3U56A

Crystal structure of mutant ribosomal protein t217v tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTVMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna/rna binding protein
molecule keywords 50S ribosomal protein L1
publication title Crystal structure of ribosomal protein tthl1 in complex with 80nt 23s rna from thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 71
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3u56A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u56A02
2HW8A 1MZPA 5DM70 1DWUA 1U63A 3U4MA 3TG8A 4REOA 3U56A 4LQ4A 3UMYA 1I2AA 4DFCB 4QGBA 1CJSA 3FPNA 3QOYA 3ZQJA 4QG3A 5DM60 1AD2A 4F9TA 1ZHOA 4QVIA
chains in the Genus database with same CATH superfamily
3P9NA 4MV7A 4M3NA 5EPUA 1QORA 4Y2HA 4RD1A 5EP2A 1ZNYA 2GN6A 1BWVS 1HO3A 4HMPA 4BAUA 3MCAA 3I39X 1VA4A 5ALQA 4NABA 3R9WA 1ZN7A 3CX8A 4JLMA 1FVFA 2QTAA 4C2TA 3IA7A 2BLLA 4NPCA 3VDQA 2PWZA 4CYMA 2HU8A 2ZJ3A 4CMAA 4HKTA 2Z3VA 1EEHA 4BE4A 2HDOA 3JZMA 2B94A 3RJ5A 4B76A 1T13A 5HIAA 1DUSA 2FWBA 1JKJB 2ALJA 4G5RA 3TB4A 5H8WA 3GEIA 3R6WA 2ZTSA 5KKCA 2G1AA 4Q1AA 4TZTA 2IUSA 3KTOA 4II7A 2BKAA 3AJEA 4GNKA 3S27A 3V2IA 3INGA 3KSBC 2QW8A 1US8B 3EIXA 4K26A 2JIZD 2XNHA 3K0EA 4PX9A 3VMFA 1BRMA 1OSNA 1GXSA 3O1LA 2DFVA 3K73O 2QQFA 3L7BA 1SRRA 2HRZA 4G0OA 1YONA 2XAAA 2PR2A 3H2JA 3GA5A 3V8PA 4ZYLA 4OIMA 3OOYA 4HLUC 4RX1A 5ENZA 4TPKA 2G09A 2Q1WA 2ZVJA 3VVMA 5DPMA 4EF6A 1XO1A 1MH1A 3CEHA 3HN2A 3KHSA 3VYSB 2FYTA 2WF8A 2BAGA 3ILVA 3WMEA 3SLGA 3Q1KA 1XF9A 3G8YA 2Q3LA 4HNGA 5AW4A 4URHA 4E1VA 5A1TA 1NZDA 3THXA 5LVAA 2XVXA 3BWBA 4A0HA 1MHTA 1U1IA 4P3PA 5A5EA 1KVTA 3SP1A 4OHZA 1U90A 3O8OA 4GFDA 2M6SA 1OAKA 2Q9BA 3CXRA 4OBWA 1V1JA 3PR1A 3CR8A 3OFND 3TN7A 4LRYA 4P3OA 3UVEA 1ZNWA 3OT1B 4X1KA 8ABPA 3G5AA 5KVVA 4BQIA 2YMQA 2MSDB 2P3OA 1WO8A 1J0DA 2XQIA 5IMBA 1KAQA 5FV7A 1U0HC 4E12A 1U0BB 1GA6A 2HL6A 2DFDA 2Q2OA 3H4MA 4TQGA 3TD2A 1M2WA 1WKVA 3M6VA 5H81A 5KCZA 4B7UA 1CQXA 1ZUHA 1N5JA 1G5QA 2BUBA 5DXJA 5DBFA 1QRSA 4FYMA 5EWJB 2F3RA 4BUZA 1BAPA 1TPYA 4GL2A 2NO4A 3FG9A 3NJRA 4LQLA 5JCZA 4J6EA 5KOHB 3GV0A 4MW9A 1ZDMA 3PXUA 2O4CA 1JR2A 3D2LA 3P9KA 3ZZUA 4JV5B 2QBYA 3WYDA 2FSPA 4UEOA 1QFYA 2IDKA 3AEKB 2QA5A 2ZB7A 3MMNA 4F9TA 2SKCA 3R3UA 2O54A 2JJQA 3IPRA 4ARCA 4MUYA 1DIBA 4QXMA 4TKZA 2FPOA 5E9AA 4QNNA 1UADA 2J9YB 1P45A 1JECA 2GKGA 3NEPX 4QT0A 3O4IA 3PC6A 1BGXT 3OECA 1PEDA 4E88A 1ZN9A 4U7TB 4PVCA 2CLIB 3UAYA 2II6A 1SVLA 4GC9A 5EKUA 2ZIUB 4BO8A 5ICSA 3VHXB 4Q6WA 1YASA 2C78A 4GZ5A 4YGXB 4NOKA 5TT0A 1U2DC 2XDAA 3KSZO 5ALGA 1Y6FA 1U9YA 3BXHA 1KDRA 2W00A 4G4GA 3TSYA 4A73A 2BTEA 3N59A 1BXGB 5EI5A 3ROGA 1U0OC 2VO1A 4DLLA 3VR3A 3LC7O 4R1PA 4Y6OA 2FI1A 4C7KA 1K2WA 2ZIXA 4FCTA 4MDEA 3A9RA 3LHSA 2C88A 5KNDA 4MRMA 2VEDA 1P6QA 1I4EB 1KTVA 3EZXA 3OA2A 3CSUA 4WESB 1GHTA 3UIEA 2CUZA 1MPTA 4DQLA 3AINA 3PJEA 1VCMA 2YJ4A 2GPTA 3FPEA 3WL6A 3A1FA 1SG9A 3F6BX 4N7MA 4C01A 4LV6A 2G7MC 2XCIA 4IMPA 2JGNA 2XQKA 3L8FA 3I5YA 4CIBA 3CNNA 1QPBA 2PEYA 2HPZA 2V0CA 4HDMA 4JYCA 4NDZA 4S35A 3LPMA 5FA5A 2TMYA 1E5XA 1F17A 4LMPA 4Q4AB 4LC1A 5FWNA 5KC8A 4TMZA 2C5AA 4JGGA 1CFJA 2PLNA 3RB8A 3GARA 3R7DA 1XEFA 3W8FA 4XYEA 3V1UA 3QJ5A 4G8BA 2JGJA 3GCWA 2MOKA 2FGJA 3QXXA 4Z86A 3RNOA 4XDYA 2I2DA 4HFJA 5GJWC 4ZGBA 3FFAA 4YJ3F 4BEVA 4RTLA 4LF8B 3FHJA 3THYB 1NLFA 5KSWB 3PZBA 1IN8A 1T2EA 3T7TA 3CB2A 4ALNA 1QRUA 1N5DA 4LXTA 1MQAA 2D1TA 2QTMA 3IVXA 2NU6B 2QI9C 4UHCA 1RQNA 5CXQA 3GGGA 4LE2A 1VQ1A 2XQJA 4L6CA 4X6YA 1F06A 4XR4A 1B93A 1JIUA 3E2MA 1TA0A 4TTIA 1WU7A 3AF1A 2A1UA 4B0PA 5AW3A 5D3QA 1SHLA 2PKWA 4EF4A 3BE6A 4HPXB 3Q3GE 4WBNB 2BR4A 3I2YX 5LNK1 1MO3A 1NF2A 3RS3A 3TL3A 1ISJA 1XT6A 1CRZA 2C0PA 5GONA 1YULA 1GG5A 2Q6KA 1B6GA 2H2FA 1S89A 3HZRA 3LRXA 4FFBB 5TARA 2C5FA 4RFSA 1YFLA 1OZGA 4PS0A 3UCFA 2P3LA 4ZYVA 4IKEA 4CCSA 5ALWA 2OV3A 1LSUA 4MVJF 3OHPA 2VP6A 3NXKA 4UAVA 1F0NA 2L82A 4WJKB 1EG2A 2Q45A 4Z8YA 1X3LA 3TW8A 1ZIDA 1PZGA 1TF5A 4ZV4A 3CLSC 5E3IA 3FM9A 2GD0A 4P34A 4D9BA 3TL6A 5LZ4A 4JU8A 5K3AA 4FMCF 1WZUA 1I7PA 3A06A 4FDUA 4A4DA 4C2UA 5CA1A 5KDLA 4RMJA 1JWBB 4OVKA 1E9CA 4J4BA 1XDBA 2R66A 1KFEB 4YV7A 5JROA 3K70B 1NQUA 3EULA 4XIYA 4OQ4A 3QI7A 2XVYA 2I22A 3RYHB 4LMRA 1GRCA 4QJIA 1QGOA 2ID4A 3E3OA 4ZVUA 4RHFA 3EBLA 3FIUA 4N12A 1V4VA 2AYZA 3A3PA 4L2IA 4PHHA 2ZIVB 4AZTA 1BMQA 3I4CA 4U3JB 4HDCA 3U80A 1QXSA 2ZI7A 8OHMA 5KREA 1F9EA 4CMBA 1IK6A 1RACA 5F23A 4P93A 1AHNA 2Q0QA 2O2HA 3HVHA 4CETA 1CS0A 1S01A 2RGAA 3Q7PA 1B3RA 3RSHA 4PEVA 5KYWA 1GAWA 4NOJA 1VCNA 3NTXA 3QKIA 3PUYA 4DLRA 3O21A 3WGLA 2AG5A 1FDUA 2OV4A 3IKJA 5KYVA 1TFRA 2Q1TA 3NYRA 3IP6A 3PLNA 4BLPA 5CAEA 1UJBA 2BFOA 2ZYTX 3GJYA 4RDCA 3H8JA 3CO0S 1B8NA 1NQVA 3WJAA 1XXLA 2VNJA 3CLKA 4LYGA 3AF3A 1RWPA 1VLVA 1ZGGA 1C0PA 4LTNA 4RD4A 4J4TA 1MX3A 5I5EA 1PQYA 4IWNA 4GMFA 3ROZA 3T4UA 3TAUA 4BC0A 5HZMA 3TG2A 4CV1A 4H27A 4ND2A 2O8VA 4NBVA 3T3MB 3N2YA 1G6OA 2QTTA 1QYRA 3ORRA 4I6EA 2ZSBA 4Q4HB 5L3ZA 1M1YB 4YIKA 3TWOA 1U3CA 5BQXA 1LDBA 2AQHA 5FUVA 3T1HB 1EHYA 1PV4A 4LY6A 8MHTA 3N1UA 1ZAKA 1U28A 3MYRA 5JO9A 1R16A 1YDMA 1E4EA 4NYJR 2W2QA 5GZ6A 4EQ6B 2VWGA 3TFOA 3I2FA 5EZYA 9ABPA 1GL3A 4WIAA 