3U59A

N-terminal 98-aa fragment of smooth muscle tropomyosin beta
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
100
structure length
100
Chain Sequence
ASMEAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQGLQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEAEVASLNRRIQLVEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tropomyosin beta chain
publication title Structural analysis of smooth muscle tropomyosin alpha and beta isoforms.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 50
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3u59A00
1WT6A 4ZKUA 1IC2A 3U1AA 3C9IA 5BVZA 1NKNA 3BATA 4N78D 4ZKPA 3U59A 2FXMA 5BU5A 2JEEA 4I1LA 3N4XA 5BU8B 1X79B 4O9BA 3N7NA 5KTBA 3HRNA 3U1CA 2POHA 4GIFA 3BASA 3VP8A 3P8CD 4N3YB 3VP9A 3OJAB
chains in the Genus database with same CATH superfamily
2HYNA 4LGDE 2YO2A 2KXPB 1URQB 1WRGA 2JJLA 3N7NA 2NPSA 2W83C 1L0LJ 1NWQA 3H1LE 3NTNA 2OYOA 1YI2P 1YITP 3CCEP 1X9VA 3LW5H 1K04A 1T6AA 2FXMA 2Q5UA 1FDOA 3F5HA 3S9OA 4R4LA 1IFIA 1VQ8P 1KN7A 1DD3A 3EFGA 1FJPA 2OQQA 3HTKB 3L72D 3JCUE 4RKUJ 1SFCC 1M1KQ 2E75B 4Y28J 2JP3A 2KNCA 1JY2O 1YIJP 1LT9A 1GU5A 1N7SD 3L74D 1S5LH 3KQGA 4HKZH 3H1KE 4JBZA 2CK3H 5CMZA 2FFDA 5AW7B 3L73D 3L72E 2E74D 3UIAA 3HE5B 3C9IA 1NU1J 2JDIH 1VL2A 3D6YA 5TISH 2FXOA 4L73A 2N1TD 1NGMB 1S9KE 3BCCD 1SQBJ 1AJYA 1GD2E 1LGHB 1NTZK 2ZT9C 1WT6A 1PV3A 2Q3IA 1L0LK 4ZMDA 2Y0CA 2KP8A 1U7JA 4XA4A 1SQVG 1KYOE 5E79H 4DZOA 2V7QJ 2KUBA 3MTUE 1Q2NA 2R32A 3M9QA 2H43A 4XFJA 2RKLA 4H13D 2QJPC 1SVFA 1BE3J 3A7OA 5KLVG 1SQPG 2YXRB 1RF0A 1BCCD 1VQ6P 3MD0A 1FZEA 1RE3A 4JQ0D 4WB4A 2WQYC 3OAKA 1URQA 4N78D 2QEXP 3KPEA 3W67A 2Q3EA 2XNXA 4N6JA 1KB9D 1NH4A 1YTZT 1SQQG 2R44A 1H0TB 3H1IJ 3H1HG 1G1IA 1VQPP 2YKOA 2GUSA 3V5BA 2C0WA 2A06D 1HUCA 4UB6E 3A3YB 2JEEA 3N4XA 4OGQD 4NPDA 1R5LA 5CCGC 2IZ1A 2LKMA 3HTKA 3B5NB 3M0DC 3JSVC 1AVYA 5KAIE 4PD4E 1NOHA 1NU1D 3L75G 3TYYA 1W2BO 1VF5D 2BASA 1NTMG 5KJ7C 3JCUH 1IFMA 3C1LA 1S5LX 1SQBD 3HE5A 4OH8B 3RBXA 1S1CX 2A45I 4PD4I 2YKPA 5BVZA 5AW6B 3CX5I 3BATA 3RK2B 1FBMA 3TGUD 1GK6A 3HRNA 1UIXA 2WMMA 1HGZA 1TU3F 1PGOA 3RK3B 4AQRD 1RHZB 1H8AA 1HWTC 1EDLA 2ZXXA 1QGKB 1T3JA 4ZKPA 3AE7C 3BRVB 4IFDK 3CI9A 1NTKJ 2OTLP 3L70J 1LT1A 3BRTB 1YYCA 1KYOH 3PLNA 4RO0A 1X0TA 3CXHD 4XE5B 2O1JA 4PV1C 2W6BA 2AXCA 4O9BA 2Q1KA 1VQOP 1JY3P 5AVUB 1YJWP 1VQLP 2OYIC 3V6IA 2W6AA 1LTIC 4EOTA 5EFWB 3L4FA 3CLQA 2W90A 3AE9C 2XKMA 3AE4C 3L73G 5AVTB 4YTPC 1JY3O 1H0TA 2I1KA 1GW3A 2WITA 2YKQA 1PP9J 1YTZI 3ITKA 3EFFK 5AVXB 2V4HA 3BCCG 4C7RA 2YIUC 1K8AQ 1T2KC 2K1AA 2QA4P 2OTJP 1RQVA 1HJBA 2CPSA 1L4AD 3WUVA 3B5NA 1J2JB 1QVFO 5B5EE 1LTJC 4IFMA 5KKZC 1IFPA 1AVOA 1NTKK 4UB6H 2HODB 3WUTA 3IN6A 1SFCB 1N8RQ 2FYUJ 2G3AA 3AECC 3L71J 2A45H 3TNUB 1FZGA 2R3SA 4PD4H 2ZAEB 1RH5B 3P8CD 5APQA 2D2CC 1BCCG 1IC2A 1NAFA 1OVVA 1K9MQ 2Q7CA 2PAJA 3M06A 3H1JJ 3MZWB 3Q2YA 5BU5A 2QRXA 3L70D 5AVRB 2ZT9B 3H25A 1OW8A 4ZNCA 2ZVNB 1SQVD 1ZXGA 3VOPA 1A02J 2XV5A 1FZAA 2JWAA 3VMXA 2K88A 5APXA 2E76D 1BDCA 2A06G 1P84E 4U3FD 1KILD 2WSCJ 3HUSC 3WUUA 1SQVE 1M7LA 1PPJD 2QJPB 3TSIA 3OA7A 1E5WA 1VQ4P 1P84I 4PJ0H 1NU1G 4WBAA 2FYUK 1VQ9P 1VDFA 2XNDH 1N7LA 1SQBG 4I7ZC 5KLVE 1SQPE 4Y99C 2IX7C 4H44D 2KOGA 1SQQD 2L91A 4OVNF 2N9BA 1VQKP 3FWNA 2Y9YA 3CC2P 3V4WA 3TGUG 3Q5PA 1GU4A 5CCHD 1KD1Q 4D6TE 4H0LC 1LTTC 2IPPA 5E79E 2KSJA 3RL0D 1AV1A 3GF3A 2ZYAA 2KI7B 1SQQE 1JCCA 2W8ZA 3H1HE 2IBZG 1AA0A 3CCLP 1DX7A 1FDIA 5AVVB 2J58A 2WPRA 2HODA 2RMZA 2B87B 4L74A 1J1DC 3KDPB 1SFCA 1ZLLA 1SS1A 4KHXA 1OMIA 4W7YA 5B5EH 1LJ2A 1NTMD 1YJNP 5C39A 3TNUA 1JOCA 5AW8B 2WSFH 4R4MA 1DIPA 5AW4B 1KQFB 1L0NJ 3OJAB 3BVHA 3L75E 3GHGC 3R4YA 3FXDA 3WMM0 1Q90D 1LTBC 3CCMP 3AE5C 3WU2E 2I1JA 2WPSA 1M57D 1NTZJ 3D71A 5KAFE 3SWYA 1CW5A 1GL2D 1RY3A 3RL0g 2YMYA 1W2EA 4Z1MH 3PJSK 4ASWA 1FS0E 1SQXJ 1JY2P 1OFCX 1AFOA 3L36A 2SPZA 1ZW0A 1EDKA 1QX8A 1EZVD 2ZJSE 4W80A 1Z56A 