3U56A

Crystal structure of mutant ribosomal protein t217v tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTVMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystal structure of ribosomal protein tthl1 in complex with 80nt 23s rna from thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Rna/rna binding protein
total genus 71
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3u56A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u56A02
1CJSA 4DFCB 4QGBA 1U63A 1MZPA 2HW8A 3FPNA 1I2AA 3UMYA 1AD2A 5DM70 3ZQJA 3U56A 3QOYA 3TG8A 4LQ4A 4QVIA 4QG3A 4F9TA 3U4MA 5DM60 1ZHOA 4REOA 1DWUA
chains in the Genus database with same CATH superfamily
1XZJA 4HB3A 4NR0A 4QUDA 4YJFB 3TQFA 1X7HA 3AXSA 3H86A 4K8RB 2A1TS 1WXHA 3ENNA 3S1SA 3T3OA 3ZDBA 5HBRA 4DF3A 2W6NA 1AA9A 4D9MA 4F5ZA 2M6SA 1OH8A 3M6AA 4GC9A 1T6XA 2Q3MA 3GVHA 3PFKA 5DBOA 5BUZA 1Z7GA 2PD3A 3EEFA 3JPWA 3QKWA 5D1HA 3OA2A 3KEGA 3SZMA 3SJ7A 1V71A 4NHOA 2WQZA 3JASA 3ZQ4A 4D9GA 4TXNA 3AI1A 2PBLA 4P3PA 3D7NA 5DOZA 2E4XA 1LH0A 4PLVA 1IXRC 1KZGB 4DDHA 1IN4A 4RJLA 2N75A 5DH9A 4OU4A 3DCNA 2B2XA 4I1RA 4M36A 1R4MB 4BNGA 4FBMA 4EJSB 1E3EA 2XDAA 1YHYA 2NQTA 2AZMA 1BEEA 2QMOA 2V03A 4HAZA 3WLTA 2CUKA 3VR6H 1YRLA 3ENVA 1QZ3A 2P9JA 2GJ8A 2FR1A 3ZLUA 3T3DA 3UJHA 4W8GA 7ABPA 3K30A 4X9XA 2XYQA 5F21A 3RANA 2IBMA 4J9VA 3TZ6A 5ITVA 3EWNA 4OA5A 1N2IA 3KR1A 3DLBA 1GDHA 1JSLA 1WDKA 1NN3A 4AY6A 2IY8A 2XYRA 5BRNA 1GUYA 3GAZA 4KXUA 3AYZB 1XV5A 1JFFA 1D5CA 1T1IA 1YR8A 3FYSA 4F86A 3HN7A 3IAAA 4B3XA 4C20A 1U0HC 1N3IA 4LDNA 3L04A 5I7VA 3M89A 2C3YA 2PA0A 2VH2A 3NBAA 4RKEA 3DC7A 4HI0E 1BKDR 1GPJA 3FGOA 5CA0A 1C3VA 1GAEO 2DCMA 2ZETA 2JJ2A 3MD0A 1L5MA 1QRUA 1CUCA 4LQDA 3S28A 5M34A 1WVIA 1MZVA 1BO6A 4HTFA 4KAXA 3K6SA 1ATZA 3EXEA 2IW1A 3FM9A 4M98A 3PHJA 4G5YA 4KYIB 4XPZA 1WBJB 1IJKA 4OLJA 4RBNA 4OREX 1PJCA 2P9BA 3UCEA 3RKRA 4GBJA 3JQ8A 4QVIA 3QI7A 3DDUA 1PHPA 3AR4A 3IE1A 5A1JA 4D56A 4YUXA 2X5KO 3O2QB 4IJUA 1C9DB 8RUCI 3DOOA 2QYSA 1A82A 2UZ3A 3RLFA 3VPHA 1DB3A 5E1DA 2BFAA 3B1XA 2J7KA 2E9SA 5JDCC 5ULLA 3R7NA 3WGYA 1N75A 3W2GA 4YJ2A 4CMBA 3GJ7A 1G3MA 2GOYA 4DCSA 2VHXA 4PPGA 1G4AE 2Z3WA 1RAHA 2IYPA 4WESA 3WLNA 2WD7A 1E61A 5EQTA 2JGLA 3LYLA 2BCJQ 1W0JD 3CB2A 4ZOLA 4YDRA 4JWKA 2LW7A 2EKBA 1EX1A 4Y6QA 1EVEA 1KNQA 1DC5A 2EFDB 1K0UA 5CLIA 4NMMA 1O58A 2XHEA 1GKKA 2JBHA 1Z8DA 2ZLBA 2MTBA 2VBCA 3TRIA 1I4EB 5CVCA 1OKKD 4OXXA 1G55A 3BRSA 4LRTB 5ESDA 5LB4A 3DZ8A 4G5OA 2Z8ZA 5EYPB 2CUNA 3G2LA 1CU1A 2W4QA 2BAGA 1C3LA 1CQWA 4K40A 4Q01A 3T1VA 1XQ9A 2GF0A 1T4CB 3IGFA 1W49A 3JWPA 3NEJA 4L1KA 3UOGA 4NVRA 3EUFA 5KWSA 4H60A 3DFIA 3D1LA 4MRVA 4QAJA 5CGZA 2A7QA 3WGZA 4S04A 1GPDG 1HT0A 2ZT5A 1HWYA 4WY2A 1ZBQA 4IOKA 5AXAA 5BNFA 2C7PA 1X3LA 4MK4A 1GARA 1ZOPA 1SQ5A 4JSTA 4A15A 3IXMA 1G2IA 4QBTA 3ZJUA 1D9ZA 3FCEA 3OO0A 5D6NA 4C7KA 2UZ1B 5IKMA 2QAGC 5A7HA 3AJ8A 1M6YA 2C1ZA 3CS3A 5CJPA 3W6UA 4D80A 5IASA 4YA6A 4Q03A 4HPJB 2J09A 2EV9A 1V2HE 1NFFA 4PTLA 4NBVA 3ZY6A 3LLSA 4QBGB 2QVCA 2ZT7A 4HNQA 2WQ6A 5FUWA 1UPCA 1ZUIA 4CW7A 1VG8A 3CVYA 2PRSA 4FQ7A 2A1TR 1Y8QB 1A8PA 3CBQA 2QW1A 2MOKA 3C8DA 4G23A 4WLFA 4JP8A 4XH9B 2G83A 2G9RA 4C06A 1RM5A 1XAHA 1Y4DE 1EAMA 2CXOA 1PNTA 2JHCA 2OR3A 1T15A 4LYFA 2FKAA 4RF2A 4KNYA 3L0IB 2WJIA 2XB9A 4MVXA 4I14A 4R7GA 3HHPA 4C7OA 3C1UA 3B1JA 4AJLA 3EUWA 4FHZA 4ABYA 5A4KA 2JVKA 5DSZA 3TNLA 5HJEA 1YASA 7AT1A 1NE2A 4PC2A 4UUMA 4F9TA 3ZQKA 4C21A 1SXQA 1XP8A 4NEQA 3CA8A 1C8KA 3EZFA 3WDSA 4YUAA 4II3A 1SWWA 2R7KA 1QIEA 2WT8A 4ZTZB 2VEDA 2FJUA 1R6TA 3EXFA 2ZYRA 3NBMA 2PX0A 4YRRA 1TGYA 3QBTA 3FOCA 5BSTA 5CFOA 1OI4A 1JILA 1UOEA 3A6KA 2ZAIA 4NJMB 4F92B 4QPJC 1GGHA 2ZIVB 1D1TA 4RHCA 4EB6A 3UWPA 4N9QA 1ZNXA 4ZFNA 3MHPA 5CDUA 1LSSA 1CUZA 2OGSA 1ZAKA 4ZO6A 1U80A 1JIQA 4B17A 4K6MA 3WGOA 2XE4A 4WECA 5JAZA 2FW9A 3LIIA 3JRWA 4BNUA 5LMZA 3S2IA 1JT9A 1TZ2A 4HV4A 4F06A 2O6HA 2AI3A 2XNCA 4YAGA 4UTZA 4AS2A 2A1IA 3RYFA 1TCVA 4URXR 4LYGA 3EZNA 1H23A 3FAZA 4BMNA 4AY4A 2J45A 4MLDA 4I9HA 3WO0A 4B2YA 4DM4A 4EB0A 2JFNA 2NYVA 3WOHA 1IWAB 1AC5A 4ALNA 4KODA 2FWMX 3G82C 4FX2A 1F1JA 1UODA 4RSGA 1Q0ZA 1WSWA 3L40A 5JVDF 1GNLA 4MEAA 4MVJD 1VSBA 5AHXA 2JGEA 4JBHA 4ZK2A 1NQTA 4OIFA 3ZPXA 2VNSA 2HF8A 1J2UA 2X0KA 3D1VA 2VJBA 3E3NA 3OZTA 2H2GA 1EUQA 4YJGB 2QJRA 3IAEA 1D4FA 2J31A 3EG9A 5C8YF 2PSSA 4MQEB 3QPBA 2OESA 2REQB 2DFDA 2BM0A 5IZ4A 5LYJF 3NHAA 3CX4A 5EIOA 3B53X 3G49A 3A4MA 3QVTA 2GAFA 3A6FA 3O90A 4M53A 1QF7A 5K0BA 1IOLA 4J0KA 3WNQA 4Q7KA 1JWLA 4ZCTA 3GBSA 4OOFA 3TTUA 2WSYB 3IBSA 4WA8A 2FKNA 3ZJ5A 2HQRA 3JD4A 3MMPA 4JU9A 5L6MB 1VL1A 4RUKA 4WH0A 4TKUB 2BUBA 5HKKA 5F9FA 2AHOA 5B4VA 3QE0A 4ONEA 3O8OB 2I5PO 4DV6B 3PTLA 1K8QA 2FP4A 4DLLA 3RYHB 2PKWA 4L22A 1P6UA 3Q3CA 2XMCA 4LKRA 4MQUA 3RYIA 3LVBA 3UXEA 5CB6A 5EJ8A 2IXEA 2AMVA 4O29A 5JSYA 5T4FA 1RYNA 3ELYA 1P39A 2PAFA 3AWDA 1CR6A 3EDCA 3HDJA 4EEXA 4N0EA 4BNYA 2JI9A 3K5IA 2P5TB 5CH5A 1HDCA 2H1WA 4AZTA 5AJUA 3VU9B 2BFBB 3V5NA 3VNUA 4CETA 5G53C 4KXMA 4D7AA 4G5HA 1CR2A 4OP1A 4XB1A 7MHTA 3E2MA 5E8RA 3QEMB 4TTVA 4NATA 4X5OA 5AICA 1ZHFA 2JJQA 5CT6A 4BRSA 3PIIA 3MM4A 4YMVA 2JK0A 5IYZF 2J67A 4F9GA 4DRXB 2RE8A 4MMXB 