1Q3TA 4LOJA 2ZLBA 2Q27A 1RBOC 2QQGA 1KEWA 1W4ZA 2YH2A 2JIPA 2XNDD 3GZTB 4MVYA 5BUQA 2WHYA 5FBRB 4GKJB 4QHTA 4OJTA 4ZTUB 2IF0A 3LJKA 1MDBA 2VRBA 3NJ4A 3MQ4A 2GM4A 2XJ9A 3IB6A 4B2LA 4DPLA 1MGPA 3WLIA 4D8VA 5AW6A 3NOXA 3VA7A 5EWMA 1I4DD 1AMUA 1ZITA 5D3MA 1J24A 1EFVA 4BUCA 1KJIA 1C2TA 4DQVA 4YMLA 4E5UA 4P4SB 2WHRA 1W29A 2WTEA 4MVJE 2P11A 4PPYA 2I3DA 4RKYA 1Z0IA 2BKUA 4JLJA 4CT4B 4ISCA 1YNSA 4K6FA 3F96A 3KB1A 1Z2AA 2R4TA 1DV1A 2Y1EA 4QOFA 2JJ2D 3HJUA 4L22A 4WI1A 1I7SB 1PDWA 1JDBB 3A26A 2WY2D 2VZ9A 1Z22A 2FOIA 4AC9A 2XCUA 3HFSA 3W8EA 1JR3D 2BGWA 1CZLA 3CLHA 2HRDA 3S4YA 1BRTA 4PQGA 4R81A 1P8JA 1J49A 4MUXA 4R16A 5DNEA 4F7WA 2IRWA 2VDLB 4RCZA 3FYUB 4XCVA 4GLOA 4UM7A 4AJEA 1P3Y1 4IS3A 2HHLA 2AHRA 3M6XA 3RIEA 3EXHA 4Z99A 3WKEA 1YRAA 1J09A 3OFNA 1PJLA 5DIFA 1UPCA 4DV7B 2C82A 4MJ7A 4H7FA 1NF3A 1ZOLA 4YJGB 4YYEA 4E11A 4GO1A 1Z26A 2J9XB 4DNPA 2QF7A 1C7JA 3NBUA 1XZ8A 4MWOA 3RQIA 2ZZMA 4NPHA 2I6SA 4X8HA 4PANA 3UCXA 3QG1A 5BR4A 4PYIA 1V1MA 4UCFA 5F1KA 1YVUA 5KSOA 2QN2A 1NW7A 2W2LD 1OC4A 2AD1A 3AF0A 4F60A 4YJFA 4CXMA 9GPBA 2YIJA 4Q5IA 3ASVA 2GPWA 4D96A 3KR1A 2V6JA 2IHKA 2Q9UA 4BNWA 4O2BB 4OHYA 2W43A 4OHBA 1EP3B 4I6JA 1N6IA 3DLAA 3ISVA 2E37A 3L6OO 1K8YB 4NCNA 5G4KB 3PNQA 5CX4A 2ATVA 1E66A 2G5GX 1SPXA 3DTVD 4Y2TA 1G5TA 3H9JA 5BSMA 3TEJA 3U4AA 3W6PA 1QH1A 4NZYA 5F4BA 4ND5A 1WMEA 2FQQA 2JIDA 2V1UA 3SX4A 3E18A 4CQMD 3EG9A 2NUPB 4IUDS 5EMNA 3P9IA 4CTJA 1GVNB 1Z07A 1ZVJA 2I4TA 2JANA 3SFVA 4Q1BA 5AW9A 1K89A 2XRZA 1DO2A 4B81A 5CB0A 2V9CA 2K6GA 3L1HA 3WBFA 4CN8A 5L3SB 4K0RA 3PFKA 1W36B 3T1QA 2X2EA 3UV6A 3T5MA 1MUUA 4UTVA 1JIJA 2HADA 3OJ0A 2VEOA 4KR3A 1CUUA 1YL7A 1RCFA 3SZ3A 4KN6A 1UMDB 1DC7A 1JJBA 1VBNA 5L3QA 3LGXA 3MIZA 2G0NA 4OCZA 4F4HA 3RS8A 3B5EA 4PQRA 4RXUA 1GZVA 1VKJA 2WWFA 3DHYA 3TRKA 2R8PA 3EC2A 4LHWA 1OGIA 3ELDA 2HT1A 2OBYA 1F9AA 3AI1A 3E81A 3QBDA 3AKEA 1ARZA 5LP6C 4F38A 1PV2A 2R1TB 3EH1A 4P58A 4PAGA 5E4TA 3QFHA 2MSEB 4FW8A 3GZ4A 4Q4CA 1G20E 2IEGA 1DX4A 2YN4A 2UXBB 5F7JA 1UP6A 3A04A 3QSYA 4QTYA 4HS9A 2FCRA 1FRQA 4DQDA 3QMPA 4I4IA 4NK5A 5LB2A 3ESYA 5CYFA 5JAPA 2NUAB 3ABOB 4E2FA 2GKOA 4I50F 1H22A 1HDOA 1GUDA 3F67A 4RPKA 4EVQA 1RMQA 2BKXA 3LBNA 3NV9A 4TV8A 2GEDA 3D7SA 2H54A 3MJHA 2H59A 4L85A 1A4UA 4QM7A 5HMMA 4EI9A 4MWBA 3WGIA 4R9NA 2YDXA 3L8EA 4M6WB 2BI8A 1MA0A 1CUSA 4R5HA 5JVDB 2PBFA 2BGRA 2FWIA 3E5MA 5BRNA 1JHDA 3L7JA 3O31A 4Q05A 3T7DA 4HTFA 3X2FA 5DRYA 4ZIRA 3IE2A 4ER3A 4DKJA 3EDRA 2BR3A 1BEUB 2XA2A 4XUCA 2VT2A 4EH1A 1JF8A 1SVNA 3ZHZA 4EFNA 4ZVNA 4ZI5A 5J58A 5K09A 2Q5OA 1ID1A 4ZU1X 5AUQA 1A4RA 2DKNA 3GFOA 1N77A 1PK7A 3QY9A 4Q24A 4YMGA 4HNTA 2OG1A 1G2PA 1T2FA 2PO7A 4W99A 6PFKA 1XTPA 2IH2A 2V7PA 2UVPA 1XCJA 4PYJA 1L5KA 2BHSA 2CVHA 4KBGA 3IQZA 1FY2A 3EK2A 1ODKA 3PE4A 1G8FA 3FMIA 3UK6A 1MJHA 2VTDA 2FLKA 2ZI3A 3KSUA 4MAFA 5EA2A 1T1IA 2QMHA 2ILVA 2ZPAA 2C04A 2R7MA 3IIJA 4PZAA 2VN8A 4O4LA 3W9BA 1FDWA 4UDOA 3ABRB 1RI2A 2OL4A 3FVRA 2GA9A 2RHRA 4RVCA 5HCNA 3IMKA 1NI3A 2J46A 4HLNA 4LDPA 3ZWWA 1PZMA 3AR7A 5F3RA 4DVGA 4KNYA 4AKHA 3NC4A 5IAOA 1BCSB 4KH0A 2P5UA 5HS4A 2AYYA 5F5LA 1KXJA 4KRYA 4DQKA 1W93A 4W8OA 4YRAA 2Z83A 5A06A 2ZU0C 3HR8A 4G0ZA 3T1VA 1LRJA 4J03A 2FFRA 4M8IA 3F5SA 3DFFA 4ANFA 3HV0A 3GLQA 5K8UA 3NLLA 4MRRA 5SV2A 3KUCA 1GNSA 2CMKA 1F48A 5J1SB 2R25B 5L7YA 3SBOA 2VH1A 1V3TA 2IUYA 2JGRA 1WXQA 4TMVA 4YCSA 3IVRA 3NH9A 1AUOA 2ODQA 3EISA 5KKAA 5F7XA 5AW1A 1IU9A 1NC3A 4E5YA 3NTUA 3L4EA 4OJQA 2XNKA 5BSKA 1M1XB 4O63O 1ZKDA 4JQCA 5ITZB 2B7BA 4EG8A 4YRCA 5HZHA 4EK9A 2PCLA 3Q7RA 5BSGA 3BERA 3B52X 3FVVA 3DLPX 3G2IA 1CE8B 3JQ7A 4WUTA 2QORA 4FNMA 2QPLA 4DV5B 2ZETA 2FZVA 1WQ3A 5EERA 3UWDA 4CF3A 1IQUA 1HDIA 3T3GA 2M98A 2FVXA 3GI1A 1CXZA 2CVFA 2QL7A 4I3FA 4X7RA 4LN1A 1M5RA 3EW9A 3DUWA 2QENA 2NYUA 1I6LA 3A9SA 3SXJA 3R9XA 1VG0B 3IV6A 5E4JA 4ZQCB 4OXQA 3TKLA 5B1YA 4LJLA 4H7HA 1CR4A 1SUIA 3HUUA 2HGZA 1VKNA 2X8JA 1ZOIA 1QX3A 4BFWA 2E0IA 1U1FA 3AHEA 3RO7A 3VC3A 2GOYA 4R8MA 1DCFA 4FMDB 3WQSB 2QTRA 4K0KB 4DA6A 1LTQA 4LNUB 5SYMA 5HF9A 3RODA 5J1TB 1Q7TA 3EHDA 1DAOA 4FFPA 4K3UA 4OQDA 4ZXPA 5K0TA 3EIWA 2FR8A 3FB4A 3Q0IA 3VVBA 1RYZA 2NZVG 2PZGA 3M4ZA 5B2FA 5M2QA 2KYRA 1Z7YA 1BJKA 5AHKA 5DX8A 3W9SA 4ZHSA 4DWOA 1RQ7A 1RTKA 2POCA 1L8XA 1EA5A 4TKVB 2XNDA 4RM2A 3A6HA 5DV9A 2J4DA 5ILOA 5JH7A 1VPEA 2QRPA 3BGDA 4WEOA 4QKQA 4QWMA 4I9HA 3SJUA 4ABYA 1HG0A 2PBLA 4L78A 2X76A 2Q62A 4BQNA 3KKMA 5B6PA 3PRJA 2QJOA 3ONVA 1LVHA 1KKLA 3WGKA 4D5GA 2DCMA 5TC4A 2WJHA 1CY0A 4PNEA 4B84A 3ZU3A 4L5BA 1ZQ1A 3AFNA 4KWEA 1UDXA 2JJ2A 3UGJA 4JJZA 5CCDA 3AVYA 3HL0A 1H2WA 2YFHA 1A9ZA 1FLDA 1T3GA 2IP2A 3R8CA 5HKLA 1H8HA 4GLFA 5K0JA 3PSHA 2PGXA 4FGSA 1XDWA 4P31A 1JR3A 1M1UA 4HAOA 1JSZA 3M9LA 4MYUA 4MQEA 1RKUA 3GY0A 3CT6A 4TL7A 3MRXA 2HK7A 2HDNB 4XWWA 5EPOA 5FT9A 1DFIA 3OOJA 5AWFC 4EFMA 2R96A 3T94A 1OB5A 3DMTC 3H5OA 4PQYA 2NU8B 1VLJA 2YOHA 5K0SA 2QP9X 2AJDA 5KYTA 4C5CA 3P9QA 3AOEA 3PG5A 4I55F 4RQTA 4OQPA 3V4RA 1UWCA 1R64A 2JLAA 1N4AA 3Q9SA 2HJVA 1R0CA 5J23A 5IW8A 4KQMA 4XFJA 5D5PA 5EUQB 5GONF 3UHOA 2C1ZA 3D6MA 4JMLA 2ZJOA 5FI3A 2BEJA 1QKKA 3PBKA 1DEHA 2M1XA 3EOAI 1R0BA 5J4LA 3V1TC 4R68A 2W2LA 2WC1A 4BZZA 2V0GA 3W6OA 