3U56A

Crystal structure of mutant ribosomal protein t217v tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
228
structure length
228
Chain Sequence
b'PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTVMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystal structure of ribosomal protein tthl1 in complex with 80nt 23s rna from thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Rna/rna binding protein
total genus 71
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3u56A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u56A02
1CJSA 4F9TA 4REOA 3QOYA 3ZQJA 1DWUA 4QVIA 3U4MA 2HW8A 4DFCB 3FPNA 3TG8A 1U63A 1I2AA 1AD2A 3UMYA 3U56A 4QG3A 5DM60 1MZPA 4LQ4A 4QGBA 1ZHOA 5DM70
chains in the Genus database with same CATH superfamily
3PF9A 5EXSA 3NNSA 1GLGA 1QH8A 4OXIA 4XUCA 3FYUA 1CY1A 1VE1A 2ZXEA 1G8KA 2LPMA 3C1UA 4BB5A 4DSNA 4TLLB 2P62A 5LDDC 1GTG1 2JGFA 4QOHA 3EN0A 3L4BC 5C1OA 3RARA 3ZU3A 4FE4A 4B17A 5HFAA 4E5NA 1PT5A 1CUEA 4AZVA 2P0EA 2XIJA 4LQCA 5H02A 2QTWB 5I9IA 1LLCA 2K7ZA 5DTJA 4Z0PA 3UFXB 1SD2A 1W4BA 1H3NA 4L4SA 4D6PA 2QXUA 1J4AA 2J4FA 3LP6A 4IF6A 4DBVO 1VSTA 1XDSA 4ZVPA 3DLCA 5KYYB 1LSJA 4MYUA 5HP4A 1GL9B 2AZXA 3DMTC 4TVBA 2NYVA 3NASA 4G5QA 4R1LA 4MUAA 2COEA 3UZUA 5K0GA 1QRRA 1PVDA 1J0CA 4IH9A 1Y3BE 4M86A 3WQHA 5IS2A 3GJRA 5F9HA 2JJ2D 3NI2A 4LOAA 1X9IA 4DSAA 2O8DA 3EQ6A 4CE6A 2QRNA 5FXMA 7ABPA 2Z58A 2WZCA 4BLTA 3D0RA 1LSSA 1M2NA 5A06A 4OHYA 1EUCB 3ZTYA 4B7UA 1KEWA 3OZXA 3Q87B 2ZIZA 3A6EA 4NNPA 4EFLA 1GRCA 3KM0A 2AG0A 3O3CA 1DPFA 1QO9A 4IEEA 2ZB3A 1PW5A 5HKOA 1Z8FA 4O2AF 5JU6A 4OQQA 4JC5A 1Z5VA 4GP9A 4L15A 2IYPA 2QNIA 4BLQA 3QV2A 1PAUA 4EB3A 4F8YA 1T1JA 4U6SA 3VH2A 2CE7A 4ZV7A 1ZA2A 3FI9A 3I0ZA 1ZSYA 1CQJB 3EIWA 3SD7A 4RXTA 3CNHA 5THQA 1OBCA 5EZSA 1L4MA 2E49A 4KYIB 3GLFB 5EP1A 3SEAA 3H84A 5C7LO 4C89A 1JEOA 1SRQA 2YFYA 3E9EA 3KWFA 5EHGA 2F1JA 4MICA 1N6IA 2AB0A 2VH5R 3KSRA 2Q3JA 1NLMA 3E22B 1E79D 3EW9A 5L3ZA 2IU3A 3HY6A 3DTYA 1IOVA 3NIDB 4IQ4A 1MCZA 4PPQA 4R4JA 5DHFA 2J0UA 2M6SA 2XMBA 3OAAA 1FVOA 1MAHA 1U0EA 4RJTA 3ZWCA 3MA0A 4LHXA 4WOBA 2AWNA 1PTKA 1A4IA 1QTRA 2HGZA 1E66A 2C2GA 2P2SA 2XMZA 4XIFA 1D0SA 5IYZF 4DJ5X 4ZTZB 2DLCX 5LJIA 4FMDB 1QBGA 2C0PA 1FQOA 3T1NA 4F9GA 2POQX 2MR5A 4B5KA 5L7YA 4Z49A 2H5LA 2RHLA 3ASUA 1D9ZA 1QLHA 2FSSA 1U3FA 3AHDA 4N0QA 2N3ZA 3ZDFA 4EKEA 4AWBA 4KR6A 1HUQA 4XR9A 1KMCA 4IDHA 3DDOA 3TLAA 4YAJA 4TV9F 4C76A 4FQ5A 2BMDA 5D8DA 5TQVA 1WJGA 5LLTA 5MF6A 4YQEA 3EXEB 2B25A 5TY0A 5LXTB 1J6UA 3KJNA 4M7PA 4CT4B 1HOXA 5J2UA 5EVJA 3RAFC 2FW8A 1OV4A 1EK1A 2YVAA 4L50A 2CNWD 4M1YA 4RESA 1K4KA 3LCJA 5EA2A 2QTVB 2F59A 3HB0A 4R2HA 3C7CB 4RD6A 5AUQA 1AN0A 3TGPA 4KIJA 3BMCA 3IKLA 3VHLB 3ESAA 1AG9A 3ZWVA 3DXXA 4U63A 2AOXA 4ZI3A 3QE9Y 2ZU0C 4WK4B 1FX1A 3S2SA 1S1CA 5AI9A 3ZCTA 4NBLA 1G21A 1Q95A 4UNSA 4CDMA 2EQ5A 3DDCA 3F5MA 2JLZA 3LKBA 5AVJA 2QMHA 1N5LA 4GSYA 4IBOA 4X7BA 1A7AA 2OMEA 4RWEA 1G5RA 2HA0A 1V1RA 3TKLA 4B74A 3JVIA 1VL2A 5JASA 4C6SA 3VNAA 3MRVA 5KKCA 1U7TA 5AKXA 3IXQA 2J45A 2O2JA 2V63I 3CIFA 3JQDA 3UO8B 2Q0QA 1UKEA 4DDTA 1E7RA 1JHOA 2COKA 3BZUA 5IKOA 1N75A 2JLSA 3O8OA 1XAJA 2CNNA 4KXLA 4EB6A 2IIVA 4QDZA 2OCKA 3RDPA 3IR7A 1EGMB 4Y2HA 3T34A 3FN4A 3SQDA 3PLAE 3HB9A 1ISSA 3R0QA 4GZMA 2BZ1A 2H92A 1FP2A 3QPBA 4G8BA 4O2LA 4TYQA 2HPZA 3DWEX 4XDYA 4KOEC 3HN7A 2D4HA 3FVQA 3BMOA 2Q5QA 4L8FA 3W2GA 3LM8A 4LYGA 2LCIA 4E2YA 2HW8A 3H5AA 3P9SA 4BYGA 2R9VA 2Z9CA 4XZ3A 1GAXA 1GUYA 3FKJA 3I6BA 4MQUA 2CFOA 5I7EA 5K6AA 3VYRB 4LSWA 5A9SB 1ZK3A 1TAHA 1A9RA 2B8NA 1UWKA 2EDCA 1U3VA 3E4DA 1H8HD 1JQ5A 1VLVA 3M1LA 2DJ5A 4G24A 4HH3C 4I9NA 4DZRA 4E2XA 5CD9A 3F8WA 3ELBA 1B8NA 2EJUA 5ALTA 3UCFA 2FMUA 3WL6A 2CXQA 2BN4A 1A04A 3G2NA 4A6XA 5BYKA 1GSOA 4NZNA 3S28A 3KKQA 4MJLA 2CLMB 1X7GA 3GPCA 2C07A 4MITA 3AESB 1FSGA 3M6XA 1IAVA 3PLRA 5CPBA 1C7FA 4CIAA 2HLDD 1ZL0A 1RQLA 3REGA 2CYBA 3SSMA 2W6QA 2ID4A 1VMAA 3PWSA 3T1QA 5KQPA 2D0DA 1KDRA 1ZVQA 3PR3A 1JU9A 3V9PA 1FE8A 4IX9A 1XDBA 3DM9B 4E5VA 1V8BA 2FUKA 4YJKA 4DA6A 4B0PA 3SZOA 1EM6A 1Y3DE 2WWVD 3WRYA 1BDMA 3CW9A 3IT1A 1YVPA 1FMTA 3UWKA 4L73A 2OECA 3MC1A 1C1DA 3QF4A 2WUVA 1FJHA 1K27A 4H7IA 2O7NA 4OKNA 4ZU6X 1P18A 1YVDA 2RBEA 2FW7A 3MSXA 2SCUB 3IP7A 1IC6A 2NU7B 3U0BA 4YJFB 1QQ5A 1P0QA 3RVDA 2RBKA 3PHJA 2FWBA 3ABQB 3DBHB 1N2BA 4I6EA 3DD1A 4JQCA 3CLVA 3RSGA 3C7KA 1N6KA 4FNMA 4YRMA 1G8HA 4F3YA 3SMQA 1ZZEA 2WJIA 4MCHA 2EEPA 3C2QA 2HT6A 4TVSA 1G4AE 1IBCA 3JQ7A 5F52A 4E5UA 2VXOA 1DWPA 1M6WA 4L2IA 4D9GA 5BSEA 1CZOA 1ST2A 1U1CA 3E9CA 3C3AA 5JNVA 2W6ZA 1U9ZA 1W25A 2D1QA 3K0SA 4O1IA 1H3FA 1QAOA 3H2YA 4RZIA 2Q3CA 2HRZA 2WHRA 1P61B 3JYOA 4LOHA 2I1WA 5ENDA 3UMJA 3ZC3A 2G1PA 1P2BA 3OPVA 2GAIA 1NNEA 4UEJA 2YX1A 4WOKA 1ZWKA 4HX5A 4G84A 1J06A 4KYUA 4WX2B 4ND6A 1ECGA 1K88A 5ECWA 5T4FA 2W2MA 3SWWA 4F5ZA 3NBYC 2OCDA 3PUIA 2PT5A 3R7WA 3DXZA 4O4IF 4EPRA 4EVRA 1K8RA 2ZYRA 1PLKA 3TTUA 2HA4A 4HB0A 2Z0MA 3HJCA 3PD7A 5EIBC 4JXZA 1E0DA 4ME6A 4D7AA 1QVRA 2PUAA 1CFZA 1EFHA 1U7PA 3R0JA 4OHFA 1K9SA 4AXXA 1AMNA 1PZNA 2WWYA 4WESA 5KCMA 2VJOA 1C29B 2RONA 2DOKA 4AIIA 1RPZA 2VC2B 2XMPA 4KPUB 3WLKX 5B7GA 5IBCA 2F6RA 3RROA 4KUEA 