1AKMA 1YUMA 1T4MA 3O03A 3ROFA 3K0SA 3MT9A 4PANA 1IBKB 2C2KA 4EVRA 1GPKA 1OLXA 1T0BA 2NQ8A 4IGIA 4E5YA 3K9BA 3GLIB 1N5OX 3C3KA 4L9AA 4ZC1A 4KUGA 4C0HA 1B42A 3I8OA 4TKMA 5DTEA 4ZVTA 4JJGA 1UMCA 1VGQA 2KB0A 3LZDA 2QWXA 3UICA 2J9ZB 2WNIA 4KQ2A 4P3KA 1H4VB 1VCOA 3CNEA 3KVOA 4RF5A 3N1UA 3C14C 3DW3X 5A9TA 2OOKA 1E2NA 4XRGA 1N6LA 3HA3A 2NNLD 3WLOA 2P69A 1X7YB 1JEDA 1GZHB 4MIYA 5H7XA 1UADA 2PS1A 3EGOA 3L8YA 3P9RA 1WU8A 5JD5A 4YHHB 3HI6A 1T1JA 3T3HA 3ZBUA 5SZHB 2I55A 4JHXA 3L7NA 4X1IB 5REQB 4QDXA 1XZMA 3I12A 4NYIQ 1KBQA 3WIEA 1PEYA 2OP1A 1C0EA 4PG5A 2RB5A 1HT3A 2H4FA 1CS0A 3IOMA 1BWSA 4RESA 2QJOA 1LJ8A 5SZKB 4FPXA 4TZ0A 4DIBA 3FHCB 3HVHA 4MUHA 2IQ5A 4KXWA 5I48A 3PK0A 2IJGX 3Q8XB 1RXUA 4CGZA 3KTDA 5JARA 2PRIA 3TD9A 3ZHQA 4JXXA 1NXWA 1XEXB 2V5UA 4XR4A 1W4LA 2YXNA 4QUJA 4CMIB 2WMDA 1E2HA 3Q9NA 1SVLA 1Z5UA 2Z4SA 1HO3A 5JS6A 4E2FA 4HY3A 2PG3A 3OMXA 3B6IA 3I0MA 4EZIA 3WAGA 4Y6OA 1NNLA 1XDGA 1XGKA 4EBFA 2JLAA 1LLQA 2RGXA 4WZAE 1E59A 1T0HB 2IU0A 4FSXA 1VRCA 4JNCA 3WIUA 3JVDA 3NM6B 4CL0A 1HOXA 3IUNA 4PLGA 2FR8C 1K6XA 3DOCA 1TD9A 3JVUA 3LPDA 3NTUA 3EGDB 4FFVA 3CUKA 3UAWA 3GROA 1NVUQ 3MOSA 4M1TA 5GM2A 2JJ1D 2ODBA 2JKZA 5FKJA 3OI7A 1M33A 5EE3A 5EHXA 2LBPA 2R11A 3VH4A 5BUSA 1W93A 4F85A 5P8WA 4YPOA 5LPNA 1G5RA 3ZH2A 3W5UA 4K1XA 1HT1E 2WJ3A 1Z6AA 5U9CA 4YHBA 5EJ4A 3H5RA 2CSUA 4MUBA 5JTUA 3M1IA 5ERXA 3OF5A 1Y1PA 1N5LA 2AZ4A 1E1QA 3IMEA 3JR7A 4LDJA 5TXGA 3PKIA 2C4WA 1J56A 1YJ5A 2QD2A 2HW8A 4JKIA 3ZJ4A 2DHCA 3K2QA 4X63A 1NYRA 1GU7A 1ODIA 4AUKA 3S44A 1XF1A 1HQCA 3TIIA 1U4SA 1DQRA 1G8KA 1ABBA 4XFDA 3BM5A 5CYPA 4GOND 3WRXC 1M6NA 4UXJA 4HYEA 2Y1EA 5FOXA 3W1WA 5AT1A 1OBHA 5CFQA 2C83A 1B4DA 3KXIA 1XDZA 1Q3TA 3TINA 4WLVA 3FN4A 1ZN9A 2J9RA 3QA9A 1QIMA 4G8BA 2XYGA 4MMZB 4CLEA 1NJFA 3B1FA 4RVOA 4BLUA 1XN1A 1RIIA 4LY6A 5B7QA 4DBVO 2VDKB 4P93A 1BDIA 3NP9A 2A9RA 2DUWA 2Q3EA 1GZ4A 3L6EA 3RK0A 3QPUA 2E7ZA 1JFLA 1RJGA 3CHYA 4OBXA 1V4BA 3K1AB 3CLHA 1YUBA 3NI2A 1W5TA 1NOKA 2BE7A 4G4SP 4L5CA 4LCBA 4RAOA 4EMTA 4Q4HB 5FEUA 1IUOA 2J8ZA 3Q8WA 3OEHD 1FXSA 2ZT6A 3F8TA 1OBOA 4UASA 4LMPA 3OY7A 1CVLA 1GU0A 1TYEB 1VLVA 2C5LA 4QPZA 3WLKX 5KCZA 4OL0A 5A4JA 1T8WA 4J07A 2YX1A 4JFRA 5LXTA 4ZIRA 1M2WA 1X2EA 2Q2WA 4I55B 4EJSC 3GLGA 2MMCA 4U8GA 1CT9A 2HI0A 1ZICA 5E4JA 1QFMA 3CSUA 1L6IA 4XWYA 1NI4A 3H2JA 1WNTA 3DTVB 1DKNA 4TKLA 4BAGA 5ICGA 3T1TA 2O4CA 4FB4A 4E13A 1CHNA 1N8KA 2QVLA 3SJZA 3GLUA 2ZBDA 4FZRA 1SHTX 3PJDA 1A96A 4FYHA 3ZCTA 4O59O 2J4DA 3ZR4B 2V97A 2AFIE 3GCDA 1QRDA 1M2HA 3K2IA 4L5BA 3CLRD 4NENA 3RUFA 1USIA 1HPLA 4G09A 3TAXA 4BLOA 2C99A 3OCYA 3O74A 3SZLA 3MN1A 2OLJA 3OY2A 4K0RA 5JZSA 4BJ6A 2YINC 2VPWA 4HNTA 1H2XA 2GEBA 2P4SA 3H9JA 1AO3A 1RP1A 3ROEA 1JAXA 1M66A 1EWYA 1XTBA 3HYLA 2HIGA 3IPCA 1GRRA 1NA5A 5FEMA 5JS7A 1Q50A 1WDDS 5KNCD 1AB6A 3MYYA 4GOKA 4N3CA 4IIYA 4RTOA 1X19A 4R5HA 1B7GO 1NF3A 1NBIA 1XRQA 4OHUA 4Q9AA 4U00A 2HYIC 2OCDA 1ZD3A 2PQ0A 3JD3A 2CFRA 1P75A 2VH1A 4NV0A 5LQSA 5HUQA 1PYOA 1SUCA 1QV9A 4WD3A 3JS5A 2R4UA 4YAKA 2ECKA 3QI2A 4K1LA 5THXA 1SQFA 1Z0IA 3CVUA 3LY5A 1FX0B 1UKVY 5AVZA 4D8TA 3BXHA 1OHHD 2IU4A 2ZSJA 2OUKA 3H87A 4OHWA 4P83A 4Q1VA 1M6VB 5I51A 1UJCA 2GEUA 2CYBA 3MMXA 1A71A 1U2GC 1VDZA 2JAHA 3LUHA 4X1KB 3VX4A 1XMIA 1ZHHA 4Q3EA 4EG7A 5SY4A 1XT6A 5LA6A 4C87A 2FDRA 2FMHA 4YDQA 5LFAA 4MR7B 3I53A 4BNTA 3F6CA 1K98A 2JB9A 4ZDIA 1P1KA 3AH8A 4WKPA 4IIDA 2UUAB 4BZZA 1Z4QA 4HFRA 3PGA1 1F8FA 4ZVKA 4DFDA 1CHDA 3AR5A 2DQKA 3QFRA 4P3XA 3UFBA 3VNRA 1XZDA 2NU9A 4EW1A 4H0CA 4CL2A 2WVAA 5ENVA 1CQZA 1ACJA 1EUDB 1G63A 2QJTA 4P36A 4UAGA 1OVMA 3TTYA 1KRWA 2NTVA 1J49A 1HT2E 1UC8A 2O3RA 3RB8A 5LR6A 1ZBDA 3UMRA 3C3EA 3FJYA 3JVVA 4JYPA 3T5GA 3JQPA 2ZYHA 3VYRB 1TPYA 3EGXB 2O8BA 1PJRA 1P31A 2QTWB 3KUDA 3ASYA 3SKVA 4EVIA 3AEUB 5FNVF 1RLDS 1SWVA 1E4EB 4B5LA 5DNYB 1VPLA 3V32A 4B5KA 4E21A 2WT4A 2EP5A 1QQAA 4U7FA 1LD3A 5M3BA 1ZZEA 4XD2A 2B1JA 3FWHA 4M8NE 1YZHA 4QOJA 2W6QA 4HH0A 1P9LA 1A95A 1GPBA 1BWVS 5HA5A 4D26A 2QT9A 1H0KA 2ZVPX 2H08A 2X7JA 3A28A 1EKXA 3BDIA 4FONA 5BR1A 4Z1OA 1ZP6A 1CYEA 3U4HA 4ND2A 2AOUB 2RHCA 1GG2A 1U4OA 5D00A 3AERA 3CLTD 3OCZA 1G7SA 4PV7A 4XAQA 1KZ7B 3ED5A 2G6BA 2QRGA 3A1CA 3CZ4A 1OT5A 3O0TA 2P3QA 5HIKA 2NZWA 3SYRA 3LC1O 2P4EA 2UVPB 1N4AA 1VI2A 2GCOA 5E3IA 3VPXA 3WJ1A 4EGCB 1XZAA 2C31A 2YQ5A 1KU0A 5AW0A 3WAJA 4JQZA 2IYVA 5ALFA 3QLUC 2ZYWX 1CP3A 1OYOA 3VAYA 3TM5A 3D6JA 2QRZA 1ZA2A 2ZR0A 2VSQA 1JIVA 1ANKA 4ZGGA 3B7WA 3AESB 1Z0UA 4IBOA 1OF1A 4IR7A 1KI6A 4QRDA 3S55A 4BLRA 3GUHA 4BQQA 1RQLA 3DUFB 2QE7A 1X13A 4Z9AA 1R0CA 2XQKA 1SOMA 5IULC 4L5IA 4LN1A 2P1DA 4CQJA 2W2KB 3HHEA 1WXWA 1IK6A 1ZLXA 3LKBA 4WJZA 2XSZA 1GTMA 1LX7A 4MV3A 2GESA 4YCCA 1ZOLA 4GU5A 1DEOA 4FR0A 1IR21 2FPGA 1N1EA 3M8KA 4A36A 3U7JA 2AN1A 5LDHA 4O4HF 3HQ4O 3QVSA 2FZEA 4G1VA 2XQJA 3X1WA 4NH0A 3VYVA 5KYGA 2XGJA 1N0WA 4UHEA 4BNFA 1FFSA 3VU1A 5BYKA 1NX9A 2QRNA 3D81A 2I76A 3REQA 4TVOA 2RK6A 1ZWKA 4G5FA 3CLUD 3LY9A 3PJFA 4M1YA 4LSMA 5AKJA 3RC7A 4UTXA 3UCFA 4AMZA 1E5VA 2O7QA 1C9MA 3ICVA 4XARA 5KAPA 2V0GA 2PZJA 1OWLA 1OOEA 3AU9A 3GRPA 4TMKA 5KPDA 2ZR7A 5EKDA 4KE7A 4TWRA 3ILXA 2I3DA 5TNXA 2DKNA 3QPVA 4LCEA 4B84A 1XVTA 