4D25A 2XSZD 1NZFA 3O8LA 4KMOA 5AVUA 2QPTA 2O6LA 3BGVA 1JG6A 4JLSA 1E2MA 1EJ7S 1LW6E 2X2OA 3AETB 4MJXA 5ED0A 1SC4A 1CDZA 1NA5A 1AS3A 1RQGA 4CM9A 4E32A 1VYVA 2FMKA 3MF4A 4RH3A 3B1XA 1KHTA 1ZK3A 3N70A 1V4NA 3ML1A 4K40A 4W5RA 1XEAA 3VR2A 2RHDA 3GVHA 3GGPA 4H1TA 3DTVA 2GEBA 4M54A 1DVRA 4DAOA 2O7SA 3EPLA 1YFZA 1SA0A 2I7VA 5D1NA 1YAJA 4CQMA 4GVPA 2HSDA 3G5TA 4KXXA 1IDN1 2B4KA 2G9VA 3AI7A 2BVNA 4NATA 3FWZA 4H0FA 4ZQHA 3UAZA 5HVNA 4HQLA 2OV8A 2Q3BA 1F8XA 3PT5A 1W5FA 3LOQA 4N0QA 3IAM1 1XQXA 1LA2A 2ZB4A 4W5OA 3GFTA 1B8OA 4GKAA 4YWHA 3RIYA 2ZWVA 3CTMA 1S2MA 5FOQA 5EMKA 1ZM4A 1DHRA 3C3XA 1HA3A 3FZGA 3AHDA 2KSQA 5JDIC 4QGFA 2QEQA 4IICA 1LI4A 1ICIA 1C0KA 2GF9A 3NHYA 4F06A 1KEPA 1TT7A 5HRAA 3W79A 1SKQA 1R4MB 1NX9A 3S29A 1CZOA 1GDDA 3GLVA 1FS5A 1EWRA 8ATCA 2HQBA 4R98A 3G89A 3WICA 4OA5A 3OLQA 3W5IA 4RTOA 3OX1A 5KYGA 4A6XA 2X1HA 1X70A 3GPCA 3N8HA 3RVOA 4D99A 3BCRA 4PG7A 2WA1A 1TTHA 4BFUA 1Y6QA 3JY6A 5D00A 1L2TA 4GOXA 5EFOA 3K09C 4J7AA 1LI7A 4DMMA 1G291 4Z4HA 1U3VA 2W6CX 3BGOS 4RVFA 2V1XA 5A9TA 3K9GA 1OTXA 1T5SA 1PLKA 3LIIA 2PX5A 2DERA 2EAUA 2QZPA 1DIOB 3QKRB 1VL0A 3ZHSA 3FTEA 4Q3LA 1PK9A 2G40A 3S2YA 1DZIA 3V3TA 1OBOA 1R8YA 2NZ8A 3D6UA 4TV9B 5B53A 3RRYA 1M2OB 4NYJQ 4C4XA 4F86A 2IYOA 1N6LA 4FR2A 1Y1PA 1D03A 1NFFA 1VB5A 3OWHA 5EWLB 2H9IA 5EL0A 2YHIB 4C87A 3BH6A 1KDOA 2ZXUA 2HRRA 2NTNA 3KJHA 1BW9A 4M86A 4GYYA 2VPQA 4YO8A 2WG0A 2YTZA 1CQZA 3KDPA 3UMGA 1SXJD 2BZ0A 2CUTA 4TROA 4GZ3A 2NZYA 4YAOA 4WFQA 4BVBA 1M2EA 2NNWB 2FZ5A 5DYNA 4UM8B 2A30A 4QHYA 3USZA 4Z7NB 2D0DA 2CW5A 2O8DB 1U9CA 5LDGA 1FIUA 4KXUA 1DTSA 3GRVA 2IW3A 3OZAA 4GBGA 4KSYA 1GAXA 1WE2A 5ITWA 2LNDA 1PLJA 5CDSA 4U7WA 4G63A 1A9RA 3OMLA 3PUXA 4MWEA 2VAWA 4KR9A 5BW6B 4A1OA 1C4KA 1UJ2A 5FHQA 4J90A 4INZA 4AB1A 3JYNA 4RM3A 3WZLA 4GQIA 4UJ3A 2NGRA 2M6KA 5GV7A 3M3PA 2R86A 1IBRA 1U2SA 1WU8A 2CMDA 3GFPA 4RVOA 5KX5B 3VNSA 2ZIFA 3CIOA 4H9GA 2WUVA 1UQTA 3C3EA 1UMBA 1COWD 2PEZA 3HKBA 3KJEA 2A8YA 3Q3IA 4AZ3A 3U13A 2H1VA 2VSFA 4WW0A 3VH3A 1LBQA 3UC9A 3AGQA 1HLFA 3LQYA 1ZC3A 2O4UX 1L4HA 4UHDA 1A2QA 3EGWA 1SXPA 1P1CA 1GPNA 3MBKA 4TQAA 4K1XA 3SHTA 4C20A 4DA7A 4FMPA 2VTVA 4LYAA 2HMYB 2BH2A 3LHDA 2ZAMA 4YAIA 1I2ZA 2P7HA 2XNSA 3CZAA 3DLCA 2F3SA 3SS8A 1TW3A 4B6OA 5KQPA 4EAAA 1CU1A 4A2WA 2JGDA 1V4BA 1DBPA 1BKYA 2HPHA 4C76A 3JQ8A 2RKOA 5JCOC 4DF3A 4A6EA 1ZZGA 1ZD2P 3OEWA 5EZ6B 4JP8A 5TQ2A 3HR7A 2YHSA 3T41A 1KSGA 2VBGA 2WVHA 3ZTWA 1Y33E 3BAFA 1NUHA 4AT1A 4BX0A 1KRXA 3VOTA 3WIVA 3GP8A 2ZUCA 2BD0A 2FLWA 1O97D 4UU8A 1NGSA 1Y7TA 2DPHA 5K6RA 2NP6A 4IDCA 1C0LA 2VOEA 3COPA 4ZO8A 1GKLA 1OWOA 2PPLA 5KPDA 1XEXB 3PD0A 5T6MA 4PE5B 1M2KA 1NQ5A 3UN1A 2JIOA 3IKMB 2OM2A 5EUCA 2PZMA 3MLBA 1DV2A 3Q5EA 5ERYA 1C8LA 3VYTB 3K9FC 3LLMA 1I51A 3GMTA 5IHPA 3DXYA 1G3RA 4TVKA 4I5FA 1OHHA 4N3AA 4QATA 2MMGA 2OQ2A 4ITVA 1P0CA 2XT9A 1OFUA 4ZRNA 3OKCA 1YS2X 4Y2RA 1O5TA 1QWSA 2RAFA 2HIHA 4U2DA 4RS3A 2FQXA 3TLBA 2OHHA 3FDFA 2R44A 1PGPA 4XQGA 2PMWB 4HHHS 2P7IA 2Y1OA 4OB6A 1QIFA 2Y4OA 4AYWA 2Q4BA 3QX8A 3S2ZA 4EEZA 2QRNA 2J67A 2QG6A 2RBKA 1D2AA 3B60A 4PHGA 3UUWA 1XC7A 1FP4A 3ZIDA 1ZW6A 3UBMA 3UMCA 2I6TA 1ZI6A 1G8SA 4CV2A 5IULC 3ZXYA 2XODA 1KOFA 1ECCA 3I0NA 4LHYA 2E4UA 3W04A 2QVYX 1DAPA 1RLJA 4FC6A 4GQAA 4J0IA 5DX1A 5FTLA 4LOHA 1UFOA 4XVRA 3GLGB 1KYZA 1FUUA 1M74A 4DLUA 1KQ3A 3NHSA 5KQSA 1KC1A 1RAFA 4Y2VA 3KVNA 1GTVA 1DAGA 2E1PA 3U3RA 3K05A 3RPEA 1GRVA 2QZ4A 4B8ZA 3U7HB 4EJSC 4WN3A 1CHDA 1L5SA 3NOQA 3I5MA 3WG9A 3WX0A 5FAKA 1OXUA 3B7WA 5JAQA 2C97A 3HVKA 1I1HA 2OFXA 4JUIA 2EKBA 2PUHA 1V6AA 4IP0A 3SYRA 3KKKA 3UGQA 4OKSA 4CR6A 4AKGA 4OU4A 4W6QA 5F2OA 1X80B 3AY6A 3DXZA 3L7IA 1IUOA 4TN5A 1LEHA 2FXIA 4EGJA 4AUEA 2GERA 3N87A 4ENSA 4QGHA 3K32A 1RDFA 5ICFA 4W5TA 2CLEB 2QVLA 1Y3AA 1A8SA 4RMIA 3VDMA 4EFDA 2HX1A 2VYFA 2Y92A 3KQLA 1N8KA 4GMXA 3C3MA 4BVFA 1NN3A 1R0RE 5A6VA 4J0GA 4XOIA 1TRHA 4CF7A 5I7SA 3GFBA 1J23A 3JRNA 4IYRA 1UAAA 1PL0A 4RJKA 1OGJA 1WUHS 4RH0A 1JG7A 2WUGA 4PZ0A 4KACA 1ZNQO 3AJAA 2V3VA 5K0GA 4NENB 2JFPA 1A9XA 1XDZA 3AU9A 3UMYA 2F1RA 2ADFA 1ENOA 3U4QA 1QX4A 1A72A 3U0BA 4CEJB 2WKWA 3WL3A 4HEQA 4XDZA 3HDVA 1GLNA 2DFXI 1LWNA 1VYTA 2Z43A 5DKFA 4NFLA 1D6SA 3UAOA 1EG7A 2PKEA 1MABA 3EGXB 5CD9A 3KLOA 4NYIR 4HGYA 5D85A 5DSXA 5HFJA 5C8XA 4GX2A 1EHCA 1PNQA 1XV5A 4RPHA 3OA0A 4HDNA 1JKIA 3B6EA 3D43A 3DZBA 3FPLA 3LECA 3QPUA 1R3UA 1X86B 3K4PA 3ZNNA 1MGOA 5T7BA 4CQJA 4FXOA 2YV5A 1T5IA 1XD8A 2PXCA 3BWMA 4HATA 3IERA 3N7AA 4MGIR 4PO8A 3I6IA 3HO6A 1ZD4A 2YWGA 5FLEX 5LWQA 4OBXA 2IU6A 2TYSB 2VJMA 1XTVA 3E23A 4JN6B 5FBKA 3IVCA 5EXTA 3DMNA 1ZWKA 2BJHA 3FHCB 1CUEA 4O5OA 3KKEA 4ZT5A 3UJHA 3VPHA 5CB4A 4D9IA 1AGNA 5DO9A 2RMKA 4MEBA 1AQIA 4C0XA 5SZJA 4EHNA 4KQWA 2UVQA 1UMCB 2O2JA 1DKOA 1OZFA 4HXEB 4OLJA 4BP9A 4E15A 1IM8A 1I4TD 4Y2XA 5ALLA 3E22B 1E9SA 2BCEA 2ZQZA 1PWEA 3N2IA 1OXXK 1EB8A 2Y68A 1SQSA 2ONYA 2YINC 5I7VA 3O3NB 2CD9A 5JJCA 3P2MA 4E03A 4EUKA 3VR2D 3NOOA 4IOLA 3SXUB 1IBMB 1I1QB 4X5OA 4GZMA 5MDHA 3W8RA 4J29A 4MRVA 3A6PC 1QO9A 4WOCA 4QUHA 1AXEA 3TOCA 1V1RB 1ZOOA 3BL8A 3JQPA 4WNYA 5ICMA 5JZBA 1O5IA 4R2MA 4Z0TA 1MAWA 4QJ5A 5F7ZA 1YDEA 3EN0A 3BMQB 2C9MA 2VAPA 1NVGA 3RREA 3AHIA 