1SG6A 2ONZA 3UPUA 5B37A 2QPOA 4IS3A 5IK2D 2UVQA 3A3PA 2FEAA 2XW6A 2IRWA 3V1UA 1N2ZA 1KFJB 1JDNA 3DEZA 2BTQB 3A0RB 2ZR8A 1D8TA 4RW0A 4E88A 1Z25A 2VHUA 3H17A 3JQGA 5EYPB 3H2GA 5AW0A 1CDOA 3PYLA 4FSDA 3K53A 3WHIA 5JEEA 1G5QA 1SAYA 1UWAC 1C1YA 1X8LA 2PL9A 2ZTHA 2TS1A 1DP4A 1XJQA 2ZBUA 3MJFA 1FUEA 4I5FA 3WGKA 2VTVA 3GJ7A 1RLMA 4K9RA 5SY9A 3R9KA 4DSTA 2WA1A 3A4IA 3CLRC 1YRAA 3T7AA 5LA6B 2BFDA 1ZJYA 3GOHA 2GBCA 1BZYA 2CXNA 4J3FA 4D0RA 3A9CA 4EY7A 4NFLA 1JFFA 1M2JA 1BAPA 1QM5A 3CZ5A 4LJLA 1HM5A 4PZEA 4TXJA 2YUIA 3UMFA 4AIRA 2VNHA 2QP9X 2I33A 4N6OA 2ZRDA 1N1GA 4RFSA 5A4KA 3H0CA 2QSYA 3H0KA 5IULC 4ZDIA 1P0FA 3BS4A 2Q2VA 1XEFA 5K6AC 3GC6A 4P54A 5D3MB 4TM7A 1KS9A 1PI3A 1LDEA 1JTEA 1XTVA 3E2PA 3L8EA 5KJEA 2V97A 4ALLA 1KQOA 2G07A 4HNHA 4WZAE 4LZAA 2ENWA 3QBDA 1D6JA 4LMAA 1VIYA 1QGZA 2VYFA 1RT9A 2YVQA 1EUDA 4INPA 4F4IA 5KNBD 3OT5A 2H2HA 3KJIA 1W0KA 4KUGA 4GXQA 1BKDR 1ZN9A 2R68A 3FM9A 3NOOA 4PO3X 1U9CA 3AVWA 2O0KA 3HYRA 3ZY5A 4NSNA 4W5TA 1FFWA 4ZHQB 2VNKA 3IHTA 1AB6A 5LD2C 3WWEA 3F6PA 3ZV3A 1YB1A 1AXGA 4LOIA 1YQWA 5DNWA 4EW6A 2O2IA 1FDIA 1XV5A 3HPQA 3T3PB 5T7BA 1SOMA 3HRKA 4OMUA 1DWOA 1YU9A 3WGQA 3KWJA 3H9EO 2LCFA 4KFUA 1FS6A 3BWYA 4YYZA 2XAAA 4LYDA 3SN6A 1DIAA 3NETA 1ZXLA 3ROQA 4JWTA 2JI7A 1DCTA 5A3VA 1SC4A 3TECE 1JKJB 1SRRA 1HYQA 3QUBA 4OQ4A 4E2FA 4A0RA 1V5GA 3OCWA 4AMGA 3DCYA 5TR9A 1J97A 3NBXX 2ONYA 3DL4A 4K5QA 3SLGA 3EK2A 4REOA 4N6GA 4MW9A 4P93A 4MCJA 1JG4A 1D2EA 1AUSS 4D97A 4QLBA 5BSFA 2QD3A 2XUDA 3FPJA 3ZWDA 1R0RE 5KHLB 4KNYA 2PZAA 3OA2A 4NI5A 2V3VA 4FLMA 1VL1A 5I8WA 1K63A 4RD4A 2SNIE 2OPBA 3LUKA 3FOEC 2QQEA 4BMNA 2GD1O 2BGWA 1ACJA 1KC1A 4QVKA 4WCVA 1Y1LA 3V4OA 2JFOA 2XWPA 1A2KC 3U56A 3RRXA 1PL6A 3WGTA 3A32A 4FDTA 5TPWB 3B85A 2ZUUA 1NNUA 1OTHA 1OXTA 2C9MA 3G8DA 5GOZA 2BFFB 4P2GA 3ETGA 4IFIA 2HPAA 4WZZA 2X5OA 1C41A 3PCTA 5BN3A 1D1SA 1SEPA 2HL6A 4WQMA 2IPXA 3QPVA 1QG6A 1GAQA 5AKKA 3UW3A 4OHBA 5FTLA 2VVTA 1BXNI 3VISA 2H4WA 4X90A 5A4DA 3ECAA 5KYXB 5FOUA 5CVTA 1ZBQA 1KVRA 1P1FA 4FYMA 4Q12A 1XWFA 4Q4DA 1XL0A 5D7NA 4KPYA 3DEKA 4AO6A 2EFJA 1R15A 4IEFB 4YRQA 3GPLA 4PTZA 1ZR2A 3LC0A 5DW3A 4YPOA 3VFDA 2CL6X 1MGPA 3EHDA 3LH5A 2XJ9A 2YH2A 3HLYA 4OX9Y 3L6BA 5AKJA 3OX3A 4P33A 5TRTA 1TJ4A 3VHQA 3E18A 3TZHA 2JHPA 4JFAA 3HEMA 1TZKA 4O4HF 2ZI7A 1E0JA 3GPBA 3M7IA 4EHJA 3KFXA 3X1DA 5HSGA 2GZRA 2A9JA 5D86A 5CB4B 2BR4A 2B98A 1ZEMA 2LRHA 3BD9A 5TX7A 3BXEA 5LQSA 5ITSA 1IN7A 1PKXA 4DNPA 3QVKA 2DWPA 4RV4A 4FT4A 1XRQA 4IS2A 3WLNA 1L4NA 4MEBA 4P32A 4TKUA 2OZLB 4YMSA 2NU9B 1SCAA 1Z2PX 4HQNA 2PUVA 5HOQA 5JJIA 4MPDA 3M8KA 4Z9AA 1FC0A 1R6UA 4ACBA 1ORIA 4L72A 4U6QA 1W4LA 5KVAA 3ZX5A 1A9XA 3F9RA 1VG0B 2QJTA 4AROA 1OKKA 1PT9A 1XK6A 3OJLA 4C20A 1RRKA 2HXGA 3NUZA 3QVGA 4XDHA 2QRGA 4LC9A 1PHRA 1P4JA 3IJ5A 2ZRHA 1XJ5A 3B1WA 2XEXA 4JSTA 2ZYIA 3E23A 3RS2A 1AUVA 3K05A 5CLQA 3EDYA 3IJRA 3MBIA 4X00A 1A96A 2WAXA 4DNXA 5KTOA 2OQ2A 3GDHA 4GVPA 3ZKWA 1JDZA 2ZSKA 3NALA 4GLOA 2ZRGA 4Q7MB 3GLGA 1GSHA 1RQPA 3E84A 3FJOA 3KIPA 1V2HE 2BMVA 1GZ5A 4FHZA 4HN4B 4ZI7F 1R4MA 5EPUA 1MX5A 3ICEA 3M6VA 4KE9A 2WNSA 3CU5A 4HGOA 1WF6A 4CG1A 4EGAA 2P6OA 4DDUA 1R9JA 3QFHA 3V7WA 2H8GA 4YK7A 3ODGA 3ZGLA 3D31A 2HXSA 1MB2A 4XD7A 5C3UA 2O2HA 1OWPA 3FWPA 3RSCA 4U4AA 2AFHA 3SHWA 4WEQA 5KSZA 5LBTA 3LL7A 2V7QD 4WHMA 2WYUA 1L3BA 3VXKA 1OXMA 4AJ1A 1PK8A 2CCJA 4LFAB 1UR5A 4BRZA 3RYHA 2Y99A 1BWVS 1W4AA 2AF4C 1UPBA 1G9XA 4IZ6A 5ARBA 4OTZA 2XDQA 1G8GA 3IV9A 2V45A 4Q5IA 4ZXPA 2AGVA 2XODA 4PYIA 2G9NA 1OGYA 2DKNA 1QMGA 4A0GA 2G7MC 4RTOA 1Z2CA 3AZQA 2DWUA 2IYQA 2JAXA 3GRZA 5KYWB 4JI7B 2W90A 1ZGGA 4KIWA 4M54A 3GA5A 3RYCA 1KFKB 4IVRA 3RJ5A 3N6RA 1U2EA 4YCSA 4MI6A 2Y8EA 1WCIB 2Z2IA 3HWSA 1FDRA 2ZYTX 1WU8A 4H0FA 2B35A 1S4QA 2FG5A 4YDHB 5CBPB 1U7UA 2GHIA 1BRTA 1FF9A 1G6Q1 4UE2A 3O21A 3DAPA 4ROSA 1K92A 2QMOA 4JFRA 5K3DA 3A1CA 4HLNA 3B78A 5KNCA 1K7SN 1N2XA 2G7ZA 2I2XB 2Q6TA 4ZAXA 4ZZ1A 2YWJA 3M1AA 2YV3A 3DFIA 4L8GA 1G2IA 3DDHA 4YMHA 3KJFA 2AI3A 1N5JA 3R0ZA 4M0CA 4F4HA 2CK3D 4B2IA 4B3XA 2JD2A 1JDJA 1G3QA 4RK0A 5DLQC 2FUNB 5JC1A 1NURA 1V96A 3DNPA 3PT5A 4RE6A 4ZQHA 3ZXXA 2CC2A 4L6CA 2BGIA 2O59A 2EZTA 1JHRA 4PSDA 5CX4A 2FP4A 4BV8A 5L4LA 3RUEA 1QQTA 1E8NA 4FCVA 1KPIA 4IMRA 3LY8A 3OLZA 5FUVA 1AQ6A 3GPDG 4KAFA 4PFSA 1QONA 4R9RA 5FFNA 3S2GA 3EA4A 3MLEA 3ETDA 3QIVA 5CM9C 5J47A 1G4HA 4NVRA 3R9WA 4PPNA 3OECA 1X7YA 3OKPA 5F3RA 3HJGA 3TCXB 3UJAA 1ZD8A 2QE7D 4QARA 1OFVA 1YUNA 4REQA 5K3AA 4GOMD 5EQTA 3IAS6 4OHVA 3U5TA 3V1MA 2QHXA 1BGXT 4IGAA 4JVMA 4UJ3A 2FRDA 1KEKA 4RULA 2Q2WA 3A14A 3WNZA 3CBQA 5I51A 4Y7CA 3LX6A 2GBFA 4QWMA 5CW2A 4OCZA 4PRZA 1XQ6A 4NBKA 2C88A 2G9UA 4G4IA 5JY1A 3WLPA 1E2IA 2WWIA 5BN4B 2C2WA 3GEPA 3IQFA 3WAJA 2QENA 4IFBA 2FB9A 3U26A 1FP6A 1UC5B 2GKOA 2GEKA 4F72A 2XA1A 3CX7A 2VS1A 1XTRA 4Q7EA 1JIQA 3VC2A 4WEOA 1P44A 1VHJA 1NVVR 4OXQA 2OCPA 3UANA 2PLRA 4IJ5A 3RASA 3O8BA 4G41A 4OM7A 2O3QA 4NCIA 3IIIA 4RJLA 3BEDA 3HBAA 3ZV4A 2CV1A 4GQAA 1R9MA 1M2VA 4PCAA 2VJBA 3CZQA 1U0BB 3OPMA 4YRDA 3I9OA 3IT0A 3HJUA 4CUKA 2P65A 3Q3HA 2OC4A 4HNSA 4M4SA 2YDYA 4C87A 1L4KA 3C3PA 2IEZA 3HVHA 3ZTWA 1T9KA 4KDCA 1W88B 3ZY3A 4W1SA 4R41A 2I62A 4UAJA 1P7ZA 5FRDA 4RK1A 