3KK0A 1UBUS 2OKGA 3BHIA 1DO0A 2GN4A 5AYVA 4PZZA 5ANRB 3KDSE 2QENA 3P1JA 2D0IA 1NXQA 1FMLA 4HPWA 2HPAA 3UMBA 4YPVA 2P77A 4V03A 3VMMA 2OE2A 5KOJA 2HSGA 1F9AA 2RJOA 4FLMA 4URVR 2I91A 4Z4GA 4TUYF 1JLSA 4W9RA 4NOLA 2P9GA 1XRSB 1EFTA 1AKWA 4C6HA 3D2BA 1A5ZA 3HLTA 4MTCA 3TXXA 2GCIA 2ZPUA 1SMKA 1TTHA 1LNSA 2J41A 3RTAA 3BD8A 3O84A 2WSSA 821PA 4QOGA 1CZLA 4ND8B 2LR0A 4RFSA 1N3YA 2WIAA 1ZISA 3GJ8A 4KXQA 4RU1A 1EM6A 1ECJA 3DW1X 1WV0A 3N8DA 4N4AA 3MWKA 5EZSA 3R8XA 3ES9A 4XASA 3D4PA 1QPBA 2PGDA 4HYQA 1IXYA 1VB3A 3GXBA 4FMBB 2JFYA 1KETA 4MQMA 1LPSA 1TGVA 2PBRA 2FFBA 3L07A 5FAXA 4JP3A 5TS3A 1PG2A 1DIBA 4TZKA 3KTFA 3DOFA 5DFAA 5T6MA 2BKUA 4CIAA 4AKGA 4O4LA 2P7HA 9LDTA 3EUAA 4NDAA 5AW2A 4IH9A 2AS0A 1P6XA 4B3GA 4RKYA 4YB8A 4JJ6A 1WR8A 3H2IA 2IHTA 3QVMA 3UK2A 4ER7A 4KR3A 2CDAA 4QARA 4R81A 4WADA 1LPMA 1UBSB 5EUCA 2NUTA 3GDHA 3ANLA 3I39X 1EVQA 1MC8A 4A8PA 1G291 2ON6A 3ITDA 3V2HA 3A04A 3VOBA 4DPKA 3U6BA 1NQWA 4ND3A 2IFTA 2X0IA 2HUNA 1YC2A 5JSHA 2VAPA 2Q45A 3R7BA 3LBAA 2H17A 1CWUA 3FLBA 2PFKA 1EGAA 3DD1A 3L0CA 2H48A 3M6XA 4F4UA 3QYFA 3O94A 1OLSB 3ABRB 2NZ8A 3NDRA 5H59A 1RHJA 3R74A 1X39A 3B5JA 2A86A 3U7IA 5TPWA 3CVOA 2RKBA 1GQYA 3G7SA 1BH6A 3G1TA 2AOVA 1DWQA 3WE7A 3KLNA 2QK4A 4MGYR 5JRZA 1H1LA 3KC2A 3ICWA 1X1RA 2GEDA 5C8YB 1EXNA 4BQSA 4TV8A 5FOQA 3PQ3A 3LUCA 3DE3X 2E3JA 1H3FA 5LP6F 3T9AA 3FOZA 3VR6D 1I4DD 1FOEB 2R00C 3ZDDA 1E64A 2H5IA 3JTMA 3QFHA 4TM8A 2OQ2A 2FEAA 3QU5A 3UMMA 1XZGA 1V16A 5IPFA 3T5BA 2BKEA 2D4AA 3ABQB 1GLGA 3E0QA 3FGNA 3MJTA 2PRJA 5HQTA 2ZVJA 2ZYIA 2FWPA 4KX5A 5KYXA 3BULA 3UHFA 3QVJA 3RSQA 1C1DB 4FTWA 4PLWA 2W90A 1JDBB 4BWGA 4FFBB 4DUGD 3IRVA 4F3NA 1UWLA 1G42A 2X42A 4MUAA 4ZCMA 1B0ZA 1KSHA 3ED1A 4OQMA 1KS9A 1S2DA 1T9KA 2FWJA 4UNPA 3IP9A 2Y1OA 2PQMA 1X38A 2XZLA 4ZI7F 4WOJA 3RCBA 3OFND 4MI3A 4UVGA 5ALKA 2ZAOA 3QUQA 4MPTA 4CQMA 2FZWA 1WM1A 1RXVA 1D2EA 1ST2A 4OHKA 1SXHA 3VZSA 2QKYA 3NIDB 3CQ9A 3TJRA 1DKMA 4B6FA 1B8VA 1J4AA 3L4KA 3FNQA 3CH4B 3ZGLA 1CF9A 2OECA 3FUWA 3OSUA 4XIFA 5EXTA 2FMXA 3AY0A 3M1AA 2CFTA 3KOYA 1OH5A 1U1GA 2OV6A 3SHOA 3DV9A 4DAEA 1UDRA 3NGLA 1ATIA 3ND5A 1H2FA 5KPJA 1ZGHA 4EDFA 1V3QE 4NG5A 2IEYA 4E0BA 3V42A 5KYWB 2HQSA 2NO0A 1JJ7A 1DDOA 5DHPA 4TLCA 2EL7A 5AJTA 4TLEA 3ZGOA 2BMFA 3K9FC 4D8XA 1L7VC 1OZFA 1WJGA 3S2UA 1QKKA 2VSOA 2YNMD 4XFKA 3THWB 4PPQA 1QO0A 5CX1A 3GPLA 4JJEA 4EX6A 3DAOA 2C54A 2X2FA 2WM2A 3GJSA 1YV9A 1TLTA 4UOZA 3GDFA 3HY4A 1QK3A 5B1IA 3G8AA 2MU1A 5A3QA 5K0FA 4QPNA 2JD1A 1Z5VA 1JECA 4IOLA 5LOVF 1VE1A 2Q4EA 2MSKA 2RGWA 3IERA 1S8OA 3KD3A 3I2FA 4QUAA 1FS4A 1C1XA 1J33A 4HEQA 2R60A 4UC0A 3TUZC 3A9WA 1HI9A 3Q9UA 1JB9A 4WZBA 3C24A 1ORWA 2PJRA 1UK6A 2IEZA 3BFXA 1S9DA 1WAMA 4IJVA 1G20B 2I1LA 2QPTA 3NKVA 5HF8A 4DNFA 1V41E 4XYLA 1N77A 1T5IA 2EFYA 1GZUA 2DPLA 1XRMA 3BSYA 1YULA 3WYCA 5HTOA 1BZYA 4PC7A 1N34B 3HMQA 2OZVA 4NXMB 1IK4A 1EIWA 4PQGA 4NQZA 1FFAA 5HRCA 5JZ9A 3HE3A 1IRXA 4U2CA 3EVAA 3G2NA 2F3UA 3OZGA 1UF9A 4OA8A 3V9PA 1VLMA 3K5WA 4EKNB 1W19A 1BSVA 3LOUA 3PGVA 4QOFA 5TEVA 3SEZA 2AFRA 1CDEA 3DMNA 1KJIA 1KFEB 3DHNA 5EGSA 5SZIA 5KJCA 3KT6A 1LLFA 2AG0A 3G0IA 4YMWA 3HDHA 1CY8A 1O6FA 2EIHA 3HJCA 1KJ8A 2GSDA 4F2DA 5ARBA 1R66A 3OZDA 3GJ4A 5I7WA 2P0EA 3NHKA 2AUNA 3GT7A 2ZAMA 3DDCA 4Q0MA 2PGAA 4H3KB 2BZSA 5JCZA 4AZ3A 3SHWA 4MDYA 1HA3A 3IR6A 4MZDA 4WJKB 5DWDA 5TS2A 1FPQA 2BI4A 1QRTA 1R4AA 4AYTA 4TT3A 4IZOA 1BMFA 2F3QA 1DIGA 1G3UA 2IXBA 3H19A 1CX9B 4WW0A 4E6EA 5EWJA 5A9RA 4JQSA 4O2AB 2J3HA 4BNHA 3WMWA 4HJXA 2X1VA 3HBJA 4DNXA 3UT5B 4Z7JA 1XLVA 5C5CA 1EWTA 1HYGA 1IHPA 3G8DA 3LX5A 2OTCA 1ZWLA 2DLDA 2EARA 4GWGA 5LKAA 4XIGS 1PJ2A 3JATB 3AETB 4CMCA 1NNI1 5EKUA 1XHFA 3M6IA 1ECFA 4PXSA 4GX5A 4A2QA 2KQUA 1H8HA 1E6KA 5ES3A 2YASA 2Z2JA 3PHLA 4D6XA 3NPAA 3PI7A 4Q9KA 3MCAA 4S1PA 4LGCA 1OXXK 1TEXA 3A58B 3QY9A 5THQA 3R20A 1E9EA 5KOHB 2K87A 2WP0A 3RJMA 4DLAA 5CEJA 4HNRA 4ER5A 2BMVA 3DFZA 4CNBA 2H7YA 3NHZA 1DC6A 1QCYA 2XV1A 4I1OA 4MUGA 4R51A 4RFLA 2GF2A 2YCBA 5DM70 5ELMA 3STVA 2Q3BA 4W1SA 1R8XA 3T5TA 4A73A 1RWMA 3OC6A 4DV0B 3D6FA 4KBYA 1SU6A 3J81A 1Z3CA 3F5QA 4G84A 5E6RA 1JPVA 3JSAA 4A7PA 1UP4A 4I4CA 3BYZA 5K7SA 2V7VA 2GPBA 1FFXA 1E66A 3RHFA 1ISGA 3H9EO 5AM0A 2Y67A 2Z1NA 3E9ZA 1N3LA 3WBFA 2OHFA 4RK6A 2F2TA 3ZDQA 1I9GA 3MSCA 4LTMA 1Q7EA 2PY6A 4DLTA 2AVNA 2H8KA 3G6KA 1GL7A 4N3BA 2FWIA 4HFJA 3EIUA 2H8GA 4J1SA 1G6KA 1NRIA 4GNKA 3TRKA 3WKCA 4FBGA 1F5SA 1UJ4A 3G9ZA 3TLKA 1HEYA 1MHTA 2P41A 5AHOA 3GJRA 4K28A 3DEHA 1VRVA 3O73A 2HHAA 3UJ6A 3WLEA 1NONA 2HDWA 3BZUA 4CCSA 3IDSA 3K05A 5L7WA 3TDNA 4HC4A 5E4YA 3RSHA 4K6CA 1KK1A 1CUGA 4N7RA 3GD5A 4F6LA 1N6OA 3RAEC 4YP0A 3WICA 5FTMA 2CXXA 4CKCB 1WUJS 3KP1A 1XEAA 2ZVQX 5DLEA 3BGIA 3BX1A 3LA6A 2XAUA 1D0VA 1RHUA 3LXRA 1X8KA 3LC0A 4UD2A 2ODNA 3WYBA 3RIHA 2BDEA 3EIFA 4IRUB 3WMXA 1L8LA 4R3UC 3DAYA 4KOEC 3VKWA 1H3EA 2BE9A 1S01A 3BIJA 3BHJA 3GVXA 5DM4A 4DYVA 3FUCA 1X7GA 1NRWA 1OFTA 2EFHB 1CSEE 4WY8A 1NPTO 5J5CA 2GCPA 5TQVA 2C2GA 4CLOB 3WJ2A 4LFAB 4BVLA 4JIMA 3U60B 4L6AA 1XNGA 3KETA 2JLRA 3IFSA 1FP2A 4OG2A 5ADWA 4Z9FA 3FKSD 2EJUA 3K1TA 3TL2A 1H2AS 4ON9A 4R0VA 1J00A 2QD1A 2W71A 1ZJ5A 3HS3A 2QN1A 3CLRC 3RRNA 4YRTA 