3U5MA

Crystal structure of trim33 phd-bromo in the free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
203
structure length
178
Chain Sequence
PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 49
structure length 178
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5mA01
4NYWA 4IR5A 5F62A 3O70A 4YYGA 5E3GA 2KU3A 5FB1A 4MR4A 2L5EA 2CT2A 4GPJA 4O75A 3SOWA 4NQNA 5HJCA 4YYHA 2YURA 5DLXA 5I88A 4UIXA 5CFWA 2GRCA 4QB3A 4YY4A 2KWKA 5ENFA 2L80A 5D1LB 4GNEA 4OGJA 5C89A 4HBWA 4X2IA 1JOCA 4C66A 3V43A 3UVDA 3N9LA 4O7AA 5CU8A 2C2VS 4B86C 5DFBA 5DW1A 1HYIA 5FFWA 4A9JA 5CZGA 3ZYUA 5II1A 2YUCA 5E7DA 4L58A 3N9PA 3ZNIA 5JWMA 4PCIA 3N9OA 1E4UA 5CQ4A 4MR5A 2QIZA 3MB3A 3GV4A 5CPEA 1X0JA 1F68A 5EISA 4XUBA 2XEUA 3I2DA 4LADB 4LZRA 4BBQA 3I3JA 2RNYA 3U5OA 5E0RA 1V87A 2YT5A 3SVGA 2DATA 4NYXA 3SHBA 3HTKC 5DX4A 5FB0A 4CFLA 2R0SA 5L8UA 5FE1A 3MQMA 4NRAA 2EGPA 4ALGA 3U5LA 2K4DA 3SVFA 5DYCA 5ENGA 1N72A 2YHNA 4NR6A 4TU4A 2L84A 3O34A 1HYJA 5I86A 5FH7A 5FE9A 4S3OC 5DY7A 4NUEA 5IGLA 5DKAA 4QUUA 4ZQLA 5TDRA 5TBNA 5F63A 2OSSA 4N3WA 4QSTA 5ENCA 1U6GB 2PUYA 4UIZA 5FE8A 2YU4A 4YYDA 1VYXA 1WEMA 4QSSA 5EWCA 3O7AA 5FH8A 5B78A 2EODA 2HDPA 3HCUA 5I29A 4KCXA 5J3XA 4LZSA 2ECWA 4UP0A 4WHWA 2VPBA 2DVSA 5D3PA 4N4HA 5HEMA 5IIDA 2K1JA 4FK5A 3C5KA 2RS9B 3KV5A 4UIUA 5AMEA 2QJ0A 2YDWA 2LN0A 2K16A 4LLBA 5CUCA 3L1ZB 5HRWA 2RNXA 2JMJA 2Y1MA 5AIUA 5HLSA 1JM4B 2E3KA 1CHCA 4MVTA 3S92A 5FE0A 3MULA 5HRXA 2R0VA 3FKMX 5AD3A 4A9MA 4YYMA 5JG6A 5IGKA 2FUUA 3LRQA 4LC2A 2ECTA 4AVXA 5CQAA 4HXMA 1F62A 2Y43A 2L43A 5H1UA 5ENHA 4O71A 2M6MA 5D3RA 4YABA 4GNGA 3ONIA 4O77A 4FO9A 4QEUA 4QEVA 3DWYA 4PTBA 4LZ2A 3U5MA 5HFQA 1LDKC 2H60A 5A82A 4O7BA 5EM3A 3U5NA 4YYJA 4TT4A 4ZW1A 4E96A 5CUBA 3G0JA 4MR6A 4HXSA 3P1FA 2DVRA 5E9LA 4TTEA 5A83A 4O64A 4TS8A 5TRBA 