1G9SA 1X7DA 2WIGA 3N6RA 1JDTA 3T5BA 4CODB 1E2DA 1M72A 4BMVA 3PRYA 3GLFA 4JI3B 2OXCA 2PFGA 4BB6A 4LK3A 3OESA 4D4GA 3Q1LA 4RJTA 3RTEA 5JW6A 2WZCA 2PG3A 4WMLA 2QR5A 3EIOA 1N2ZA 1XZIA 2GBGA 4J43A 4LPKA 2AOUB 2P0EA 5DX0A 3KYDB 1N32B 3PT9A 4QOSA 4F8JA 3NB0A 4UE2A 1XKLA 2J6BA 2XMZA 4N0EA 5AW2A 4BXOA 1PSWA 3HP1A 3W7VA 1GQYA 1E5LA 2QUJA 2W8BA 2PMEA 5KYWB 4OMFG 4Z4GA 3O1IC 2G83A 3H5NA 3V6LA 1P61B 3OAAA 4DDUA 3NDPA 4JJ4A 1FDSA 4OH7A 1ULBA 4IJWA 3V00A 3F1LA 4HNVA 1QC5B 2FSVA 4KQJA 3IRUA 2WQZA 3O73A 2X9GA 2LDBA 3KVYA 3NQ41 3WYGA 5SY4A 5JH7F 2R4QA 4HUJA 2Y93A 4ONEA 3S8EA 2IS6A 3P0FA 3FXAA 4RY2A 3V4PB 3GUYA 1R8SA 1SXJA 2WMOB 4HFRA 4KQCA 1WSBA 2ZBEA 1A77A 2B37A 1EK5A 2ZTHA 1YV9A 2RHHA 1GUAA 3BWYA 2C2XA 3OG9A 2FW1A 3O8DA 4MO9A 4UEKA 4ZVTA 3ZIUA 3JALA 1TYAE 1Y7HA 4BAZA 4UU7A 4GPBA 1SUDA 2YRFA 1P3DA 4N8DA 4O25A 1B26A 3RIMA 2HF7A 3A1WA 3T3PB 3F49S 3U3OA 3LW7A 4NZZA 2RHLA 4HBZA 4Y6SA 1KEZA 4ZXFA 1GCUA 1WJGA 5C8VA 4KQEA 3SBDA 3FMGA 2GK7A 3JQ6A 4JBLA 3ZWYA 2PJRA 1TU4A 1JW9B 2RDMA 3ETJA 1P18A 2XZOA 1GQ2A 2Y99A 5IH3A 3DBOB 5ALEA 2IBMA 3H4IA 2V7BA 1A04A 2ACWA 4IW3B 4A91A 5MHTA 4QYSA 3RVMA 3UCEA 1K86A 1COWA 2REBA 5D87A 1IG0A 2I6QA 4JYMA 3V1YA 1JJ7A 2DRIA 1Q0PA 1X94A 1XLVA 3HBFA 1RYEA 3OE7D 4TLEA 4FB4A 3GRFA 1QP0A 3L84A 3ROTA 4E21A 2XB4A 4EB6A 2Z56A 1QVWA 4JU9A 5K8LA 1WBJB 2RHTA 3T5DA 3NONA 2OYSA 1KEVA 3G7SA 2VNSA 3URKA 3OJOA 1QO0D 3Q85A 4LJ4A 4ILKA 4MINA 4OQEA 2DFLA 4K86A 4XX1A 4EY4A 4I81A 3UFXB 3O4RA 1JB9A 3RC2A 5I4BA 2CCKA 3AVPA 3V6MA 1SHUX 1UIMA 4TM7A 2P2GA 3HR4A 4M88A 4RY9A 2IYUA 4Y18A 3M5PA 4KBFA 4BWFB 5KNLA 1QHGA 2YBVB 1CHNA 5JSYA 3O83A 4B6PA 1U0JA 1SR8A 1PEYA 2FPPB 2JI7A 1HBJA 1K8XB 2YX1A 1L7EA 1QTRA 3GAZA 4KO3S 5SYNA 1TEHA 1CUDA 3A27A 3BMCB 4MRAA 4C0QC 4WLVA 3TE6A 1U0SY 5LD2B 1K7YA 1KHHA 4IDHA 4KSCA 4I9UA 1R6UA 1UBTS 3HFGA 1EVQA 1Y42X 1JH8A 3FSEA 2C3PA 5EN4A 1ZGJA 2J48A 2Z9DA 1EFTA 3GT3A 1RWXA 3GQBA 4TYQA 2XMCA 3ER8A 1UKEA 4POAA 1MJNA 2Q1XA 3VGJA 1RLIA 3A6KA 1HTTA 3O9VA 4UBMA 3QM1A 2F8SA 4YP5A 2LVBA 2XYQA 1DFGA 3QE4A 3CINA 4R2IA 2GHRA 3A4VA 4CFSA 2ZR0A 5BMVF 1PJ3A 3KB8A 3DVSX 2J0UB 2YZGA 2KBEA 4YECA 2YJ3A 4U4AA 3DYBA 5E0KB 5G1PA 3W4KA 2Q6TA 1UM8A 3KEQA 4Z1OA 4LDNA 1E7MA 1EVLA 2KW5A 4B3MB 1XZQA 4WKBA 4A2CA 5LUAA 2A9KA 2P9HA 3DR3A 2FF5A 1XYGA 3LCVB 2WF7A 4EMUA 1QDUA 3OIGA 1PJZA 3VRHA 1O95D 3E9NA 4J8PA 1HMPA 1NE2A 4YDHB 3V2HA 2AX4A 4IFBA 3OI7A 4A15A 4UZFA 1SHKA 1K88A 1XRLA 3O0TA 4PCLA 4BX9A 1Z6GA 4M46A 2QUKA 1N0HA 4MLZA 3VYRB 2GEUA 1ZVMA 2PL3A 3EQ8A 4HDRA 1M5TA 1WEHA 1YIAA 3FUXA 4IOMA 5IXJA 5B58C 3IAAA 2DYKA 2P62A 1TT5B 1CETA 1I33A 1JSLA 2PMCA 5EJAA 5FL3A 4BIMA 3QWIA 1GN9A 2N47A 4UNQA 1HZZC 1HR0B 2XHEA 1I0LA 1ZM9A 3N0RA 1JR3E 1KNXA 5CFRA 1PI3A 2GJKA 4TXLA 4IMJB 1W5SA 3WYNA 4U7GA 2DBYA 3IBFA 3ICWA 1XN1A 1P7YA 1H94A 1R1DA 3MHPA 1M2NA 3E35A 4JJGA 4MUBA 4DR7B 4LVUA 1M6VB 3P4XA 1WCV1 4QVGA 5KYKA 1XQ1A 1PR1A 1M34B 3GNLA 2PRZA 5K0NA 1GLGA 4X63A 4XLLA 2UZ1A 1CUAA 4Q47A 4RWEA 4AZSA 3OQVA 3MMPA 3SE0A 5L4LA 3INTA 1D2GA 4IJVA 2BP7B 3EZ9A 3KYIB 2ZWMA 3N2NA 4U1RA 2X42A 3UHAA 1SURA 4BX3A 2BMWA 1I0IA 2BJVA 1ZHOA 1Y5IA 2VPZA 4MRSA 4TKLA 5I3CA 3SLRA 2G8NA 1W47A 1U4SA 2I2WA 2FX5A 3DH0A 3I23A 3QUTA 2JAUA 5SY9A 3RUEA 3MOGA 4KIFA 4DCNA 2ZI4A 4UUMA 4XZ3A 1KJZA 1HLPA 2VJKA 4EGQA 2FPMA 3JQ9A 4EL0A 4F5ZA 1BQEA 2IS2A 1LNSA 1SZDA 5IYZF 4MUFA 4HXGA 3V3KA 1PR3A 4O2AA 3WJ2A 5LSAA 5KWVA 1MNQA 2C5HA 4UBOA 1JQKA 2MDTA 2GVNA 3WKDA 1VP3A 1CUZA 3SFZA 5TMPA 2G04A 1MRSA 3FJYA 1M7BA 4J3JA 3EUWA 2QZZA 1USKA 4RVGA 4EYOA 1GZ6A 1PNOA 1RM4A 3HA2A 1E8NA 1GYRA 1W2GA 3N07A 1KQGA 3T0GA 2C7QA 1WXIA 2ZQYA 2LXNA 2UZAA 4P4TA 4M87A 1E1CB 4R9VA 4JOBA 1AG9A 1Z8HA 3ED5A 3GLTA 5LU9A 2AUNA 3KD2A 1BVUA 3MXTA 4WKOA 4GP7A 4NSNA 1CIVA 4EY7A 2NSHA 4ZEMA 2EATA 4JB2A 3TG8A 1OOEA 3OPYA 1Z0ZA 2W2MA 5FWDA 5K8JB 3KQNA 1K2VN 3QVLA 1RHJA 4BB5A 2XQVA 1B76A 1N5IA 3QU2A 1WB5A 3CRMA 4HJXA 1AHPA 2ADOA 2EP5A 1OASA 4LY9A 1JU9A 1HY3A 1YHYA 3D7MA 4RIHA 2VPIA 4BBAA 3KFXA 4WLOA 1FXWA 1Y5MA 3E8MA 1MC8A 1TYCA 4W5NA 3JWJA 1XNJA 6REQA 2Q7DA 4OFWA 1V8FA 3LC1O 3OZVA 5F73A 2E49A 3TCNA 1ISSA 3KRTA 4PAQA 4R1QA 5EMHA 5EIAA 3U7QA 1RADA 1BXKA 3AJDA 5K0BA 5LJIA 1DXOA 4ES6A 4NCAA 2BRUC 1GY8A 3VTAA 2YBDA 1M0WA 2WDZA 2YV2A 1OE0A 4C0SA 1V3UA 4OHCA 4R0NA 3BCSA 1S8NA 3F6YA 3N0WA 4WTOA 5IT0A 2PIDA 2F1IA 3RSSA 3THXB 1EDDA 4JXZA 2CEAA 1E3IA 2SICE 5C46F 3L0ZA 1HNZB 3O8OB 1WPRA 3PVSA 4BTEA 3MMZA 3TNYA 3K8QA 3KE9A 4F3YA 1U7HA 1EFUA 1VE6A 3ZJ4A 1JKFA 2UZIR 5D5HA 4XFKA 1T9CA 1A98A 4UXIA 1IHYA 2GZ2A 4N3NA 5JD4A 1D2RA 4LNAA 2GTPA 1J2JA 2X13A 3O9MA 1ISHA 5C53B 2PX4A 3B82A 3M1AA 3MQFA 4GX1A 2FMHA 4ZI2A 3CVJA 1IVYA 4TLBA 1ODJA 1RAHA 621PA 1MOPA 3NVAA 4MGEA 4IILA 5GGXA 3ITKA 4EO7A 2P65A 4ZD6A 1TZ2A 4JJKA 2DBRA 2VBIA 4ZC8A 3U31A 1OAAA 2P9ZA 5BNIA 5AVJA 1ZD9A 4YALA 2QBYB 2H0QA 3DFUA 4L4XA 5TE9A 5ES3A 1JLKA 3LUPA 1E1NA 2YFQA 1XFDA 2A1TR 4MYDA 4QTUB 5CLIA 1L5FA 1NN0A 4DLXA 3EF1A 1KA9H 1OMOA 4S0ZA 3GEHA 3RC3A 2YN0A 1FPMA 4R2HA 2VDNB 2E5WA 2HGSA 3CSSA 4O6VA 1HC7A 2C59A 2K4MA 2CZQA 1NDHA 1SUPA 1HFWA 3LUCA 3QV1A 4LF4B 5KJ6A 2G6BA 1A50B 3PQCA 4YBRA 1R8XA 1FSPA 3JVDA 