1GN8A 1ZOSA 3JPWA 1OZ0A 2WWFA 2F8TA 1J2JA 3ONFA 1E9SA 2L2QA 1TD1A 4KQKA 4XIIA 1IONA 2BI8A 4HQLA 4QTYA 4NMHA 3W9BA 1W5SA 1UDWA 4PQFA 4EA7A 3MCWA 4GBJA 4XLTA 1UXKA 2PNFA 3RS8A 2W71A 3T5GA 2DWOA 5F23A 1ZAYA 2GN2A 3AXTA 3E53A 3E9QA 4PAOA 5DXJA 3I6MA 4XQGA 3SR4A 3VH3A 5AW1A 3O93A 3JV7A 2QN1A 4TKVA 1DEHA 2IOFA 4RAOA 3DMRA 4O4LB 4LYHA 2JIPA 3N9IA 5AHKA 2B4YA 4RTSA 1VDMA 3A10A 4BLSA 1J5PA 2Z09A 4PRLA 2FPSA 1NQXA 1RABA 5K8TA 4KL8S 1DAGA 1QZZA 1GR1A 1XGKA 5L9AA 2O8FA 3KYDA 1YBMA 4FC6A 4IG9A 4JYMA 4AJ4A 1POWA 1N3LA 1W48A 4CLHA 3A9TA 1C9MA 1G5TA 3E3AA 5KEIA 2KJQA 4RMHA 1SUDA 4OV6B 2PX3A 2WM8A 3F1LA 5I5EA 5K8LA 1XCJA 1LY1A 4J16A 4PPGA 3R7LA 1KS2A 2CT8A 5JLJA 2GRUA 4TZTA 2BMJA 4QICA 4CM4B 3R0IA 4MPTA 1F8GA 4DT1B 5EMJA 5JTTA 4CM8A 4R9NA 3ZE0B 5KINB 2B9VA 5HKKA 1TLFA 4MH0R 3DG9A 1Z12A 2WJHA 5CX1A 4QTZA 2LTAA 1KR5A 4U7DA 1XTKA 2ZW9A 1I3NA 3C7AA 3RHZA 1P62B 2CXSA 3A6ZA 4HQRA 3BFVA 3SJCA 5I3ZA 2BVNA 3IMEA 4JT4A 5JI2E 3SZRA 1GPYA 4R7ZA 2Z95A 5HRCA 5B4UA 1G7RA 2VI5A 3L01A 1E5DA 1U1FA 2YYZA 2A5YB 2ZAYA 3HYLA 4URFA 4BMCA 4BFLA 3FWNA 3RVPA 4C78A 2B2XA 3LCVB 1AHPA 4RTJA 4GL4A 2IKQA 1MB0A 2DE0X 2EKLA 4LTNA 4M1ZA 2OENG 4CIDA 2WU1A 4I19A 1UPXA 3VR4D 3GBPA 4TUYB 3ZHZA 4JUFA 3KEMA 4J94A 2HHCA 1E3MA 3EAQA 2UYOA 3ZJYA 4DE5A 5DX0A 1HT1E 3KJEA 4OQMA 1ORRA 1QH0A 5FTNA 2V1UA 1JMVA 2NAPA 2PX2A 4MS3B 4F3RA 4JOBA 1UBOS 1ODJA 2R5NA 4JBWA 3VR5A 3OKAA 1O94A 4G5SA 4RPCA 2JLVA 1E4EA 3ETNA 4AZ3B 1ZCFA 4KW7A 1EP1B 4FYXA 3ZGNA 1D7AA 3RS4A 5L6MB 1VHWA 3K70B 5D1HA 3WWDA 4Z54A 1QQ7A 2LCQA 3TD2A 4RBNA 4WL0A 3LO8A 2PT9A 2G28A 4L22A 3T52A 3TDNA 4CMKA 1USUA 2W93A 2FDXA 2XMDA 3EIQA 4IGEA 1VE7A 3S2ZA 1YB4A 4Q16A 4QQRA 3WIDA 2GCOA 2AV6A 2D2EA 2ZTLA 3JVVA 4EGJA 1V39A 2H4ZA 3A25A 5EJGA 4D9IA 4E21A 5ICGA 1CYDA 1ORTA 2F7SA 3DAGA 3I52A 4W63A 4OBXA 4CM6A 2VXBA 2Q4OA 1R50A 2E4VA 1CS0B 3D6MA 1RVDA 2ALJA 3GRKA 3K0FA 2Y6UA 3PVZA 3WX0A 4CBVA 1NXTA 3W3ZB 3LCCA 4NCNA 2F64A 1ZISA 2H1IA 4MDEA 2Y27A 1P6UA 4BZZA 2GOYA 2C82A 2UZIR 1A71A 2C97A 1G17A 1H4SA 3AUSA 4KUHA 4D42A 2FMHA 1IM8A 3PQEA 2PEZA 3OZFA 4J49A 3WC4A 4DS3A 4PZ0A 3UCXA 5LB2A 1ID8A 3BJIC 1K9VF 2ET6A 3GVCA 4ZO9A 4DJAA 4AY4A 4N3AA 3UMYA 3PI7A 4UOQA 4P0PB 1L7QA 3U09A 1X0XA 2GK6A 5DBGA 1G8PA 5T3YA 4NBRA 3LMKA 4EG3A 1N2GA 1U7OA 1FA9A 3H3JA 4P7BA 3AEKB 1GZHB 3LT1A 1KFEB 3DYBA 3SYNA 2DLDA 1FYXA 1NE7A 4GPTA 1GRQA 1QHHB 1X7DA 3DZJA 4BO3A 2UVPB 3NKVA 2YR0A 2H2IA 3VPXA 3ABZA 5FTJA 3PC6A 2ZCVA 3WLOA 1QJ4A 1RLTA 4PNEA 5HS6A 4HDNB 1IWOA 1PV1A 2C2BA 1QFYA 1JA0A 2IBMA 2YOGA 1OFGA 2WYVA 3AHGA 2FR1A 1KKLA 4OGGA 3EJ6A 5JQGA 4AD8A 3SDSA 3UMGA 2GN6A 4P36A 2W70A 1SK9A 3S1AB 3QYJA 4NG5A 1BYIA 3CRQA 2GEUA 3X1YA 4B4DA 2A5LA 4JGBA 4Y6LA 2BIFA 3PS9A 3QBJA 2Q4DA 1HLPA 3WK7A 4KQCA 5E4FA 4ZEXA 4BOYA 4JIMA 4MS4B 4GPIB 4KQ1A 3S29A 3PQCA 4BU0A 3WICA 5KPJA 4J16C 2IF2A 2HIAA 2FRVA 1N8TA 2PUWA 1N0IA 1SU4A 2GDJA 1EI9A 1GEEA 3EZ7A 4MKHA 1Q7TA 2FPPA 3PI6A 4U2BA 5ELXA 3TTSA 2P9EA 1E59A 4RK5A 4ERNA 2V6BA 4OJMX 1YMUA 2PWYA 2CEAA 1GCOA 4JP3A 1XRRA 2HYDA 2WSSD 3OIVA 3QJYA 4KXFB 4B33A 2P40A 5EJ9A 1DQRA 1O2DA 1M33A 1T6XA 4FOSA 2HWYA 3UK0A 3WJ1A 4ZCMA 1GL3A 3SZ3A 5LPNA 2QTRA 1CLUA 4Q3OA 1S2LA 3GWZA 5CAEB 2BMEA 5D00A 5DBFA 7GPBA 5KO2A 1NVUQ 1E1CB 5K5EA 3ZLBA 5A9RA 1JIXA 3RQIA 5KYGA 1BS9A 4ER6A 4ZTUB 5ICSA 2OGUA 2P3LA 1B2RA 4H6XA 3VC7A 3KQVA 3EPHA 1P2TA 1J1ZA 1INLA 1YJ8A 2F90A 2EWWA 1HMYA 2ZR9A 3O9ZA 2R3SA 4BZQA 1U31A 4MO9A 3LC2O 1EFUA 3MPOA 4S05A 2WKRA 3TVTA 2RGEA 4YYEA 3FH0A 3MM4A 1NNI1 4HGNA 1XEXA 7MDHA 1FFSA 3ORQA 1D0VA 3JQAA 3O9MA 4I2VA 2DHRA 5AK0A 2I6TA 2QT0A 3HSKA 4I66A 3L1HA 4OYHA 1J7KA 2O2DA 5C80A 2B6NA 2IZ7A 2Q46A 2QMZA 2ZS8A 1NQOA 4K3UA 3W6ZA 3A27A 3FPCA 2PGOA 4DLPA 3ZD9A 3P71T 2AZMA 2ZAMA 4AMZA 2TRSB 5ITZB 1OA1A 1W85A 3MUFA 1FJGB 1KHHA 4F7WA 1D2GA 5LQCA 1BG6A 2J7PA 4IJ6A 4UU0A 5IWAB 3IEVA 5A0TA 3RS0A 2BKUA 2RGWA 2PBRA 3THXA 2QNBA 2YWGA 2OYRA 2D2FA 2H3HA 3CRW1 1S8OA 1VTKA 3G6KA 1JIUA 3JQFA 4QT4A 4QUHA 1Z63A 4GC5A 4DY6A 3R7SA 3K1AA 1PZMA 3DVSX 1T9GR 2XNJA 5EKTA 2GJ8A 3LDGA 4N54A 4PZAA 1C0KA 5DRTA 4G0WA 2YN4A 4W8HA 4HMPA 5B30A 4MA5A 5LOVA 2GR9A 3C3YA 3WL3A 1VYHA 1ZH0A 1EHIA 2BL4A 2DY0A 3QELB 4P35A 1DC6A 1D03A 1TO2E 1EX1A 3IVGA 4CIWA 2FSVA 4Z6KA 1KJYA 2DSNA 2O2CA 3E81A 1EESA 3PU6A 3MW8A 1E20A 1FX0A 1PFVA 1XVIA 4W5HA 4OK5A 4EX7A 5JYBA 4OJYA 5DI3B 1GITA 2C7QA 1PZEA 5DIFA 4PIPA 5EC8A 3UAGA 1VOTA 4XYBA 2WWHA 4OLHA 4RHUA 3I62A 1KAOA 1ZM2A 3PLNA 2LW7A 4JT8A 1OT3A 4S1WA 3WE7A 3DLIA 2XYGA 3QPAA 1FU7A 4IUYA 2D7CA 2HCBA 1SC9A 3O0DA 2GPWA 3QUTA 2CY0A 2P4UA 3EIXA 4ARBA 1C9DB 2PX8A 5KYVA 3ZQ6A 1Y4AE 4B73A 2JGDA 2PLWA 3C5EA 1OA0A 1NX6A 1D5WA 1NXSA 3WGVA 4ENRA 5J1SB 1YACA 4KXMA 3A3KA 4XFKA 1T2UA 1T36A 3TCKA 3QPDA 2JH8A 1QTIA 3DEIA 1IK6A 2NTEA 3QTTA 4YC7A 3LQRA 1Q7BA 2GH1A 3AEUA 3MMSA 5CK4A 4ALIA 4ZJZA 1OLSA 3TR6A 5E6SB 5EZ5A 4NJMB 4U8GA 1C7QA 2N75A 4RZUA 3LBYA 2A8YA 4X6UA 2VZ9A 4XGNA 2LGJA 2DUMA 1XVAA 2HT1A 1JWBB 3WSVA 3IHKA 4M60A 5CFPA 4FGSA 1FK8A 1G7CA 1G8MA 1TA0A 5EP2A 1JG3A 1PR0A 2JGMA 4MKIA 4ARZA 1ULSA 3P0JA 5IKXA 2I4NA 3ZG6A 1X1AA 1O0SA 2HNBA 2R25B 3LP8A 1E2BA 1C8KA 2UYQA 4ND4A 4PSVA 4QECA 