 4QYFA 5DT0A 3VUHA 4D55A 3KULB 2YIXA 3SXFA 4FV3A 4GFOA 1OBGA 3PA4A 4EOJA 2V58A 4I5PA 2YWPA 4UCOA 2PWLA 3R7UA 4U43A 4AGCA 4YBZB 4EH4A 5HKMA 4Z3VA 4O0YA 2Y8OA 3Q60A 4XX0B 2WTVA 1SVGA 2XIXA 3PXQA 2GU8A 2YM6A 3BLRA 3FZTA 3Q4CA 4FSZA 2R5TA 1QPCA 3QRTA 4CRLA 4RX8A 5DA3A 5FR9A 2IW6A 2P55A 3HVCA 2ZV8A 3IG7A 5AIRA 3WZUA 3UDTA 3MWEA 1KE7A 2I0VA 3UDBA 4FC0A 2ITZA 5C9CA 3PG3A 4LL5A 5AV4A 1NVRA 1P5EA 2E9UA 5AV0A 3S2PA 5AX9A 5AP0A 3FWQA 3CPCA 3UQ8A 4CRSA 4C4GA 3KMMA 3SKCA 2VR1A 4HJOA 3QZGA 4GV1A 3F61A 3T9BA 4GW8A 4TWCA 5BVNA 1QPDA 3K3PA 3WI6A 4MWHA 4Y72A 3GUBA 4DHIB 1XQZA 2JDTA 3BU3A 3KF7A 4M7IA 2UW0A 4TUYF 1I1LA 1W96A 1PF8A 2EIYA 2ZM3A 2CLQA 4EK5A 5BVEA 4AAAA 4MQ1A 4YGAA 3I12A 1FBNA 3MIAA 3UIUA 1SM2A 1VLRA 3BL9A 4LGHA 4CTCA 2IW9A 3CCNA 3WOWA 4CHIA 3LFCA 4NM7A 3KK8A 3R2YA 1LPUA 2WO6A 4LI5A 4PF4A 4W4VA 5E1EA 2PU8A 4QMXA 5AP2A 1I09A 4OT6A 5FBNC 2C5YA 3SRVB 4EC8A 5AWMA 5HX6A 3WZDA 5BWWA 3H0ZA 3SAYA 3HV6A 4TYIA 5HCXA 4YB8B 4EEVA 3NLBA 3P7CA 2QQ7A 4RFMA 2XIRA 3I7BA 4AT4A 5GIOE 3E88A 3E63A 3OCSA 1S9JA 2IPXA 3P79A 3TMOA 4FTIA 2P3GX 3GEQA 3P7BA 3ZFYA 3GP0A 3JZIA 4RIYB 4WG4A 1WBOA 2Y0AA 3KRWA 2CN8A 4S32A 5CU6A 5E8XA 4FIIA 2HHFA 3OVVA 3TY9A 3MA3A 3ETAA 4U80A 4JNWA 3MPMA 2YM7A 3OMVA 3FMHA 3KN6A 1UKHA 4I22A 3GU5A 2R3HA 4FT0A 4GJ3A 4L53A 4MK0A 2VTRA 4MTAA 4DEDA 3KXXA 2R3KA 2O63A 3C4WA 2WXVA 3LFFA 5AMNA 1H28A 3E3BX 2F7EE 3NUSA 4TM5A 2ZMDA 5AAEA 3E5NA 3H30A 2JFLA 2QONA 4C3RA 2FSOX 3BGPA 2QO7A 2F9GA 5GINE 4H3QA 1H4LA 3FZ1A 3R30A 4U8ZA 2XS0A 2LGCA 2XBJA 2O3PA 3T8OA 2QO2A 5DOSA 3N8DA 1Y6AA 1IG1A 1P2AA 3F3TA 2R3QA 4EHGA 2BVAA 2QK4A 5C01A 5FTOA 1YXSA 2OZAB 2VTLA 2WQBA 3ZUUA 3TY8A 2QG5A 4CE5A 1ZOHA 3ULZA 4CMDA 4RJ4A 4M69B 2GFCA 3BHHA 4MA5A 4DITA 2R86A 2QOOA 