3E05A 3VU3A 2Z04A 3CKYA 2G28A 3LTEA 4MKZA 1TZBA 3P9SA 2WWHA 3SOZA 1N5LA 4DBZA 3RS5A 2WJWA 1W5BA 4HN2A 5K03A 3EMKA 1YZVA 3GLUA 4BKQA 4FYWA 1X1RA 3G6WA 4E6PA 1FP1D 1MG5A 1YO6A 4WNAA 2MTBA 5FBZA 5IJ0A 4R54A 4NARA 1JSCA 2A35A 2FV8A 2Q4OA 1VE3A 2JAHA 3UWMA 3BUSA 1OTYA 4G5SA 2B4RO 3AKDA 1Z0UA 4JVOA 4F7DA 3KEOA 4ZHQF 1M2HA 4PLPA 2UYHA 2DR3A 4FQ5A 1JEYA 3JR3A 1FP7A 1T8SA 1WL8A 1JDPA 2V54A 2ROQA 2XTZA 3DTTA 4EW2A 3CNBA 3OE7A 3ZEAA 4U7JA 3AU8A 1RQXA 4URZR 5G3ZA 4Z3KA 3KOYA 4L75A 4ND8B 3VH1A 5CBPB 5KHAA 4G5OA 1JSRA 2GQ0A 3M8KA 3ZE6A 1AX9A 1Z5UA 5JAIA 3ROKA 7AT1A 1N0IA 1J8QA 1YS6A 1QO0A 3GEMA 2NPOA 1SHJA 4UUAA 4AP9A 3H4VA 4EX6A 1MFPA 3NASA 1C0IA 2J9RA 1QFSA 2Y76A 1Z4LA 4R40A 1Q6YA 4IGEA 3SC2A 1JRLA 3GEEA 3KTAA 4PGFA 4WPGA 4HAXA 4RZSA 1S96A 2AUMA 4JKYA 1A9OA 4V0RA 1SUCA 4O1MA 1JDZA 4Y1RA 2Y2VA 3N28A 4D6YA 1C7IA 4NYIQ 4BNFA 4HWKA 2BL4A 1JEDA 3M33A 4PSCA 2WAOA 3RFUA 3ZXIA 5JI3E 3CNLA 5MGNA 3LFUA 2E2WA 2IYQA 3CPEA 4BQOA 5BRJA 2AK2A 3WAGA 2R6GA 2GM5A 1U7XA 3EIQA 1TCAA 4IX9A 4ZAGA 4DMRA 7ABPA 4HG2A 4Q3NA 4C05A 1FJGB 1FQKA 3QH4A 1XZGA 1V25A 3AUXA 1BHO1 1HQDA 3CKLA 2FZLA 2YVQA 5CB4F 3IV9A 1RE0A 2HWXA 2A1UB 2PX6A 5EJFA 2IDZA 3LIPA 4B45A 3EHEA 4CR7A 1HETA 2R11A 2PH5A 3PFWO 4Q3OA 1O4VA 2PZJA 5DSZA 4AJIA 1DCMA 1Z34A 3WK9A 2R62A 4P53A 3CW8X 2OV2A 2OHJA 3BD8A 4RFSB 4ITRC 4XIIA 1IWBB 1FDIA 3AUSA 4MGKR 2Y0DA 4WDRA 1E2KA 4WA8A 1BMFD 3ZW7A 4AY4A 1UCFA 1AS0A 1AOXA 1YBVA 3E58A 3B1VA 3EXEA 3KNZA 2BY4A 4GC5A 4KEAA 1JPJA 4XGRA 1O95A 4QOGA 2ZS8A 3RSZA 5JMWA 5C5DA 5EQJB 2VCEA 2NQ8A 5CMLA 3RT9A 2HHJA 3LP5A 3C39A 2C7VA 4M53A 5CA1B 1PO7A 1YTLA 2ZRAA 1KMHA 1R8JA 2IA5A 1I24A 3AONB 4N5MA 1M8GA 1MHPA 4LCBA 2EEPA 1SCJA 4LECA 3VISA 1GPLA 3LZ6A 5F64A 3K2QA 3F5DA 1NWCA 2O8BA 4M1OA 2CC2A 4QIHA 4IEFB 3KCQA 2ZT7A 3DM9B 2REQA 5LYYA 3RASA 4ETMA 3OZRA 4XLTA 5LUBA 1YZYA 1MIOA 1B8VA 1BFUA 3BZBA 3ONDA 4L2IB 1IZ0A 1M8FA 4CIVA 1U81A 1QNLA 4QQNA 3AUUA 5A7HA 1S8AA 3P2EA 4A8PA 1AUQA 2IY8A 3QMMA 4B8WA 3WR5A 2BBWA 1NPDA 1P4AA 1T9DA 1W4CA 2RGNA 4GPAA 1XK7A 1CF2O 2JFYA 1NM5A 2XTAA 4WY8A 4A0SA 2OFPA 5ELXA 1KOGA 1E98A 3ZCSA 1JDVA 4H60A 1OZ0A 1U8TA 4DYDA 1CS0B 1JJVA 3W06A 4AW9A 4E14A 3GAAA 3NXSA 4G09A 1T1RA 4L73A 5CT8A 1KMMA 4XFDA 2ZRFA 1B15A 3MGKA 4RELA 2RJ3A 3ESAA 4XASA 3WGQA 2QTFA 4IS2A 4ZDJA 1N33B 3WRVA 4AUMA 4OUDB 1BEZA 1B8PA 5ESXA 2FN7A 5F5NA 3ZDQA 5EJ2A 3AK4A 3L0SA 4D9GA 4Z51A 2JFVA 3AHHA 4ATNA 3R3XA 3TH5A 2EZ9A 2WTAA 1S2NA 5FWAA 1AQLA 3H13A 4RORA 1T43A 1QGDA 4OKNA 5LA6F 2IC5A 2VDPB 3I92A 3LQFA 3V4ZA 3Q7EA 3GJXC 3PCTA 4ZCSA 5AM5A 3HVUA 1EQ2A 1KI3A 4MROA 3HKEA 4MS1A 3E48A 3RYFA 2ETVA 4PG5A 3ZV5A 4FVTA 1F60A 3SZLA 4PVDA 1DSSG 3ONNA 5CFMA 4AN4A 1XJ0A 2HF9A 3PHIA 3ZLJA 3WK8A 5NLLA 3DAFA 2VTKA 1E4EB 4PZUA 2P6PA 3KOWA 1O8BA 1XHFA 2OD2A 3G0BA 5EZYB 3ZCVA 1GUFA 1YE3A 1TMGE 5BSVA 1EFRD 4B35A 2H48A 1GGMA 3EWNA 2X9NA 4EHHA 3H2IA 1SCUA 2OD9A 1RRVA 1KVUA 3EXFA 1I7LA 3R7BA 3IAS6 5B2EA 2NV6A 3FLMA 3KR2A 2HU7A 5C5IA 1ZBQA 2VQ3A 3FI9A 3GX1A 4BP8A 5LKRA 5GTDA 4ZOLB 1NT4A 1ZU4A 3GF4A 2RGGA 4W7SA 1O94C 3KPUA 5D3MB 1EFVB 4YCCA 3Q2KA 1K08A 4AZ0A 3IUPA 3JAWA 5E1DA 1Q16A 1V11A 1YZLA 2X1LA 5DCWA 4IDAA 5LWHA 2F9FA 2CNDA 2XNJA 4RSMA 2G25A 2NSYA 2OCBA 2L18A 4MVJI 3KQSA 4GYJA 1IVSA 2RFLA 4PGGA 3E15A 1KAMA 4UOQA 2VYCA 1VSTA 1CG6A 1CJBA 4MCAA 1PDVA 1AN0A 2QQEA 3L6DA 3E82A 1G5IA 5TX7A 2J6HA 4EVSA 3V2GA 2V7TA 2AT1A 2HC9A 5AIAA 4BNGA 1GN8A 5IABA 2PZLA 1XZDA 3IIKA 2JD2A 3LY7A 4MYRA 1FFWA 4O8ZA 3OLYA 1II0A 4MCJA 2VSNA 2X0DA 3D6AA 2NVOA 5HM6A 1U63A 3BL6A 2PL9A 1H9CA 5EP3A 1GGVA 3RI3A 4D6PA 1KBZA 4EKEA 3OIFA 2ZSIA 4I3GA 3ZJUA 2HA0A 4ZZ2A 1V8PA 1XVAA 2K7FA 3I0MA 5C1PA 2RIRA 1EMDA 5E6SB 3AM5A 2H17A 3CLVA 3PQ7A 1OYVA 4K9SA 2HRQA 3S5UA 3NIFB 3TLXA 4AY5A 3M34A 5T4FA 1ZNXA 1H6BA 1PJBA 1L7OA 2J3JA 4FFOA 5ALZA 1J22A 1T3LA 1VJ0A 5BYAA 1QTNA 2J3IA 3HCRA 1J9GA 2W2TA 3ZK7A 3HJBA 1UZAA 3IPXA 4QUAA 1H8ED 1GZ3A 2OFOA 3F7TA 4XM0A 1V1MB 1HOTA 2PL5A 3LFHA 4G97A 4D8YA 4Y6RA 1C9KA 1O6CA 2WF9A 4BLSA 1MKYA 4YJFB 2I4LA 3EDMA 5LNK6 3CLSD 5I9SA 1I3MA 3V1LA 2OV1A 1SXJE 4R3WA 2PK3A 1T2NA 2CFRA 2F00A 2C5BA 3GNQA 4EB0A 4PYOA 4DJJA 3EPJA 2RARA 4DLVA 2OOSA 3OQ1A 1SGWA 3B78A 4QRIA 3ADOA 2J8ZA 4L15A 2P5YA 4PNZA 5TPZD 3HN6A 4ZT3A 4YY3B 3IAHA 5ANRB 2A7QA 2Y27A 5KS2A 3G7UA 5C7YA 4OM8A 1JIVA 2D0IA 1MV8A 1N1GA 3NTQA 3EG9B 2HWUA 2JLUA 1BWQA 2BBTA 2I3BA 2IODA 1O3YA 3OPVA 3TDKA 3W7AA 4Z4CA 5K7SA 1XAGA 2Q8QA 4BY9E 2YBEA 3Q40A 4LC0A 4JI7B 2M6RA 1ZUNA 3P5SA 2Q5QA 3BK2A 3QELA 4LGCA 5BN5B 2PD6A 2WABA 2CYBA 1NOIA 3JQDA 1WW2A 1X38A 2SBTA 2RC6A 1VHTA 2HEGA 1GRNA 1ZGAA 3OQPA 4HWRA 2OZEA 4YMUA 2O20A 2VJNA 4MJ3A 4M60A 1P72A 3MELA 5L3QB 4XD7D 3L8HA 3BIJA 4AJPA 5H82A 1IN4A 3GD5A 1XMIA 3AEQA 1U9IC 5M3BA 3ZE7A 1CJCA 2ZW9A 3EEBA 1DRUA 5LOVA 1T26A 2OZKA 5FPPA 2PS9A 3IEXA 3AKZA 3A25A 4LKRA 3AG5A 3O1JC 2QLTA 2ATCA 3DFKA 5JQGF 2GFIA 1E6WA 1OKKD 3N6XA 1K9VF 3BQMB 1EPUA 2H1WA 5K3FB 4NBUA 2HSZA 3LT5A 2JFZA 4PCUA 2AI2A 4RESA 2OQIA 1JXAA 1VLLA 3OX3A 1GNLA 2D2FA 5CXXA 1IZ8A 1VPDA 1SCAA 4DADA 3SZRA 3OBBA 2WZQA 4D02A 2ZRNA 5KTYA 3FOEC 3PA6A 4I46A 4TV8B 2VF8A 4DE5A 2YR0A 2C9OA 2GVZC 2MSLA 1UDCA 