5IT0A 1KNXA 3L93A 1T1GA 2GCIA 3CO5A 3EMBA 3UWMA 2R751 3ZWKA 3EIEA 3ILVA 4YP0A 3HEBA 3DBRB 1JQ3A 1Z13A 1ZJWA 3KQMA 5DTQA 1TVKA 4BNJA 1PYDA 5FV7A 1ZD2P 2XLBA 4M1MA 3TLGB 2FW1A 2CLSA 1NW8A 1NVGA 3FBTA 4B7XA 4JA2A 2GO1A 3TD6A 3I0NA 2FUG1 2LV8A 3PGJA 1J42A 4NK5A 5JCZA 4RMJA 2OKCA 3BGDA 3FTNA 1DBSA 4JI3B 2JBAB 1YDGA 1BDHA 4GR5A 4PQEA 4B3CA 1NZFA 2X58A 3K8QA 4AX8A 2RHGB 4C2UA 5DWVA 2QD1A 4CYMA 2BSXA 4BQEA 3SIWA 3I39X 3PQDA 4Y2PA 2QI9C 3ZE6A 4DNQA 1CBUA 5GM1A 3ELWA 2A0FA 3A1TA 3CKMA 1ORDA 4HRVA 1VPWA 4XWKA 1Q19A 3IDZA 2OBBA 3LHKA 4RH3A 4PG8A 3IVCA 1FUIA 4KIUA 1MAVA 1K7FB 3OIUA 2IY9A 3E9DA 1LPSA 2H1RA 3C41J 3EGXA 1GKKA 3PIIA 1AXRA 3AP3A 3B13B 2ZRPA 3AXMS 5LB4A 3VR3A 4PBRA 3TRHA 1O77A 3P0FA 1O6BA 5F1PA 1I7QB 2ZRCA 2ZB7A 5FHQA 5KYTA 5KOYA 2K87A 1X39A 3VKGA 3BCSA 4JUIA 3THWB 3L1JA 4K1LA 1EBUA 3G85A 4ID9A 3T9CA 3AT1A 1H5NA 1PQPA 1YQ9A 3ONVA 2PT7A 3P97A 4ABYA 1EGQA 1HFJA 3TX2A 2YW9A 1ATIA 2QY9A 3EGIA 1P33A 1EEHA 1QRAA 2C5SA 2O23A 4RPLA 2K2WA 3ZDQA 4J0DA 3QU5A 3JQFC 3KOMA 1ZOPA 3OM0A 4WWHA 3R5TA 1C50A 4O4JB 1QRTA 4WKGA 1M8GA 4XPZA 3W5VA 3FUVA 2HU5A 1QOPB 3BA6A 3L1KA 5AOBA 4HSEA 1YTLA 2M1XA 5A4IS 4GR9A 4CEIB 4N5MA 4LRUA 1VIVA 1MKYA 2CHEA 1JSCA 4AQDA 3NEAA 3PKZA 3QW4B 2VCEA 2VHYA 5DBHX 2Q2QA 3FNGA 4RZHA 4NK4A 5BOSA 1N2SA 1BN6A 2Q0HA 1HYHA 3TUJC 5IAKA 2X9VA 3SYTA 4FYYA 1OZAA 1X14A 1PQWA 3BFKA 3M6IA 2AOVA 3TLXA 3AUFA 5FOXA 2IE8A 1JJIA 4Z7JA 4ZRNA 2VXCA 2BOVA 4G0NA 2O2ZA 1TEHA 1Y7IA 4BNDB 1SELA 1YOVB 4UU1A 3WLFA 3PXAA 2QG9A 1TUEA 2ONJA 4MB2A 1ACLA 2A4MA 3FMIA 3NC4A 1BCSB 3QEJA 1LTKA 4JB8A 4QUEA 2PZLA 5M3BA 2OHXA 2VRBA 2CWDA 2WE8A 4HAVA 5JXGA 4CRWB 2QJOA 1PS9A 3IAM1 1R5OA 5IVKA 1XZNA 4GBED 2RI1A 4FW8A 2VP4A 1CEXA 1DKNA 4F6CA 3I1IA 1LPMA 2BGTA 2EW1A 2Q5CA 3MLAA 3ROEA 3BDIA 3ADDA 4PZZA 4M1QA 4D5EA 1E1YA 5LZ7A 2RBGA 3CT6A 4J29A 4U0KA 5A1JA 3IJPA 2HSZA 5CNKA 3L0DA 1EB8A 1U0JA 4DUGD 2H7CA 2PGAA 4DFDA 1I6KA 2NVUA 3LLVA 1JVNA 1PNTA 5A1TA 5KKAA 3UMMA 4TPKA 2YJ3A 5HE8A 3I92A 1LQ2A 5IFKA 3H11B 3Q5DA 2OHIA 4PICA 5B55A 3D3JA 5I3CA 1V9CA 4R69A 3CZMA 4CIXA 4K81B 3E9YA 5D5QA 4RF2A 2GARA 1SVNA 4X8MA 3GWGA 4DKJA 1DAHA 3SIXA 4JJEA 4E3WA 2JBHA 2XI4A 3RSOA 2HY7A 2ZB4A 2I91A 3NHFA 4DDHA 3PJGA 1GZDA 4OQNA 4F60A 3C48A 5G0TA 1UZAA 1KJQA 2QSUA 4WLUA 5GJBA 3PG5A 4G8JA 3UOAB 3WTBA 4PPYA 4KWIA 3PKIA 5KOJB 3KB6A 4CWAA 1BCRB 1NOKA 1YUBA 1FDOA 2GQ0A 4B83A 3S2IA 1UPPI 2FGJA 2QM7A 1NONA 4H4CA 4ZOEA 4HDRA 4B9AA 3GCGA 1GG2A 2C7GA 1K3FA 3O1LA 2YV5A 3P9QA 1IMJA 4P5EA 1JR2A 5ESDA 5C81A 2OT3B 3WHPA 2QBYB 1TCAA 1T2DA 1CUVA 1F3OA 4BN4A 4LOLA 2O2EA 2Z8YA 2XQGA 1U94A 3R7NA 3F98A 1KQPA 1OIWA 4OAQA 2YZ7A 3C3XA 4Q9AA 1O6CA 4N5IX 2OQIA 1EM8B 3UJ6A 3JW8A 3A8TA 1I3LA 4A8PA 3GEEA 3QE0A 4II7A 5BN5A 4CGZA 1UZNA 4A8JA 3VU0A 1Y9JA 1E1QD 3E3LA 1KI7A 4EQ6B 2O5CA 4LDPA 3AIKA 3HYTA 3NG1A 3LUAA 1TTPB 4KR0A 1VKZA 5AKZA 5LUBA 1E9EA 2IYTA 3GH1A 5BO5A 3EAFA 4K1XA 2Z4SA 3AH8A 1U4SA 2GPYA 2F3TA 3MJHA 4IMJB 4IHJB 4EDHA 5IHPA 1T3GA 2RARA 3UTCA 2AHOA 3QI7A 1UPAA 2WB2A 2PSFA 2HEGA 3HI4A 5AKIA 4YBZA 2JKVA 1AA6A 4EX6A 1RRMA 4NE7A 5E6UB 1MC4A 2Q28A 3H1GA 4PHHA 3VTZA 1G59A 1A9SA 1I3MA 1L7NA 2WVGA 3BMXA 4G1EB 1RHJA 1U2DA 3OT4A 4IO0A 4MR9A 4NMWA 5CXUA 5HQTA 1EXWA 4G3XA 4JLPA 2VDRB 5J3JA 2QL9A 4Z9YA 5IN4A 2E1PA 3TMYA 2XRZA 4OI0A 3GLVA 3P9CA 3HXPA 1YKGA 3FOZA 2O2SA 3LW7A 1WHTA 1S2GA 3KKKA 2IZZA 2RHRA 5CFLA 2DLNA 1MA0A 2J59A 1OX5A 1S89A 2VL7A 5H80A 2VSNA 5AW5A 3SS9X 3TTXA 1Z0FA 4E09A 1PL7A 3AO0B 5C8VA 3RUCA 3VZRA 4OKSA 4FZVA 1LBHA 3AUXA 1VHLA 3A36A 3OC0A 1QS0B 2Q45A 1BMQA 2OBFA 3SF8B 2OHHA 4DMKA 4F96A 3RHFA 3L1IA 3K09A 3BREA 2C5GA 2UXDB 4F5YA 4PN3A 4I4LA 5AXAA 1BFKA 1P5JA 4TMVA 3GJ4A 5BUZA 4MCIA 4XRRA 4RD0A 1NDQA 1YC5A 2I3DA 3K71B 3A06A 5C53B 1OREA 2OM2A 2RDMA 3FB4A 3UXEA 1Z18A 1K7YA 5DSTA 3R4VA 1JHPA 3UJBA 4PX5A 2AMJA 4EL0A 2OE2A 3A4VA 4N3BA 2ZDQA 4P4UA 5EHXA 1TGVA 3N8DA 4MGIR 2F4NA 1OE0A 2PJUA 3HCBA 4CCAA 5ICCA 5K99A 5FD8A 4B45A 2ARKA 4LISA 5F12A 2I22A 3U6BA 4OD0A 1DB3A 1KI3A 3FYDA 4UBKA 4KTVE 1DEXA 1OPXA 2W6MA 4H6PA 2B36A 4RHEA 4UBOA 1T34A 2O6LA 1XRNA 1GOTA 1UQRA 3HFJA 3RE1A 1DXOA 3LQQA 4G2NA 3LUDA 3NDBB 2XZPA 4CCWA 5BVGA 2GZ1A 1IJBA 2WNHA 3PE6A 3Q0TA 1WTCA 3BILA 3A7DA 3G6WA 1QIKA 4XXHA 4R7GA 1ETUA 4Q0MA 5KNDA 1EIZA 3NHKA 4ND8B 5L6LB 1DXHA 1JHVA 1ID1A 4P3NA 5TMEA 1S5PA 3M6FA 5C1BA 2UXBB 2WTAA 1XCMA 4P5DA 3NAMA 3ZEAA 1KWGA 1I4DD 3MT7A 2EHDA 1K89A 5K45A 3ZCRA 1GUAA 1S3SA 2RK3A 3PSAA 3N2NA 4GP6A 2A0WA 3SVTA 3UWDA 3HCWA 3WMWA 4UTZA 3VKUA 4O2BA 3WQSB 3WLHA 1PYOA 1E9BA 3PPVA 4TSRA 4DW8A 1M6EX 5IT4A 2ZRLA 3SBEA 4BX9A 4BP3A 1BIFA 1IWBB 2PZ8A 1GTL1 3UAYA 1MW9X 4BKMA 4NCBA 3W8EA 1K3TA 4YJ2A 4B5LA 1EWTA 1YZ3A 3ZGVA 1G63A 3F5QA 5AVXA 1TAGA 2R4TA 2VQ3A 4HAXA 4PANA 3IV7A 3LQFA 2XB9A 4BMPB 4DWOA 1A8PA 4AFNA 3EB9A 1CY7A 2FSFA 1PQYA 3KHUA 3V4RA 1WW3A 1R9NA 1OLXA 2ZRBA 5H4GA 4R2LA 3QVVA 2X15A 5E4TA 1MH1A 2WABA 2WIBA 1LPBB 3FA2A 1E6CA 3IMCA 3JZAA 4BRWA 3MRSA 3HKDB 2HHAA 3AHEA 4ALNA 3BSFA 2VSQA 3ZGOA 3C98A 3GROA 2HQRA 2JCXA 1FQWA 4Q3EA 1DX9A 4KJXA 5C51B 2QP3A 3W5UA 2J6HA 2YV4A 2EF1A 1ZUNA 2BI4A 5IEJA 3HDVA 3AM1A 3F47A 2WK1A 3GLKA 4EY3A 1JA9A 