4PPEA 5A85A 4AYCA 4CA1A 5E9KA 2KWNA 5HENA 2ECNA 5F61A 5I7YA 3UW9A 5KH7A 2ECGA 4LR6A 5KH9A 2MD8C 4YBMA 2FSAA 5B8DA 5KO4A 2KFTA 3M63A 4LJNA 4YAXA 1K2FA 2WP2A 5IBNA 3IU5A 2L75A 4PS5A 4NN2A 4WHUA 2MNZA 2YQMA 5G05B 4IC3A 3ZVYA 3HMHA 5C13A 4L7XA 4I7DA 5CQ5A 3MB4A 2F42A 2RSDA 2G45A 2KIZA 2YREA 1X4JA 2OUOA 4O70A 2R0YA 2KWOA 4MEPA 5H1TA 2EA6A 5L97A 4J0RA 5I40A 2DWWA 5DINA 4ALHA 5G4SA 1BORA 4FJCA 4Z1QA 3HCTA 5FG4A 1WEVA 5F3AA 2AN6A 5EV9A 3ZYQA 4MEQA 1E6IA 2MA5A 1WEEA 4NR5A 1MM3A 5EWDA 5A7CA 3IU6A 1Z60A 3VK6A 5CRZA 4CL9A 2LGKA 2YYNA 5A5RA 3S91A 4QYLA 4NRCA 4Y03A 2JMDA 4IC2A 5CQTA 2KTBB 3U5JA 5EU1A 4QUTA 5DYAA 4Z1SA 5AMFA 2C2LA 4XI1A 4S3OB 4QSXA 5LKTA 2OXQC 2DVVA 4UYFA 1WILA 4YATA 2H0DA 5L96A 5FERA 4YC9A 5BT3A 3MHHA 3GG3A 4QYDA 4BW4A 5COIA 3T6RA 5A5OA 5E3DA 5L99A 2FUIA 5B77A 4J1PA 4QC1A 4YYKA 1N87A 3LXJA 5CUAA 5F60A 5ENIA 5A5PA 5D3TA 2G43A 4R8PK 5G4RA 5C11A 2L85A 4A9LA 5C8GA 2E6SA 2LXHC 4X3GA 1WEUA 4HXRA 4UIYA 4WIVA 1WENA 5EPBA 1IYMA 2MJVB 5CUEA 2YQDA 3MUKA 4RVRA 4QF2A 4UIVA 5TABA 3Q2FA 5CP5A 3SOUA 1JM7B 4ZDTA 5ACYA 4UYGA 5EVAA 2QICA 4GB0A 4CCGX 5IG6A 3EB5A 3SVHA 5EICA 2YEKA 2YELA 4W4UA 4QSUA 5F1HA 2RNWA 2E7OA 5CUGA 4QZSA 5FBXA 4UYHA 4YY6A 1FP0A 5FG5A 4IORA 5FH6A 3LQIA 1WUGA 5ENEA 2Y1NA 4O7FA 5DLZA 4FLPA 5D1MB 3KNVA 2OO1A 4LKAA 5CY9A 3JVMA 4O76A 2VP7A 4NS5A 5LVQA 3ASLA 5HRVA 5HELA 4QBMA 5D1KB 4B7YC 2BAYA 2YQLA 3TLPA 4CUSA 5IGMA 1VFYA 2G4AA 4O7EA 5E9YA 5FE6A 2F6JA 4GNFA 4I7CA 4HXKA 2I7KA 4R2YA 5HQ6A 3ZVZB 1EQFA 4IOQA 4YH4A 4BW3A 3P1DA 4YYNA 5I89A 2G6QA 3MHSA 4WA6A 1G25A 3LQJA 2KR4A 1WGMA 5F1LA 5E73A 4A9OA 5C85A 2XB1A 2YW5A 4LYSA 4UYFB 4CUUA 1WESA 2CSZA 2H0DB 2LSPB 5HQ5A 4XYAA 5B75A 4A9EA 5LVRA 4NXJA 4Z6IA 4IOOA 5I83A 4LYIA 4BHWA 4A4CA 5BT4A 4IR6A 4PCEA 4CUPA 5TB6A 5LJ1A 1WIMA 2M1RA 2MIQA 2D9EA 