1KFMA 1P84H 3IR9A 4PV1B 2BEZF 1R8EA 3NXSA 4K3AA 4IFFA 1NKZB 5CBOA 2AEMA 3O6QB 5DJUB 5AW2B 3TDKA 1JEKA 3ABVC 3SWFA 3TK1A 2ZVOB 3QH9A 1L0NK 5AVYB 2LR2A 2NPSD 4I1LA 2C9LY 2CPBA 2H89C 3A0HE 3L74E 1JNMA 1N73C 2Y0EA 3CPWO 3AEBC 3FGAD 3L73E 3L70G 2B88A 1N7SC 1ZRTD 2UWJE 1YBKA 4DJGA 2WT7B 5CCGA 1NVOA 2E74C 2O01J 3BCCE 1OX3A 2B87A 2JWDA 3M0DA 1LTJB 3P8MC 2N1TC 1KFNA 1SQXK 4U3FG 3AE6C 1ZRTE 1ZR2A 1NKNA 5KJ7A 1NO4A 1H89A 1KYOI 1PPJG 3C8VA 5KTBA 3VN0A 2ITAA 2D2CB 2HPCB 1NYHA 2BEQD 2WTYA 1L0LD 2KLVA 4GKGA 3CCRP 2BCCJ 1JTHB 2QIWA 3LIDA 3B8EB 1CZQA 1BCCE 4H13C 2YO3A 3BASA 3WU2H 1Q86Q 1HF9A 2K37A 3M9HA 5KAFH 5B66E 2WSEH 4HJGH 2IFNA 4N78E 1USDA 5CJ0A 1FDMA 3I55P 2P7JA 1X79B 3AE2C 1KB9E 2FYUG 4JF7A 3PP5A 3HUSB 3CC4P 1U7MA 2RH0A 3IFMA 3O6QA 2KSEA 2WPVB 2A06E 3CX5D 1OW7A 4EYYQ 5APUA 3D6ZA 2O01N 1PGQA 1KQLA 2QJYC 3QWOC 2JKVA 3KXDA 4ZKUA 1EXJA 1URQD 1BSHA 4OGQC 4I7ZB 4Y99B 1FZBA 1NU1E 2P10A 1XTCC 3Q5SA 2P67A 4CPGA 1SQBE 4WY4B 5AW5B 3JC22 4GT1A 1OXZA 1VF5C 4WVZA 2HG5D 3VP9A 1K73Q 1RF0C 4H0LB 3A0HH 1GDTA 2IDBA 3CWBJ 2Q6QA 2QE7H 2WT7A 2IBZD 5M1BA 3IF4A 1IFJA 3AEEC 3TGUE 4JYCA 1LTJA 2WZ7A 5AW0B 3LW5J 1YQ4C 1BE3D 1DEBA 1J1DB 3PH0A 2E75D 2Z5IA 1QL2A 2DW3A 2GUVA 2OARA 4WWIA 3HD7B 4PJ0E 2M5AB 2IBZE 2IZ0A 2XU6A 4JPZB 1EZVG 2YXQB 2HPCA 1GW4A 3VMZA 1FOSF 1HVVA 2YNYA 3GHGB 3G6EP 2M0BA 1FZCC 3H1ID 4HH2A 1X8YA 3CXHE 1JTHA 1PL5A 1U57A 4L75A 4YXWH 3CMEP 4JYBA 4TLFA 2K9YA 1OVRA 1MV8A 3AE3C 2E42A 1IK9A 2MJZA 5KLVJ 1G1JA 5CHXA 3H32B 1L2PA 2QG4A 3PHLA 3SFEC 4BXLA 3HUSA 1MKMA 4U7JA 5B66H 1M1JC 1OZHA 3AEAC 3II6A 4D6TJ 1KB9H 4ASVA 5L8RJ 1BGYJ 1LWUC 4UB8E 1L0NG 3H1HJ 1FE6A 1YHQP 1MUUA 5AW9B 3VP8A 3KZIE 1NTZG 4EDFA 1M90Q 1L4AC 1L0LG 5APWA 2KLUA 2K3RA 2GA1A 3B4SA 4WY4A 1N73B 1NTKD 2HR3A 2POHA 1JM0A 3FXEA 3P8CE 1DH3A 1SQXG 1N7SB 2J5UA 2E74B 5KLVK 1SQPK 3B5ND 3MHVA 3L70E 3H1LJ 4EIJA 2N1TB 3HD7A 2WWWA 2M5AA 4HYTB 3SSUA 1WMKA 4GDOA 1MZ9A 5APSA 3GHGA 4U3FE 1KILE 1SQQK 3GW6A 3P7KA 1FC2C 1PP9D 1HJ0A 3RK2D 2N9YB 3CC7P 1Y47A 3B5NC 2E76C 1IO4A 3T97B 1J1EC 1PPJE 5AVWB 1KILC 3IAOA 4GODA 3Q1MA 1N2DC 1PGPA 3RK3D 2KNCB 3G71P 4H13B 3CXHH 3H1KJ 4GIFA 3W68A 1CI6B 4QMAA 3GF7A 3RBZA 3L72J 4KJMA 4MN4C 3H32A 1VPCA 1LTAC 2W27A 1RF1C 1JO5A 1BGYD 2FYUD 1ZMEC 3L74J 4DOJA 1Y9BA 2OYHC 2E5YA 3MUDC 3L71D 3L73J 4N3YB 4H44C 1BE3G 5K5GB 2QJKC 5CCHC 2ZYDA 3BCCJ 3V4QA 3PRJA 1SP4A 3H1JD 3CCUP 3U1CA 4AUWA 1JMBA 3RL0C 4UB8H 2QJYB 1E79H 2BCCG 4OGQB 3KZIH 2QVAA 1NTME 3H1IG 2FXPA 3E7KA 2P2UA 2FY8A 1VQMP 1VF5B 3H1LD 5APTA 1N7SA 2M8RA 3EQ2A 2I8DA 1KMIZ 1PFIA 3V2PA 4C46A 4YXDC 4NPEA 1K05A 1YJ9P 3TF5A 2N1TA 3FWLA 1BCCJ 5CJ4A 2C9NY 2NZ2A 3Q3DA 2Q9IA 1JY3N 1SFCD 1X22A 1VQ5P 3MGNA 1QVGO 3CD6P 1T3UA 2RN0A 1EC5A 5KLIC 4RJTA 1GL2C 1RE4C 1LP1B 1IFDA 4BRYB 2OYIB 2KIKA 2P58A 3H1KD 1OIPA 3T97A 1FZCB 1NJIQ 2J59M 3GLMA 1EZVE 5APYA 1OWAA 5H2FH 4A7PA 3NFQA 2HLOA 1AQ5A 2ZT9D 2PRRA 1S9KD 3Q5RA 1CI6A 2FBWC 3CWBG 3FX0A 3M0AA 5AVZB 5GTHH 1EZVI 1Q82Q 1NTKG 1MFTA 3M9BA 1ZR4A 4DCKA 1PIXA 1A02F 2YIUB 2FYNC 2R3CA 1FU1A 2K9JB 1FJKA 1KYOD 2MKVA 3A2AA 1DEEG 1M1JB 3P32A 3AE1C 1EXIA 5KKZB 4GOFA 1VQNP 5GTIE 2NPSC 1KZUB 4TT3H 2KZJA 1L0ND 1LWUB 4IOIH 3S4RA 3TGUJ 4LC1A 1KQGB 1S2EA 2QSIA 2H7HA 1GMJA 1NTZD 2ZFCA 3V2RA 1L0NE 2KB7P 1L4AB 1ZOYC 4HB1A 1IJDB 1PP9G 4I6MC 2FYZA 1SLQA 2OTKE 3H6PA 3L35A 1KQSO 4DT0A 4K35A 1NTZE 2B89A 1SQXD 1L0LE 2ZXEB 1LT9C 3GG2A 1S4XA 1JMMA 1YQ3C 3AE8C 1Q81Q 2FFDC 4D6TG 5CCGD 1HGVA 1NU1K 2G8YA 1SQXE 1KC8Q 1BGYG 3I56P 1QEXA 4OWFA 4I2LC 2IYPA 2LXBA 3L71G 1SQBK 5KJ7D 4PD4D 1EQ7A 2WSCH 1LP1A 2NRGA 4BRYA 2OYIA 1KB9I 2PFXA 1FZCA 4IL6E 2W6JH 2E76B 3H1JG 2WSFJ 1FOSE 1J1EB 1KILB 3KYQA 3CX5E 1T8ZA 5AVSB 4LLHA 2AXTE 4YPCA 2VRSA 1LTSC 1G2CB 2KK7A 2P1JA 3H1LG 2JR8A 2K9JA 1RE3C 1RF1B 1HH0A 2WVRA 1S72P 1M1JA 2OYHB 5BU8B 3AEFC 1IZNB 1NAYA 1URQC 4PV1D 3A0BE 4H44B 1OVUA 5APVA 2Z4EA 2QJKB 1LWUA 4M3LA 3E1IA 1R5SA 1N86A 5GTIH 