1QTNA 4RVDA 2G67A 3DE2X 1P4AA 1CZKA 3D43A 3TSAA 4FB5A 2CLIB 3IUBA 3OQIB 4R1TA 4UJ5A 1Z56C 2PBLA 5IHXA 4URYR 3MIIA 2O8CA 1ULTA 3IMGA 2FFQA 4TTAA 3M1YA 4YRFA 1QMPA 1UZUA 1Z88A 4O8ZA 2DHEA 4CMHA 1Z82A 1FDSA 3QWHA 1GPKA 3L8FA 1HDIA 3OCCA 1CUHA 1NW5A 1T5LA 3MERA 4YMWA 3ZIAD 4DRYA 3LTNC 1XJCA 1I3OA 3ADBA 1PGOA 1NVMB 3L0CA 4MUGA 3T5AA 1HYBA 1U2DC 1TZCA 1UMBA 3AF2A 1QLJA 1QCZA 4S35A 1U8CB 1O9GA 4TL6A 1UFKA 5JO9A 3VHXB 2RHOA 3GLGE 1FRQA 2JJ1A 2DYKA 2IYSA 5HGJA 3TRDA 1AO0A 3NO4A 2FEXA 2IX9A 3AG5A 4Q9DA 5I4BA 2QRMA 4YJHB 1J9EA 1NYTA 2HH9A 4WY8A 4Y1RB 1UM9B 2ZRQA 5CFNA 3LAWA 4DCTA 4OBEA 3DB1A 4Q9LA 3BE4A 4IZOA 1XZBA 3ZHBA 1NRIA 3GLHA 1D6MA 5I9SA 3RI3A 1Q3TA 5HUHA 4P82A 2VDPB 4PG7A 1HTBA 1NFFA 2AFHE 2I2AA 3NEPX 4I4CA 3DJYA 2GTIA 1O3YA 1EHCA 3PGLA 4FILA 2VHZA 2HO4A 2D5CA 3VDQA 1Y48E 4NS4A 3Q41A 1GPWB 3CLUD 4YCBA 3R9IA 5FOSA 3GRFA 5IEBA 3UJ3X 2PS3A 3KVNA 1B4DA 2DT5A 2NO7A 1MC1A 1XZGA 2YYSA 3AI2A 3JWPA 1GAWA 3NM4A 1WMBA 4HQKA 3S2UA 3VOBA 2ZUWA 1NM5A 2AW3A 3AWIA 4NEHB 4GOND 4MTCA 2VBGA 3MWFA 2WHEA 4EYSA 1NW6A 3IOEA 3AGPA 2D2IA 2IITA 1M34A 5LYJB 1X7WB 4IOMA 1FQKA 3HVJA 3L9XA 4FR2A 1NUAA 2QNRA 5C1IA 2BISA 2R1UA 2WJPA 2WSMA 4EUSA 3CX6A 2HOQA 3W8NA 3KKMA 1PZFA 1H0KA 2C84A 4J7UA 4EFKA 2WJAA 1HDCA 4Y1FA 1EWVA 2OLEA 1SQ5A 3FHLA 5K0EA 3O03A 3BEOA 1UBCA 3DMNA 3TB4A 1KMHA 4GGOA 4QYIB 3OTWA 1H8EA 3HCAA 3MWKA 1SBNE 4XJXA 1QIJA 2FX5A 3SJZA 1SVIA 1MOPA 1UPFA 3KXLA 2W6OA 4P7GA 2VHJA 4H17A 1KQ3A 4C7MA 1WULS 5AVWA 2HYIC 4BEBA 1AE1A 1ISMA 1GNPA 4ZO4A 4Z4EA 3HXLA 5JHGB 4PC7A 2Z8YM 1C30B 1LTHR 3LI2A 3EVFA 3LRPA 3UGTA 4AP6A 3C3BA 4EWLA 2WJ3A 2SHKA 4IJQA 1QUFA 3I8XA 5EINA 3DBIA 1DKLA 4AY3A 3GLQA 1L7EA 3CISA 1BYUA 4J1SA 4BTVA 3U1BA 1N78A 1JNXX 4P92A 5TQ0B 1HG0A 4L4XA 2ZRIA 3WL5A 3F6SA 2FMXA 1P2UA 4IX1A 3G2PA 2P1RA 1F2TA 4RTLA 4FU0A 1RLIA 2J1LA 3RLFA 3SICE 1C1XA 1EVIA 1FSZA 3DE6X 2PPLA 4KI7A 1P0CA 5KJ6A 1NLZA 2AMLA 3NWPA 5BPHA 4EGCB 4BO4A 3D3KA 4AURA 1P3JA 5EWJA 1T2CA 4CKEA 4NU6A 3EQ9A 4H16A 3IDSA 1R8XA 2O50A 1J9ZA 2HUPA 2VRNA 2D62A 2OFFA 3KP1A 2V9CA 1PFKA 4GOKA 2GD0A 1AT1A 4ANFA 4BFXA 1ZGAA 3ONNA 3HVKA 1I4EB 3ZZMA 3A3NA 3NIBA 1ODLA 4JQSA 5EHIA 1RAHA 2DFVA 3L6DA 2OOSA 2BFEA 4DMRA 1J0EA 4LHVA 5JS7A 5LNK6 3T3MB 3L49A 5BMVB 2XMSA 2X2EA 4NYIQ 1TQ6A 2FDRA 3VTAA 4C4OA 5MFPA 4TL7A 2J3JA 2X9LA 4F91B 3COJA 3WGIA 3Q1LA 9LDTA 2H9AA 3OURA 1WDDS 4L6AA 3D1VA 3IPCA 3GNSA 3PUXA 2CUNA 2OB1A 1NUTA 5LZ8A 4BFWA 5KQLA 1P80A 2P1DA 2FWRA 4OMFG 3CCCA 1G7TA 2AIRA 3ETCA 3LT4A 3F2IA 1J2TA 3IESA 3O31A 5F78A 4X1YB 4WFQA 3C5WP 5FBLB 3T8YA 4PX2A 1D7OA 3BGWA 7AT1A 4I4TB 5ALIA 3TYXA 4S1PA 3DOJA 1PFUA 1MIHA 3NTLA 3U31A 4EUFA 3ORYA 4AZTA 3ZD6A 4N0DA 1EVZA 3MILA 5DIZA 2LDXA 5T67A 2R86A 2JKZA 4LRTB 4TWIA 3OZCA 1NSYA 2AG1A 3NOXA 4NYIR 2OGZA 3VV2A 4G26A 4CMIB 1BXRA 5AKEA 4OXYA 1G16A 1T8UA 3KETA 1EWQA 4LHEA 5KX5A 2DEUA 4EMTA 4L0CA 3QU7A 3UG6A 5HJEA 2YY7A 4PLTA 3AM3A 4A27A 1CV2A 3QNMA 4PWYA 2G8LA 4ZIRA 1Q0HA 4X92A 4JYZA 2NPIA 2G4VA 1GLVA 3A6FA 4ZRMA 1ZUIA 3KYBA 3FDZA 1J25A 1YVUA 2FWMX 4CFSA 2IEYA 4EHHA 1HL7A 3RYIB 1XVUA 2J3DA 1JLLB 3QFFA 4Y0NA 3AR8A 1NR1A 3JQ8B 1NXVA 4GOLD 5AHWA 5AKHA 5F7OA 1JG1A 4GKKB 1JHYA 2WINI 1O96A 1FYDA 4MMYB 1YIDA 2ZE7A 3I5YA 3U60B 5DWDA 1AQYA 4LK2A 4KYVA 1ZD3A 5K0LA 3D64A 4DUYB 3T9FA 5KYKA 1Z45A 5BWMA 2XXAA 3SBOA 4EUNA 1CZHA 4QKQA 5L45A 1NM5C 4QUDA 4EG6A 4OBWA 3RRMA 2QGFA 1JIKA 1EYZA 1T5OA 1VLQA 2P4EA 2JLBA 5KDLA 1NTOA 1XNGA 2WKSA 1JH8A 2ZIFA 3ABOB 5E1DA 5JDCC 3SXUA 4F46A 4C3VA 3CM0A 5KYUB 2O3UA 3KOXA 5J4KA 2ZTVA 4GDMA 3KYCA 3LA8A 4YT4A 3NNNA 2F1HA 2ZYDA 3FCXA 1UZDC 2DBQA 4OGWA 5NLLA 3HPRA 3DLTA 3RCBA 3QLVA 4JI6B 1IB0A 3SP1A 3RS5A 4R8VA 3NBKA 2ZBQA 1YE8A 3D3NA 4XSGA 1U4NA 1JPUA 5T4BA 4NARA 3TAXA 3UY4A 3W5JA 1QP8A 3QMMA 1SVSA 8ADHA 1RRCA 1DJLA 4YAGA 1X3SA 1JKMA 2HRBA 1I3CA 4ZI2A 1XBTA 4U7GA 3PCRB 2A86A 4IGIA 4RWZA 1RDFA 5BV1A 2R8EA 1PFWA 4B40A 3X44A 4XPIA 2L19A 4AY2A 1JLSA 2VYVA 5C52B 4Q1BA 4EJ0A 4WXYB 1J2EA 4RFVA 3RW9A 1GL6A 2HF8A 1ULZA 3QXHA 1NZJA 1XZDA 3IIKA 4Y2SA 5B64A 1TYZA 5TEWA 3GU3A 3WGGA 1O97D 2FFAA 4MVWA 4WBNB 1E1NA 1RMTA 3C6KA 2YJZA 1GU0A 1F1JA 3EIUA 4H1HA 3L6CA 4UUNA 4ZQIA 4LV6A 2B20A 3HS3A 4BKRA 3FHTA 3VR1A 3DZBA 2JFVA 3DFKA 1N2CA 3A2NA 3R40A 2KLBA 2ODPA 1S8FA 4ZHSA 2IHZA 2C5LA 1E1DA 1VI2A 2ORED 5D01A 4ARAA 3MAJA 3R3VA 4BNFA 4BQRA 2PS1A 4ES6A 1FJXA 2X2PA 1UP6A 5F5LA 1OWNA 3CH4B 3UKJA 4BGVA 1SVOA 3PGKA 4WCFB 2PL1A 2Q9AA 5K6RA 1HE1C 1KARA 1KP3A 1CB0A 1OX6A 5G4LA 3WAKA 2AA3A 3BE5A 3AR9A 3UXYA 4KBGA 2B4TO 4YVFA 2D5IA 2XYPA 3B6KA 4Q02A 1BE8A 1OTXA 1DJPA 4KH0A 4P98A 5I7AA 4DLZA 3LQYA 4CKWB 4D9HA 2N1MA 2AS0A 4Y2UA 3VNUA 1MTZA 1VIAA 2GYWA 1KQFA 2PD6A 1WW2A 3QY9A 1E58A 4RADA 1SKUA 3RKSA 3G2KA 2DQ4A 1LSOA 2IBTA 4BVHA 4NOJA 1W96A 2EKPA 1THGA 3A9WA 3EXHC 1ADFA 4EGQA 4ENPA 3IE2A 3U1VA 3GA0A 1GTJ1 3EZLA 3MFQA 2F3SA 3LT0A 4X64B 5REQB 3WSTA 4DRXB 4F0MB 4DPLA 3HACA 1N1DA 1KY2A 2AI2A 3MXOA 3JAWA 3HR4A 1XROA 4DIFA 2X6QA 3OEWA 2I4IA 2V7WA 5IMBA 2QN9A 3NTQA 1RQRA 1BGVA 1D09A 1AKWA 2ZI5A 4NABA 4CTOA 5LP6B 4J4HA 3RUHA 3CR8A 4P5PA 1YFZA 4DV4B 3WWZA 3KK0A 4AQYB 3FWKA 1G8FA 1JEAA 3G82C 2IW1A 4NJOA 4EMUA 