4GNDA 4LK9A 3T7LA 5G0FA 5FE5A 2MNYA 3ZPV1 1RMDA 5FFVA 1WE9A 3L1XA 5L98A 5DFDA 4Z93A 5D3NA 5EP7A 4O7CA 3HMFA 1WFKA 2LGVA 2KREA 1VD4A 3N9NA 4MENA 5H85A 5I80A 4O74A 4QR3A 3NG2A 2M3HA 4P5OB 5LJ0A 3EB6A 1WEWA 4HXPA 1X4IA 4IR3A 4A9NA 3ZTGA 2NAAA 2UZGA 5LCWB 5FG6A 4C9ZA 4YBSA 3Q2EA 5F25A 4FIPA 5DFCA 2VJEA 4XUAA 4QSRA 2I8NA 4YBTA 3UV5A 5DKHA 4TQNA 3O36A 5EWWA 5KTXA 4N4GA 5I1QA 4V3LC 2KYUA 5DYXA 3M62A 5ENJA 3RPGB 2DX8A 5DW2A 4QSPA 4TT2A 5CRMA 4BW1A 5L8TA 5D24A 3HCSA 5A5QA 2ZETC 5J0DA 4QR4A 5DYUA 2IDAA 2KE1A 3P1CA 2KWJA 2VPEA 3O33A 4YK0A 2D82A 4YYIA 4IR4A 3U5KA 2NXBA 5EPRA 5KHMA 2YSMA 3P1EA 4QSWA 4QR5A 1WEQA 3IHPA 3QZTA 1LDJB 4CURA 1ZS5A 5FFYA 2DVQA 5A81A 1FBVA 5A5SA 5D7XA 4PKLA 5ETDA 5ETBA 2RI7A 4HXLA 2PNXA 2R10A 2E6RA 3JVKA 1ZBDB 3HMEA 4O72A 1JM7A 4KV1A 5F5ZA 1JSPB 4AYCB 5D25A 4TZ2A 3QZVA 5D3JA 4Z6HA 5EA1A 5DBMA 4O78A 5B79A 4CFKA 5HM0A 5E9VA 5LUUA 3LQHA 4TYLA 2CKLA 2MUMA 5EWVA 4UI9B 5AITA 2LV9A 4UYDA 5F2PA 4CUQA 1X4UA 4TZ8A 5ENBA 2E7NA 5CQ3A 5I7XA 4A9HA 2DKWA 2YHOA 4A49A 4NQMA 4WZ3B 2LGLA 3AQAA 3RCWA 1DVPA 2ECIA 4AP4A 4C67A 2RFJA 2LGGA 4DONA 4MSXA 3PHDA 4NRBA 2CSYA 4N4IA 2L5UA 3DQVR 5FEYA 2LRIC 2K17A 4A0CD 2KGIA 4NUDA 5EYAF 4NR4A 4YH3A 5G04B 5LKXA 4Q0NA 3LJWA 4LDFA 4BW2A 5LJ2A 2LQ6A 5TDWA 5C7NA 1WUMA 4HBYA 2YEMA 5KTUA 3UVYA 4OGIA 2VJFB 3AADA 4NYVA 2M85A 3RTRB 4A9FA 3M99A 4YADA 4NR9A 3UVWA 1WEOA 3FL2A 4CUTA 4LRGA 3N9QA 4OUFA 5CUDA 4F52B 3PUQA 5EPSA 4QSQA 2JMIA 4V3KC 5CGPA 1Z6UA 1MM2A 4TT6A 3KQIA 5II2A 3UV4A 3O37A 4XY8A 4A9KA 5TCMA 3KV6A 5D26A 5JI8A 4N4FA 5DKDA 1XWHA 5HQ7A 5FDZA 2YSJA 4QC3A 5D3LA 3L11A 2WP1A 5C87A 5HFRA 5HCLA 5D3SA 5F36A 4CLBA 5DKCA 2LXPC 5CTLA 2YW8A 4I7BA 4AUQB 4MEOA 2L0BA 4ZUXU 5EWHA 5K29A 4QEWA 5FE7A 3O35A 4HBXA 4ZC9A 3K2JA 4A9IA 4WZ2A 5FE2A 3D7CA 3JVLA 5D3HA 4UITA 2VJEB 5CS8A 