2EBWA 1ML3A 1SBTA 1R8SA 3HB0A 2P90A 3FR7A 4UHCA 3SC2A 3THOA 2BZGA 2ETVA 2N42A 3E1KA 4C78A 2F4NA 4H7DA 4PG6A 4DJAA 3PNSA 2NSHA 1PWEA 3O75A 4MVJI 1NF2A 3JWGA 4Q6WA 4AP9A 4BQRA 1X8LA 4WXPA 1KAMA 3PICA 1GUFA 3WLLA 3QENA 3PXDA 1IIRA 3EFOA 5HZHA 2VQ6A 1XEWY 2JNWA 1ZD8A 1J7KA 4YMSA 5LQRA 3OTOB 5ALNA 1C7FA 1SR8A 5L45A 1IEXA 2I2CA 1LJLA 5KVQA 3V8BA 3KWMA 3TEJA 4FEAA 2WU4A 1KE1A 3F7TA 1KFCB 3GC6A 1Q0HA 2QXTA 4RIIA 2UUBB 3LG2A 2BHLA 4IHAA 4MJ3A 3CG0A 3WYNA 2QTMA 3H7IA 1M2OB 2FWRA 5JAOA 4TL6A 3VTZA 4JS0A 3I4LA 4OGWA 2SKEA 2D5IA 5BQOA 1F7UA 3PD0A 4FFLA 4M6WB 4CLXA 1O94D 1LPAB 2I9KA 1LZLA 4RCZA 5EE1A 4EGFA 2FI1A 1AT1A 1QS0B 2KI5A 2YWGA 4J7AA 3Q3VA 3NTVA 1GUDA 3T3MB 2RGNA 4Z7OB 3SQNA 4NJEB 3D4BA 3AFMA 2NTYC 2GFQA 2B34A 3W06A 1P2TA 5FUBA 4AJOA 1KHTA 4EX7A 1HYHA 3A3NA 1HFWA 2VQ3A 5C0OE 5EESA 5JH7F 1FLVA 2NVUB 1CJUC 1K5PA 2WWWA 4M1EA 4C1NA 4D81A 1G21E 4F96A 2X4IA 4IO1A 3FTFA 1RWVA 4KQWA 2F59A 1NV9A 4JU8A 1UKAA 2G0AA 3AQIA 4F4FA 4RD1A 3WRWA 1XA3A 4JUBA 4MKZA 4Q1AA 2OKCA 4E30A 3I2KA 3WX0A 3M3HA 2I80A 2GNPA 2P9EA 2QX6A 3T5MA 4GMXA 1SA0B 2A0WA 2J3DA 3IAM6 4A82A 2REBA 3GWZA 2H1OA 1K8XB 4LZNA 4OI2A 1T26A 1YR2A 2IZ7A 5J2TB 1GM5A 3G7NA 1GZ3A 1A1VA 4AAYA 5TX7A 1DWPA 2R7MA 5FPSA 2RHHA 5EQJB 1UBOS 4FR5A 4NPAA 5EJAA 2BGWA 3N2IA 4A6DA 1NVAA 2Q46A 1UMBA 1AQUA 4FZ5A 2VTVA 4U2BA 5AW7A 3LVFO 1QGUB 3WFIA 4CLRB 5AHRA 5KQGA 3JAWA 2VUTA 3I1IA 2Q2QA 2J0VA 4IP0A 3M1YA 3N2GA 5CPBA 4F97A 2O7RA 3R0JA 1RC0A 2VYFA 3CLTC 4YNBA 5D3MB 1J9EA 3IUJA 2WICA 2FUKA 4O4IF 2X1HA 3QIAA 3S2EA 4PPNA 3K20A 3OH8A 3TR5A 1AZTA 5BSWA 1VPVA 1DARA 2OG1A 4O4HB 1SXGA 5B3KA 4UM9B 4U02A 1ZRNA 1U3VA 1W9HA 2XR1A 3DAHA 1B2LA 5AESA 1JDSA 2KBFA 2XNDD 3CXUA 2DMRA 1TO2E 1QC5A 3O8QA 3L8CA 4IDGA 4IH1A 3WMRA 1LTKA 3RO7A 2VNJA 3HCWA 4DIMA 4MPPA 2QT1A 2E5LB 5AIBA 2Q07A 4GG1A 4RVUA 5D86A 4A0HA 4HNUA 1SCUB 2PUGA 1FQOA 1E5LA 3PPIA 5F5NA 1DEAA 1HV8A 3R4CA 5ALLA 1NBOA 1GLVA 4MCAA 1KPHA 2J3MA 2ZDQA 2M9MA 2G80A 1XLTA 4CDRA 4FJ2A 4QFBA 3WLFA 3ODGA 3CJRA 2BUAA 4B40A 1AUVA 1D4OA 4FGZA 3SOPA 4EAAA 4KN5A 3P7MA 3WHKA 3EPHA 3E7DA 2V5AA 1IBMB 1S1CA 3ONFA 2JAUA 2NACA 3FTPA 3O2SB 2QA5A 4ZD6A 5CA0F 3I8XA 5ITZB 3VX3A 5I7OA 1TLLA 3P2YA 2PUCA 4TUYB 4CT5A 4KQKA 3CCFA 3CLUC 1KKUA 2GPSA 1JGTA 3RNLA 1JJIA 3H1BA 1WEKA 5JZMA 4KLNA 3D6NB 1SVKA 4QKQA 4P35A 2ZDHA 1BD4A 1HE1C 1ZO8A 4G3XA 2I65A 2OGWA 1ES9A 2O2GA 1S96A 4JH0A 5AHKA 4BO5A 4C3UA 4D9NA 1RJDA 4OGLA 2BEUA 1N8NA 3ONWA 1E99A 4FZ3A 2HZ7A 4Y1RA 3H65A 2BEVA 4YJ2F 4MIEA 1DXQA 5FL7D 3SG0A 3HCOA 5JG7A 1NW5A 2D1FA 4TZ6A 2C5SA 2BR5A 3ZQUA 3W6NA 4KO3S 3MS4A 3B9RA 3PU6A 4HAXA 4GVLA 5IVKA 1RQPA 5FBQB 2C2XA 4D4KA 4J3NA 4H3SA 3V8PA 3K9LA 4Q21A 1UPUA 3TGPA 2R1TA 4YCMA 2PJZA 1QG6A 5IW8A 1PL6A 1ULZA 2ZI6A 4YYEA 1T2NA 2RK4A 2XCTB 5I4BA 2JL1A 4LVOA 5AVKA 3PTAA 2JGDB 4IFTA 4L4SA 4ZAGA 3ABZA 3RR2A 3U44B 2G0TA 5J4YA 2Z4RA 5EQFA 2WVJA 1V8PA 4Q6BA 3PUHA 5KWJA 4JA2A 1ZUHA 3DDOA 3ND6A 3FTNA 3LXXA 4BO8A 3HXQA 3NM5A 3ZVLA 2DCUA 3FW1A 5IBPA 4ZHQF 4GAEA 1SNYA 1TQ8A 4BMZA 1U8TA 3OE7D 4PLCA 1WUKS 2UYOA 3KHSA 4JENA 1GTL1 2RHOA 4OXIA 2WJHA 2RHLA 4R9VA 4OL9A 1Z0JA 2H85A 3OP4A 1O6BA 2BGJA 2B8WA 2FPMA 1J1IA 3JD0A 4RDHA 1KEEA 3OLWA 3R44A 1E3WB 2X2PA 1J90A 1T36A 2BFFA 2GN8A 2IVZA 3BL6A 2XWSA 1K88A 4OXNA 2HZBA 4QYMA 1CG6A 2I22A 3ROGA 4Q1BA 1CUFA 4DQXA 2ANCA 1DQPA 1IBRA 4DXDA 1YHNA 4QGGA 1R6VA 4C7VA 3HKCA 3U6KA 2MSNA 4IDNA 4JL6A 4BIIA 1YB6A 3N9IA 5KQLA 2G6TA 3HNPA 1O8BA 4Q02A 2FN7A 2KSQA 3HZRA 4EM6A 2YIMA 1FEZA 3R5TA 2H5LA 1KFBB 3WIOA 5K3EA 4QO8A 3RFFA 2PX5A 4MZXA 2WJ6A 4KVGA 2YHIB 1EVJA 2G07A 3H5WA 2FF5A 1VL2A 4AM8A 4D8YA 3S8EA 1PDVA 1Y3DE 1EFPA 4M0LA 4Q7MB 1G4UR 1T10A 2HXGA 4GPZA 1BQ4A 1E94E 1L8AA 3OC0A 3UXYA 1WPRA 4C0QC 3EPKA 2P6PA 4X3CA 4HDNB 3ZVMA 4LNUB 4FOTA 2QD5A 3AUAA 2BT4A 5AUOB 9ATCA 3RFXA 4NCBA 2LCQA 2AB0A 2BJWA 1U8AA 3RRMA 2TRSB 3GFSA 2HPZA 1E0SA 4TXLA 1RXYA 1PUJA 2BJVA 2O06A 2ZJ3A 4F12A 1ECPA 5B2ZA 3WS7A 4HPXB 3FVTA 4KDCA 3HGQA 2FQYA 4YROA 4Z4QA 1ID8A 3HWWA 1KI9A 4IHJB 1D0IA 3DV2A 3RVLA 3LLVA 4QYWA 2BISA 4GRIA 4C88A 4CU2A 1OA1A 4DXAA 2D7CA 4WERA 5JD4A 1UBJS 4DUYB 1IAQA 2YWJA 2XE7A 4C76A 1AKNA 1W36D 1V4NA 5J5AA 4OD0A 8MHTA 1P7CA 3KSUA 4FQ5A 2IPLA 1QNLA 4R6XA 1UBCA 3VU0A 3JQCA 4QT0A 1RSCI 3A31A 2IUUA 4Z54A 3A6DA 3R0ZA 4R2IA 3VSEA 1Q7GA 1XCGB 3HU2A 1U31A 1C5KA 1FDVA 1TMOA 3ZHBA 3OQOA 2JDID 2X6RA 5BQ5A 3FB1A 4BN5A 1M2NA 2JA2A 5ES4B 3BHMA 1Y8AA 1QG2A 5DLPA 2FMFA 3H8VA 3WADA 2E5FA 3LM8A 3NYQA 1XMJA 2D74A 2V58A 1WUTA 2WABA 4RXUA 4ZP1A 3WMGA 3VU3A 2CMHA 1NMSA 2QR5A 2JCYA 3BF7A 3CN7A 2HH9A 1YCFA 1Z2AA 4YX9A 4LQ4A 1HZJA 2G06A 2H2WA 1K3TA 3MBOA 3UT0A 4DBLC 5FWXA 3RG2A 3TB6A 1CEXA 4UCQA 4YI5A 4CLDA 3SBDA 1XAGA 4MRMA 4ZT4A 4TV9B 4UOQA 1DSSG 3GBPA 4GP6A 1Z2CA 5E2BA 4V0SA 2OLKA 1G2OA 3MCZA 3MPUA 5CG2A 3LQQA 2IK8A 3LPAA 4MB0A 3UXHA 1QQBA 3QPWA 4ARIA 2DUJA 2AXEA 1H2HA 5JSZA 2Q28A 4WZAB 2YNMC 4E3WA 4KSCA 5KYUB 5LQAA 3C3DA 3WGKA 8AT1A 3VDXA 1GQOA 1U9IC 2X7XA 4QFCA 1UXIA 1XZHA 3NTOA 4XKJA 3O91A 3AM4A 4QFDA 1EUCA 4MW0A 4R2LA 1Z2OX 1OT3A 2IV2X 1DG1G 1W46A 3A3PA 4URYR 2HU5A 2IE0A 4H77A 4CCYB 1YR3A 3N39C 1EFCA 1T1EA 3G5TA 3AVQA 