3ITZA 4S34A 4IDTA 1ZARA 3ZXZA 3DFAA 3ROYA 3JRXA 4GT5A 4EJNA 3REPA 2ERKA 5IZFA 2W1ZA 4IX5A 2V7OA 3R8PA 4YJOA 2ITYA 4LDTA 3ZDIA 3QTRA 3C9WA 5I5YA 5J95A 2VO7A 2R4BA 3KA0A 4YJ2F 5CI6A 4EK3A 4UFZA 2XYNA 3EL8A 3FYKX 3GI3A 3VBWA 4J97A 3U87A 5BQ0A 3L8SA 4YZNA 5FD2A 4BBEA 1PXLA 5I47A 4TT7A 2UZBA 4ZLYA 4ZZNA 3OW3A 1W93A 3CTHA 2IG7A 5D10A 1H26A 4FV5A 3QTIA 1DAWA 5IU2A 3FHIA 3VJNA 1ZYSA 3V5QA 3SW7A 2GNGA 4FSQA 4IZ7A 3EMGA 2XKDA 3QC9A 1B39A 2CKQA 1NVQA 3VBXA 4EK8A 2ITNA 5I9YA 5DRDA 3MVJA 2X2LA 1CKOA 4IFCA 5AM6A 2ZV2A 3EQIA 3IDBA 5AV3A 1KOBA 5FDPA 4IWYA 1OBDA 1KWPA 4ZTQA 2G2FA 1SNUA 3N51A 1VYZA 3OEFX 4P5QA 3VS0A 4D9UA 3NVMB 2P2IA 2ETMA 4IAYA 3H9OA 3PE2A 4FKTA 4O84A 3NUPA 4TRLA 4ASEA 2ITOA 1STCE 3O23A 4YURA 2OJIA 2GDOA 3EN7A 3CP9A 4XP2A 1R0PA 4I4TF 2AEGA 2LAVA 4IZYA 3NW5A 3NYVA 3VBTA 2VWWA 1O6LA 4RX5A 2WMUA 5CY3A 5HORA 3U9NA 3VAPA 5JQ5A 2I7QA 2QOLA 2XJ0A 4FL1A 2XARA 5EW3A 4JG8A 4XRLA 5EOBA 3GCPA 4PL4A 4DC2A 3JRWA 5CVFA 3ZDUA 4IVBA 1OVEA 2ZDHA 5I5UA 4XEYA 3QU0A 3PP0A 3SDJA 3DK7A 4TNDA 4BDEA 5BWTA 2Y4RA 3P5JC 2W1EA 2VO0A 1Q4LA 3FLYA 4RMZA 3S3IA 4CV9A 1MQBA 1WBSA 1NVSA 2PE0A 3FMDA 4KAOA 1Z9XA 4FNXA 4DEIA 4RVTA 1KSWA 4BCKA 4M3QA 4DDIA 1JBPE 3H9RA 3KXNA 1M7NA 4X2KA 4QMNA 3RTPA 4P5ZA 3ZO2A 2YABA 3ORIA 3K5UA 4FV8A 3TM0A 4XRJA 4BY9E 4YHJA 4EH3A 4DFUA 4NM5A 1OKVA 4BBMA 2B7AA 4ZMEA 5JSMA 2I87A 4AZFA 4CFMA 5HD4A 1PHKA 3GFWA 4DBXA 2WB8A 3EOCA 4QMQA 4BN1A 4DH8A 2QR7A 2UZVA 2YIYA 3AC3A 5GNKA 2ZM1A 4PMMA 1KJ9A 3TV6A 5FEQA 5KMIA 2BIYA 4AXCA 4BZDA 2VV9A 5EM5A 2I80A 2BROA 4CC5A 1YI3A 2DUVA 3K54A 4JDHA 3AKJA 3H3CA 4J95A 3RMFA 3TXOA 4KSPA 1KEEA 4XP0A 2W06A 4YPDA 5EQEA 4AGDA 3QWKA 4JIAA 2P2HA 2V22A 4IC7A 4ZJIA 3HRCA 2C69A 4YLJA 3TWJA 1PRYA 2J0LA 4C4EA 