2H8PD 1BE3E 2BCCD 3RL0B 3OW2O 3HE4B 2IYOA 1L4AA 1SQVJ 4EI2A 3H1KG 2IBZI 2E5TA 1JB0J 3USSA 5TJHA 2E75C 3L72G 3CL3D 4U3FJ 2BCCE 2KYVA 2C0XA 1JY2N 4B86A 3V2QA 1T2KD 3LIEA 3L74G 3H1IE 1RQUA 1SQPJ 3CXHI 1ZV8A 1ZN5A 2QM7A 3MIWA 5AW3B 2OGUA 3PTZA 2KS1B 2R5BA 1M8OB 3CMAP 5DJTB 1M56D 5KLIB 3M91A 1GL2B 1SQQJ 2D2CD 1ZP0C 2R5DA 4BWNA 1OW6A 2QM8A 3GMAA 2KZIA 1USEA 2O1KA 2AEFA 3V2NA 3AEGC 3O8ZA 3G4SP 1KILA 2PGDA 4C7NB 4NPFX 3SFDC 4IL6H 3F89A 3CWBD 1SQVK 2B9BA 2IFMA 5KAIH 5CBNA 3G3ZA 1G2CA 3CX5H 3L75J 1RF1A 2AXTH 4KT0J 2FYNB 5AVQB 1NTMJ 2OYHA 3CWBE 1VQ7P 3MUDA 2Z5HA 3E1RA 3EWKA 3A5TA 1NTKE 2WSEJ 1P84D 2NPSB 1FAVA 5CCHA 1IK7A 1GK4A 2O01H 3A0BH 1LTGC 2WPQA 2GM4A 2V7QH 2A45G 1KV4A 3K5BA 2L5GB 3HE4A 3VYIA 2M3EA 1PZQA 3ZDMA 5H2FE 3VMAA 3D70A 2HFED 1GZLA 2PP6A 2ZYGA 3S1KA 5KLVD 1SQPD 1EDJA 1S5LE 1BSNA 3MP7B 3U59A 4L76A 4WY4D 1D7MA 1UIIA 4AYCA 1H88A 3AEDC 1W5CE 5GTHE 2Y0DA 4H0LD 1CSBA 1HBWA 3I5CA 5TISE 2Y9ZA 1LT9B 2O3JA 1PP9E 2XDJA 4W7ZA 1NHLA 4D6TD 1BDDA 3VMYA 2FFDB 2JO1A 2LXCB 1AQTA 1IFNA 3RK2C 3RK3E 2KS1A 2FKWB 1Q7YQ 2AEJA 3H1HD 1NTMK 3CCVP 1QLED 3HD7D 1LNQA 3VTPC 4WY4C 5AW1B 3CCQP 3RK3C 4GOEA 3R2PA 3CCJP 1GL2A 1RE4A 1KTMA 1Y8AA 2YMKA 1GTWA 3L37A 3SWKA 1BGYE 2FYUE 1XTGB 2E43A 1JUNA 3L71E 3CCSP 1S3JA 4C7NA 1KORA 1QL1A 3B71A 3L75D 1MFZA 1EDIA 3HD7C 3U1AA 3KHUA 4IL6X 2WSSH 2XZRA 4RESB 1N73A 3H1JE 3RGUA 1PGJA 1JCDA 2H88C 3G9RA 1FZFA 1HTLC 3NMDA 1DD4A 2M3BA
chains in the Genus database with same CATH topology
2Z5IA 1QL2A 2GUVA 2KB7P 2OARA 3HD7B 2HYNA 1L4AB 1IJDB 3VOPA 4LGDE 2YO2A 1A02J 4I6MC 2FYZA 1SLQA 2XV5A 1FZAA 2XU6A 3H6PA 3VMXA 3L35A 5APXA 1URQB 1WRGA 2HPCA 2JJLA 1GW4A 3N7NA 2NPSA 3VMZA 1KILD 3NTNA 1NWQA 1FOSF 1HVVA 2YNYA 3GHGB 2ZXEB 3HUSC 1LT9C 1FZCC 1JMMA 1X9VA 4HH2A 3LW5H 1X8YA 1M7LA 2FFDC 3TSIA 1JTHA 5CCGD 3OA7A 1E5WA 1HGVA 2FXMA 1NU1K 2Q5UA 4JYBA 4WBAA 2FYUK 1IFIA 1VDFA 1MV8A 4I2LC 2E42A 1N7LA 1IK9A 3EFGA 1FJPA 2MJZA 1SQBK 3HTKB 1G1JA 5KJ7D 4Y99C 1SFCC 2IX7C 1EQ7A 5CHXA 2WSCH 3H32B 1JY2O 2KOGA 2OYIA 2N9BA 3HUSA 1LT9A 1GU5A 1N7SD 1FZCA 1M1JC 3V4WA 3KQGA 3II6A 1GU4A 5CCHD 5CMZA 2FFDA 5AW7B 1FOSE 1J1EB 3UIAA 3HE5B 1LTTC 2IPPA 3C9IA 1KILB 2KSJA 3KYQA 3RL0D 1LWUC 2N1TD 1T8ZA 5AVSB 4LLHA 1S9KE 1JCCA 1MUUA 5AW9B 1DX7A 5AVVB 2J58A 3VP8A 1GD2E 2VRSA 1LGHB 1LTSC 2HODA 2WPRA 1NTZK 3KDPB 1J1DC 1SFCA 1WT6A 1G2CB 1ZLLA 2P1JA 2Q3IA 4KHXA 1L0LK 1L4AC 4W7YA 1RE3C 1RF1B 5APWA 2KP8A 1HH0A 4XA4A 3TNUA 1M1JA 1JOCA 2OYHB 5AW8B 5BU8B 2WSFH 4WY4A 1URQC 1N73B 4DZOA 2POHA 5AW4B 3P8CE 3MTUE 3OJAB 5APVA 3BVHA 2Z4EA 1DH3A 3GHGC 1LWUA 1N7SB 4M3LA 3WMM0 3E1IA 2R32A 3M9QA 2H43A 1LTBC 1N86A 2I1JA 2WPSA 1SVFA 5KLVK 1SQPK 3A7OA 3B5ND 2H8PD 1RF0A 3RL0B 4EIJA 2N1TB 3HD7A 3HE4B 3MD0A 1FZEA 1L4AA 3SWYA 1CW5A 1GL2D 1RE3A 2WWWA 4WB4A 4HYTB 1RY3A 3OAKA 2YMYA 1W2EA 1URQA 4N78D 3KPEA 3CL3D 2XNXA 4N6JA 1MZ9A 2KYVA 1NH4A 5APSA 1JY2P 1YTZT 2C0XA 3GHGA 1JY2N 4B86A 1SQQK 1AFOA 3V2QA 1T2KD 3L36A 3LIEA 3P7KA 3RK2D 1G1IA 3B5NC 1IO4A 2YKOA 4W80A 1J1EC 1Z56A 1KFMA 2GUSA 1ZV8A 3IR9A 5AVWB 1ZN5A 1KILC 3V5BA 2C0WA 2QM7A 3NXSA 3MIWA 1N2DC 1HUCA 1NKZB 4IFFA 5AW3B 3RK3D 3A3YB 2JEEA 3N4XA 5AW2B 4GIFA 5CCGC 1CI6B 2LKMA 3HTKA 2R5BA 3SWFA 3B5NB 3TK1A 3M0DC 3H32A 1VPCA 3M91A 1NOHA 1GL2B 1LTAC 3TYYA 1L0NK 2BASA 2W27A 1RF1C 1JO5A 5AVYB 2NPSD 4DOJA 2R5DA 4I1LA 2C9LY 2CPBA 2OYHC 5KJ7C 1JNMA 2QM8A 1N73C 1IFMA 2O1KA 4N3YB 3V2NA 3HE5A 3O8ZA 4OH8B 1KILA 2A45I 4C7NB 2YKPA 1N7SC 5BVZA 5AW6B 3BATA 3RK2B 1FBMA 5CCHC 1SQVK 2WT7B 2IFMA 5CCGA 3V4QA 1SP4A 1GK6A 3HRNA 3U1CA 3G3ZA 4AUWA 3P8MC 3M0DA 1LTJB 1G2CA 1HGZA 3RL0C 2N1TC 3RK3B 4AQRD 1KFNA 1SQXK 1RF1A 1H8AA 5AVQB 1HWTC 1ZR2A 1NKNA 2OYHA 1T3JA 4ZKPA 5KJ7A 1NO4A 3MUDA 2Z5HA 3BRVB 1H89A 2P2UA 4IFDK 3CI9A 3A5TA 3BRTB 5KTBA 3VN0A 2HPCB 5APTA 1N7SA 2WTYA 2NPSB 2M8RA 3EQ2A 1YYCA 2KLVA 1FAVA 5CCHA 1PFIA 3V2PA 1GK4A 2O01H 4GKGA 4C46A 4XE5B 2O1JA 1LTGC 