2Z0MA 4Q7MB 4G3XA 5LD2C 5FEMA 3DGEC 1U7TA 4FHGA 4M8KA 1C3XA 1BVRA 3OOSA 4HTFB 3EVGA 2XHZA 5TRTA 4OG2A 1D04A 2F9MA 3THWB 2NPFA 1WB6A 1BVHA 5A0FA 5DEIA 5TJ9A 3K1JA 3TX6A 1QDLB 4KFRA 4D3DA 2O0JA 3L4SO 1FMFA 3QBJA 5J47A 3A2LA 3ZCXA 4F97A 1CT9A 2IQIA 3IDSA 3LHIA 4H16A 1QUFA 2IOFA 1VIVA 2HPAA 4LOIA 4UZEA 4ZOEA 1EGMB 2UVPB 3EDQA 3GLRA 3OJCA 4MUGA 2N1MA 5EYPA 3U09A 1WABA 1Y8CA 2KJQA 2B35A 4RS4A 4D9KA 1FFAA 3CJTA 1ECBA 2ZT6A 2RGCA 1IJBA 3NNDA 1JFRA 1PEAA 2R6CA 2ZRMA 3GK3A 3TLJA 1F2UA 1AKNA 1BMFA 1Q2UA 4HLUA 1FCJA 3HJTA 4RKFA 2DTXA 4TLAA 4YYZA 4O4LB 1CR2A 2AKEA 4GLLA 4GLBA 3ESBA 3ZY4A 1AA1C 3N5KA 4EY3A 1H9BA 1YF3A 3OIUA 1GKUB 4KIWA 4AURA 5HTOA 1AGXA 3JTEA 4GR5A 4X94A 3H9BA 3UYLA 1G59A 1E3SA 1JXQA 4AJNA 5LQCA 5DI3B 2JGLA 1WDDS 3SHQA 3WLJA 2J33A 1L0BA 4CM8B 2FWMX 1R3DA 2HA5A 2W6MA 3HA5A 3I9LA 3NDRA 4D8XA 2CE2X 2PXXA 3E7XA 3KL4A 3CRVA 5I9TA 3BBLA 3OHMA 1SUAA 2VATA 4FFVA 4X6UA 2QX4A 3PRHA 5IH7A 3DKKA 1CVIA 4P54A 1TI7A 4JB0A 3C48A 4OLBA 3E1GA 1NR1A 1C3JA 3TI7A 5DXAA 3TLZA 5IZ4A 3TQCA 1JMKC 3V8VA 5AK3A 1AA9A 2IE8A 2ODNA 3KXPA 4FD3A 3RRBA 3KQYA 4DA0A 3N53A 1VXRA 3B7GA 1XCMA 1DX9A 1G17A 1KH1A 2JHCA 4JI4B 5MN6A 1UT5A 2D3WA 4AULA 4EIWA 4MARA 4ZGWA 4RVUA 1E2HA 5HRCA 4XQ0A 3SG0A 3EE6A 4G5HA 2WJPA 3BFVA 5JEEA 4O4IA 1GM5A 4KZPA 1E6EA 3FCXA 1KI9A 4CG3A 4EFLA 1E6UA 2QV7A 2H7XA 2J7PD 1PD1A 4EHAA 1YZQA 3E4CA 4QPZA 1BX3A 5G02A 1VJRA 1ZL0A 2WKPA 1AUSS 3ZGVA 2AJTA 5HF6A 3L8ZA 4DLTA 4Y2JA 4AYXA 3BFJA 3ON5A 3JQFC 4UNNA 1THZA 3BD9A 4JBWA 3WVNA 4JDPA 4CR8A 2X8JB 1U2DA 4MW5A 1MO4A 4E2YA 1AKVA 1ZJZA 1NJ2A 2YV1A 5BQOA 5IM4F 3LD9A 1ZBDA 4XGNA 4G1BA 3T9EA 4OI0A 5AVZA 5FR2A 1NRIA 6CHYA 5C31A 1DJLA 1OVGA 1KEEA 3GT7A 1A27A 1GJRA 1OXMA 1U2QA 2V9ZA 5K4HA 4YPFA 1JPUA 2FPKA 3WDKA 3C5WP 1X19A 3O3OB 1EFRA 1AZLA 5CA0F 2DR2A 4IAOA 2AZMA 3JARA 3SSMA 2MYTA 1IULA 2G9RA 1A3CA 1P9RA 1Z17A 3P20A 1PS0A 8LDHA 3AL3A 4W9NC 3ZTTA 4D3SA 1C3OB 2VP4A 3DD5A 1OXSC 3M1IA 3NHJA 1CNFA 2JARA 2PU5A 3T5GA 3IA2A 5LYJB 4Q16A 4KPUA 4X84A 4AL4A 3WO1A 4RYDA 4D0NA 1MRZA 4ZICA 4UQPA 4COKA 1Y6RA 1KR5A 1BYIA 1ZRSA 4BNLA 3O1HB 3UWSA 2LGJA 5HXAA 3EXG2 3OWXA 1KSJA 4EJ2A 3DZDA 3F7OA 1ZRMA 1M67A 1J4AA 3EXAA 5AOBA 2IWRA 1Q21A 2H2GA 5ARDA 4BCBA 4F9EA 2HCFA 3LC2O 3GA7A 2GZHA 3VJLA 3N8KA 4MWTA 3D5QA 2B8TA 5A03A 1DTWA 2DM6A 1L5LA 3EY4A 3TVYA 5BYKA 4Y1GA 3WLOA 4DABA 1ZGZA 4KIUA 5IK2D 1QQAA 3UXEA 4QTZA 1BE8A 4MQEB 3ZQKA 1X7HA 3KE8A 3K0SA 4DWVA 2JGEA 3D1VA 1TM1E 5AUOB 4D97A 4CLRA 2XVZA 4MZXA 3SBXA 3UPDA 3BFXA 5L4SA 1S3GA 3IPLA 1XNQB 5HGXA 1E6LA 4D4MA 4D4LA 2VL7A 4H4DA 1LS1A 2VVTA 4YK7A 2HWWA 5A7FA 4QRHA 1LH0A 2HIMA 2DFTA 5DVZA 1J07A 5HM8A 4PSUA 2BFEB 3FR8A 3HJAA 4RK5A 4Q1FA 1QSGA 1XTRA 3ITNA 1CUIA 4QWWA 4BJ5A 2JA1A 3G0CA 2XTMA 3QA9A 4BNMA 3I62A 1TYEB 3HU1A 4L9RA 3C45A 4L08A 4KYTA 1H8EA 3FYCA 2GD1O 2BIFA 4HWOA 3PC8C 5IUNC 4XOUA 3KXKA 2NN3C 3GFVA 3GBVA 5JNVA 5B57C 1CRLA 2AV6A 2H2HA 1NXSA 1D0SA 2HKIA 2SECE 3BILA 2EGUA 1I2BA 1P4GA 1T3TA 3I2KA 3I6QA 3IAEA 4ZDIA 4XWKA 2CNBA 4RJLA 5ALNA 4NBWA 1FE8A 1E6KA 3RJ9A 1UBUS 2Z5GA 3FKSD 3O74A 2Q3DA 3DD1A 3A3YA 3HCBA 3IE0A 5TPZA 3T7IA 1DGQA 4UXJA 1VLQA 3DTVB 5HDQA 5TDHA 2ET6A 3RBZA 4F12A 5HOEA 1B0UA 3GGSA 1SA0B 2JAWA 2JKVA 1U2ZA 1W44A 4CQMB 3RHSA 5GQSA 1U2PA 1L4BA 3AXMS 3HCEA 3R40A 2VYND 1HMYA 3Q3JB 1YS7A 4H1VA 3UMFA 1XKQA 2X23A 3PCRB 1GKIA 4M98A 4MDYA 1HE5A 1TJPB 3EGDB 5IXSA 2AS0A 2E9SA 2Z2YA 4LOAA 3FWYA 5JAZA 2XWPA 2ZJYA 5D6OA 3LOPA 1IY2A 3N8GA 4JJAA 4QUIA 1LJ8A 3FNIA 3ISTA 4KAFA 1ZK2A 1RYBA 4FGLA 3H1BA 2OV6A 1CDOA 4O59O 3TZQA 3LUAA 1D4ZA 1UFKA 3FCSB 2IZZA 4XD7A 2IELA 4M22A 1KH2A 2I4NA 5DK6A 4BU0A 2WUEA 4TZKA 4UE6A 5COQA 2NPIA 4N0DA 4WOBA 2R7LA 4DARA 4KYVA 4AUKA 3DEJA 3HLKA 1KMCA 4X41A 3CT4A 2BC9A 2FEOA 2LBPA 2V6BA 3OPXA 3P2OA 4DM7A 1EKXA 1ECFA 3H8WA 1ADBA 2H1OA 4HVCA 1OKKA 3RT1A 3GCXA 3MLEA 1QHHB 1WD7A 4PX5A 4F1WA 1R9JA 2EFDB 1SC1A 1YBMA 1WV0A 1JYSA 3HJHA 1ONSA 4Z1MD 4CKCA 4P2BA 4IIBA 3TLGA 3DE4X 1SM4A 3N58A 4KQ2A 4PO3X 4URWR 4AMUA 1MP0A 3HXOA 4QELA 4QPJC 3N7UA 5TSDA 1TQDA 5BWOA 4LFBB 1XEWX 2QSJA 2FCAA 1JIXA 1F8UA 4J2OA 1IXZA 2YOFA 4OSPA 1MZVA 1Q3HA 5A6SB 3ICEA 1E20A 4YI5A 4CKEB 4TZ0A 1XXHA 4IHJA 3ZW9A 1S1CA 3ONEA 2LDXA 1NY5A 2OBXA 5IZCA 3DOFA 1NUAA 2GPAA 1PS9A 2VXOA 1NHGA 5LYJF 3DDNA 2NO7A 3GJ8A 5FHRA 1Z3CA 3LH5A 4HFNA 3ZGYA 2WFAA 3H86A 1DOAA 3H2GA 4H3VA 3WMWA 3EIFA 4YT4A 1QTIA 2R97A 3C41J 3L01A 2OBNA 4FZVA 1JDJA 1DRWA 5KYYA 3S7ZA 4I0WB 3H0KA 1W46A 2JEYA 2Y8EA 5IVDA 4BO2A 3L06A 2FSUA 1KYTA 1UQUA 1M7HA 1GPDG 2W37A 3MEQA 3ZWCA 4HYQA 4U8HA 1DWQA 2H4WA 5KINB 3ZWOA 4LZWA 2NV2B 1NRWA 2ZBVA 1EJ6A 2GJ9A 2OHXA 2P0YA 3O4GA 1YKGA 4WCFB 3RM3A 5KSPA 1DJPA 3IBTA 1P9NA 1XALA 1OZAA 3GEGA 4IR7A 3WIUA 2IBSA 3GJ0A 4Y2QA 2PGOA 4KODA 3NOVA 2QN1A 3LT4A 4AQYB 5HFNA 3V8QA 1H2HA 1E89A 7GPBA 2OM6A 3PS9A 4YP6A 2H0RA 3IIIA 3HEAA 3U3MA 5C7LO 3I6YA 1U0TA 1DPFA 2EU8A 3FETA 5G2OA 3SEAA 4RF4A 4MQFA 3E2PA 2QAIA 1KP2A 4B44A 4UAUA 2RJOA 5JRZA 1RKVA 1EHIA 3MNFA 3PQ2A 3TIVA 1UMBB 3HKBB 1IPFA 2CLFB 2XD4A 1O1YA 1NONA 4MUAA 4JSYA 3LXMA 5EUBA 3ADCA 4N7JA 5BSRA 5IAKA 3DOUA 4UM9D 2DUNA 1YHZA 2DH5A 3B2QA 2V5UA 4LJYA 3PICA 