4OBPA 4KINA 4YPSA 3PG1A 3SV0A 4MV8A 2C0TA 3FUPA 3Q52A 3F82A 4CKCA 2ZVAA 3AMAA 4NFNA 2UZNA 4RBLA 5ETAA 4YSJA 1MRUA 4DAAA 3ORMA 3OWPA 4AW2A 2W4KA 4FSUA 4GRBA 4YTIA 3VHKA 3RPOA 4B6LA 5I9VA 1R1WA 2R7IA 1EUDB 2V7AA 2VX0A 3NFFB 3Q1KA 3EN4A 5GONF 3EFKA 4K0YA 2ZV9A 3R8VA 3VN9A 3A7HA 3CQEA 5BUIA 3TUCA 3UYYA 4OT5A 5HQ0A 2GMXA 3PUFC 3QXOA 4QPAA 5ACBC 3MN3A 5IEXA 3GBZA 4FOCA 3UZOA 1KE6A 3TUDA 4FMQA 1ZOEA 2UVYA 2GTMA 4O38A 3KRRA 4L3JA 4RIXB 3VWAA 2C68A 2E9NA 2V62A 1KV2A 1WBTA 4M15A 4MQ2A 5BWRA 1YXTA 3EZVA 3LQ5A 4C4JA 3R9DA 2RGPA 3O2MA 4JT3A 4RLLA 4I0SA 4TN6A 3SD0A 4YAKB 1DM2A 3DBDA 4K6ZA 3V01A 1UNLA 3BEAA 5CAEB 3LMIA 2HK5A 3GNIB 5DR6A 4LL0A 4NKAA 4F0IA 2QCSA 3C4ZA 3POZA 4AZWA 3ZRLA 5JKGA 4MBLA 4QQ5A 3SC1A 3WE8A 3EL7A 4ZLZA 3WF9A 4F7SA 3OUUA 4L6QA 2CN5A 2VWBA 4YC6A 2PUPA 2ZDUA 4ZS4A 2JDOA 3I5NA 4CG8A 5C27A 4G31A 3FL4A 4PV0A 3OT3A 4A9RA 4FT5A 4J8MA 3E62A 3FQHA 4C4HA 2GLTA 2BILB 2C5XA 1K2PA 4EQUA 4KRCA 4U40A 4FR4A 1DS5A 2NYAA 3D7TB 3JVRA 1XJDA 5IQEA 2XJ1A 3LW0A 3QA0A 4OUCA 5AP1A 4U42A 2C6IA 3LKMA 3IW4A 5EYMA 4CNHA 2XK7A 4ZY5A 1E4EA 5DGZA 3VW8A 3WARA 1Z57A 3FEGA 4TKSA 4E4LA 3ID6C 3MESA 3F2NA 3PP1A 4Y46A 2GQGA 3QALE 4O7SA 4IQ6A 5IQBA 2J5EA 1OMWA 5BPHA 3DGKA 5E7RA 3ZTXA 2IW8A 1W98A 1GIIA 2GNJA 3TTJA 2WAJA 2ITTA 4F0FA 5IQGA 4AT5A 3QXPA 2ITXA 3QFVA 5LMBA 1ZY5A 3FLNC 3HL7A 4GMYA 4I6HA 4I6BA 3IKAA 4AW1A 3QLFA 1Y8YA 1GJOA 3MW1A 3UZRA 4ZQIA 4ZLOA 5I5ZA 1VBHA 5DN3A 3R7OA 3VQUA 4ITJA 3OC1A 2XK9A 4H36A 3TV4A 3OHTA 4FSRA 4FKUA 3DNEA 3R21A 2VTOA 4E26A 1AQ1A 2GS2A 4YR8A 2HXQA 4J52A 3UZPA 2A0CX 3ZYAA 1ZMUA 2ERZE 3MVLA 4FK3A 3F9NA 2E9VA 4MYGA 3QZHA 3UTOA 3W2QA 4F1MA 3T99A 3KRLA 3HAVA 3Q04A 1U46A 5D7VA 2GCDA 5EI2A 3W55A 4BCPA 4KABA 3KCFA 4X2NA 4RX7A 2YJRA 