2W6BA 2WPQA 2GM4A 2A45G 2N1TA 1JTHB 3LIDA 5CJ4A 2L5GB 4O9BA 2C9NY 3HE4A 2Q9IA 3B8EB 3VYIA 1CZQA 1JY3P 5AVUB 1JY3N 2YO3A 1SFCD 3BASA 2OYIC 2W6AA 1LTIC 3MGNA 4EOTA 3M9HA 2HFED 3L4FA 3CLQA 1GZLA 2PP6A 1T3UA 2WSEH 2IFNA 4N78E 2XKMA 5CJ0A 3U59A 4WY4D 5AVTB 4AYCA 1GL2C 1H88A 1RE4C 1FDMA 2P7JA 1JY3O 1X79B 1CSBA 1HBWA 1IFDA 2I1KA 1GW3A 2WITA 2YKQA 3I5CA 4JF7A 1YTZI 2OYIB 3PP5A 5AVXB 3HUSB 1LT9B 4W7ZA 2XDJA 3T97A 1FZCB 4C7RA 1NHLA 2J59M 3VMYA 5APYA 1OWAA 2FFDB 3IFMA 1T2KC 3NFQA 2HLOA 1AQ5A 1IFNA 3RK2C 5APUA 1S9KD 2FKWB 1HJBA 1CI6A 1NTMK 2CPSA 3HD7D 1L4AD 1KQLA 3B5NA 3VTPC 3M0AA 1J2JB 5AVZB 1LTJC 4IFMA 4WY4C 5AW1B 1NTKK 3RK3C 3R2PA 4ZKUA 3M9BA 2HODB 1URQD 1GL2A 1ZR4A 1RE4A 4Y99B 1A02F 1SFCB 1FZBA 1GTWA 3L37A 2R3CA 1FU1A 1FJKA 1XTCC 1XTGB 2E43A 3A2AA 2A45H 3TNUB 1M1JB 1JUNA 1FZGA 3P32A 2P67A 4WY4B 5AW5B 4GT1A 1OXZA 4C7NA 3P8CD 2HG5D 5APQA 3VP9A 1RF0C 1QL1A 2NPSC 1KZUB 1MFZA 1IC2A 3HD7C 1NAFA 3U1AA 1GDTA 1LWUB 2WT7A 2Q7CA 4LC1A 2PAJA 1IFJA 2XZRA 3M06A 4RESB 1N73A 4JYCA 1LTJA 5BU5A 2WZ7A 5AW0B 2H7HA 1JCDA 1DEBA 1FZFA 1HTLC 2ZFCA 3NMDA 5AVRB 3V2RA 1J1DB 2M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT6 A;  4ZKU A;  1IC2 A;  3U1A A;  3C9I A;  5BVZ A;  1NKN A;  3BAT A;  4N78 D;  4ZKP A;  3U59 A;  2FXM A;  5BU5 A;  2JEE A;  4I1L A;  3N4X A;  5BU8 B;  1X79 B;  4O9B A;  3N7N A;  5KTB A;  3HRN A;  3U1C A;  2POH A;  4GIF A;  3BAS A;  3VP8 A;  3P8C D;  4N3Y B;  3VP9 A;  3OJA B; 
#chains in the Genus database with same CATH topology
 2HYN A;  4LGD E;  2YO2 A;  2KXP B;  1URQ B;  1WRG A;  2JJL A;  3N7N A;  2NPS A;  2W83 C;  1L0L J;  1NWQ A;  3H1L E;  3NTN A;  2OYO A;  1YI2 P;  1YIT P;  3CCE P;  1X9V A;  3LW5 H;  1K04 A;  1T6A A;  2FXM A;  2Q5U A;  1FDO A;  3F5H A;  3S9O A;  4R4L A;  1IFI A;  1VQ8 P;  1KN7 A;  1DD3 A;  3EFG A;  1FJP A;  2OQQ A;  3HTK B;  3L72 D;  3JCU E;  4RKU J;  1SFC C;  1M1K Q;  2E75 B;  4Y28 J;  2JP3 A;  2KNC A;  1JY2 O;  1YIJ P;  1LT9 A;  1GU5 A;  1N7S D;  3L74 D;  1S5L H;  3KQG A;  4HKZ H;  3H1K E;  4JBZ A;  2CK3 H;  5CMZ A;  2FFD A;  5AW7 B;  3L73 D;  3L72 E;  2E74 D;  3UIA A;  3HE5 B;  3C9I A;  1NU1 J;  2JDI H;  1VL2 A;  3D6Y A;  5TIS H;  2FXO A;  4L73 A;  2N1T D;  1NGM B;  1S9K E;  3BCC D;  1SQB J;  1AJY A;  1GD2 E;  1LGH B;  1NTZ K;  2ZT9 C;  1WT6 A;  1PV3 A;  2Q3I A;  1L0L K;  4ZMD A;  2Y0C A;  2KP8 A;  1U7J A;  4XA4 A;  1SQV G;  1KYO E;  5E79 H;  4DZO A;  2V7Q J;  2KUB A;  3MTU E;  1Q2N A;  2R32 A;  3M9Q A;  2H43 A;  4XFJ A;  2RKL A;  4H13 D;  2QJP C;  1SVF A;  1BE3 J;  3A7O A;  5KLV G;  1SQP G;  2YXR B;  1RF0 A;  1BCC D;  1VQ6 P;  3MD0 A;  1FZE A;  1RE3 A;  4JQ0 D;  4WB4 A;  2WQY C;  3OAK A;  1URQ A;  4N78 D;  2QEX P;  3KPE A;  3W67 A;  2Q3E A;  2XNX A;  4N6J A;  1KB9 D;  1NH4 A;  1YTZ T;  1SQQ G;  2R44 A;  1H0T B;  3H1I J;  3H1H G;  1G1I A;  1VQP P;  2YKO A;  2GUS A;  3V5B A;  2C0W A;  2A06 D;  1HUC A;  4UB6 E;  3A3Y B;  2JEE A;  3N4X A;  4OGQ D;  4NPD A;  1R5L A;  5CCG C;  2IZ1 A;  2LKM A;  3HTK A;  3B5N B;  3M0D C;  3JSV C;  1AVY A;  5KAI E;  4PD4 E;  1NOH A;  1NU1 D;  3L75 G;  3TYY A;  1W2B O;  1VF5 D;  2BAS A;  1NTM G;  5KJ7 C;  3JCU H;  1IFM A;  3C1L A;  1S5L X;  1SQB D;  3HE5 A;  4OH8 B;  3RBX A;  1S1C X;  2A45 I;  4PD4 I;  2YKP A;  5BVZ A;  5AW6 B;  3CX5 I;  3BAT A;  3RK2 B;  1FBM A;  3TGU D;  1GK6 A;  3HRN A;  1UIX A;  2WMM A;  1HGZ A;  1TU3 F;  1PGO A;  3RK3 B;  4AQR D;  1RHZ B;  1H8A A;  1HWT C;  1EDL A;  2ZXX A;  1QGK B;  1T3J A;  4ZKP A;  3AE7 C;  3BRV B;  4IFD K;  3CI9 A;  1NTK J;  2OTL P;  3L70 J;  1LT1 A;  3BRT B;  1YYC A;  1KYO H;  3PLN A;  4RO0 A;  1X0T A;  3CXH D;  4XE5 B;  2O1J A;  4PV1 C;  2W6B A;  2AXC A;  4O9B A;  2Q1K A;  1VQO P;  1JY3 P;  5AVU B;  1YJW P;  1VQL P;  2OYI C;  3V6I A;  2W6A A;  1LTI C;  4EOT A;  5EFW B;  3L4F A;  3CLQ A;  2W90 A;  3AE9 C;  2XKM A;  3AE4 