4DB2A 1RJFA 4Z3KA 2V7VA 1F2VA 3ES9A 1CUYA 2P6NA 4IIJA 2PGJA 3TIGA 2JEOA 1E32A 1R2QA 2PYZA 4HP8A 4ZVRA 5JANA 3RK0A 1FXWF 2HWKA 4I9FA 2D3TA 1XDZA 3ON5A 1LDBA 4WA7A 3FTQA 2IDJA 5E0KB 3OT1A 1TA4A 4E6EA 5JNRA 5ALFA 2QOEA 1P1JA 1SUBA 3O2SB 4QJIA 1R0WA 4W7SA 3AJEA 4WXMA 2Y1EA 1I4LD 1Z5ZA 3AKDA 2PS0A 2ODQA 3KAJA 1D8AA 4C43A 1N6PA 2VJQA 3H4MA 1EVQA 1PU2A 2CMDA 3CEPB 3GMSA 4UU8A 5A7GA 4FIDA 1NWHA 1SN7A 4KX5A 2EDAA 2FX3A 1CJCA 4FHFA 5TT0A 3WB1A 2WWGA 2BFAA 3AERA 3ZWMA 2RGNC 5JUWA 2QORA 1IEVA 2OO5C 1MABB 5BUQA 2WHPA 9ABPA 4L1KA 2GXQA 1FSPA 2ZWVA 4NCXA 2RD2A 2BE9A 4Z2YA 3DKVA 4LGMA 2ORIA 2EZUA 4RTNA 5M29A 2GN4A 3HP4A 2IPAB 3L7LA 4PRKA 3RFXA 2W2KA 4LYAA 4CEJB 1RXOC 1R64A 3DAYA 1K3UB 1IOLA 4L3OA 5GPBA 4COOA 5CG2A 3OPYB 4BFYA 1C80A 2HJWA 2XE7A 5LJLA 2H1LA 4H6WA 4HDKB 2W9XA 3T38A 3NAZA 3QMVA 1QAQA 4LXQA 5TSDA 2NUAA 5TMPA 3IERA 1Z0ZA 4BIMA 3CVVA 3BJRA 3C3MA 1MGOA 3FWZA 5F5XA 2D59A 1SBYA 3OZVA 5D85A 5F77A 3QLVC 2JDIA 1NC1A 3K9CA 2J30A 2QLNA 2D74A 2DUUA 2JIBA 4NU5A 1YKFA 3HO1A 1W581 3FUUA 3KVYA 4LGCA 3HK2A 5SZIA 3I34X 3BWCA 1USWA 3HG7A 4KAXA 1LV7A 1RS0A 1UPTA 1FFGA 4E15A 3VO2A 1P9WA 3C14C 3ZW7A 4DCNA 1AV6A 3VR5H 5JE8A 1F12A 2I99A 2VKTA 5DNYB 3VRHA 1BOOA 1DQYA 2GYUA 3UOGA 1SHZA 1M6VA 2B99A 1TJPB 1JI3A 3HDGA 3HV2A 1RXWA 3GP8A 1RSCI 2Y6VA 3OCUA 3MMXA 1GLNA 5COAA 4JZYA 4RH0A 3VPGA 2IOFK 1CZUA 1KI6A 3HBMA 1X15A 3K9GA 3UFXA 1N0UA 2A9PA 1FZQA 1VSBA 1XRSB 2J3MA 4GIBA 3JQBA 3CRMA 4YJ3F 4ERXA 5KYYA 3DR5A 3MOGA 3RVOA 5AM5A 3L7YA 4W9NA 2RGUA 4HWSA 5EJFA 2P6PA 4W8OA 1ARZA 1UBGA 3UFBA 3WBFA 2H4XA 3ZDRA 3H6KA 2XWBF 2XSZA 1OR8A 3F4BA 3GCXA 3BCRA 4NQRA 3GJ3A 5TJHA 4D5GA 1CRZA 3IL2A 4FB4A 3B48A 4MIOA 3ZVMA 1BXKA 1SOWA 4MUBA 5KVQA 4QPDA 1LD3A 2KB0A 4GMKA 4KLAA 1EUCA 1QZTA 2DPMA 2GBPA 1UBUS 3ML1A 4PVCA 4TYNA 1IIBA 4AWXA 1JPNA 3P5SA 4FFBB 1XQYA 4MUEA 4UVEA 5I7WA 4DV1B 1VKHA 2WAOA 3DWFA 3R3ZA 1R4NA 4A2CA 1QGAA 5FA5A 3E9ZA 5HBRA 2XB2A 2ZB8A 5U9CA 3N74A 3F7OA 3GGPA 1B14A 4B6EA 3Q3IA 4MVJM 1L5RA 5G4KB 4YO8A 3CG0A 2ZG6A 4RS3A 1RHKA 1VPDA 1RXSA 3NB0A 3QEBZ 3PDWA 2JANA 2VPWA 5DISB 1SULA 3W0LB 4C01A 2ZM6B 3SGLA 1R27A 3GLFA 1QBKC 3U40A 1E63A 1VDZA 4KLNA 1HNZB 2Z2JA 1A1SA 1NVKA 3R23A 5LYYA 4CCSA 3FTDA 4EFDA 3G2MA 3LIIA 2VZ8A 3QHQA 1WNFA 4UD2A 2I7VA 5E4JA 3B2NA 3UW1A 3FZNA 3E22A 3OE4A 4GGMX 4QXAA 4QXMA 1NOJA 4QBFA 1RHQA 4WK6A 1JJAA 3T7TA 3H9UA 2FPGB 1FLAA 2JNWA 2QQ0A 3OJOA 1ZD9A 2X76A 3F8TA 4ND3A 4HDAA 1V35A 4LKRA 5TC4A 4B71A 4X63A 4M83A 3IE0A 2XXBA 2B30A 4N65A 1BMFA 4YCNA 5KNLA 4RNCA 1KZ6A 3QPCA 1MEOA 1V9LA 2GPJA 2QGNA 1YR9A 2IEBA 2ZOSA 3LGXA 1XF1A 2QP4A 4PINA 5LD2B 2JPDA 1TMOA 3OWOA 3P9IA 3VBCA 4AUMA 3K3PA 1Y5NA 5J59A 1MN6A 1TFRA 1Z2NX 4Q05A 1J5XA 2OHJA 2PUCA 3Q15C 5EL0A 5A02A 1KDYA 1RCFA 3H1AA 4Q1CA 1HH4A 1H6BA 2XB8A 1NU8A 5AICA 4QYSA 4MGHA 2HFKA 4M8IA 4CF7A 1RWKA 2WD9A 3OJEA 5DSXA 4YLGA 4PXAA 1XKTA 4IIYA 3ROZA 2ACVA 2QTVA 2XKAA 1VE6A 5ICFA 1HURA 1ZLXA 3BFJA 2AKAB 4BJHB 2XRYA 4KGDA 2VNSA 3L1VA 2JFWA 3DE1X 4XM1A 2Q8NA 5TJ9A 4J2TA 3AR4A 3AI1A 1CUBA 2IEIA 2OD9A 1ISPA 1XFAA 3CMMA 1DVRA 1VE9A 4EQZA 2D7DA 1JV2B 2DETA 5HS4A 4A82A 1TYAE 5T5QA 2WWRA 4G0YA 3T3DA 4BDTA 2HK6A 4R0VA 3DQZA 4RKYA 3RC7A 3WAGA 1U2GC 4P53A 1U0HC 2R8XA 4MIEA 1Y4UA 2GJ9A 5JNSA 5EUBA 5CDYA 2FR8A 2W0SA 1ORWA 3FNRA 1V45E 3JZFA 2J3LA 3H5IA 4R31A 5HILA 5AJVB 1W1IA 5G0UA 4AUKA 2JJQA 5DM0A 3FR8A 1JHMA 5I9NA 5AK5A 4EABA 2GF9A 3M6AA 5FLKA 1WSAA 2ZSUA 1WXWA 3O75A 1T6ZA 4RSGA 3I2GA 3Q8KA 2VUSA 1NW9B 4DR7B 4Q3BA 1YQQA 3PT9A 5CEFA 2GWHA 1UFVA 3T4UA 3NGMA 4KDFA 1P5HA 2BP7B 2UYGA 2RHTA 1SIBE 4N12A 2OP0A 5ECDA 2PH1A 4MV9A 4JU8A 2NSLA 1TMYA 4BEWA 3BB1A 2Q5OA 4TXHA 1N34B 1Z7YA 1KI4A 4ZAGA 2C4KA 3U5ZB 2NTJA 4RUBS 3EAGA 1GFIA 4ISCA 3N75A 2JK0A 5A9SA 1GPJA 2VFAA 5FL7A 4KRXA 3WLTA 1ECJA 2YWCA 10MHA 5BSRA 4RJJA 5LZ9A 3VU8A 4GECA 2VLBA 2W6NA 5H68A 4JDUA 1QOZA 2NYRA 2BLNA 3C0KA 5CJPA 5SY6A 2BHTA 5HCUA 1YI1A 4Q3AA 2C1ZA 5TV2A 4YHBA 4R8SA 5FAKA 1XPRA 2HU2A 4GXRA 2BMFA 5DHTA 3HDHA 1DCKA 2VF8A 2GLUA 3I9V6 2DFDA 3AESA 4X7PA 4IH1A 1EFAA 3C1OA 4WOCA 4BJ1A 3OIFA 4U2GA 3SYRA 3K4QA 2PQMA 2GA8A 1UBHS 1V4BA 2YZGA 5LMUB 1O4VA 1QYCA 1QKKA 4D3DA 3BE6A 3EZ2A 1A0OA 4KVFA 5CIWA 3WWPA 3OZSA 3EGDB 4RO0A 1J39A 2XA9A 3KO8A 4C5CA 9LDBA 4GZ5A 3ZHSA 2ACKA 3QVLA 3V1LA 5K8JB 2JVKA 5CLJA 3GAMA 3RFCA 3IQDB 5GOTA 4F2GA 3JQEA 2JAQA 2PKXA 2GXSA 4ZT5A 4JS0A 4DLBA 3I61A 1JQLB 3QIAA 4HLCA 2O57A 3FFXA 3GFPA 5HKLA 3GGJA 1V4VA 1JB1A 2SCUA 2WNIA 2NU7A 3DEHA 1O95D 4POAA 4BVFA 1T2FA 4WV3A 3VUEA 5A4MS 3BPSA 2A9OA 2A5FA 3LPLA 3DBHA 2Y76A 3N76A 1E60A 1QYDA 4LF6B 4DPKA 1YQTA 5FBHA 4OUDB 3E61A 3N58A 5JJBA 3G0DA 3Q9LA 3HBJA 5CTJA 1NBMA 2CNDA 1UZHC 2Z1NA 2Q6IA 1CB7A 2X3FA 4Z9XA 5G2OA 1PT7A 4NHOA 4QXRA 3TW4A 1QHXA 1K5HA 2E21A 1J90A 4TXLA 2FSUA 1JS1X 1ODFA 2IZ6A 3KR2A 2ZT6A 1E3LA 2QDXA 4UXIA 1UQUA 1N25A 1JFTA 5ADHA 1MU0A 4YFVA 4MRSA 3L7BA 2OPHA 4YRKA 1G18A 5CEEA 1N33B 2G9RA 3KWMA 2HBYA 1YIAA 2QDKA 1I2BA 3QJGA 1ZKDA 2WF8A 3PBKA 4B2PA 1QSGA 1YBFA 2VK8A 3SHQA 4WLVA 1SQSA 2BHRA 1F0NA 3KQQA 3J81A 1ZZGA 1MJHA 3EF0A 3H18A 4JC4A 4NFYA 2Q5HA 4ZDJA 4MUIA 2A3RA 2QY6A 3MD0A 1YD7A 1SZJG 1YI0A 1E0KA 