1T1HA 2RO1A 4TKPB 1Z2QA 5KH3A 2VPGA 5H9MA 5C4QA 4Q6FA 2CKLB 2HYED 2VNFA 5E74A 4UP5A 2ECJA 4NUCA 5FE4A 3PURA 3RPGC 5D0CA 3DAIA 2KGGA 4QF3A 4HXNA 3NXBA 2MT5A 4Q0OA 5E9IA 5FE3A 3GL6A 4BJXA 5CQ6A 3G0LA 5I3LA 5LKZA 5CQ7A 2MD7B 4HXOA 5EGUA 5AD2A 4F3IA 2VPDA 3P5OA 2D8SA 5E9MA 4QNSA 4NR7A 3MXFA 2MA6A 4R7EA 3JVJA 5KU3A 4QY4A 4XY9A 3N9MA 4WZ0A 4HBVA 4J3IA 4J0SA 3U5PA 4PY6A 5BT5A 4KV4A 2JRJA 2ECVA 2YYRA 5EQ1A 4TU6A 5EK9A 3UV2A 3SOXA 5EI4A 5B76A 4AKNA 4LYWA 5H1VA 4UIWA 5LKUA 2VJFA 2N9GA 4MR3A 4NR8A 5IGNA 4UYEA 2F6NA 5A5NA 5KTWA 1WEPA 3C6WA 3DPLR 3ZPVE 3QZSA 2I50A 4A4BA 4QSVA 2LDRA 5CQ8A 3UVXA
chains in the Genus database with same CATH superfamily
4NYWA 4IR5A 5F62A 3O70A 4YYGA 5E3GA 4Z0OA 2KU3A 5FB1A 4MR4A 2L5EA 2CT2A 4GPJA 4O75A 3SOWA 4NQNA 5HJCA 4YYHA 2YURA 5DLXA 5I88A 4UIXA 5CFWA 2DJAA 2GRCA 4QB3A 4YY4A 2KWKA 5ENFA 2L80A 5D1LB 4GNEA 4OGJA 5C89A 4HBWA 4X2IA 1JOCA 4C66A 3V43A 3UVDA 3N9LA 4O7AA 5CU8A 2C2VS 4B86C 5DFBA 4QQ4A 5DW1A 1HYIA 5FFWA 4A9JA 5CZGA 3ZYUA 5II1A 2YUCA 5E7DA 5SVIA 4L58A 5SVXA 3N9PA 3ZNIA 5JWMA 4PCIA 3N9OA 1E4UA 5CQ4A 4MR5A 2QIZA 3MB3A 3GV4A 5CPEA 1X0JA 1F68A 5EISA 4XUBA 4AKHA 2XEUA 3I2DA 4LADB 4LZRA 4BBQA 3I3JA 2RNYA 3U5OA 5E0RA 1V87A 2YT5A 3SVGA 2DATA 4NYXA 3SHBA 3HTKC 5DX4A 5FB0A 4H9DA 4CFLA 2R0SA 5L8UA 5FE1A 3MQMA 4NRAA 2EGPA 4ALGA 3U5LA 2K4DA 3SVFA 5DYCA 5ENGA 1N72A 2YHNA 4NR6A 4TU4A 2L84A 3JUEA 3O34A 1HYJA 5I86A 5FH7A 5FE9A 4S3OC 5DY7A 4NUEA 5IGLA 5DKAA 4QUUA 4ZQLA 5TDRA 5TBNA 5F63A 2OSSA 4N3WA 4QSTA 5ENCA 1U6GB 2PUYA 4UIZA 5FE8A 2YU4A 4YYDA 1VYXA 1WEMA 3D1DA 4QSSA 5EWCA 3O7AA 2CRWA 5FH8A 5B78A 2EODA 2HDPA 3HCUA 5I29A 4KCXA 3LVRE 5J3XA 4LZSA 2ECWA 4UP0A 4WHWA 2VPBA 2DVSA 5D3PA 4N4HA 5HEMA 5IIDA 2K1JA 4FK5A 3C5KA 2RS9B 3KV5A 4UIUA 5AMEA 2QJ0A 2YDWA 2LN0A 2K16A 4LLBA 5CUCA 