1QH1A 2P9TA 3EYWA 4WK2B 1AMNA 1IVYA 3SYLA 4EH1A 2JLZA 4KGXA 1QHNA 4NS1A 3DZDA 4HL6A 4C5AA 1SD5A 3DGFC 1C2YA 3HUFA 4X8HA 1ODTC 3BRWD 1P0FA 4TL9A 4BMOB 4AX4A 2WJGA 3OOSA 3GLFE 5KYKA 1KQPA 2PU5A 3GJ6A 1FC0A 3CBGA 1L7DA 1UEIA 1DHRA 1U3UA 2GKOA 3CRNA 1I2AA 1X1QA 3O2NA 2ZPAA 3SBXA 1CDOA 1Y8RA 5A0TA 3I2IA 1ORVA 4YBRA 3B85A 3OZVA 2V3CC 4RHXA 3C6KA 3EASA 2QUHA 3DV0A 3DT6A 3RSCA 1L5RA 2Y1KA 1C1YA 1YK1A 2CEKA 3OQIA 4OJKA 3GX1A 2IXAA 4FEGA 1NBME 1X77A 4M37A 4UCWA 2G3YA 2QI9C 2CHFA 2VJOA 1JG2A 3LGAA 2AEJA 2GT1A 5A4DA 1LRLA 2NZXA 2JAWA 4R6WA 5TQ2A 4DABA 5DM60 1XX6A 2YY6A 3FHOA 3G0GA 3MLAA 4MCIA 2OK7A 2CBXA 3DKIA 4IIEA 1GZSA 3TVDA 1XL0A 1Z63A 4UBOA 2EERA 3IPXA 4PFJA 4DJFC 2YW9A 1LWOA 4NI5A 3OE4A 3BD7A 3DMTA 4RY2A 2V96A 1QFSA 5AXBA 1DOHA 4FDLA 5CFPA 5L3SA 4MJLA 1YOVB 4OJQA 4J6FA 3FMFA 4B9AA 4CMHA 1ADBA 4GYWA 4HBGA 2W42A 1JV2B 1CQJA 1WPXA 1P0IA 4JITA 2YJNA 1MAVA 4NU0A 3I01M 1AZLA 1Z62A 4P7BA 3T0FA 4F6RB 1UIMA 2J5QA 5DT2A 1UPMC 4DEYA 4F60A 1BQ3A 2YJ3A 1IR1S 4RLFA 3WLQA 4R05A 3D2AA 1GN8A 3RS9A 2AC4A 1R8JA 1UBFA 3KWFA 3OT1A 1XYGA 2BTOA 5A9SB 1I4TD 4LCJA 1PGOA 1HDIA 1E4YA 2I2AA 4RENA 1E9DA 5TGZA 3RHZA 2HPVA 3K2EA 3P9SA 4G0YA 5FJJA 4FFRA 3W7VA 3HO1A 4G41A 3N6VA 3OCXA 3QWAA 4QTUB 3WO1A 2RAUA 4NU8X 3B6ZA 3HC7A 4HGRA 2AFIB 2HWYA 3F4BA 1FY2A 3EC7A 5F3WB 3IVMA 2Q4BA 3BQNB 3QUBA 3QTTA 4W5JA 3N3AC 2WJZB 3QA3E 2YBEA 2EFJA 4IPTA 5DF1A 3H9BA 3SQWA 3HJFA 3T5PA 4GPEA 1D5WA 4ZYYA 4DB4A 2X4DA 1R6UA 1EWKA 1VJGA 5DTRA 1TTTA 1GPYA 2OO5C 3DCYA 1NIPA 4QU5A 1QHEA 3OQ1A 2F43A 1XMSA 5BN4B 3RC2A 3UAXA 1L5WA 3OLYA 4YCBA 1LDGA 4ZAXA 2ID7A 2GVZC 3ETJA 2X1LA 3Q72A 3QOFA 2M6KA 2K7ZA 3THSA 4BKMA 5DNVA 1U63A 1QK5A 2Q3DA 4DE5A 3SMQA 3IEXA 4DV5B 4C6SA 1PV2A 1VIVA 4UFPA 3AL0C 1NP3A 2NX2A 4H1VA 4ERNA 4ZYZA 2UYCA 1W2HA 4JUIA 5JQGA 1RCOC 1D4AA 1K5GA 2PSHA 2ZANA 5CW2A 2ZPTX 4C3VA 3LU1A 5ARCA 4D8WA 5JFOA 1G8JA 4P9NA 3CX6A 2UU9B 1L5VA 1L5QA 2MCFA 2JAXA 2IV3A 4A8JA 2WYWA 5JAMA 3PT9A 3KZKA 4KO2S 3TE6A 2Z5GA 3WIBA 3RVSA 4EPWA 5EJ7A 4W5OA 2L18A 2PLFA 2JFPA 3K71B 1Y4UA 4LF7B 2PUAA 1GKUB 3V4FA 3AO0B 1PFUA 1OGJA 1SFRA 2MMGA 3LHSA 2QGFA 4JZYA 3BSSA 4PYJA 3L49A 1HNWB 2WM8A 5JBIA 4B2LA 4RKFA 1UBLS 3K8QA 3J81k 4MKIA 3RGGA 2FG5A 4YCLA 1ZIYA 1IY8A 2WZCA 3D1JA 3MT0A 5CDFA 3TLCA 4A9AA 2JGRA 1A4UA 1SCAA 5BWOA 3NC1C 5G4KB 1D03A 3W8NA 1LDYA 2D7JA 2Y99A 4D97A 2I34A 4G1UC 2IE8A 1RMQA 2C8LA 5AKLA 1UBNA 2E6UX 3TW4A 2J59A 5LWQA 1EVKA 1HM5A 1Z75A 3TCXB 1FXWA 2LUOA 5EOVA 2IYXA 3QTBA 1PBTA 3R3YA 4OLAA 1Y4SA 4E12A 1CUHA 2GAOA 2WFLB 4MUJA 2R44A 3FSGA 5ICCA 2X2EA 4QYIA 5LU8A 3G85A 1O57A 5G0WA 4M9UA 2Y0EA 1BCSA 5EVCA 1QAMA 1P77A 2B83A 1WV1A 3RU3A 1VZ3A 2QN3A 4CKZA 3R9IA 4M0FA 1LI7A 1VLJA 1SG0A 1UZDC 1PEKE 1VI6A 1X80A 3EEBA 2JJ2D 2XEXA 3K0FB 4UVIA 5FV4A 4P22A 3TFWA 2HREA 3TFQA 5BVGA 4MUXA 5IDWA 4YRZA 1WPQA 3CZQA 4ZHSA 5JAQA 1ZI8A 1XA0A 2IIBA 4RTKA 4UBIA 4IFEA 2VT3A 3BK2A 4IIXA 1E20A 2OXFA 3NORA 3PR1A 4JI8B 4IVNA 1LS6A 1RE0A 4WKOA 2YRFA 4M46A 2LCFA 3UAZA 4US0R 4R41A 3VU8A 5JH7B 4KBGA 4OI0A 2ENUA 3WSVA 4EI9A 1PR9A 4J7CA 3C5CA 4YCAA 2FZGA 1RCTE 1C4OA 3DP7A 3OCUA 5K4HA 1OSNA 2VUUA 3QVLA 1K9VF 3W5VA 2WHXA 3G2MA 5AOVA 3OTHA 4JJ8A 4WKNA 4YAJA 4C30A 4CF5A 3CH7A 2KX7A 3EQ2A 4WLOA 2B7CA 2HMAA 1OVGA 1O94C 2CHUA 2FUCA 2CLFB 3WWPA 1K7EB 4DIEA 5CYOA 1ZAYA 3C6XA 3O4GA 5C52B 2XQGA 2EJVA 2AJCA 2YV5A 1V45E 2ZS9A 1US8A 2GD1O 3PNQA 3QF7A 3V8RA 4JA0A 1DG3A 2XCQA 4HXEB 4L9RA 4CM5A 4ENWA 5KU1A 1JG4A 4FYIA 1DNPA 3BMXA 3PFGA 1GGFA 2QAIA 3DFKA 1T6ZA 4IGAA 3WG9A 4BO9A 3ZLBA 4OMUA 1AMOA 1JZSA 4NTZA 3DCIA 2J1LA 4KQ6A 3U48A 4BFWA 4MVJG 5JI2E 2OD9A 2NXNA 1MX9A 3UBTA 1VIMA 3H99A 2VP5A 4BMPB 2ETXA 4GZMA 2HRZA 2TYSB 2PGOA 3USES 1UMDA 2WRZA 4LXXA 2GLXA 4QNRA 4BVJA 4TX1A 4IDOA 1MCZA 3IP8A 4WACA 1N1MA 3KQVA 3CKKA 3LPNA 3BG5A 5LA6F 1P4GA 4O4IB 5FHQA 2VTDA 3TQTA 5BUQA 3R3ZA 4NAUA 3HA2A 1Z18A 4FNAA 1JQ5A 4KFUA 3SQLA 4B3CA 5AVSA 2XI4A 1RYMA 1SHKA 2ONKA 4WAUA 3V6LA 4DR6B 1IPHA 3TXYA 5K0GA 3K8YA 4KYVA 1EXMA 4CIYA 1A9YA 1VM6A 3FIUA 3B12A 1GK8I 5B5SA 1D8TA 1KGDA 1NTRA 4TSFA 2ZUFA 4Z0TA 4N54A 4WLEA 4YXWA 2KMLA 4DDKA 3VNAA 2OQVA 1F2TA 3D2LA 4HNSA 3B2NA 3FG9A 1P2FA 2A1UB 4Q39A 5AVQA 3PEYA 1HMYA 4J8PA 4EEZA 3O8DA 4R8VA 1JFTA 2D00A 5BYAA 3GDGA 1ESMA 1OAAA 2IL1A 5JMWA 1BVYF 1U8CB 2CL6X 2QAGA 3FCSB 1GFIA 4L28A 3PC6A 4QICA 1JQEA 1NI3A 4WINA 3WL7A 1THZA 3ZWNA 3HGMA 1H0RA 2VK4A 3FPFA 5FWYA 4AJ1A 1WMSA 1Z13A 2AWNA 4PZDA 4FHCA 3QLEA 1G17A 1TM4E 4ROTA 1PT7A 5CUQA 3WA6A 4IG9A 4ARSA 5CA0B 2P2NA 1L8QA 1KWGA 4LW8A 3NNDA 2PYIA 1XQVA 1FSPA 5LP6C 1LDEA 1WNFA 3EXEB 1SXJE 2AW5A 1BWRA 3H1AA 3PXXA 4TS9A 1A76A 2VWGA 3I52A 4UXHA 2C4NA 1VPEA 1XAJA 3IP3A 4I50A 2NUPA 1IFXA 4QBIA 1OWMA 1NM5A 2Y9MB 2EDCA 3CIFA 4IL5A 4BP8A 3C1AA 3A25A 2JEYA 2XWPA 5DYYA 2H4WA 3WWCA 1MKYA 4YS6A 2OFPA 1USWA 1CRPA 4DSNA 4YDSA 1P7ZA 1Q0UA 3PR3A 3CZCA 4R4JA 2PGXA 4W8OA 3HKEA 5A7GA 1TE2A 1X7XB 1ZIOA 5FR1A 3QYPA 4YRQA 4WNCA 1H85A 5DWVA 3RS4A 2LWIA 1VCNA 1RPZA 5BWCA 2BBOA 5AXCA 2VJMB 2QL7A 4D4JA 3CUTA 3BTOA 1XLUA 3H8SA 2V8OA 1DXYA 2QVBA 5D3QA 4W8HA 2FK7A 1MIHA 5IJWA 3WRYC 1P74A 1WLYA 4DB2A 1OFGA 4M0PA 2IITA 