1Y7LA 4LMPA 4QPZA 4DYVA 3C85A 3UBTA 1ZN8A 5JZMA 2XTAA 4HH4A 3NJRA 3ZXIA 3MEQA 1U0OC 1E6MA 2NXNA 5D3QA 1CPYA 3SC3A 5FPYA 1V1JA 4P4NA 4PLYA 3UPDA 3V7UA 4CKBB 3D6JA 4A0QA 1LBSA 3EY4A 4WNYA 4D9BA 2WICA 4N9QA 4PAMA 4HGPA 3STHA 3ZDXB 5LMNB 4LXUA 1SCIA 4IUDS 2Y1OA 3QQ5A 4RIEA 5EE0A 3L2OB 3MS7A 5TLSA 3UTDA 3ABRB 3HN6A 5ILOA 4XQ9A 3W05A 1PV4A 1S3GA 4RF5A 3ND8A 1OF1A 3DCNA 3IP1A 2E18A 1WZUA 1PSDA 4J1TA 4Q4AA 1XF9A 4TQGA 3UCEA 3WFIA 4TROA 4A36A 5GGXA 4OJTA 4DIBA 4DBZA 4WMLA 4DC0A 2A35A 1KU0A 3QVUA 5K3FB 2WAYA 2H54A 4IV0A 1JECA 3ENZA 4AO8A 4PTLA 4F84A 1H0HA 2BTQA 2FMKA 5LIPA 1H85A 5DYYA 3RSLA 5EYPA 3D1LA 1VBNA 4RA6B 3U2QA 2FYTA 2FR8C 4E1AA 2QB5A 5LQMA 1MDFA 1IZYA 4FX2A 1VC2A 1VRWA 2WW8A 4UFPA 1I6WA 4DIKA 2IUUA 3L0BA 1IR1S 4AJNA 4DWVA 3TJZA 4AL4A 2RKBA 2CFIA 2A5JA 2ZLBA 4BZPA 1OAOA 2G09A 2AZ4A 3A6GA 3AZPA 4MJ3A 4TLDA 3VPAA 5IX8A 5LA6A 1GRRA 2ZJBA 4OL0A 2BH9A 5KC8A 4RTPA 1ZEJA 1E2FA 1V9SA 1VJCA 5DM1A 3TUZC 3FG9A 1NLFA 3PRHA 4L0MA 1OFUA 3EMVA 3DAFA 2W37A 1DSSG 5AM1A 3H42B 1P60A 2FEOA 4WAUA 3FIJA 4CV1A 3HA3A 4IY1A 4I1UA 1VHTA 1OXUA 1LA2A 2JFPA 3UKDA 4B6FA 1WEHA 5D3MA 5BRAA 1WUTA 1MJ5A 4CL8A 2X23A 3JAKA 4YLEA 5SZKB 4BAGA 1KEUA 3FSGD 4FJ2A 4N49A 3ZDAA 1JQBA 2MU1A 3R6DA 4ZEVA 1WEKA 3RTCA 5E8RA 1CT9A 3EG9B 3IP3A 4YUXA 5CD1A 2DKOA 5CDSA 1JKXA 1T2EA 1WF3A 2WSLA 2Y1XA 1WDTA 1WHSB 2A0XA 3N86A 4TWAA 3SYLA 3AHJA 3UT5B 4HVLA 1OBOA 4PXSA 2E0IA 2ZUBA 2PSHA 3K2BA 4ZHQA 4W7HA 3N3BC 3KKLA 2V7TA 3MQFA 3ANTA 2IGTA 3ZXSA 1KE1A 4QGSA 4L4UA 4NF2A 2X1HA 3VSEA 5FOQA 2J3EA 2ZQYA 1N6OA 2WHQA 4KQWA 3SEZA 1FJ2A 1TK2A 2Y9MB 3NYIA 4MVJF 5P8WA 4KACA 3AFOA 4KQEA 3ZJUA 3MJTA 1DO0A 1R8YA 1Z5PA 3PTLA 5BW4A 4QUKA 1O0CA 2I3AA 2V0CA 4TXMA 1USGA 2BMWA 4M9UA 4Q7LA 1DHRA 3KT3A 3NU1A 4JROA 1SUFA 2JHAA 3FKSD 4PC2A 2V5UA 2WYHA 3WNVA 1GXSB 5EGSA 2ZUFA 2BFWA 3P9ZA 4N8EA 1K0FA 1D4ZA 2PBFA 4Z8YA 5IC4A 3LVFO 1PEAA 4WINA 2G77B 1R3UA 1C3OB 1AKMA 1PG0A 4MARA 5C4IA 1RBLI 1CP2A 1RYDA 3ACDA 1LBQA 3O82A 1RTKA 1HBJA 1K98A 3OOJA 1ZO8A 2HQOA 4GM4A 1FYVA 4JQZA 4LC0A 4LX8A 4AMUA 1Y3FE 4YTEA 4K8RB 1K6XA 1LQTA 4OI1A 3QF7A 4ENUA 4KLCA 5HDQA 4L8VA 1RBZA 4MYCA 3HL4A 3FSEA 4J6FA 1MB4A 2HB6A 3WO0A 3NHBA 1Z0UA 1I7SB 3PSHA 3WMRA 1FNCA 3L0ZA 5DBOA 1AGYA 2VSXA 2IWRA 3LUBA 5FNVB 1Z4LA 2PZKA 3RSZA 4X93A 2BWJA 3QKRB 1WCV1 5ELMA 4ZD6A 3UJDA 4QRDA 4UNNA 3F7MA 5IJWA 2BFFA 1ISHA 2G08A 2IHYA 3WNQA 3IXLA 3K9WA 3C16C 4GL2A 3VSAA 5B6PA 1N8KA 5JADA 1MX1A 2R00C 4FQ8A 3QLJA 5JS1A 2AC7A 5DNEA 2FWPA 4BO5A 2J0QA 1K2WA 3D4OA 2NVWA 1Z7GA 5CMLA 2WG0A 4JI5B 5KYXA 4XYLA 1FLNA 4CG2A 1BFDA 4NWIA 3NHLA 4KIGA 3L8MA 4KPFC 2Z6UA 1I30A 3AZOA 4NONA 4KXWA 1T43A 2D7JA 3ZN2A 3EUWA 4FWBA 1NP6A 4FMCB 2A1UB 4XTCS 3RFTA 2EEZA 4OHUA 4P58A 3WYNA 1ZX1A 3EISA 3KLPX 4HGYA 4MJXA 1R5NA 3U16A 4RAQA 2ACWA 4EL5A 1PE0A 4HEA1 3ABIA 4K0RA 4HYYA 4YS6A 1WU7A 3D7SA 3HV0A 1CDDA 4DCMA 3G1WA 1XD9A 3GXOA 3N6VA 4KXVA 2X6RA 3EOBI 3DTNA 4TN5A 5J2TB 3C1TA 3CUSA 3BJZA 1IG3A 2GJSA 1FYEA 4YQZA 2X0KA 3DNMA 5CB4A 5AXDA 3VBEA 4WVLA 3DJFA 3O3MB 3RHSA 1YS7A 4D0GA 5JROA 3OY2A 4WW0A 1LPNA 3OO0A 3WGLA 1U8ZA 5IUJC 1LS1A 1DCFA 2P5TB 5E1MA 1TM2A 1NGSA 5BWNA 5AESA 1SH7A 2OZLA 2GVZC 3LX5A 1VPTA 1MV5A 1NVFA 1HORA 1U8TA 2NU9A 4G5XA 4PZ9A 4H3VA 1XLUA 1TF7A 1XZFA 2G36A 3CNQS 1KSJA 4HFRA 4QBHA 4V0QA 8OHMA 3S8YA 1MJGM 1S01A 5F7XA 2Y4OA 3WDMA 1NUQA 4MV8A 2A9QA 3QITA 5F35A 2X5XA 1O5TA 1JAIA 5E3JA 3FCYA 5C7YA 1R0CA 3KKOA 1C3LA 5AK6A 4JEHA 5LIRA 1UL1X 4YBRA 2YCBA 3JVEA 4G67A 2C9YA 1ETHA 2ORWA 3LQ4A 4N1AA 5BRNA 4ZYWA 4BO9A 3MG9A 3CW8X 1EA7A 2G88A 4B82A 4Q00A 3CB2A 1RKQA 5SICE 1I7NA 3ZLTA 1DWQA 5CJJA 4FT2A 3JVUA 2QW1A 4TSFD 3ZWOA 3K20A 2PMCA 1N5DA 1P4GA 2IXTA 3C8MA 4KR9A 4QASA 3KCNA 5FR1A 3HWRA 2R5FA 2AJ8A 3B7WA 1IHXA 1VA4A 5I8PA 2V0NA 3FBGA 4U39A 2A5GA 5ES3A 3UK6A 3OO1A 3RSQA 2XUJA 4NV0A 2P1ZA 3DL7A 3BIWA 5CLIA 3ROTA 1VYUA 5AVRA 5IU6A 2A2ZA 3EDRA 2VK4A 4NEQA 3JYNA 2W2LD 3KQOA 1IZZA 2QVZX 2VQFB 1TMKA 2I4RA 4KR3A 1VL0A 5E7QA 1BWSA 2BKVA 1ZM9A 2CHQA 3NVAA 4GXNA 4QULA 3IUYA 4WLOA 3AIOA 2BKLA 1N3BA 4GZ3A 3PQ2A 3HC7A 3TPZA 4M7OA 1OB5A 1KPGA 3ACBA 3CMCO 1M75A 4BPBA 2AI1A 3W1WA 3B9PA 5KYWA 1NY6A 3WL4A 5EXDA 2BDEA 2XEDA 3ZOZA 3L1UA 3DE7X 4URWR 3ZK9A 4B3GA 1IEQA 3JZDA 3MXTA 1U7HA 1Q1BA 3GLHE 2HREA 5ULLA 5CFQA 4M55A 1J21A 1DMSA 3DTVA 3RJTA 1FRNA 1DKOA 1REQA 1VLLA 2ZDHA 4ZVNA 2EBUA 1ZOOA 5CBPA 2QMEA 4NOLA 3OWHA 3M5PA 1VZ3A 5HK9A 5DMHA 1R8SA 3SZLA 1QYXA 3E35A 1YCGA 2PPVA 3FNEA 4LI3X 3PVCA 4AULA 1KEPA 3O95A 3OJXA 5FEMA 2O0JA 2WR8A 1N2JA 1J0XO 3CLTC 1NV8A 3PD1A 4IDGA 4DB4A 2J48A 3LHSA 4MDFA 2C00A 4V0KA 2YXNA 1POXA 3RAEC 3Q6IA 1E8MA 4MO2A 2B9EA 1Z15A 1T91A 4QRHA 4ZT2A 1X6VA 2E4XA 3IO3A 3MTIA 3MCZA 3RKUA 5FBVB 721PA 1ONOA 1QE3A 3KTDA 1JPJA 4JBIA 3F6CA 4LQDA 2CD9A 2DAPA 5JVDB 2Y1KA 1T2VA 4BVGA 2CE2X 5AOAA 1IHPA 1M34E 1PR5A 3FFTA 2OVFA 1FP4B 3GVHA 4EW1A 3SQNA 4BQFA 1EFTA 2FRXA 4C0XA 4NJEB 1W94A 2FX2A 1FFBA 4NYMQ 5B53A 1YA8A 4Y30A 1E5LA 4MA0A 1QQ6A 3D4LA 5IAJA 2P9QA 2QM3A 3QOXA 1NMXA 1YHYA 3JR3A 3WKCA 3GF4A 3TZBA 1AM4D 5JCOA 3KKEA 4TMYA 2LXNA 3B3AA 2O7VA 1ZICA 4CQLB 3LUCA 5F4ZA 3EBPA 1IHOA 3SS7X 1CE8B 1TE2A 2RI6A 1UDAA 