3L1ZB 5HRWA 2RNXA 2JMJA 2Y1MA 5AIUA 5HLSA 1JM4B 2E3KA 1CHCA 2P57A 1PUOA 4MVTA 3S92A 5FE0A 2CONA 3MULA 5HRXA 2R0VA 3FKMX 5AD3A 4AKIA 4A9MA 4YYMA 5JG6A 5IGKA 2FFWA 2FUUA 3LRQA 4LC2A 2ECTA 3SUBA 5CQAA 4AVXA 4HXMA 1F62A 2Y43A 2L43A 5H1UA 5ENHA 4O71A 2M6MA 5D3RA 4YABA 4GNGA 3ONIA 3DDTA 4O77A 4FO9A 4QEUA 4QEVA 1DCQA 3DWYA 4PTBA 4LZ2A 3U5MA 5HFQA 1LDKC 2H60A 5A82A 4O7BA 5EM3A 3U5NA 4YYJA 4TT4A 2RR4A 4ZW1A 4E96A 5CUBA 3G0JA 4MR6A 4HXSA 3P1FA 2DVRA 2E61A 5E9LA 4TTEA 5A83A 4O64A 4TS8A 5TRBA 4PPEA 5A85A 4AYCA 4CA1A 5E9KA 2KWNA 5HENA 2ECNA 5F61A 5I7YA 3UW9A 5KH7A 2ECGA 4LR6A 3N9NA 5KH9A 2XOCA 2MD8C 4YBMA 2FSAA 5B8DA 5KO4A 2KFTA 3LVQE 3M63A 4LJNA 4YAXA 1K2FA 2WP2A 5IBNA 3IU5A 2L75A 3FAOA 4PS5A 4NN2A 4WHUA 2MNZA 2YQMA 5G05B 4IC3A 3ZVYA 3HMHA 5C13A 4L7XA 4I7DA 5CQ5A 3MB4A 2F42A 2RSDA 2G45A 2KIZA 2YREA 1X4JA 2OUOA 4O70A 2R0YA 2KWOA 4MEPA 5H1TA 2EA6A 5L97A 4J0RA 5I40A 2DWWA 5DINA 4ALHA 5G4SA 1BORA 4FJCA 4Z1QA 3HCTA 5FG4A 1WEVA 5F3AA 2AN6A 5EV9A 3ZYQA 4MEQA 1E6IA 2MA5A 1WEEA 4NR5A 1MM3A 5EWDA 5A7CA 3IU6A 1Z60A 3VK6A 5CRZA 4CL9A 3FANA 2EXUA 2KKXA 2LGKA 2YYNA 5A5RA 3S91A 4QYLA 4NRCA 4Y03A 2JMDA 4IC2A 4AI6A 5CQTA 2KTBB 3U5JA 5EU1A 4QUTA 5DYAA 4Z1SA 5AMFA 2C2LA 4XI1A 4S3OB 4QSXA 5LKTA 2OXQC 2DVVA 4UYFA 1WILA 4YATA 2H0DA 5L96A 5FERA 2DSMA 4YC9A 5BT3A 3MHHA 3GG3A 4QYDA 4BW4A 5COIA 3T6RA 2YVRA 5A5OA 5E3DA 5L99A 4F1PA 2FUIA 5B77A 4J1PA 4QC1A 4YYKA 1N87A 3LXJA 5CUAA 5F60A 5ENIA 5A5PA 5D3TA 3E2DA 2G43A 4R8PK 5G4RA 5C11A 2L85A 4A9LA 5C8GA 2E6SA 2JUNA 2LXHC 2M13A 4X3GA 1WEUA 4HXRA 4UIYA 4WIVA 1WENA 5EPBA 1IYMA 2MJVB 5CUEA 2YQDA 3MUKA 4RVRA 4QF2A 4UIVA 5TABA 3Q2FA 5CP5A 3SOUA 3Q1DA 1JM7B 4ZDTA 5ACYA 4UYGA 5EVAA 2QICA 4GB0A 4CCGX 5IG6A 3EB5A 3SVHA 5EICA 2YEKA 2YELA 4W4UA 4QSUA 5F1HA 2L7PA 2RNWA 2E7OA 5CUGA 4QZSA 5FBXA 