C;  3L73 G;  5AVT B;  4YTP C;  1JY3 O;  1H0T A;  2I1K A;  1GW3 A;  2WIT A;  2YKQ A;  1PP9 J;  1YTZ I;  3ITK A;  3EFF K;  5AVX B;  2V4H A;  3BCC G;  4C7R A;  2YIU C;  1K8A Q;  1T2K C;  2K1A A;  2QA4 P;  2OTJ P;  1RQV A;  1HJB A;  2CPS A;  1L4A D;  3WUV A;  3B5N A;  1J2J B;  1QVF O;  5B5E E;  1LTJ C;  4IFM A;  5KKZ C;  1IFP A;  1AVO A;  1NTK K;  4UB6 H;  2HOD B;  3WUT A;  3IN6 A;  1SFC B;  1N8R Q;  2FYU J;  2G3A A;  3AEC C;  3L71 J;  2A45 H;  3TNU B;  1FZG A;  2R3S A;  4PD4 H;  2ZAE B;  1RH5 B;  3P8C D;  5APQ A;  2D2C C;  1BCC G;  1IC2 A;  1NAF A;  1OVV A;  1K9M Q;  2Q7C A;  2PAJ A;  3M06 A;  3H1J J;  3MZW B;  3Q2Y A;  5BU5 A;  2QRX A;  3L70 D;  5AVR B;  2ZT9 B;  3H25 A;  1OW8 A;  4ZNC A;  2ZVN B;  1SQV D;  1ZXG A;  3VOP A;  1A02 J;  2XV5 A;  1FZA A;  2JWA A;  3VMX A;  2K88 A;  5APX A;  2E76 D;  1BDC A;  2A06 G;  1P84 E;  4U3F D;  1KIL D;  2WSC J;  3HUS C;  3WUU A;  1SQV E;  1M7L A;  1PPJ D;  2QJP B;  3TSI A;  3OA7 A;  1E5W A;  1VQ4 P;  1P84 I;  4PJ0 H;  1NU1 G;  4WBA A;  2FYU K;  1VQ9 P;  1VDF A;  2XND H;  1N7L A;  1SQB G;  4I7Z C;  5KLV E;  1SQP E;  4Y99 C;  2IX7 C;  4H44 D;  2KOG A;  1SQQ D;  2L91 A;  4OVN F;  2N9B A;  1VQK P;  3FWN A;  2Y9Y A;  3CC2 P;  3V4W A;  3TGU G;  3Q5P A;  1GU4 A;  5CCH D;  1KD1 Q;  4D6T E;  4H0L C;  1LTT C;  2IPP A;  5E79 E;  2KSJ A;  3RL0 D;  1AV1 A;  3GF3 A;  2ZYA A;  2KI7 B;  1SQQ E;  1JCC A;  2W8Z A;  3H1H E;  2IBZ G;  1AA0 A;  3CCL P;  1DX7 A;  1FDI A;  5AVV B;  2J58 A;  2WPR A;  2HOD A;  2RMZ A;  2B87 B;  4L74 A;  1J1D C;  3KDP B;  1SFC A;  1ZLL A;  1SS1 A;  4KHX A;  1OMI A;  4W7Y A;  5B5E H;  1LJ2 A;  1NTM D;  1YJN P;  5C39 A;  3TNU A;  1JOC A;  5AW8 B;  2WSF H;  4R4M A;  1DIP A;  5AW4 B;  1KQF B;  1L0N J;  3OJA B;  3BVH A;  3L75 E;  3GHG C;  3R4Y A;  3FXD A;  3WMM 0;  1Q90 D;  1LTB C;  3CCM P;  3AE5 C;  3WU2 E;  2I1J A;  2WPS A;  1M57 D;  1NTZ J;  3D71 A;  5KAF E;  3SWY A;  1CW5 A;  1GL2 D;  1RY3 A;  3RL0 g;  2YMY A;  1W2E A;  4Z1M H;  3PJS K;  4ASW A;  1FS0 E;  1SQX J;  1JY2 P;  1OFC X;  1AFO A;  3L36 A;  2SPZ A;  1ZW0 A;  1EDK A;  1QX8 A;  1EZV D;  2ZJS E;  4W80 A;  1Z56 A;  1KFM A;  1P84 H;  3IR9 A;  4PV1 B;  2BEZ F;  1R8E A;  3NXS A;  4K3A A;  4IFF A;  1NKZ B;  5CBO A;  2AEM A;  3O6Q B;  5DJU B;  5AW2 B;  3TDK A;  1JEK A;  3ABV C;  3SWF A;  3TK1 A;  2ZVO B;  3QH9 A;  1L0N K;  5AVY B;  2LR2 A;  2NPS D;  4I1L A;  2C9L Y;  2CPB A;  2H89 C;  3A0H E;  3L74 E;  1JNM A;  1N73 C;  2Y0E A;  3CPW O;  3AEB C;  3FGA D;  3L73 E;  3L70 G;  2B88 A;  1N7S C;  1ZRT D;  2UWJ E;  1YBK A;  4DJG A;  2WT7 B;  5CCG A;  1NVO A;  2E74 C;  2O01 J;  3BCC E;  1OX3 A;  2B87 A;  2JWD A;  3M0D A;  1LTJ B;  3P8M C;  2N1T C;  1KFN A;  1SQX K;  4U3F G;  3AE6 C;  1ZRT E;  1ZR2 A;  1NKN A;  5KJ7 A;  1NO4 A;  1H89 A;  1KYO I;  1PPJ G;  3C8V A;  5KTB A;  3VN0 A;  2ITA A;  2D2C B;  2HPC B;  1NYH A;  2BEQ D;  2WTY A;  1L0L D;  2KLV A;  4GKG A;  3CCR P;  2BCC J;  1JTH B;  2QIW A;  3LID A;  3B8E B;  1CZQ A;  1BCC E;  4H13 C;  2YO3 A;  3BAS A;  3WU2 H;  1Q86 Q;  1HF9 A;  2K37 A;  3M9H A;  5KAF H;  5B66 E;  2WSE H;  4HJG H;  2IFN A;  4N78 E;  1USD A;  5CJ0 A;  1FDM A;  3I55 P;  2P7J A;  1X79 B;  3AE2 C;  1KB9 E;  2FYU G;  4JF7 A;  3PP5 A;  3HUS B;  3CC4 P;  1U7M A;  2RH0 A;  3IFM A;  3O6Q A;  2KSE A;  2WPV B;  2A06 E;  3CX5 D;  1OW7 A;  4EYY Q;  5APU A;  3D6Z A;  2O01 N;  1PGQ A;  1KQL A;  2QJY C;  3QWO C;  2JKV A;  3KXD A;  4ZKU A;  1EXJ A;  1URQ D;  1BSH A;  4OGQ C;  4I7Z B;  4Y99 B;  1FZB A;  1NU1 E;  2P10 A;  1XTC C;  3Q5S A;  2P67 A;  4CPG A;  1SQB E;  4WY4 B;  5AW5 B;  3JC2 2;  4GT1 A;  1OXZ A;  1VF5 C;  4WVZ A;  2HG5 D;  3VP9 A;  1K73 Q;  1RF0 C;  4H0L B;  3A0H H;  1GDT A;  2IDB A;  3CWB J;  2Q6Q A;  2QE7 H;  2WT7 A;  2IBZ D;  5M1B A;  3IF4 A;  1IFJ A;  3AEE C;  3TGU E;  4JYC A;  1LTJ A;  2WZ7 A;  