4ACAA 2A5LA 3V4FA 2Q0XA 4DV2B 3DTNA 1FFXA 4RDIA 4PIVA 4MV4A 1NUTA 2JKZA 3IKTA 3QQPA 1O8CA 1L5HA 1DIHA 3SX0A 5IS2A 4J2TA 3VQTA 1YB2A 4ED9A 2DWPA 1IOLA 2B4AA 2KX7A 2QXUA 2GRUA 4I14A 3ZWQA 2XRFA 3NC1C 4PQFA 4TSFA 2ZU6A 3TTXA 3PTZA 3CZPA 1XD9A 1G7CA 4OHOA 3JQQA 4OI4A 1EU1A 5KNBH 3KJZA 2P35A 2QMOA 3IODA 2X0KA 3MTIA 1UXOA 1ZIYA 2FSHA 1VSUA 4MIOA 3HP4A 5IVKA 2HMVA 1O77A 1ONNA 3MWDA 4S1NA 1YK0A 3DBVO 4XYBA 4TLCA 1PKXA 2CNNA 5TMBA 3OICA 4P86A 5EHGA 3S6JA 1S2IA 1XRRA 3F7NA 3TBHA 4ARSA 2I3ZA 3BF7A 4QEZA 4BVAA 1FFYA 1L3BA 2RD2A 3U1TA 3F9CA 3NUZA 3WBKA 2WNIA 3C3PA 4AKSA 4BFTA 3IB3A 3ZDZB 4NV0A 1GPMA 2J7PA 2QW1A 4NNJA 4KR2A 1K6IA 3NM6B 4HQKA 1E2EA 3ZQJA 1I30A 2ZB2A 3HB1A 3CNEA 4G0PA 4BVGA 4JP1A 1M8JA 3WLMA 4F6RB 2PQ2A 3JD4A 1CLUA 5F52A 1VJ1A 4XVHA 2ERYA 1NNSA 3AVTA 4CU2A 1MRNA 4P08A 4AKEA 5JNTA 1XPRA 3K4HA 4C5BA 1TO6A 3UH1A 1MOQA 2GCNA 3L1JA 2H1HA 2MSWA 5A9SB 1IOVA 1W8DA 2X8AA 4AJOA 4S12A 1QPGA 4RIFA 5FI1B 3K0FA 1AGPA 1FPQA 1FP4B 1YB7A 4I99A 3EUFA 3T7CA 4M1SA 4GS5A 3W2GA 2MIIA 4RY8A 2LE0A 4ZVOA 2P6OA 1F1BA 4H6WA 4QYWA 4MV3A 1BHQ1 1IHUA 3GN1A 4RSGA 5LOVF 2I3AA 4TVSA 3LDUA 1L4NA 3WLSA 3BMXA 3KM0A 5LP6A 2GWHA 2TECE 4D9NA 5A4KA 3PFGA 1KVQA 3L77A 4HGRA 1PSZA 4YMHA 1QGZA 3HEMA 4WK2B 1HDGO 2QM0A 4Z9XA 5BNZA 1JPVA 1V9LA 4DKXA 5IAGA 1DQRA 1I3OA 1BA3A 3K30A 2J59A 1KZYC 1TVCA 2ICAA 3KB2A 3NKVA 4X60A 4IIJA 3MILA 3ZGLA 4JP3A 5H02A 4C7MA 3OF5A 1Y4UA 4LZOA 4D9CA 5CJJA 1IQPA 3PF8A 3EJWA 2O2GA 1IBCA 3COZA 1E0KA 2HFKA 2Q49A 4GM1A 4HGOA 1NXOA 4C3UA 3CPSA 5AOCA 1VHWA 1YQEA 2R3SA 4Y2UA 5CYPA 1VMIA 4WINA 1PJ2A 2AUTA 2YIMA 3G9ZA 4NXNB 4G5GA 1PBNA 2H1CA 1H1TA 3EFHA 1W2WB 1NF9A 1YUMA 2A57A 5J2UB 3U9TA 4JBNA 3ZYCA 3ZWPA 1KRWA 4L7VA 2QX6A 1KK3A 1ZWLA 3EX7C 5CM8B 4LWPA 4GDMA 3AP2A 3E84A 3VO1A 2R5FA 2B5WA 3CEPB 1W35A 4HDSB 1RWNA 3GHYA 5KO2A 2A5DA 2FEAA 3ETCA 4V1CA 4HAUA 3D8SA 3AXTA 3RRZA 3I5XA 1FTQA 1N9KA 3ND6A 3L1KA 2ZRHA 2F4VB 3GLFE 1TB4A 3H5RA 1V7ZA 1XAJA 2ZAYA 2NSLA 1HE3A 3TXYA 2V45A 5TXGA 3ZHUA 5ILQA 2ZUEA 4TL9A 4HEA1 1WETA 3NIGB 3U4QB 4BJ6A 3H3JA 2Q6LA 2Z3ZA 1FQOA 5AO9A 5I8ZA 4D42A 1PR0A 4O1HA 1P33A 5JSHA 2JGIA 3E9DA 1THGA 1Q77A 2OE2A 1PHPA 1U9ZA 4JR0A 3HYTA 2BGGA 2YHUA 2OYCA 1MABB 2V3WA 3H11A 1WMSA 3DDHA 4FSXA 4OQYA 4Q15A 4NPAA 1L7RA 3E3LA 4HDNB 1V5EA 1WSAA 1X6VA 4NE7A 4KOAA 5AKZA 4H15A 2Y0PA 5TEVA 2CDAA 1YS1X 3MJVA 1IEQA 1D9XA 5H68A 4K9OA 2GZSA 5A4MS 1E1RD 5CLGA 3LT1A 4G0VA 3WV4A 3UF0A 4DCSA 4I8DA 4BFLA 2VJMB 3IMFA 3VNAA 3F2IA 2RH5A 3UY4A 4RKQA 5FNVB 3IOYA 4MUIA 3VZRA 5B4VA 4L5YA 3W2FA 2W42A 1G1AA 4LIPD 5AKLA 1VRWA 2FWAA 1Y6JA 2Z8YM 3F5FA 1GZUA 4FUQA 4D1YA 1EZ4A 4I08A 1D6NA 2RG1A 1DAKA 3K1AB 3UJDA 1X42A 4QG3A 2DT8A 1Y80A 1SG6A 1F3LA 4LJ6A 4OFBA 4DMGA 2OQVA 3NPAA 5KVQA 2GO1A 1XMSA 2ST1A 1K6XA 1FVOA 1JQBA 3BB3A 3FA2A 4X95A 2GPBA 4N18A 4OQMA 3JYQA 1E2GA 4LZAA 4MUHA 3RVNA 4CDMA 3DG9A 5CGZA 4OOEA 5JTUA 1LFDB 3B89A 1FFSA 3LDGA 1NYRA 4GM0A 2UZ0A 1TA9A 1WG8A 3LX5A 3NWPA 5LZ9A 3KB6A 3CX3A 3KKNA 3KPVA 1KC3A 3N2GA 3UOAB 4NCKA 2OBFA 4JXXA 4KIGA 3E7DA 2PZFA 2AMJA 5FOTA 3KXDA 5EXSA 3IL2A 1ES9A 3OP4A 1YQ9A 1U3DA 1B8UA 4FZJA 2REOA 2VOJA 3QVGA 2O1WA 1DTEA 3R6LA 4BTVA 4L74A 5FADA 4J91A 3OM9A 4YMWA 5DHRA 2JS7A 4Z1MA 2XB8A 4EOGA 2I76A 2QUAA 4OAQA 4UFOA 2VHTA 4QFBA 4MPTA 2XYGA 4UNIA 4XIFA 1G3MA 3OJLA 4BBZA 4D0SA 3F4KA 4IG9A 4F3NA 4OJMX 1Z5GA 2F1HA 5A2GA 2ZJ8A 1UDBA 3LRPA 5C18A 1EGVB 2BGMA 4XVUA 5CVCA 2CYAA 3IQHX 2QLNA 3JYHA 1W6RA 5EAIA 5AIBA 5K6AC 3GGOA 2LP4Y 3HY3A 3IXLA 3KPWA 4E7OA 2HR1A 3WRYC 4DSNA 1K3TA 1DLIA 1TKBA 1P6UA 2IPAB 3HHPA 5JWRA 4QXQA 2P69A 3KQHA 1FFHA 1NNI1 1U0RA 3E1KA 4L8VA 2ZM5A 1ZESA 2QN3A 3MRVA 3ZDXB 4ER6A 3K16A 3SR0A 1VJGA 1QYVA 2CLDX 1SXJB 5A62A 2EVWX 2YWRA 2ZCVA 3PQDA 3V7WA 5AESA 2JFQA 1NFQA 5ER6A 2GYVA 1TEVA 2P41A 2J6IA 1GZ5A 2ZJBA 3DSRA 4H59A 3SKVA 4EZBA 5JS8A 3KZVA 4IQ4A 3IBGA 1QLHA 3OJFA 1MVNA 1V7QA 2CLKB 2DECA 1XTBA 2H57A 2J85A 2I7XA 3CUKA 3IKVA 3QKTA 3S81A 1OBVA 4IV0A 3U19A 1AH2A 4HNRA 3R09A 4EJ6A 2QSZA 4MW1A 1GG8A 1KAHA 4JA0A 4RZ3A 2QN8A 1TKRA 5L40A 1JIIA 1INLA 3ZZ0A 1I8TA 3MOIA 2ZUDA 3PQ5A 4MK4A 4TWZA 5TQVA 2C9CA 3D8TA 3V7UA 1C1HA 2X58A 1NJ8A 1FQWA 4IF4A 3PD1A 4HWTA 4N9WA 1JG1A 2VJOA 1FFBA 1KDVA 2GN1A 1PT8A 2VYQA 5U4QA 1UXJA 3ZY2A 3B1KA 3DMTA 1Y5RA 3OT1A 4YN3A 5ELLA 1YDWA 4EB6B 8GPBA 3G3EA 4YHBA 2I1LA 3BJMA 3DZIA 1Q84A 2ZCUA 3CMCO 3E9RA 4PZ9A 5FOSA 2D1FA 4JOSA 2VK8A 2E3JA 4JR2A 4DDWA 2PQMA 2YWDA 2K5UA 4Y1FA 1IVNA 1JDSA 2Y1GA 1GYQA 4G25A 1NV9A 2VHEA 4EA9A 4CLDA 1NY6A 2FZEA 4BO6A 2AEFA 4FWIB 4ZO4A 3VPCA 2WM8A 4KYUA 2BEUB 5AFSA 1KAEA 2COEA 1O4WA 4ZVKA 2R8BA 4JELA 5KNBA 1KTIA 1N36B 4L0QA 3OQHA 4P32A 5AJWA 2VJYA 1VJCA 1U2GC 3L6CA 1GAJA 5CPFA 2ZYRA 1XI2A 5AI5A 3GGJA 1T5BA 2A92A 1EDZA 2CMFA 2PFSA 4FNOA 1FNMA 4ZVPA 3REOA 2Z2ZA 2QTWB 1P19A 4RO0A 5FOWA 5D7NA 3FI0A 1QQTA 3D6JA 3OC0A 2P4HX 3C5CA 1DQYA 3U4HA 4WK0B 2C54A 3G9TA 3GQBB 4L76A 1TEXA 4CKYA 3MTDA 4G85A 4P80A 3VHXA 4N5NA 4W9RA 2WRZA 1VLZA 3ENVA 2GWRA 5BR7A 4G1CA 1EX6A 5IK2A 2PV7A 3QE3A 1D1PA 1RNLA 2GZ1A 2H16A 2I71A 1XKXA 1YHNA 1U6JA 3H6KA 2B0CA 4FLEA 4GKVA 1W0JD 4CLOA 5ALJA 2KS6A 1H2ZA 1NVVR 2G6TA 3DQZA 