4UYHA 4YY6A 1FP0A 3FJUB 5FG5A 4IORA 5FH6A 3LQIA 1WUGA 5ENEA 2Y1NA 4O7FA 5DLZA 4FLPA 5D1MB 3KNVA 2OO1A 4LKAA 5CY9A 3JVMA 4O76A 2VP7A 4NS5A 5LVQA 3ASLA 5HRVA 5HELA 4QBMA 5D1KB 4B7YC 2BAYA 2YQLA 3TLPA 4CUSA 5IGMA 1VFYA 2G4AA 4O7EA 5E9YA 5FE6A 2F6JA 4GNFA 4I7CA 4HXKA 2I7KA 4R2YA 5HQ6A 3ZVZB 1EQFA 4IOQA 4YH4A 4BW3A 3P1DA 4YYNA 5I89A 2G6QA 3MHSA 4WA6A 1G25A 3LQJA 2KR4A 1WGMA 5SVYA 5F1LA 5E73A 4A9OA 5C85A 2XB1A 2YW5A 4LYSA 4UYFB 4CUUA 1WESA 2CSZA 2H0DB 2LSPB 5HQ5A 4XYAA 5B75A 4A9EA 5LVRA 4NXJA 4Z6IA 4IOOA 5I83A 4LYIA 4BHWA 4A4CA 5BT4A 4IR6A 4PCEA 4CUPA 5TB6A 5LJ1A 1WIMA 2M1RA 2MIQA 2D9EA 2KKYA 4GNDA 4LK9A 4Z0RA 3T7LA 5G0FA 5FE5A 2B0OE 2MNYA 3ZPV1 3O47A 1RMDA 5FFVA 1WE9A 3L1XA 5L98A 5DFDA 4Z93A 5D3NA 5EP7A 4O7CA 3HMFA 1WFKA 2LGVA 2KREA 1VD4A 3MDBC 4MENA 5H85A 5I80A 4O74A 4QR3A 3NG2A 2M3HA 4P5OB 5LJ0A 3EB6A 1WEWA 4HXPA 1X4IA 4IR3A 4A9NA 3LJUX 3ZTGA 2NAAA 2UZGA 5LCWB 3M7KA 5FG6A 4C9ZA 4YBSA 3Q2EA 5F25A 3VKHA 2XOYA 2JM3A 4FIPA 5DFCA 2VJEA 4XUAA 3PLWA 4QSRA 2I8NA 4YBTA 3UV5A 5DKHA 4TQNA 3O36A 5EWWA 5KTXA 3DWDA 4N4GA 5I1QA 4V3LC 2KYUA 5DYXA 3T9KA 3M62A 5ENJA 3RPGB 2DX8A 5DW2A 4QSPA 4TT2A 5CRMA 4BW1A 5L8TA 5D24A 3HCSA 5A5QA 2ZETC 5J0DA 4QR4A 5DYUA 2IDAA 2KE1A 3P1CA 2KWJA 2VPEA 3O33A 2MKEA 4YK0A 2D82A 4YYIA 4IR4A 3U5KA 2NXBA 5EPRA 5KHMA 2YSMA 3P1EA 4QSWA 4QR5A 4AKGA 1WEQA 3IHPA 5SVIB 3QZTA 1LDJB 4CURA 1ZS5A 5FFYA 2DVQA 5A81A 1FBVA 5A5SA 5D7XA 4PKLA 5ETDA 5ETBA 2RI7A 4HXLA 2PNXA 2R10A 2E6RA 3JVKA 1ZBDB 3HMEA 4O72A 1JM7A 4KV1A 5F5ZA 1JSPB 4AYCB 5D25A 2XOZA 4TZ2A 3FM8C 3QZVA 5D3JA 4Z6HA 5EA1A 5DBMA 1MBMA 4O78A 5B79A 4CFKA 5HM0A 5E9VA 5LUUA 3LQHA 4TYLA 2CKLA 2MUMA 5EWVA 4UI9B 5AITA 2LV9A 4UYDA 5F2PA 4CUQA 1X4UA 4TZ8A 5ENBA 2E7NA 5CQ3A 5I7XA 4A9HA 2DKWA 2FD4A 2YHOA 4A49A 4NQMA 4WZ3B 2LGLA 3AQAA 3RCWA 