2J6MA 1VEBA 4ZP5A 2PVHA 3TCPA 2HENA 3W2SA 3W8LA 2R2PA 3AKLA 3U4WA 5LVPA 3DDQA 3A7GA 4ZOLF 5I9ZA 1TA8A 4NFMA 3CEKA 3LCSA 2CCIA 3MPAA 4K18A 4CVAA 2GS6A 3PY3A 4X2JA 1CQIB 5AAFA 4XG4A 3WF5A 1RQQA 3OW4A 1PJKA 2NRYA 3LAUA 4CZUA 3DAJA 2FPIB 2YZMA 5KS8A 3L9LA 4J98A 3SA0A 2R3RA 2XF0A 4Q5HA 4D28A 4X3FB 4AGUA 2J0JA 2YM8A 4YJNA 3FMJA 4LUEA 4FZFB 3AD4A 4U41A 3RPYA 2VTJA 3RHXA 1IOVA 1JNKA 4EOKA 3V51A 2E2BA 5L8KA 3PE1A 5AIKA 2XEZA 4CFUA 2C3JA 3LMHA 4CFFA 3JZFA 1JLLB 4XYMB 1OPKA 3OBGA 4EH6A 3E8EA 3LHJA 2WMSA 2PBZA 3CIKA 4O4JF 1P4OA 3ZBFA 5L8JA 4YU2A 4YLKA 3QYZA 3DNDA 3PIXA 2QHNA 3W0PA 3NVKI 5I9WA 4Y83A 2WHBA 1PY5A 3ALOA 2VWXA 4HVGA 2NO3A 5HCZA 4AW5A 5CEKA 4FZ6A 4MXAA 1YOMA 2R3JA 2UZEA 4RPVA 4I4FA 2HZNA 3VS2A 4J7BA 2JGZA 3DXPA 4BB4A 3OOGA 5AUYA 3CGFA 3G15A 4D2SA 2C6KA 1PYEA 4FTTA 4IAKA 2HVRA 4EOPA 4IH8A 5CAVA 3UO4A 3ZLWA 4FKOA 2XIZA 3QX2A 2FVDA 3P1AA 4BCGA 3CD8A 4DAWA 3CBLA 4BYIA 3V4SA 2BDWA 3ACKA 2IO6A 5CS6A 5CU2A 4ASZA 1EUCB 1Q5KA 2XVDA 3HZTA 5K3WA 3W2PA 3CR0A 5CEOA 5HBEA 1WBPA 4L44A 3HKOA 4CV8A 1REJA 3KL8A 4DDGA 4R7HA 5JT2A 5LCKA 3PUPA 4R5YA 2YCSA 3RK9A 4F65A 3FI3A 4JBVA 5E25A 4E6NA 3A61A 4C33A 3LQSA 3I0OA 4JBQA 3PN1A 4GH2A 5IISA 2XKCA 2ITQA 3AMYA 4S31A 2CGVA 4H05A 2W6OA 3I7CA 1H00A 1A48A 2VTMA 2P4IA 1JSVA 2OIBA 3FC1X 4BYJA 5E1SA 2WMTA 3N4VA 4JRNA 3BELA 3E87A 3RV3A 4HNTA 4EBVA 2W05A 4HYHA 1VR2A 4AZVA 3UO6A 1YHSA 3U55A 3QC4A 1B04A 4O4HF 4BKJA 4FSTA 4LV5A 4RIWB 4E6AA 4C5AA 4CKEA 4JBPA 1TQMA 1W8CA 2QOHA 2HCKA 2GS7A 2QVSE 4K2RA 3IGOA 3R7YA 2NNWB 1JKTA 1KT8A 3R04A 3MPTA 1OECA 2VUGA 3QCXA 1KE5A 3ZM9A 3TNPC 3QFFA 5C1PA 3FZRA 3II5A 3DDPA 2EXMA 3Q9XA 4E4MA 1M0TA 2QG7A 4E6CA 2Y4PA 2WU6A 3CY3A 3P4KA 3QTWA 3ZRMA 4EOOA 1YWVA 3Q5IA 3VQHA 3HB9A 2ONLA 