4GOLD 3ORSA 1PUIA 3I6YA 4E2ZA 3IDFA 3GUYA 3QXGA 1K7FB 1GUAA 1L1QA 1P72A 2DH6A 1W30A 3NEPX 4FS3A 4IDAA 3PVSA 4U9HS 1UPAA 4BEJA 3HCRA 3PA8A 1U65A 1VGVA 1J5EB 2AMJA 4S35A 3UF0A 2HRRA 3BD6A 2HDHA 1PJSA 2GXAA 4ILEA 4ZHQB 1K6MA 2P5YA 2H9AA 5AKXA 3V7FA 2AG8A 2QB5A 3L02A 3ON5A 2P5SA 1UT5A 3PRHA 4MS4B 2JGMA 2WU1A 4ZQHA 3TTSA 2YJGA 3M5DA 1KH2A 4V2IA 3DNPA 1D4ZA 2J33A 2WHEA 7GPBA 1AN0A 1JTVA 1PSDA 2OB1A 2VNHA 3EGCA 3UJAA 5HKKD 1I5EA 1SC4A 2I1QA 3PUWA 3R3HA 1P1FA 1F2UA 3DH0A 4MQBA 4YWHA 5CDSA 2AJBA 3M9XA 4MUEA 3HR8A 5TC4A 4BXOB 5J1SB 2XUDA 3PSAA 4AS1A 1ULHA 4IEEA 1NJGA 2Q1UA 4PX3A 1ODLA 4AJHA 1RQXA 1SBIA 2ZIFA 2MINB 1WXFA 2UZ0A 3I28A 3QX3A 3T95A 5EMHA 5FPHA 1PRYA 1IHUA 2PXXA 2PBFA 3R5HA 3UA3A 3ZE8A 2AFVA 4C5BA 5EJFA 5I6DA 3SXUA 4PYNA 3ZDYB 2GX6A 3KHTA 5BW4A 2AE2A 1Y9EA 4JXZA 2VPPA 3VZDA 4OHXA 3P4UA 2Q6TA 3KYDA 5E2AA 2VOEA 1Z5NA 1F1BA 1WCWA 3TZKA 4DILA 2VF8A 1XEWX 3ENZA 1GOTA 2HBZA 1FUKA 4Z4EA 1U2SA 3Q3IA 2GFHA 2IU3A 5B4TA 2F3TA 4O2BF 4MGHA 2OPHA 4XR9A 1ZNWA 2E0IA 2OHVA 2ZWOA 4B3TB 1HNXB 2VDNB 3ZCPA 2PZBA 3I73A 2E55A 5DYNA 1QYIA 4R0NA 3ZI7A 1JA9A 2C95A 3RFUA 2F7SA 4QTTB 1ZG3A 5JD6A 1AZWA 2R6GA 4O4LF 5FOSA 5FORA 1KO1A 3MWFA 3IDAA 3ZI0A 3LKZA 3P19A 1JFRA 4WN3A 3MMNA 5AVJA 1O89A 1JFVA 3IP5A 4AKHA 1Q5PA 5KSYA 3B70A 4C1BA 4PLHA 4F11A 4ABTA 2NT3A 2NXEA 5HNKA 4HDMA 1HF3A 3LQYA 4D4HA 4HEA1 1DCKA 2UDPA 4S1WA 1ULUA 2C3UA 1J2YA 1I2CA 1Y82A 2XVMA 3RLIA 3GLRA 5B7GA 3FX2A 1NR7A 2NTJA 2VFAA 3AUYA 2J85A 3FNRA 4UPEA 3OPYB 1LNQA 1UBGA 3WFJA 4ZZ0A 2IZ6A 3MB8A 2DB3A 3G02A 4F3TA 3O4IA 1L0BA 1Q19A 3TAHA 3EOZA 5BVHA 3FKJA 3ZNNA 1T2DA 3P9IA 3ET5A 3M6LA 2NU7B 1OXUA 1H6AA 3OESA 5CB8A 2A78A 1CYDA 4OK5A 3TH5A 3X0DA 1R37A 3EAQA 3CUVA 3TKLA 2Z8YM 3HCEA 1W36C 4C14A 4TV8F 4DPMA 4MB2A 1X1DA 1P8JA 4R98A 1P9OA 2BI7A 4W7HA 4KR7A 4F38A 4UD6A 2VUIB 3FSJX 4OMDA 4RX1A 3C4JA 2OMKA 2GN1A 2XKJE 2FFHA 4LXIA 4XGQA 3GP3A 1N78A 3T9CA 1WMEA 2XUQA 4JYAB 4P7FA 5ERYA 1Y37A 5E8JA 1L2TA 2Y1WA 3HFJA 4PYKA 4CDGA 2DPYA 2YZ2A 1VTKA 5JWOA 1QIJA 3FKQA 3GEGA 4MJ7A 2J3EA 4FJ1A 4LEIA 4QYSA 2P1RA 4RD2A 1KJ9A 2OM2A 4Y2UA 3E1GA 3U9SA 5JUWA 3RVOA 1W1IA 4MJXA 4PYRA 2FEWB 2C3PA 3DONA 3SIRA 2QX7A 2DUUA 3CT6A 1E1QD 3RVNA 5I7EA 4N12A 2HJSA 4OYYA 1QYDA 3GUZA 4P86A 4QVKA 2HA5A 1L5ZA 1NU6A 1XI2A 4MR8A 5EPOA 3DDSA 4UMVA 3VDQA 1XK6A 5CA1A 4PC6A 1O96A 4TS1A 3AJAA 1WMBA 2NUBA 4NCKA 3AIKA 2I7VA 3IEMA 4INZA 5K5EA 2FN3A 3EXHC 1ENPA 1A9XA 1RQRA 4P5EA 4LRSB 1DT5A 2AJTA 2CUTA 3D4LA 1FF9A 1TT7A 4DPLA 1DC4A 4IMIB 1USUA 1J1UA 3CEMA 2ZAGA 4LE0A 3E5MA 4DSUA 3D4NA 1BIFA 4CMKA 4NZPA 2YWEA 2ZJ4A 4GBMA 3N58A 3NUZA 5BQXA 4BHTA 2ATCA 2DULA 4K9MA 1QBGA 5IZCA 3T1HB 1UMCB 5CCEA 4UBJA 5KDDA 3PCTA 3FSRA 1DHTA 4ZMBA 2CNDA 2QHXA 1M0EA 4FFWA 4YAOA 4WVLA 1A9OA 1M1YE 4MV6A 3HSKA 1EIZA 4FX5A 2A9KA 4G26A 1BMQA 1Q2UA 1EGHA 2H1IA 2AQ8A 4LYYA 4PC1A 1CUYA 3KLPX 1SKYB 5JYBA 2ZB3A 1Y1SA 2VHWA 4HWOA 5KDLA 2I4MA 4ZGBA 2VJQA 4TGLA 2B9EA 4BFCA 1HZZC 3GCXA 4ZIRB 4JWTA 5JYDA 2NU6B 1AIPA 3RJ9A 5A02A 1MPXA 3WWEA 1J0EA 5JDIC 1G18A 2H59A 4KTVE 1JDJA 3VSCA 2ZIGA 1EINA 3CSSA 4FMCF 5E7IA 2YFQA 1QGOA 4KQIA 2CNLA 4EW2A 1H6CA 2H2IA 2O2CA 5ALHA 4F0JA 2RIPA 1KYVA 2A0KA 3ZXSA 3WYAA 2QRPA 2VDWB 3A9VA 3AY3A 3CPSA 5EHZA 4Z99A 4KAFA 2AL7A 2OXIA 3RRZA 2DPXA 2ROQA 5MF6A 1IL0A 5THKA 5BSHA 2W2PA 1PR5A 2PVSA 3IALA 4I5IA 1R4MA 3FNGA 4JBYA 4EJSA 4MVJM 3GZTB 3DE5X 3UO8B 2W7TA 3ESAA 4B31A 5AUPB 1MJHA 4G9BA 1YZKA 1T9BA 2YHAA 1YE3A 2O52A 4EF4A 1IB6A 5BXYA 1BJRE 2O8VA 2XGSA 1FFEA 3NHWA 3NAQA 5C32A 1U0EA 2HC9A 3ZGNA 4KXLA 2H07A 1KNXA 5LNK1 3E7XA 3JV7A 1WKCA 2X5JO 4MS1A 3VO2A 4HQ0A 1C9JA 1VLQA 4G0MA 4I4TF 3WGNA 1ZW1A 5LZ5A 4EPRA 2EFEB 2GQ0A 1P18A 3O4RA 2WYOA 2HFKA 2ZB2A 3PEFA 3PPWA 4CUJA 5FTNA 1H5QA 3ADBA 1MQAA 2RH4A 3ISVA 5IBCA 4CL3A 4ID3A 2NZVG 1P1RA 2OZLB 1KQGA 1E9SA 1XWFA 2ATEA 2FN4A 4N0PA 2IHJA 2OO3A 3IELA 5IH3A 1EDOA 1QGED 1T2EA 3FI0A 2HF7A 3FFTA 5B57C 2DFNA 4NYMR 1E77A 1KE2A 4CQLB 1JIUA 2B8EA 4EJ2A 5KJFA 4Z53A 4HG2A 3DBIA 2UYQA 2B7LA 2XE8A 3QLVC 2OYRA 3WKEA 2BZ1A 2JIOA 1FP1D 2HK8A 2IPOA 2WU8A 1MMFB 2DLNA 3NOXA 4JJZA 4RZSA 5AUNB 3FAKA 4HB2A 1LPNA 1IOZA 1YRHA 2YOHA 3FPCA 3TLMA 1XD8A 3OWOA 3PKZA 5JVDA 5HE8A 2JG3A 3OZAA 1MAHA 4M38A 3DO5A 4LJSA 4EHJA 5GTDA 2GZAA 2J6CA 3TEMA 1RR6A 4ZPJA 3L7KA 3WNDA 3DNMA 3E18A 1F6WA 2ZQ5A 1N2XA 5BY2A 3FPNA 1RXEA 2OCXA 3L2OB 1DXOA 5FO1A 4DIKA 3KT0A 3M1LA 3OU7A 1HEUA 1XTIA 3WYEA 2N47A 3GAMA 3NMUF 2TMKA 4WXMA 2VA9A 3ANSA 4D1YA 2ECOA 4CKBB 3REOA 2XIQA 4NG4A 2FWAA 3RH0A 4CF3A 4UTVA 1L4BA 3OM9A 4PSDA 2AOXA 1ID1A 1Q0QA 1DIHA 1ZC3A 1RBMA 3DE7X 1BS9A 3EXIA 2VXYA 3GGJA 1K08A 3KJFA 1U1FA 2K6GA 1U2GA 1CUJA 1YZNA 2EBHX 2RFLA 2WJYA 2WVGA 2XD9A 4KIFA 1E2IA 4M0EA 2ZSDA 1N2EA 2XD4A 5D85A 2NT4A 3TQHA 5I45A 4HX9A 1YU6A 3U13A 3DDWA 2GYWA 1MO3A 3GFPA 4XD7A 4JBNA 1EXWA 3EX7C 1RLJA 1LEHA 2V9ZA 3HJTA 2ASVA 4BKQA 1CPYA 3BRCA 3H7AA 3D7RA 5C3UA 1XUOA 3TMKA 3B20A 4BQOA 4G1BA 1J2TA 4N01A 4ND4A 4P31A 3IKVA 1BKYA 1YDFA 2ARKA 5EERA 5G0VA 3HYCA 3ZE2B 4TVSA 2CE7A 1T4CA 3PV0A 4JJ4A 1E89A 1FQWA 2R85A 4JI3B 3ST7A 1CXZA 3ESXA 4E94A 1O0CA 1KZ4A 4UPVA 4BJ3A 4LZWA 1GG8A 5CNIA 2HF2A 