5AW0 B;  3LW5 J;  1YQ4 C;  1BE3 D;  1DEB A;  1J1D B;  3PH0 A;  2E75 D;  2Z5I A;  1QL2 A;  2DW3 A;  2GUV A;  2OAR A;  4WWI A;  3HD7 B;  4PJ0 E;  2M5A B;  2IBZ E;  2IZ0 A;  2XU6 A;  4JPZ B;  1EZV G;  2YXQ B;  2HPC A;  1GW4 A;  3VMZ A;  1FOS F;  1HVV A;  2YNY A;  3GHG B;  3G6E P;  2M0B A;  1FZC C;  3H1I D;  4HH2 A;  1X8Y A;  3CXH E;  1JTH A;  1PL5 A;  1U57 A;  4L75 A;  4YXW H;  3CME P;  4JYB A;  4TLF A;  2K9Y A;  1OVR A;  1MV8 A;  3AE3 C;  2E42 A;  1IK9 A;  2MJZ A;  5KLV J;  1G1J A;  5CHX A;  3H32 B;  1L2P A;  2QG4 A;  3PHL A;  3SFE C;  4BXL A;  3HUS A;  1MKM A;  4U7J A;  5B66 H;  1M1J C;  1OZH A;  3AEA C;  3II6 A;  4D6T J;  1KB9 H;  4ASV A;  5L8R J;  1BGY J;  1LWU C;  4UB8 E;  1L0N G;  3H1H J;  1FE6 A;  1YHQ P;  1MUU A;  5AW9 B;  3VP8 A;  3KZI E;  1NTZ G;  4EDF A;  1M90 Q;  1L4A C;  1L0L G;  5APW A;  2KLU A;  2K3R A;  2GA1 A;  3B4S A;  4WY4 A;  1N73 B;  1NTK D;  2HR3 A;  2POH A;  1JM0 A;  3FXE A;  3P8C E;  1DH3 A;  1SQX G;  1N7S B;  2J5U A;  2E74 B;  5KLV K;  1SQP K;  3B5N D;  3MHV A;  3L70 E;  3H1L J;  4EIJ A;  2N1T B;  3HD7 A;  2WWW A;  2M5A A;  4HYT B;  3SSU A;  1WMK A;  4GDO A;  1MZ9 A;  5APS A;  3GHG A;  4U3F E;  1KIL E;  1SQQ K;  3GW6 A;  3P7K A;  1FC2 C;  1PP9 D;  1HJ0 A;  3RK2 D;  2N9Y B;  3CC7 P;  1Y47 A;  3B5N C;  2E76 C;  1IO4 A;  3T97 B;  1J1E C;  1PPJ E;  5AVW B;  1KIL C;  3IAO A;  4GOD A;  3Q1M A;  1N2D C;  1PGP A;  3RK3 D;  2KNC B;  3G71 P;  4H13 B;  3CXH H;  3H1K J;  4GIF A;  3W68 A;  1CI6 B;  4QMA A;  3GF7 A;  3RBZ A;  3L72 J;  4KJM A;  4MN4 C;  3H32 A;  1VPC A;  1LTA C;  2W27 A;  1RF1 C;  1JO5 A;  1BGY D;  2FYU D;  1ZME C;  3L74 J;  4DOJ A;  1Y9B A;  2OYH C;  2E5Y A;  3MUD C;  3L71 D;  3L73 J;  4N3Y B;  4H44 C;  1BE3 G;  5K5G B;  2QJK C;  5CCH C;  2ZYD A;  3BCC J;  3V4Q A;  3PRJ A;  1SP4 A;  3H1J D;  3CCU P;  3U1C A;  4AUW A;  1JMB A;  3RL0 C;  4UB8 H;  2QJY B;  1E79 H;  2BCC G;  4OGQ B;  3KZI H;  2QVA A;  1NTM E;  3H1I G;  2FXP A;  3E7K A;  2P2U A;  2FY8 A;  1VQM P;  1VF5 B;  3H1L D;  5APT A;  1N7S A;  2M8R A;  3EQ2 A;  2I8D A;  1KMI Z;  1PFI A;  3V2P A;  4C46 A;  4YXD C;  4NPE A;  1K05 A;  1YJ9 P;  3TF5 A;  2N1T A;  3FWL A;  1BCC J;  5CJ4 A;  2C9N Y;  2NZ2 A;  3Q3D A;  2Q9I A;  1JY3 N;  1SFC D;  1X22 A;  1VQ5 P;  3MGN A;  1QVG O;  3CD6 P;  1T3U A;  2RN0 A;  1EC5 A;  5KLI C;  4RJT A;  1GL2 C;  1RE4 C;  1LP1 B;  1IFD A;  4BRY B;  2OYI B;  2KIK A;  2P58 A;  3H1K D;  1OIP A;  3T97 A;  1FZC B;  1NJI Q;  2J59 M;  3GLM A;  1EZV E;  5APY A;  1OWA A;  5H2F H;  4A7P A;  3NFQ A;  2HLO A;  1AQ5 A;  2ZT9 D;  2PRR A;  1S9K D;  3Q5R A;  1CI6 A;  2FBW C;  3CWB G;  3FX0 A;  3M0A A;  5AVZ B;  5GTH H;  1EZV I;  1Q82 Q;  1NTK G;  1MFT A;  3M9B A;  1ZR4 A;  4DCK A;  1PIX A;  1A02 F;  2YIU B;  2FYN C;  2R3C A;  1FU1 A;  2K9J B;  1FJK A;  1KYO D;  2MKV A;  3A2A A;  1DEE G;  1M1J B;  3P32 A;  3AE1 C;  1EXI A;  5KKZ B;  4GOF A;  1VQN P;  5GTI E;  2NPS C;  1KZU B;  4TT3 H;  2KZJ A;  1L0N D;  1LWU B;  4IOI H;  3S4R A;  3TGU J;  4LC1 A;  1KQG B;  1S2E A;  2QSI A;  2H7H A;  1GMJ A;  1NTZ D;  2ZFC A;  3V2R A;  1L0N E;  2KB7 P;  1L4A B;  1ZOY C;  4HB1 A;  1IJD B;  1PP9 G;  4I6M C;  2FYZ A;  1SLQ A;  2OTK E;  3H6P A;  3L35 A;  1KQS O;  4DT0 A;  4K35 A;  1NTZ E;  2B89 A;  1SQX D;  1L0L E;  2ZXE B;  1LT9 C;  3GG2 A;  1S4X A;  1JMM A;  1YQ3 C;  3AE8 C;  1Q81 Q;  2FFD C;  4D6T G;  5CCG D;  1HGV A;  1NU1 K;  2G8Y A;  1SQX E;  1KC8 Q;  1BGY G;  3I56 P;  1QEX A;  4OWF A;  4I2L C;  2IYP A;  2LXB A;  3L71 G;  1SQB K;  5KJ7 D;  4PD4 D;  1EQ7 A;  2WSC H;  1LP1 A;  2NRG A;  4BRY A;  2OYI A;  1KB9 I;  2PFX A;  1FZC A;  4IL6 E;  2W6J H;  2E76 B;  3H1J G;  2WSF J;  1FOS E;  1J1E B;  1KIL B;  3KYQ A;  3CX5 E;  1T8Z A;  5AVS B;  4LLH A;  2AXT E;  4YPC A;  2VRS A;  1LTS C;  1G2C B;  2KK7 A;  2P1J A;  3H1L G;  2JR8 A;  2K9J A;  1RE3 C;  