3ESCA 1XZCA 3D4IA 3M70A 4M6WB 1TVMA 4L02A 5A5FA 4G1BA 2B8JA 4DV3B 3GZ4A 2DTDA 2IL1A 3R77A 4JX9A 3W6NA 1TT7A 1IZ7A 3LPAA 2X19A 1U0GA 3WFZA 1F9AA 5H9VA 3REFA 5HZHA 1WKBA 1MJFA 2QXTA 4RXUA 3PX7A 2XZOA 1IN8A 2Y68A 3I4LA 4B8WA 1OVMA 2ZWOA 1ICIA 2REQB 4YRJA 5FJJA 3U7EB 3X2SA 3GFVA 4B81A 3QOYA 1AKNA 3L4EA 5BN4A 5JYEA 2GN9A 4HZGA 2AWOA 3PPYA 2HDOA 2PDAA 2X7JA 3M4ZA 3R24A 4DIOA 1VYTA 1FMJA 3KTFA 1E5XA 1PJTA 1QH9A 3Q3VA 4QEKA 4HR7A 4OVKA 2WD7B 3K1JA 4DILA 3MWEB 1ZI9A 3HLTA 4AJOA 2P69A 2QD2A 3QUCA 2P11A 3EEYA 1TXGA 4G01B 5HX7A 2B3TA 1OAKA 2J3QA 2JI8A 5LC1A 2FKAA 1RWWA 2A88A 2EGUA 2OFOA 3HJNA 3HO8A 4J0EA 4QU9A 3E1GA 4ZAYA 4BYMA 3U9LA 5BUSA 3LVQE 5CB8A 4FUQA 5EP4A 1WVIA 2WTBA 1PGNA 1NE2A 2B61A 1W88A 1MT3A 1Y6GA 4RVSA 4OSEA 2PY6A 2RAPA 3L43A 1W5BA 3LYUA 3D2CA 2WRZA 1P77A 2A7QA 2IW3A 2Y4NA 2WHXA 3DGEC 4H15A 4XB6B 3LG2A 1HLFA 2CD7A 1YTUA 1M8JA 4FFWA 4W6ZA 3A9RA 5K20A 2BGGA 1MIOA 1IXSB 2WIAA 4X6YA 5C31A 2PSDA 5CB6A 5IT9A 1KK0A 1ESNA 3HVUA 3RODA 3AJAA 1QNFA 1ZPDA 3A28A 3JASA 3RSSA 3EGCA 3GYBA 2Q8QA 1MX9A 1PGPA 1H4TA 1WS6A 3NH6A 5P21A 2FP3A 4O4LA 2NU6B 5DASA 1E7WA 5C5IA 3UJ7A 1VE5A 1HXHA 3RNLA 5IKPA 2DWQA 1YS9A 2D1TA 3AIMA 3VNQA 2AYYA 2CCKA 3WKDA 4E08A 2QRZA 4CR7A 2W6PA 1BD4A 4S0XA 2QTLA 4QXPA 1H4VB 3JALB 4DUPA 2WU4A 1NQWA 3DMHA 8GPBA 4E7OA 4QREA 3K15A 4QBGB 1II8B 4N8SA 5BORA 1RBMA 5DN9A 2DHCA 3IAXA 1YFLA 2NIPA 4D9EA 1W44A 1MDBA 3LT5A 1NNLA 2EKDA 5IH3A 1RU3A 4CM4A 4EPYA 1WLSA 4RHTA 5CNIA 4DT1A 3FB1A 1KBZA 2WIFA 5DGIA 4OFWA 1MRSA 1GV0A 3SFTA 3RU9A 1RI2A 1EP3B 2XYRA 3T5CA 2PL3A 4BQSA 1KDPA 4A6EA 1V5FA 3I72A 2VRCA 4JOQA 1TM5E 1Z0DA 4LEIA 1A50B 1LRKA 4GVXA 3KU4A 5EKDA 4B75A 1HTTA 1BDIA 1OYOA 3JRXA 3TSYA 4GD3Q 4J0GA 4I99A 1V41E 2X5JO 3ASZA 4MVJG 1W73A 4I1PA 4YAWA 1XXLA 3FOBA 1X13A 1IQRA 3MJCA 4L4ZA 3FNQA 4RPGA 4A8TA 4BX2A 3JRWA 2JLAA 3K5WA 3DHEA 5HF9A 3IXMA 3MTJA 3NUQA 5TT1A 4IOJA 1M8PA 4K87A 4KVZA 4GI3A 3GJQA 1HE8B 1M72A 5DK6A 3T15A 4D92A 3V8RA 2WV9A 2WJ6A 3KPJA 4TUYA 4JB2A 5M2QA 2XOKD 3W5CA 3N07A 3QRWA 3DMFA 2NO1A 2QM8A 4Q3DA 2QIPA 3ZWQA 4JMPA 5FX2A 2P3OA 1IY1A 3AUKA 4B43A 2WLSA 4MS3A 421PA 1ZAKA 2B37A 3DPSA 1G1MA 2YWDA 3MT8A 1USIA 5IYZB 3FETA 2XT0A 3NJ8A 4AZ3A 4CKZA 4HN9A 4Y6SA 3L04A 4A0FA 2DQKA 1X1DA 2YWXA 5KYNA 4DCUA 3LCMA 2P7IA 3DVQX 1IHYA 1GCAA 2J5XA 1F48A 1X80B 2WOOA 5KSOA 1AKVA 1G66A 4PNHA 3UT0A 1BEUB 3KXPA 6CHYA 3BWBA 4YRGA 3LDAA 3DFZA 1B8UA 1T0BA 4FMBB 5DTIA 3HM9A 3P0IA 1KP9A 4TV9B 4U7HA 5FI5A 4F6RB 1K1EA 3PNQA 1JX6A 1QF7A 1V48A 1ML4A 4IDOA 2B6HA 4LDZA 4EF4A 3CR7A 1BVHA 1DIGA 4N6NA 4OK3A 1N2CE 2AC2A 3HJBA 1ESEA 2F3RA 5TGZA 3MIZA 3LFHA 1ELOA 1WXGA 4DMCA 1VIMA 2L69A 5LN1A 1LBEA 2G1JA 1B0AA 1P0IA 5EVCA 4AKGA 1NRJB 2WG1A 1ZGHA 3GFGA 2H5JA 4H18A 3WGYA 5KJCA 1G7SA 2X8LA 1RWOA 3BFXA 1XZKA 1OYWA 2PZBA 4E5YA 4FC7A 1Q0LA 1MO5A 3H2ZA 5BR7A 4N3NA 3FCAA 4K9KA 4FW9A 4DYDA 1H2HA 1CRPA 4H7DA 2OK7A 4CT0A 3R3XA 3EOAI 3H9QA 4RF4A 3OU7A 4LSGA 4C4TA 4TRRA 4D3SA 2E48A 2OL4A 3PA6A 3VR6A 5A9TA 4NE2A 3ZHYA 3BTOA 1PG2A 2JGEA 4PFKA 4JCCA 2IT1A 1J9GA 3UMSA 4WXHA 2AE2A 2PLFA 4CQMD 3AEKA 1A4UA 3CRRA 1K97A 2MMCA 2PX4A 1FRFS 3C5CA 1CUIA 4ETMA 3T1TA 1PWEA 2EX0A 1YAHA 3KKNA 3U3KA 4J9UE 3FPKA 1TA9A 2UVPA 4MVJH 1P39A 3TM4A 3NHUA 4OF4A 4BLPA 5CVVA 1YS2X 3L40A 2C5HA 1DPGA 3QXXA 4ZV4A 1LVHA 4MV4A 4DLXA 2Z9BA 3WA6A 2FW6A 2Z8ZA 4RYDA 4HDNA 2H07A 1AS0A 1W1UA 3G1TA 4CTMA 1IXYA 4LF8B 4Y9UA 2X40A 3EEIA 3LF1A 1OV6A 3QTBA 3QVXA 3LOPA 1GCIA 2DR3A 3E5MA 3GJ8A 1P72A 1PJ2A 1L0BA 1ZHOA 2O3SA 3AL2A 2CJXA 3IMKA 3LECA 3NP9A 5ED0A 2DPLA 1NIPA 5B6IA 5IANA 3TW8A 2Y1WA 1XPUA 3LNTA 1SO8A 1I0IA 5H59A 5LL6P 1V71A 3KAKA 1Y8RA 2JIZA 4MS4A 2ZJFA 2XVYA 2VPIA 3A05A 2HV9A 3D7NA 5DNDA 4IEIA 3WI7A 3PFNA 3Q1KA 4RD2A 3EULA 3SKVA 1CNMA 2C2HA 2IHTA 3N2YA 2DBYA 4NDNE 2C20A 4HT3B 1ZNQO 3RT9A 4C7KA 1KDZA 4CG0A 2QGZA 5EMMA 1N57A 1GAJA 1SHTX 3EGOA 1SXPA 3FLAA 2RJ3A 3E7FA 3DKPA 3WRXC 1M5TA 4ZJUA 1U1DA 3TZ6A 4TLBA 1QFZA 3H8WA 3EPPA 3TAHA 3D7LA 2BTOA 2HADA 2ZTMA 1R66A 2ZI3A 2H1CA 4L7VA 4X41A 4ZAFA 3LXUX 1S2DA 4GRDA 2AE1A 1L8AA 2R44A 4BMSA 1Y9AA 1AZTA 3AY6A 1UJ2A 2DF8A 1AMOA 2KWIA 3S7ZA 5DM4A 4MV7A 3NT2A 4W6QA 4BWFB 3L0YA 5DRYA 2EQAA 3GJ5A 2JJ8A 3PNKA 2TSYB 3F3SA 4UEOA 5BV2P 3BTUA 5C5DA 4MIYA 4JL8A 1EINA 2F2TA 3HFSA 5J5AA 1K8QA 2WMDA 3JY6A 4I1SA 5KU1A 1KH1A 4YRNA 2WUDA 4MWEA 5CRIA 4M99A 4D80A 3NANA 1JB9A 2ZFUA 3AK4A 5H7XA 1GTRA 4JXJA 2OO3A 5JLAA 4D9NA 3BK2A 2ZANA 4HNUA 1EDOA 5I7FA 5ITZA 2FHSA 4XQEA 4EG5A 2GI4A 4B6SA 4ECAA 1FNNA 3K6SB 3K70C 4ATNA 1OXSC 2YXBA 4HAYA 3PEVA 5J1TB 4OAPA 1M1NB 5T4HA 2N1BA 3TOSA 4KQ6A 3VPDA 3W8DA 1FTYA 4OXKA 3W3AD 1XC7A 4YJGB 1APBA 4XGKA 3GK3A 1T9HA 2BFCB 1Y82A 4XSHA 1Q12A 4ZARA 3TVDA 2WPDD 2OWDA 4BASA 4TN1A 5THKA 1DBIA 4O4IB 2C0CA 4C7VA 1ZY2A 4Q3NA 5FBKA 3LLUA 4JLSA 5EJAA 1XTPA 1NQ5A 1XT6A 2RGYA 3BSYA 2Z3WA 3P2IA 3P96A 4FGUA 4RVOA 2YOFA 3RWOA 4CV0A 5E2IA 2CL5A 4BEVA 2X8JB 3KKZA 1S2NA 3QELA 1IN6A 2VPZA 3B12A 4WBSA 3U17A 3V9AA 3ZZ0A 4DV2B 1HX7A 4F0KB 4QHSA 3EA5A 3TGWA 3EEOA 2R6CA 5ERGB 3PJDA 4C9BA 4EA6A 1Z4JA 1ES9A 4FFOA 3VDXA 1UJCA 4O3MA 4LXXA 3Q3GE 1XI2A 3MT0A 1Q0QA 2RCNA 1E7MA 1H1LB 3KR9A 1FTQA 4XM2A