1LCIA 2WWHA 2JVJA 4EBBA 5C46F 3ZJYA 4QZVA 4DCVA 4ZOBA 4ZK6A 5K3OA 1CUBA 1XCOA 1CDDA 2HHLA 5JZVA 3DLHA 1U8YA 5K6RA 1THMA 2ZWAA 3ANXA 4HP8A 1ZUD1 3OF2A 4IJ5A 2WFZA 1J9GA 3B8EA 4NENB 3VTFA 1EVIA 3D2CA 1SO8A 4MVJP 3KQNA 3S1AB 3G5LA 5HF5A 4F6CA 4OY3A 1RLOA 4XJVA 1UC5B 3IB3A 4XYMA 4ZU6X 4WFQA 5AVWA 1ZD9A 4M0CA 3V8NA 1H0HA 2NXCA 3ELBA 1Y8QA 3K0KA 3NOVA 2YVUA 4Y2HA 4KACA 5ICSA 2CXHA 2QE7D 3DLCA 3SSNA 3AR8A 1Y6JA 2ZWPA 4MLCA 2VIIA 3DD5A 5F3DA 5IABA 4KLAA 2BBTA 4DA9A 2XSZD 2ZJ1A 2GYYA 3NP7A 4UKDA 5IDYA 1QIFA 1G8MA 2OAQ1 3QLUA 1BGWA 4ESHA 3HTXA 1QXSA 5F7ZA 5EPEA 4C07A 2C9CA 5GIPE 1TLFA 4ASUA 2ATXA 4KV7A 4BFXA 2WWVD 4JOCA 3SU8A 3C8UA 3RU9A 4M1ZA 1NQUA 4U7JA 4KWHA 3TIXB 1FFGA 1ZVMA 4QYXA 2GZ3A 4D98A 4DT1B 1UXKA 1H6BA 3CE9A 4M60A 3TUIC 4LRYA 4U7HA 3QELB 4YONB 2X86A 1NXSA 2D1TA 2J9FB 4C0JA 1Y1KE 2DUMA 3KALA 4NJMA 2GTHA 2XZDA 4BP9A 1DV1A 3L7BA 1Z34A 4NFLA 4RQUA 3R9KA 2AFHE 1IZ0A 1JB1A 3KOZA 3J7AC 1KH1A 2O5RA 2Y4NA 1JEQB 4P4GA 1WDMA 4FMDF 2XOKA 4QU9A 3WLMA 1GNTA 4YLGA 2VF2A 4YV7A 1L7RA 1SBYA 2AUTA 2UUPA 4GBED 5TEWA 4KXFB 3ZD6A 2Q1TA 2BONA 2R8XA 4G65A 1KJNA 4QDUA 5GV7A 5HJ7A 5IKEA 3G23A 5KTNA 2WIFA 3GZJA 1ND5A 3AVUA 3KPUA 1GDTA 1KYTA 1R16A 3TL6A 4UM8B 5E9QA 5C81A 3IE2A 3HP4A 3LBIA 3O9ZA 3R6WA 1Q7RA 3AXKS 3CUUA 1BGVA 1M8GA 2ID9A 3CMMA 4RO0A 2JLSA 4UAUA 1CJBA 1KO5A 2GZSA 4X6LA 8ATCA 3JARB 4D9CA 4FKMA 1DUSA 1LJUA 2HKIA 2QLMA 1YJXA 2WSSD 3FPJA 3GFRA 3Q6NA 4IFIA 4YJGA 3VJMA 1UUFA 4LJ9A 3HXMA 2DQZA 2HLPA 2IIQA 2Q5OA 3L0YA 4DVJA 2REQA 1UP6A 5DJ5A 3Q12A 1AF7A 4DQKA 2HV8A 4HDAA 3JW8A 4J2OA 4ZANA 3MCWA 4D0NA 4BO6A 4WKCA 3OEYA 1E9AA 4IXWA 2NG1A 1Y5MA 2F8LA 2JBWA 4ODIA 2IH4A 8ADHA 1E2DA 4BMXA 1TM2A 4EELA 2QZ9A 4I19A 4JX9A 1K0FA 4TKUA 1JQJC 5KOIA 3U1TA 4RPKA 5C5DA 5IEJA 3ZS8A 3O8OA 1T0IA 4GVXA 4ZVVA 3DEIA 3O31A 3W5SA 1MGOA 2VT7A 4ETIA 4I5DA 4OXKA 4WX2B 3MAJA 1ZCAA 3ZHCA 1K68A 1C3XA 5EP3A 2EZ8A 2F3SA 3C3PA 1MX3A 4HDOB 5B7NA 1UIRA 1WU7A 2YHUA 3AW9A 4LFCB 1E92A 2P67A 3SIPA 2XA1A 2R7NA 4KCGA 2XNJA 2O19A 3GNTA 2Q49A 5FBKA 2AKYA 3VU9A 3RIYA 2BFBA 4JVSB 1QU3A 4FHDA 3ACCA 4ZZ1A 4A5SA 4J3JA 1PWZA 2DC1A 3QEMA 3TZBA 4EHIA 5DTIA 2VP2A 3I2HA 3HBLA 2TS1A 4HDCA 3SE7A 1NVWQ 1H5UA 2V3WA 4F1KA 1EZ4A 2ZBUA 2X19A 3G6WA 4DRXA 5IAJA 1T5HX 5HSGA 1JLLB 1KI4A 2DAPA 2E4VA 3I6BA 5ITSA 3SBEA 4XWAA 1GYQA 1SC6A 4GXRA 4F9FA 2PUBA 5EEHA 4Y6RA 4F3KA 2PKYX 3K5PA 3NB0A 5D5HA 3GLIA 5C8XA 2A33A 3GFOA 1YJ8A 1BN7A 3QFCA 3HH8A 3REQB 4NX2A 4JN6B 3U40A 3N8HA 4KO4S 3F73A 3NG1A 4DWVA 2HQOA 5E38A 4KUEA 4OQNA 3KJZA 1TEZA 4PYLA 3VRHA 4BX9A 1QVRA 1J70A 1KYZA 4IQ4A 4E6PA 3FNFA 1JSZA 2CJXA 5JNTA 1AMUA 1L1RA 3DO8A 3CZMA 6PFKA 5K8LA 1X7YA 3OETA 1KSFX 2VQEB 3RTBA 1K66A 3AF2A 4D3ZA 1I10A 1RI1A 5TQ0A 4TTQA 4OFBA 1PUXA 3RK1A 3ZW9A 1Q3KA 1ZR4A 4PWZA 3SJCA 3L84A 3ME5A 4KN6A 4BB0A 5REQA 3IHKA 4DCNA 4N8SA 2I8AA 1JG1A 3L18A 4NARA 4D4IA 2VXBA 3ZKWB 3CU5A 3MW8A 3O3NB 1GYRA 3DVSX 4DEXA 2Q5IA 2XNHA 1YTLA 1V95A 1XQWA 3F46A 3VBEA 3NGXA 1IU9A 3MOGA 3OQJA 4CQMD 3P9XA 4KN9S 4N3GA 1A1SA 2OZKA 1YMVA 1Z4LA 1D6NA 2B6HA 2HA0A 5AM3A 3V80A 1B76A 4PY2A 2FGJA 3P9CA 5U4QA 3V2GA 1F9EA 5E4FA 5K0SA 1RCFA 4HWTA 3L0SA 4KK4A 3R3JA 3RBZA 1XEXA 1TM3E 2HO5A 4DJJA 1F6BA 4CMIA 2ZATA 3L4JA 1KEKA 4ZREA 2CYCA 4WCVA 5AUQA 1DINA 4TYMA 3CT4A 4L5YA 2CLOB 3QPDA 4O2BB 3K5HA 2WYUA 1Y1LA 2RHGB 3AKEA 1VKRA 2C88A 4HXGA 3MCUA 5AOAA 3TMYA 2Y0DA 4HVTA 2EJTA 2WE7A 4JR0A 5GVSA 3H4IA 5FBLB 3RUIA 4PIPA 4Q3OA 1QO0D 1XCBA 3EGDA 3L0BA 4KREA 2RGEA 1E4VA 2QT0A 4ZEWA 1XTVA 2OBLA 5DIFA 4B3HA 1J1ZA 2ALJA 2XWJI 2WIJA 1I0ZA 1RAGA 3AHIA 4NFSA 3KXKA 4RHEA 1DKRA 2NUTB 3L6CA 4HN2A 5I4IA 3ORQA 4KE6A 4LGMA 4EY3A 3U3OA 3ANTA 3E03A 2NV0A 3TPCA 3OUUA 4R54A 2GVNA 4JC4A 2J3JA 4OJTA 4A16A 5D5QA 4J0EA 3MUNA 1TMGE 1UDBA 3BUSA 1A5AB 2QSYA 3G0BA 4HUQB 2PMCA 4PSUA 2UZ4A 2EF1A 2H0QA 1YKSA 2P30A 2DFLA 3DO6A 2BEJA 3R5JA 4GPBA 2COUA 1XIVA 4OHFA 1PZFA 5EHIA 1J22A 1UJMA 1KARA 3WSTA 1E7MA 1V4VA 3PT5A 2PKEA 4XCVA 1I33A 1QG0A 1D2CA 1ZESA 1I4WA 2PV0A 3A1FA 2H2DA 3GPBA 4XVQA 5EP2A 2LDXA 4PHCA 4FM9A 4N3AA 4GGOA 3N8KA 3FLAA 3AT1A 3FHLA 1IZ8A 3F6RA 4G1EB 3T7JA 4G67A 3VTKA 5FR2A 3R8FA 2XGGA 2GN2A 2Z3VA 2EG5A 3LGXA 4PCUA 3QOYA 3C6YA 2RKWA 4JGGA 4RW0A 4A26A 4D3SA 1CF4A 1E3DA 3JTEA 3FRJA 3C15C 3C3WA 4FGSA 4R1UA 4N49A 1V16B 2ILTA 4HJRA 4LOKA 1PKXA 2PZFA 3OJ0A 1BFUA 3K1AA 1K7CA 1HBJA 1FTQA 3EVCA 5H70A 4KIGA 1L4NA 4Q4HA 4GQAA 5IN5A 4PONA 1HNNA 1ZZGA 1RYBA 1RACA 4V38A 2FUG1 2FRXA 2H16A 3G9XA 4ACAA 1EQ2A 2JLWA 2XUAA 1TDJA 4UBLA 3PCRB 4B1FA 1QGAA 2R751 4QUGA 5HKBA 4I55A 4TT3D 3IPYA 5EXXA 3C0KA 1IY1A 1BMFD 2YWHA 5CXXA 3U9LA 4F4JA 3OFSA 5FTKA 1RYEA 2NO4A 1O0SA 1WUHS 3IEUA 3WLHA 1OE0A 2WAMA 3L7AA 4DIFA 1PFYA 4LHEA 3DTVA 1CUWA 1XJCA 1JDPA 2G4CA 4R0MA 2X41A 4RIHA 1KK3A 1LUAA 4HAOA 4ES6A 1UAGA 4QJIA 1QMPA 4R1NA 1YFLA 2OC9A 3P96A 3QNUA 4GP9A 2ZBVA 3FUUA 3SDZA 1KI1A 1P4SA 3UMFA 4BFVA 4EWLA 3U3RA 1EFAA 1H8HD 1X7ZB 2A3RA 2YDYA 3EC2A 3EA4A 1WSDA 1JIKA 2VTBB 4FGJA 5G0TA 2ZREA 4HADA 1II8B 1SUSA 2GO1A 3HL0A 2AMFA 4L5JA 1ZMOA 3IIKA 1U1CA 4DHEA 3H75A 4G1CA 2PZKA 4QXOA 4G2NA 1E2QA 5DP1A 3W90A 5AVRA 1WE2A 1M1NB 1JVNA 3T3EA 3M3PA 