1RF1 B;  1HH0 A;  2WVR A;  1S72 P;  1M1J A;  2OYH B;  5BU8 B;  3AEF C;  1IZN B;  1NAY A;  1URQ C;  4PV1 D;  3A0B E;  4H44 B;  1OVU A;  5APV A;  2Z4E A;  2QJK B;  1LWU A;  4M3L A;  3E1I A;  1R5S A;  1N86 A;  5GTI H;  2H8P D;  1BE3 E;  2BCC D;  3RL0 B;  3OW2 O;  3HE4 B;  2IYO A;  1L4A A;  1SQV J;  4EI2 A;  3H1K G;  2IBZ I;  2E5T A;  1JB0 J;  3USS A;  5TJH A;  2E75 C;  3L72 G;  3CL3 D;  4U3F J;  2BCC E;  2KYV A;  2C0X A;  1JY2 N;  4B86 A;  3V2Q A;  1T2K D;  3LIE A;  3L74 G;  3H1I E;  1RQU A;  1SQP J;  3CXH I;  1ZV8 A;  1ZN5 A;  2QM7 A;  3MIW A;  5AW3 B;  2OGU A;  3PTZ A;  2KS1 B;  2R5B A;  1M8O B;  3CMA P;  5DJT B;  1M56 D;  5KLI B;  3M91 A;  1GL2 B;  1SQQ J;  2D2C D;  1ZP0 C;  2R5D A;  4BWN A;  1OW6 A;  2QM8 A;  3GMA A;  2KZI A;  1USE A;  2O1K A;  2AEF A;  3V2N A;  3AEG C;  3O8Z A;  3G4S P;  1KIL A;  2PGD A;  4C7N B;  4NPF X;  3SFD C;  4IL6 H;  3F89 A;  3CWB D;  1SQV K;  2B9B A;  2IFM A;  5KAI H;  5CBN A;  3G3Z A;  1G2C A;  3CX5 H;  3L75 J;  1RF1 A;  2AXT H;  4KT0 J;  2FYN B;  5AVQ B;  1NTM J;  2OYH A;  3CWB E;  1VQ7 P;  3MUD A;  2Z5H A;  3E1R A;  3EWK A;  3A5T A;  1NTK E;  2WSE J;  1P84 D;  2NPS B;  1FAV A;  5CCH A;  1IK7 A;  1GK4 A;  2O01 H;  3A0B H;  1LTG C;  2WPQ A;  2GM4 A;  2V7Q H;  2A45 G;  1KV4 A;  3K5B A;  2L5G B;  3HE4 A;  3VYI A;  2M3E A;  1PZQ A;  3ZDM A;  5H2F E;  3VMA A;  3D70 A;  2HFE D;  1GZL A;  2PP6 A;  2ZYG A;  3S1K A;  5KLV D;  1SQP D;  1EDJ A;  1S5L E;  1BSN A;  3MP7 B;  3U59 A;  4L76 A;  4WY4 D;  1D7M A;  1UII A;  4AYC A;  1H88 A;  3AED C;  1W5C E;  5GTH E;  2Y0D A;  4H0L D;  1CSB A;  1HBW A;  3I5C A;  5TIS E;  2Y9Z A;  1LT9 B;  2O3J A;  1PP9 E;  2XDJ A;  4W7Z A;  1NHL A;  4D6T D;  1BDD A;  3VMY A;  2FFD B;  2JO1 A;  2LXC B;  1AQT A;  1IFN A;  3RK2 C;  3RK3 E;  2KS1 A;  2FKW B;  1Q7Y Q;  2AEJ A;  3H1H D;  1NTM K;  3CCV P;  1QLE D;  3HD7 D;  1LNQ A;  3VTP C;  4WY4 C;  5AW1 B;  3CCQ P;  3RK3 C;  4GOE A;  3R2P A;  3CCJ P;  1GL2 A;  1RE4 A;  1KTM A;  1Y8A A;  2YMK A;  1GTW A;  3L37 A;  3SWK A;  1BGY E;  2FYU E;  1XTG B;  2E43 A;  1JUN A;  3L71 E;  3CCS P;  1S3J A;  4C7N A;  1KOR A;  1QL1 A;  3B71 A;  3L75 D;  1MFZ A;  1EDI A;  3HD7 C;  3U1A A;  3KHU A;  4IL6 X;  2WSS H;  2XZR A;  4RES B;  1N73 A;  3H1J E;  3RGU A;  1PGJ A;  1JCD A;  2H88 C;  3G9R A;  1FZF A;  1HTL C;  3NMD A;  1DD4 A;  2M3B A; 
#chains in the Genus database with same CATH homology
 2Z5I A;  1QL2 A;  2GUV A;  2KB7 P;  2OAR A;  3HD7 B;  2HYN A;  1L4A B;  1IJD B;  3VOP A;  4LGD E;  2YO2 A;  1A02 J;  4I6M C;  2FYZ A;  1SLQ A;  2XV5 A;  1FZA A;  2XU6 A;  3H6P A;  3VMX A;  3L35 A;  5APX A;  1URQ B;  1WRG A;  2HPC A;  2JJL A;  1GW4 A;  3N7N A;  2NPS A;  3VMZ A;  1KIL D;  3NTN A;  1NWQ A;  1FOS F;  1HVV A;  2YNY A;  3GHG B;  2ZXE B;  3HUS C;  1LT9 C;  1FZC C;  1JMM A;  1X9V A;  4HH2 A;  3LW5 H;  1X8Y A;  1M7L A;  2FFD C;  3TSI A;  1JTH A;  5CCG D;  3OA7 A;  1E5W A;  1HGV A;  2FXM A;  1NU1 K;  2Q5U A;  4JYB A;  4WBA A;  2FYU K;  1IFI A;  1VDF A;  1MV8 A;  4I2L C;  2E42 A;  1N7L A;  1IK9 A;  3EFG A;  1FJP A;  2MJZ A;  1SQB K;  3HTK B;  1G1J A;  5KJ7 D;  4Y99 C;  1SFC C;  2IX7 C;  1EQ7 A;  5CHX A;  2WSC H;  3H32 B;  1JY2 O;  2KOG A;  2OYI A;  2N9B A;  3HUS A;  1LT9 A;  1GU5 A;  1N7S D;  1FZC A;  1M1J C;  3V4W A;  3KQG A;  3II6 A;  1GU4 A;  5CCH D;  5CMZ A;  2FFD A;  5AW7 B;  1FOS E;  1J1E B;  3UIA A;  3HE5 B;  1LTT C;  2IPP A;  3C9I A;  1KIL B;  2KSJ A;  3KYQ A;  3RL0 D;  1LWU C;  2N1T D;  1T8Z A;  5AVS B;  4LLH A;  1S9K E;  1JCC A;  1MUU A;  5AW9 B;  1DX7 A;  5AVV B;  2J58 A;  3VP8 A;  1GD2 E;  2VRS A;  1LGH B;  1LTS C;  2HOD A;  2WPR A;  1NTZ K;  3KDP B;  1J1D C;  1SFC A;  1WT6 A;  1G2C B;  1ZLL A;  2P1J A;  2Q3I A;  4KHX A;  1L0L K;  1L4A C;  4W7Y A;  1RE3 C;  1RF1 B;  5APW A;  2KP8 A;  1HH0 A;  4XA4 A;  3TNU A;  1M1J A;  1JOC