2XWJI 4LHVA 3GO4A 2X5NA 4DLBA 1RBLI 5JRDS 4FE3A 4WESA 2BONA 4TX1A 1P2DA 5A5DA 3LWNA 4JBXA 4ZKEA 4CG0A 2XE4A 1N4DA 3ICVA 4NCXA 3QK7A 1ILEA 5ERXA 2ZIGA 2AQIA 1YAHA 3WGOA 2Y71A 1LLQA 1XYYA 3R76A 4IFTA 2BDTA 2OCIA 5CH8A 4EABA 4ER7A 5U9CA 4TMFA 5AD1A 1OGYA 2A78A 3REFA 4BP1A 2B2XA 3CLUD 4LV8B 2YDYA 4HDRB 3EWIA 2PUDA 1N7JA 3E9CA 3HU2A 4Q4AA 5DSTA 1RRFA 2LKDA 1MA3A 1CZNA 1P0MA 2A0XA 1E5TA 4EVIA 2W2KB 3K09A 4DDKA 4DBLC 5FD8A 1YJXA 3H1FA 5KWIA 1TKAA 2QX9A 2Z5LA 2ZT8A 1IXRC 4KK3A 1UDAA 1Y1SA 1J6UA 3CONA 3ECCA 5I9NA 3PUKA 3STUA 3O93A 1KEUA 3C1OA 5KYXA 5KC9A 3V4OA 3THYA 1M6EX 4CGYA 1VJTA 3CV3A 4PLFA 4BV9A 2LCQA 3QG5A 4IHJF 2VF4X 4S1PA 2EC5A 3DKPA 3B8EA 2NSDA 1XJQA 1PFYA 1PQ4A 4LE1A 2ZWPA 1E3TA 2XYHA 2UZ1B 3UW1A 1H5QA 1KO5A 3HRIA 4D82A 3BVPA 4HZUA 4R1LA 5CLJA 2BISA 4JBIA 2RG7A 5L3RA 1NJGA 5ESDA 4O2RA 3WGYA 3ZHTA 4MW6A 2B36A 2FG5A 1YCHA 4ZYZA 3H8SA 1YI1A 3BQNB 4AJ4A 5THQA 1YR1A 2GXQA 2XLBA 1QS0A 1Z13A 1NW8A 3T9DA 4EI8A 5JQWA 3IEVA 2Q6OA 1NBOA 4PC1A 2I2AA 1DJQA 3ZOKA 3RW9A 1JX6A 1RYMA 3WHPA 1ZH2A 1E5QA 2I8LA 4PZCA 2BTQB 5DTRA 2MINA 3NR2A 4O2AB 3ZVMA 1C81A 3RLFA 1Q7GA 3KIPA 5BURA 1E5DA 4P82A 3ORSA 1VECA 1YVEI 3KOZA 4PICA 2ONZA 4RTNA 1VKHA 4DCPA 2ARKA 2DBZA 3UATA 1EZ1A 4Y3UA 3KQPA 2YMPA 4Q00A 3SS7X 2NQ2C 2MJLA 2IYVA 3LYAA 3KR9A 2A9FA 1GZHB 1Y1LA 4IRMA 5EE5B 1E1RA 2C83A 3IUYA 1OUMA 4NU8X 1WHSB 4KAXA 2Q2NA 1V43A 2J31A 3C6MA 4OMUA 3MWYW 4W6ZA 4JVSB 1CDEA 4EHJA 3TQOA 3OPYB 1GCOA 4MB2A 3R7NA 4D8WA 4U3JA 4KNWA 3I83A 2HNAA 1A4IA 3ESQA 1QK4A 2EQBA 4KHZA 1Y9EA 2W6QA 3WLTA 121PA 1XP8A 3TDMA 4A6PA 5DT9A 1K0FA 2WJJA 1O08A 2XOKD 5JCOA 2OKCA 3K8ZA 5AXBA 2YXDA 4KAJA 4Y8VA 3U1VA 3W3AD 1P0PA 2AG1A 5A5GA 2ZS7A 5CW2A 5JSZB 2Z2KA 3LP6A 4MZDA 3ZBTA 5DNAA 3V4VB 3VNQA 4YUAA 5JALA 3H65A 3U7QB 1YB1A 3E53A 5HS6A 4ASUD 2WVGA 5B3KA 5AHXA 1PFQA 2QUIA 5DASA 1P31A 3K5HA 2QB5A 4BX8A 1ORHA 3SKYA 4L5IA 3X1XA 4BMSA 3TOZA 1GQSA 3OTOB 1P2FA 2ZS9A 3Q6MA 4K6KA 1YR7A 1C29B 3JZIA 2QNIA 3HO1A 4AN0A 1ZEMA 3FYDA 5HUQA 4B74A 1NLZA 1MO2A 4BKRA 2I6FA 2XLCA 3RFTA 3UWKA 1CY1A 1TQ2A 1H0SA 1XXHE 5GINE 3BTUA 4JKIA 3EUEA 2HJSA 3I8OA 5KTPA 1G5RA 3OP1A 4MR7A 4EQ6A 1W59A 3QVKA 5DH9A 5E9WA 1QE0A 3LUHA 1PF7E 3AR8A 5JU6A 3DNFA 4P0PB 1V7CA 1VCOA 3IQGX 3QOFA 1Q14A 3VU9A 1TD9A 4A0QA 3KS9A 2B2CA 2XMGA 5AVXA 1UAGA 1Q3KA 3J7AC 5FULA 4EELA 4DUGD 4FK8A 1L1FA 3V34A 5LP6F 1IN7A 3D3QA 4Q21A 3TTWA 4E6EA 2EX4A 1G8MA 1WZNA 3TE7A 2YVUA 2Z57A 3WYCA 3DO8A 1DFHA 4P4SA 1I0ZA 3ID6C 3RE1A 4WCFC 4EJMA 3U5ZB 1Z45A 1ZMXA 4PWYA 3MS4A 1Z8NA 3R0QA 4D46A 1A5ZA 2BKLA 3LKDA 4LEIA 4EJSA 1K8RA 4TMTA 4KI7A 3PQEA 3VZBA 5JUWA 4UUBA 4QODA 1JTEA 3NT4A 1XZJA 1H3FA 1Z6AA 3HCNA 2JRCA 2IEBA 4URYR 3BHMA 1SK8A 4EJFA 4NZ9A 4EP1A 4OQQA 5K5EA 4LPSA 3DMDA 4LYJA 3UB3A 4UNSA 4S1WA 1IIBA 3SC4A 1JLMA 5DFAA 4JODA 1W1WA 4DQUA 1TQHA 1WF3A 4QO7A 1F2DA 1MFZA 2DWOA 1VPVA 4UUPA 3VYUB 2OXRA 3LCCA 2I33A 1U3UA 1JEYB 2F90A 3I8SA 1PW7A 3R3JA 3SIXA 1JEJA 1UKYA 4YJGA 1PAUA 3FF1A 4GR4A 4PN7A 3T4EA 1DBIA 2H06A 2ZJZA 2IS4A 5F4ZA 6Q21A 3ZY3A 2GYUA 4CUKA 1MEOA 3QTTA 2AMLA 1KIAA 1VJ5A 3WMGA 2Z5VA 2G06A 1S7CA 2QGZA 2NT3A 4L51A 4Q7KA 2A3NA 2ORIA 1GCGA 3SC2B 5BWBA 4H0CA 2ISSD 3KTAB 1PWZA 3EXIA 5EIXA 4O2BA 1JVNA 5AW0A 1U0NA 2PD3A 1YOBA 1PTJC 2B3TA 2F67A 3HBJA 4H7JA 4QSHA 5G4KA 5HQTA 2H0AA 3HDGA 4BQEA 1PFUA 3HMQA 5CTJA 4QO8A 3DDUA 3EMDA 3NHMA 1N3LA 1FS4A 4L5CA 2B99A 1ORVA 2O2YA 2OAGA 1ADGA 2IT1A 4J7XA 1P1BA 2XGMA 4RFLA 3ZWVA 7REQB 1H2RS 1N9ZA 2P3SA 5F2KA 5ARBA 1G3IA 4WVFA 1DE0A 3OOEA 2TMKA 1ODTC 3EA5A 4NMLA 4A2QA 1BDMA 4BO7A 4WASA 2P4EA 3WB2A 4RC9A 1PFKA 3KSDO 3ABSB 4FYYA 3EGCA 5GM2A 5BSUA 4BFZA 2W4QA 1IY1A 1JQ3A 3E6AA 4FE7A 4I9GA 3ZWNA 4TWIA 2A9RA 4O4HF 4LYYA 4AO7A 4BMPB 3WLEA 5KOIA 2JAPA 1A8QA 1PJQA 1UBCA 1W0JA 5AXDA 1DIAA 1NNUA 4TMYA 5KTTA 3OZFA 3QFSA 4IQ8A 3WDSA 4ARIA 1UR5A 3BCHA 3SDSA 4D80A 5JNSA 3OC6A 5ADHA 4E3ZA 4IVPA 3EXEB 3OKFA 1T35A 3MAGA 3KUDA 3HACA 1J5EB 1R18A 1T4DA 3WZMA 4YLYA 2R1TA 5EHIA 5JMOA 2L19A 3HLYA 2P78A 3WAJA 2R0QC 3E27A 1OLUB 3CH7A 4LXGA 4WCVA 1Y7PA 1Z5WA 2L0XA 3L0IB 1O87A 2NUTA 3N3AC 2IYEA 1Y1TA 3PXAA 3F8WA 3VR0A 4EX7A 2WHPA 4RD2A 1F3OA 4LFAB 1VMEA 3QXSA 2IU0A 2CDNA 2O8BB 5IAJA 3BSSA 4KR0A 2NUAA 2J09A 2QRHA 3ZHXA 1U8AA 1U04A 1Z4NA 4ERNA 1J2YA 1IH8A 5ABPA 9ATCA 5IUJC 1PEKE 4WQMA 1MIOB 5BVGA 1WDKA 4GLJA 4MV9A 3D0OA 1DADA 5ESRA 5H16A 3SF0A 4XRGA 2IHNA 2JIRA 4J4HA 2X14A 2RK6A 3MTQA 1OWNA 2JFOA 4LVNA 4N6OA 2IOQA 2WTMA 4EO4A 4F9GA 4K9MA 5HK8A 1QE5A 5IC4A 4M1YA 2BFNA 1ODSA 2IIVA 3OCWA 3N2ZB 2YIVX 3FCCA 3HSKA 4PZYA 1X9HA 4BO1A 1M76A 4KX5A 3IIMA 1S1MA 1PZFA 2BR5A 2B7CA 5FLKA 5KOYA 5AVKA 3RR2A 3UNXA 4F3KA 5SZIA 3T5TA 2LD4A 4YAKA 2AX3A 4WV3A 3D4PA 4LOLA 4QTXA 1S4QA 3KR0A 4FDAA 16PKA 2QMQA 2EIHA 1ZI8A 3SYLA 1C9DB 2WFLB 2GX6A 3A1EA 4NU6A 2GPJA 4QXPA 3VUEA 1XR3A 1N2SA 2JHAA 5BVHA 1KL7A 3EUAA 1LK7A 3CW2A 1IK4A 3DOJA 3S1LA 4E0BA 4P5EA 1AUVA 1OXKB 4EZIA 4ZK6A 1XF1A 5H1YA 3ERCA 1NMXA 4C1NA 3HKEB 5J43A 4MS1B 3RYFB 4IZ6A 1W49A 2C3MA 4ZMBA 4RTSA 2BM0A 4O3FA 1MQ8B 7YASA 2BGLA 3F6CA 2FLVA 4TS4A 1CUYA 3I32A 4G0YA 2NXCA 4K05A 5EHQA 4B87A 3R0JA 4KITB 1FFGA 4H3HB 3FMFA 1P6XA 3JS5A