1CUAA 1G5FA 1SOAA 3SE0A 2YXBA 3EE6A 4URWR 3V7UA 2HEIA 2CNWA 1TIBA 3KSMA 4IKOA 4FCVA 4Y2TA 4EDHA 3E61A 4IQ8A 5HUHA 3QKIA 4EHHA 3JWJA 4LHXA 2G40A 2LPMA 2Q0XA 2Q5FA 2EQAA 3OIWA 4UMEA 3R7AA 2VATA 4ITRC 2A9QA 3KWLA 5DX1A 3WL8A 3L8FA 4MTLA 1FTNA 2GUWA 3F8WA 1X9HA 3V7WA 4F2HA 2NMVA 1NN1A 3VNSA 1FX0A 2O3QA 5FTWA 5FFFA 1PR1A 3Q7QA 4M1QA 4W99A 4A0QA 4YN3A 4B6QA 4FMCB 2J0QA 1M6VA 4RVGA 2EF0A 4X1KA 3Q3JB 3LO5A 4WJLA 3RRBA 1N5RA 5DCUA 5LQKA 1QHGA 2CXRA 2VRBA 5GIOE 4JXJA 4BBJA 4EHAA 4MR7A 5K03A 4RPLA 2C9OA 2JJ8A 1FNNA 2DH5A 3TOCA 4AG3A 2ICAA 2W00A 2VJNA 4L0CA 3ZZMA 1YNOA 5JNRA 1VG0B 1H4TA 2V98A 2ZBFA 2FLVA 5LQNA 2R96A 2ZUEA 1WF3A 3AXMS 1T43A 3CIOA 2PX6A 1EUDA 1Y33E 2I6GA 2W37A 3WMEA 3LL4A 5IJXA 1U6IA 4BN0A 2O1WA 1YR7A 2BFOA 4G2TA 2W6OA 2M1XA 4L9WA 4PAQA 1V96A 2B30A 1BOFA 1ULSA 3FRHA 3K3PA 3MTIA 1D1PA 2XE6A 4I4TB 5JCOA 5JXIA 5L4SA 3EGXA 3M4YA 4JSRA 5DRTA 3TN7A 5BSGA 1JR3A 1ZRSA 4TMXA 5T8KA 3AEUA 3N75A 1E4EA 1GD1O 3KAPA 4HB4A 4B74A 3OIGA 3LUPA 4GI5A 3FCAA 3KXLA 4AJIA 3GUUA 5K6AA 3R3XA 4XVRA 1TO6A 3KQQA 3P2KA 3VNQA 3PX2A 4KR9A 2IZ5A 1ESZA 3BE5A 4FR2A 4TQ9A 3UW1A 4D9KA 1K4MA 4DLZA 3H6HA 5JXHA 2XYVA 4N7MA 1EK6A 1M2VB 4HAVA 3ZWBA 2AOUA 3LUKA 1OZGA 3N7UA 1EJ7S 5BO5A 4AC9A 3LHKA 4H7JA 5JCOC 3ASZA 1YS4A 1QP7A 2XMSA 2TMDA 1JEYA 3IPAA 1JSXA 2OEPA 1VMAA 2QIPA 2Q41A 3COZA 3EVGA 4AZVA 2C9DA 3BQ9A 3KPWA 1IM2A 1SEVA 2YZKA 4GOXA 1GL6A 2B6NA 4FYYA 2D2VA 4PIVA 5HZMA 5I5EA 2GA9A 3O3OB 3OEED 1YQUA 3F3KA 3ROQA 5MGNA 1NQAO 2G9VA 3QIVA 2OYSA 1RWBA 4D74A 2KLHA 1UBTS 5LBIA 2APJA 1M1UA 2D2IA 3ZOZA 3Q0TA 5BP7A 4DAOA 1Q21A 1T4DA 1WCIB 4RA9A 3RUHA 4F0MB 3AESA 1H2WA 3AKZA 1DWUA 1AKEA 3DUFA 4PICA 3DYVA 5K8JB 4HFNA 3KJGA 4B87A 2GAAA 3O4HA 1DBSA 4R16A 2HGSA 5I8PA 2W2KA 3C7DB 4YASA 1QYXA 3EFHA 3MILA 2YHSA 4PPFA 3ZK9A 1EBUA 1VE7A 1XHLA 4OJYA 2F6RA 2HRCA 4QGHA 4Q1CA 3TPZA 3B7PA 3NVDA 4M9CA 3DQZA 2D4HA 1OH6A 3ZOKA 1XTRA 2V54A 4RK4A 3V4OA 3WLRA 4PYMA 4EW6A 5LD2C 2VHTA 2FLKA 2YXLA 1FDSA 2V45A 5TMDA 3K8ZA 4EGQA 4K9PA 1FFBA 1XRJA 3KJEA 4DM7A 2C4HA 1P4AA 1Y5LA 4K3VA 4NK4A 3MHTA 3UG7A 1XZQA 1GPWB 3OJCA 3ONDA 2H4XA 2IZ0A 1CTQA 5GONF 4QT4A 2Z1DA 3F2VA 4KR2A 3DYBA 1RMTA 4L4ZA 3SHQA 1P5FA 4Z6KA 2O07A 5D84A 2ONJA 3HCPA 1ADYA 3RUBS 1F60A 1MEOA 2JZCA 1NVTA 3I3OA 3ENWA 2B4QA 2ZOSA 3U4IA 3ACBA 5U4XA 4KIJA 4PINA 4BQNA 2QRKA 4CV0A 4EPVA 4HVLA 1KQFA 3SCZA 3C87A 3GLQA 4PBRA 3PJGA 1YMQA 4GR5A 4IV0A 2NM0A 2BEWA 3ABSB 3F0TA 4Y1GA 1GZ5A 5B6IA 3CEAA 4QPCA 1R5OA 1VP9A 3C70A 3FWNA 1N9GB 2C7GA 1G0OA 1X42A 3CF6R 3DVRX 3I1JA 3VC1A 3W0LB 4AJ4A 1U5AA 4Z3OA 3TYXA 4XSVA 4AF7A 3HJGA 3OZFA 1BG6A 1MB3A 2Y0CA 3NWEA 2J6HA 3TNJA 3ZUGA 3OM1A 4ATNA 2PZAA 3OHMA 2E82A 5B6JA 4NYMQ 2BCGY 2CF5A 2WV7A 1Z4PX 2J9XB 4P7KA 4ZQGA 5IVPA 2OYCA 5CK5A 3U0VA 1A69A 4NAVA 3QVGB 4LA4A 3MRXA 1XTSA 2HYDA 5IJZA 3JALA 4ND8A 2QJWA 1MDBA 1KDTA 4AJJA 4BLSA 4XLZA 1CEEA 3FUTA 1EE2A 3B48A 4B2PA 1YQTA 1NUSA 4RYDA 1YI8A 2B5OA 1EFRA 3M33A 3N8NA 1TL7C 2ZIZA 1LBHA 3LVQE 2GNOA 3JQ9A 3PDJA 4UNSA 4DR1B 2GDJA 5ARDA 5FA5A 4GOOD 5FRDA 4N1AA 4UM7A 4M9ZA 1P7PA 4N0QA 5JSUA 4F0HB 4E07A 4C0SA 2AF4C 2ZQZA 2RAPA 5DHAA 3SDBA 1B16A 2HMYB 4EG6A 2B61A 1MFPA 3MLEA 1BMTA 1EUZA 4FMDB 1VJTA 2V7QA 3WDKA 2R6JA 3AZQA 3VV3A 4UU1A 4Q9JA 2XY4A 2PS3A 4N0MA 4DMUB 1RWNA 1G2PA 3D54D 1ZOOA 2RI0A 5GINE 2AJDA 1EWRA 3KZOA 3QXCA 2PTGA 1T2AA 1NVKA 2X22A 3Q1KA 1WSBA 5C7OO 3OTQA 5E3JA 1SXJB 1OLSA 4RMHA 2WJVA 4YFYA 4BVFA 3MJEA 4LZZA 4DNOA 2C0QA 1JE1A 3IJ5A 3QVKA 4BVEA 1OX4B 1AHIA 4ZV7A 5F35A 2CLCX 4REOA 3LH5A 3V1YA 3HFRA 3QLTA 3ZHSA 5I8WA 3ZDAA 1VQ1A 1I01A 2BCEA 2GPWA 1E58A 1GGNA 1QZZA 3F98A 4IX9A 5DTQA 4DXHA 1IBLB 2B78A 3NCHA 5DB4A 3TE7A 3IBFA 1NW6A 4HLQB 4S1TA 4O25A 4QXAA 2QTRA 4LY9A 3A05A 1GFSA 3C41J 5KTMA 4RSHA 1EVZA 5IM4A 4F4IA 4CG1A 1JJBA 4FMPA 1JHDA 2V6FA 3E9DA 3DKPA 3CH6A 2QG6A 1C1DA 4R40A 1OUMA 3V7NA 4E46A 1PVOA 3INGA 1TUBB 4L2IB 1RHMA 4FFBA 5BWLA 1PT5A 1Y9DA 1LV8A 1FYFA 1X9GA 5IK2A 1LLDA 1UMBB 1FB5A 1D7OA 1QUEA 2AW3A 4A8HA 4KXXA 3ZGXA 2CFOA 4E88A 4IGEA 4ETMA 3P0HA 4MUYA 1T5TA 4DJ5X 2RI1A 2FVXA 4HQKA 3JAWB 1E2FA 5D1NA 4UNNA 4CMEA 3DWFA 5EIWA 1M6EX 1C3OB 2VZLA 2WHQA 3R23A 3Q2OA 4H0NA 5FUQA 1SOUA 3QHPA 1OX5A 3B1KA 3WGVA 1RS0A 4DV7B 1RVV1 1RZUA 1Z4OA 2ZSHA 3SR3A 2O23A 1CY4A 1OMOA 4CR8A 2O3TA 1BEUB 3KSRA 4GM1A 2CL7X 2OBFA 1VL5A 4YIKA 5DKFA 2B8NA 1ESNA 3A1TA 4QDKA 2C1XA 3OOYA 1LPPA 5AKYA 2P2GA 1JXOA 4X3OA 2Z6AA 5H02A 5TMPA 1W87A 2CL5A 4BASA 3H17A 3FZGA 5KYWA 1BTOA 1L7OA 4CIXA 2ZZMA 3WOVA 3V1UA 5JCXA 4QXRA 3V6MA 1CQIB 2R2GA 1EFUA 2XUJA 4QJ5A 1QV7A 3WNVA 4E03A 4B34A 1T9GS 1QHHA 5FUVA 3N0VA 3QPAA 3ZXIA 1SVUA 5ECWA 5FXMA 1QLHA 3L93A 3FIJA 3PC4A 4B85A 5I4CA 2YXEA 4EHNA 5T7BA 2QVGA 1ZK2A 3UWOA 4PU0A 4KSBA 4QUBA 3D3KA 3I45A 4RPCA 5K3CA 5J43A 5KVCA 1OXSC 2F00A 1G59A 3LT4A 4NMWA 5L3ZA 1NKTA 5HIMA 3PJRA 2DBVO 4R1OA 5FPTA 3ZVRA 3SZOA 3R9XB 1YZUA 4RHUA 1BVUA 3PKJA 4G5QA 3R7LA 3TQOA 3TS1A 3OBBA 1DVRA 3U37A 1GZ7A 2PWPA 3S2FA 1YA6A 3DB1A 1OJ7A 4AUMA 4CVNA 2V68I 3C3BA 3I58A 3NBYC 3HFSA 1ZY2A 3OD5A 4XJTA 1GCAA 4I50F 1G20A 5LYYA 4FYJA 1Y1RA 4WGGA 1KMMA 1Z2NX 1HKUA 2WILA 2ZJ2A 3CEHA 3WB0A 3ZYCA