A;  2OYH B;  5AW8 B;  5BU8 B;  2WSF H;  4WY4 A;  1URQ C;  1N73 B;  4DZO A;  2POH A;  5AW4 B;  3P8C E;  3MTU E;  3OJA B;  5APV A;  3BVH A;  2Z4E A;  1DH3 A;  3GHG C;  1LWU A;  1N7S B;  4M3L A;  3WMM 0;  3E1I A;  2R32 A;  3M9Q A;  2H43 A;  1LTB C;  1N86 A;  2I1J A;  2WPS A;  1SVF A;  5KLV K;  1SQP K;  3A7O A;  3B5N D;  2H8P D;  1RF0 A;  3RL0 B;  4EIJ A;  2N1T B;  3HD7 A;  3HE4 B;  3MD0 A;  1FZE A;  1L4A A;  3SWY A;  1CW5 A;  1GL2 D;  1RE3 A;  2WWW A;  4WB4 A;  4HYT B;  1RY3 A;  3OAK A;  2YMY A;  1W2E A;  1URQ A;  4N78 D;  3KPE A;  3CL3 D;  2XNX A;  4N6J A;  1MZ9 A;  2KYV A;  1NH4 A;  5APS A;  1JY2 P;  1YTZ T;  2C0X A;  3GHG A;  1JY2 N;  4B86 A;  1SQQ K;  1AFO A;  3V2Q A;  1T2K D;  3L36 A;  3LIE A;  3P7K A;  3RK2 D;  1G1I A;  3B5N C;  1IO4 A;  2YKO A;  4W80 A;  1J1E C;  1Z56 A;  1KFM A;  2GUS A;  1ZV8 A;  3IR9 A;  5AVW B;  1ZN5 A;  1KIL C;  3V5B A;  2C0W A;  2QM7 A;  3NXS A;  3MIW A;  1N2D C;  1HUC A;  1NKZ B;  4IFF A;  5AW3 B;  3RK3 D;  3A3Y B;  2JEE A;  3N4X A;  5AW2 B;  4GIF A;  5CCG C;  1CI6 B;  2LKM A;  3HTK A;  2R5B A;  3SWF A;  3B5N B;  3TK1 A;  3M0D C;  3H32 A;  1VPC A;  3M91 A;  1NOH A;  1GL2 B;  1LTA C;  3TYY A;  1L0N K;  2BAS A;  2W27 A;  1RF1 C;  1JO5 A;  5AVY B;  2NPS D;  4DOJ A;  2R5D A;  4I1L A;  2C9L Y;  2CPB A;  2OYH C;  5KJ7 C;  1JNM A;  2QM8 A;  1N73 C;  1IFM A;  2O1K A;  4N3Y B;  3V2N A;  3HE5 A;  3O8Z A;  4OH8 B;  1KIL A;  2A45 I;  4C7N B;  2YKP A;  1N7S C;  5BVZ A;  5AW6 B;  3BAT A;  3RK2 B;  1FBM A;  5CCH C;  1SQV K;  2WT7 B;  2IFM A;  5CCG A;  3V4Q A;  1SP4 A;  1GK6 A;  3HRN A;  3U1C A;  3G3Z A;  4AUW A;  3P8M C;  3M0D A;  1LTJ B;  1G2C A;  1HGZ A;  3RL0 C;  2N1T C;  3RK3 B;  4AQR D;  1KFN A;  1SQX K;  1RF1 A;  1H8A A;  5AVQ B;  1HWT C;  1ZR2 A;  1NKN A;  2OYH A;  1T3J A;  4ZKP A;  5KJ7 A;  1NO4 A;  3MUD A;  2Z5H A;  3BRV B;  1H89 A;  2P2U A;  4IFD K;  3CI9 A;  3A5T A;  3BRT B;  5KTB A;  3VN0 A;  2HPC B;  5APT A;  1N7S A;  2WTY A;  2NPS B;  2M8R A;  3EQ2 A;  1YYC A;  2KLV A;  1FAV A;  5CCH A;  1PFI A;  3V2P A;  1GK4 A;  2O01 H;  4GKG A;  4C46 A;  4XE5 B;  2O1J A;  1LTG C;  2W6B A;  2WPQ A;  2GM4 A;  2A45 G;  2N1T A;  1JTH B;  3LID A;  5CJ4 A;  2L5G B;  4O9B A;  2C9N Y;  3HE4 A;  2Q9I A;  3B8E B;  3VYI A;  1CZQ A;  1JY3 P;  5AVU B;  1JY3 N;  2YO3 A;  1SFC D;  3BAS A;  2OYI C;  2W6A A;  1LTI C;  3MGN A;  4EOT A;  3M9H A;  2HFE D;  3L4F A;  3CLQ A;  1GZL A;  2PP6 A;  1T3U A;  2WSE H;  2IFN A;  4N78 E;  2XKM A;  5CJ0 A;  3U59 A;  4WY4 D;  5AVT B;  4AYC A;  1GL2 C;  1H88 A;  1RE4 C;  1FDM A;  2P7J A;  1JY3 O;  1X79 B;  1CSB A;  1HBW A;  1IFD A;  2I1K A;  1GW3 A;  2WIT A;  2YKQ A;  3I5C A;  4JF7 A;  1YTZ I;  2OYI B;  3PP5 A;  5AVX B;  3HUS B;  1LT9 B;  4W7Z A;  2XDJ A;  3T97 A;  1FZC B;  4C7R A;  1NHL A;  2J59 M;  3VMY A;  5APY A;  1OWA A;  2FFD B;  3IFM A;  1T2K C;  3NFQ A;  2HLO A;  1AQ5 A;  1IFN A;  3RK2 C;  5APU A;  1S9K D;  2FKW B;  1HJB A;  1CI6 A;  1NTM K;  2CPS A;  3HD7 D;  1L4A D;  1KQL A;  3B5N A;  3VTP C;  3M0A A;  1J2J B;  5AVZ B;  1LTJ C;  4IFM A;  4WY4 C;  5AW1 B;  1NTK K;  3RK3 C;  3R2P A;  4ZKU A;  3M9B A;  2HOD B;  1URQ D;  1GL2 A;  1ZR4 A;  1RE4 A;  4Y99 B;  1A02 F;  1SFC B;  1FZB A;  1GTW A;  3L37 A;  2R3C A;  1FU1 A;  1FJK A;  1XTC C;  1XTG B;  2E43 A;  3A2A A;  2A45 H;  3TNU B;  1M1J B;  1JUN A;  1FZG A;  3P32 A;  2P67 A;  4WY4 B;  5AW5 B;  4GT1 A;  1OXZ A;  4C7N A;  3P8C D;  2HG5 D;  5APQ A;  3VP9 A;  1RF0 C;  1QL1 A;  2NPS C;  1KZU B;  1MFZ A;  1IC2 A;  3HD7 C;  1NAF A;  3U1A A;  1GDT A;  1LWU B;  2WT7 A;  2Q7C A;  4LC1 A;  2PAJ A;  1IFJ A;  2XZR A;  3M06 A;  4RES B;  1N73 A;  4JYC A;  1LTJ A;  5BU5 A;  2WZ7 A;  5AW0 B;  2H7H A;  1JCD A;  1DEB A;  1FZF A;  1HTL C;  2ZFC A;  3NMD A;  5AVR B;  3V2R A;  1J1D B;  2M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...