1DVPA 2ECIA 4AP4A 4C67A 2RFJA 2LGGA 4DONA 4MSXA 3PHDA 4NRBA 2CSYA 4N4IA 2L5UA 3DQVR 5FEYA 2LRIC 2K17A 4A0CD 2KGIA 4NUDA 5EYAF 4NR4A 4YH3A 5G04B 5LKXA 4Q0NA 3LJWA 4LDFA 4BW2A 5LJ2A 2LQ6A 5TDWA 5C7NA 1WUMA 4O62A 4HBYA 2YEMA 5KTUA 3UVYA 4OGIA 2VJFB 3AADA 4NYVA 2M85A 3RTRB 4A9FA 3M99A 4YADA 4OGEA 4NR9A 3UVWA 1WEOA 3FL2A 4CUTA 4LRGA 3N9QA 4OUFA 5CUDA 2CRRA 3PUQA 4F52B 5EPSA 4QSQA 2EJNA 2JMIA 4V3KC 5CGPA 3LDYA 1Z6UA 1MM2A 4TT6A 3KQIA 5II2A 3UV4A 3O37A 4XY8A 4A9KA 5TCMA 3KV6A 5D26A 5JI8A 4N4FA 5DKDA 3ERRA 3D1BA 1XWHA 5HQ7A 5FDZA 2YSJA 4QC3A 5D3LA 3FEHA 3L11A 2WP1A 2IQJA 5C87A 5HFRA 5HCLA 5D3SA 5F36A 4CLBA 5DKCA 2LXPC 5CTLA 2YW8A 4I7BA 2OWAA 3H7HA 4AUQB 4MEOA 2L0BA 4ZUXU 5EWHA 5K29A 2LAUA 4QEWA 5FE7A 3O35A 3VKGA 4HBXA 4ZC9A 3K2JA 4A9IA 4WZ2A 5FE2A 2EGMA 3D7CA 3JVLA 5K3QA 2D8UA 5D3HA 4UITA 2VJEB 5CS8A 1T1HA 2RO1A 4TKPB 1Z2QA 5KH3A 2VPGA 5H9MA 5C4QA 4Q6FA 2CKLB 2HYED 2VNFA 5E74A 4UP5A 2ECJA 4NUCA 5FE4A 3PURA 3RPGC 5D0CA 3DAIA 2KGGA 4QF3A 4HXNA 3NXBA 2MT5A 4Q0OA 5E9IA 5FE3A 3GL6A 4BJXA 4OGCA 5CQ6A 3G0LA 5I3LA 5LKZA 5CQ7A 2MD7B 4HXOA 5EGUA 5AD2A 4F3IA 2VPDA 3P5OA 2D8SA 5E9MA 4QNSA 4NR7A 3MXFA 2MA6A 4R7EA 3JVJA 5KU3A 4QY4A 4XY9A 2CSVA 3N9MA 4HBVA 4WZ0A 4J3IA 4J0SA 3U5PA 4PY6A 5BT5A 4KV4A 2JRJA 2ECVA 2YYRA 5EQ1A 4TU6A 5EK9A 3UV2A 3SOXA 5EI4A 5B76A 4AKNA 4LYWA 5H1VA 4UIWA 5LKUA 2VJFA 1ZKRA 2N9GA 4MR3A 4NR8A 5IGNA 4UYEA 2F6NA 5A5NA 5KTWA 1WEPA 3C6WA 3DPLR 3ZPVE 3QZSA 2I50A 3KDEC 4A4BA 4QSVA 2LDRA 5CQ8A 3UVXA 2XP0A
chains in the Genus database with same CATH topology