1YW2A 1LEWA 3I5ZA 4WIHA 2R7KA 3LIJA 3OROA 4M97A 2PMOX 3BHVA 2CCHA 3ZSHA 4KIOA 1U5QA 4KSQA 2OJGA 3VULA 4FFNA 3CJGA 4BGHA 5CZIA 1LEZA 2GSFA 5AA9A 3MVHA 5JQGF 2F4JA 2IZRA 4DFXE 3PVBA 3HP5A 3F3UA 3W1BA 5GJGA 5KMNA 1GZNA 2YIWA 4F64A 4FTOA 4MXCA 5F1ZA 4EK6A 4E1ZA 5IEVA 4DEBA 4U97A 4FV0A 4DH7A 5DH3A 2HHFB 1ND4A 2B55A 3TZ7A 5IUGA 2WTDA 3BAAA 2OWOA 5IQAA 3R7IA 4IANA 4PDSA 1XWSA 4IB5A 2YITA 4ENXA 2PPQA 4DFYA 3Q4TA 3GGFA 1YHVA 2YDKA 5EI6A 4TYEA 3THBA 1GZKA 3K3JA 4GT3A 3NGAA 2BAQA 2GNFA 4FKRA 3FKNA 3ZO1A 4BICA 4GYIA 3ZSIA 1DV2A 4TVIA 3KMUA 3VW6A 3JVSA 5IH6A 5FUTA 1H24A 3M2WA 5D9HA 4O0SA 5E8SA 1YOLA 5HO8A 4LM5A 3F66A 2X6EA 3VJOA 5EKOA 3GLKA 1TKIA 2C3IB 3ODYX 4FV1A 3FMLA 1G8AA 3Q9YA 4NYEA 4K6NA 4MEDA 2JDSA 1OIQA 5E8UA 2OXXA 3R7EA 1XH7A 3I81A 2ACXA 5M51A 2JDVA 5LP6F 1BLXA 3QAME 1R0EA 3U54A 3WILA 4CXAA 2WFYA 4QP8A 4OTHA 3QKMA 4F08A 3PZHA 2OBJA 4ZHQF 2PVYA 1PMUA 2C0IA 4PP7A 2YS7A 4ALUA 4O7ZA 4R77A 4L00A 4ZJJA 5T3QA 4RRVA 3WIGA 5FP6A 4FSNA 5AP7A 2WTJA 4XG3A 3S1HA 5M08A 2RIOA 4GIHA 4JQ7A 2CPKE 5CWZA 5AP3A 4IAIA 4CSVA 1C30A 2R7MA 4YJTA 1QCFA 4G5JA 4O91A 5BYLA 4RJ8A 2VUWA 2BTSA 2C5VA 3R1YA 2YAKA 3BLQA 4FKGA 5DBXA 3R83A 2X5RA 3O50A 3HRFA 5CNNA 2HZ4A 3IDPA 3RP9A 5ANEA 3ZSGA 3PFFA 1QL6A 4TTHB 5DFPA 2W6ZA 3HDMA 2GQSA 2PZPA 2X4ZA 5IA4A 4G1WA 2BKKA 3WWHA 1H1RA 4PY1A 3KC3A 3KRXA 5EH0A 3QQKA 4DEHA 4QQCA 3QCYA 4GCJA 3AQVA 1I44A 4C61A 4UYAA 4FL2A 5J87A 1JSTA 1K3AA 5AV2A 1KJ8A 3BQCA 3T3UA 2CGXA 1HCLA 4UCVA 5DGHA 4J71A 4D1SA 2UZDA 4KB8A 5BPYA 5BPFA 3EHAA 3V5LA 3Q3BA 3PXYA 1G8JA 3R73A 5IUHA 3HMMA 1XO2B 1J3HA 4YTFA 2WMWA 3HMOA 4HCUA 2W6PA 3QCSA 1CMKE 2XUUA 2XALA 3EN5A 3HUCA 3O96A 3D7ZA 4QEBA 4UB7A 5DYJA 5IA0A 3C4FA 5CU0A 3P23A 2W6NA 3GDEA 2GNLA 4F7LA 3W0RA 3W16A 4E5AX 3C5IA 4QNAA 2B1PA 3UMXA 3BWJA 3R63A 4JR7A 4FICA 4QMUA 3KXHA 3NYNA 4GK4A 4TZRA 1CKJA 3BA9A 3OS3A 4TL0A 3AC2A 3PJ1A 5ITAA 1UU8A 3G2FA 3IONA 2DZDA 5CZHA 1Q3WA 4ACHA 1OL5A 2OU7A 4FIHA 2Z7RA 3TIZA 2CNUA 3UGCA 3UO5A 2XYUA 2WELA 1I1MA 2WIHA 3UNJA 3H0YA 2R3LA 2Q0NA 3RALA 3NUYA 3TTIA 3QWUA 1H25A 2CLXA 1M6VA 2WIPA 3F88A 2GQRA 1IRKA 4X3JA 2HW7A 4BCOA 3T9CA 4PNKA 2DYLA 4UN0C 3UC3A 4I5HA 3FMNA 4KS7A 3DCVA 4U81A 5M56A 4I23A 2ZOQA 2ZV7A 4PBCA 3A2CA 3L8PA 4JDKA 5I5WA 3ZXTA 3BWFA 3TACA 2R3NA 2QOCA 1PMVA 3BBTB 2C4GA 2W1FA 4IVDA 5HNBA 2X7FA 4W4YA 1T46A 4XLVA 4WSYA 3IECA 3ETHA 4DCEA 2BRHA 5AFVA 3O7LB 4IE9A 3DQWA 5JRSA 2OLSA 2GHGA 5CA0F 2RG6A 1HCKA 2SRCA 4YHFA 5ANGA 4R3RA 4AS0A 2QKWB 3FXXA 2VNYA 4FT7A 4RWJA 4AXAA 4BHNA 4C59A 4DG2E 4EKKA 5DG5A 5CAQA 3UQCA 4L01A 3SLSA 2OH4A 4DFLA 4HZSA 1OKWA 1VJYA 4CFVA 4F78A 3TW7A 4IX6A 1W0XC 3KRJA 4LOOA 4FZDB 4H58A 2XK4A 1H0WA 2VWVA 1KE9A 1R3CA 3A60A 3WF7A 4AWIA 2NP8A 3JY0A 1R78A 2OO8X 4AP7A 4EHZA 1X9NA 3MH0A 2PE2A 2XH5A 2PK9A 2CGWA 4ANBA 4MBIA 3GOPA 5D41A 3TW6A 5H8GA 4JQ8A 3PWYA 1AUVA 4BI2A 5AUVA 1H1PA 2O2UA 1PXJA 2RG5A 3QUDA 2UZOA 4RWIA 4TW9A 4V01A 4UXQA 1XMLA 3ZZWA 2COJA 5CA1F 4AGWA 5FBOA 4CT1A 5CEPA 4ZAUA 3QRKA 5EG3A 3A62A 3L9PA 5JH7F 4LH6A 2W70A 3KREA 3BPRA 3SG9A 5CALA 3FC2A 5E4HA 3GCVA 3BHUA 4MUQA 1Z2PX 1NA7A 1GAGA 1PXPA 2AC3A 2PY3A 3FJQE 4DGMA 2VRXA 4UCUA 5E9EA 3R28A 4AA4A 5AP4A 5FEDA 4MXXA 3ATSA 3P86A 1CS0A 4RJ7A 3D94A 1YI6A 2V0DA 3TJCA 3C51A 4G9RA 4YC3A 2VGOA 1GOLA 3DZOA 5CXZA 4IADA 1XR1A 3O8TA 3ORPA 2C6EA 3HLLA 3ORZA 5BVOA 3Q6WA 5HVJA 5FLFA 2OGVA 2BHHA 2VNWA 3OUNB 2BRGA 5JVDF 3NYXA 5KZ0A 4MXYA 4EL9A 2P0AA 3TEKA 4GG5A 2BAJA 2W4JA 1B38A 4CTBA 1BXRA 4JMQA 5JFSA 2XNBA 4AAYA 1SNXA 2HAKA <