4NYWA 4IR5A 5F62A 3O70A 4YYGA 5E3GA 2KU3A 5FB1A 4MR4A 2L5EA 2CT2A 4GPJA 4O75A 3SOWA 4NQNA 5HJCA 4YYHA 2YURA 5DLXA 5I88A 4UIXA 5CFWA 2GRCA 4QB3A 4YY4A 2KWKA 5ENFA 2L80A 5D1LB 4GNEA 4OGJA 5C89A 4HBWA 4X2IA 1JOCA 4C66A 3V43A 3UVDA 3N9LA 4O7AA 5CU8A 2C2VS 4B86C 5DFBA 5DW1A 1HYIA 5FFWA 4A9JA 5CZGA 3ZYUA 5II1A 2YUCA 5E7DA 4L58A 3N9PA 3ZNIA 5JWMA 4PCIA 3N9OA 1E4UA 5CQ4A 4MR5A 2QIZA 3MB3A 3GV4A 5CPEA 1X0JA 1F68A 5EISA 4XUBA 2XEUA 3I2DA 4LADB 4LZRA 4BBQA 3I3JA 2RNYA 3U5OA 5E0RA 1V87A 2YT5A 3SVGA 2DATA 4NYXA 3SHBA 3HTKC 5DX4A 5FB0A 4CFLA 2R0SA 5L8UA 5FE1A 3MQMA 4NRAA 2EGPA 4ALGA 3U5LA 2K4DA 3SVFA 5DYCA 5ENGA 1N72A 2YHNA 4NR6A 4TU4A 2L84A 3O34A 1HYJA 5I86A 5FH7A 5FE9A 4S3OC 5DY7A 4NUEA 5IGLA 5DKAA 4QUUA 4ZQLA 5TDRA 5TBNA 5F63A 2OSSA 4N3WA 4QSTA 5ENCA 1U6GB 2PUYA 4UIZA 5FE8A 2YU4A 4YYDA 1VYXA 1WEMA 4QSSA 5EWCA 3O7AA 5FH8A 5B78A 2EODA 2HDPA 3HCUA 5I29A 4KCXA 5J3XA 4LZSA 2ECWA 4UP0A 4WHWA 2VPBA 2DVSA 5D3PA 4N4HA 5HEMA 5IIDA 2K1JA 4FK5A 3C5KA 2RS9B 3KV5A 4UIUA 5AMEA 2QJ0A 2YDWA 2LN0A 2K16A 4LLBA 5CUCA 3L1ZB 5HRWA 2RNXA 2JMJA 2Y1MA 5AIUA 5HLSA 1JM4B 2E3KA 1CHCA 4MVTA 3S92A 5FE0A 3MULA 5HRXA 2R0VA 3FKMX 5AD3A 4A9MA 4YYMA 5JG6A 5IGKA 2FUUA 3LRQA 4LC2A 2ECTA 4AVXA 5CQAA 4HXMA 1F62A 2Y43A 2L43A 5H1UA 5ENHA 4O71A 2M6MA 5D3RA 4YABA 4GNGA 3ONIA 4O77A 4FO9A 4QEUA 4QEVA 3DWYA 4PTBA 4LZ2A 3U5MA 5HFQA 1LDKC 2H60A 5A82A 4O7BA 5EM3A 3U5NA 4YYJA 4TT4A 4ZW1A 4E96A 5CUBA 3G0JA 4MR6A 4HXSA 3P1FA 2DVRA 5E9LA 4TTEA 5A83A 4O64A 4TS8A 5TRBA 4PPEA 5A85A 4AYCA 4CA1A 5E9KA 2KWNA 5HENA 2ECNA 5F61A 5I7YA 3UW9A 5KH7A 2ECGA 4LR6A 5KH9A 2MD8C 4YBMA 2FSAA 5B8DA 5KO4A 2KFTA 3M63A 4LJNA 4YAXA 1K2FA 2WP2A 5IBNA 3IU5A 2L75A 4PS5A 4NN2A 4WHUA 2MNZA 2YQMA 5G05B 4IC3A 3ZVYA 3HMHA 5C13A 4L7XA 4I7DA 5CQ5A 3MB4A 2F42A 2RSDA 2G45A 2KIZA 2YREA 1X4JA 2OUOA 4O70A 2R0YA 2KWOA 4MEPA 5H1TA 2EA6A 5L97A 4J0RA 5I40A 2DWWA 5DINA 4ALHA 5G4SA 1BORA 4FJCA 4Z1QA 3HCTA 5FG4A 1WEVA 5F3AA 2AN6A 5EV9A 3ZYQA 4MEQA 1E6IA 2MA5A 1WEEA 4NR5A 1MM3A 5EWDA 5A7CA 3IU6A 1Z60A 3VK6A 5CRZA 4CL9A 2LGKA 2YYNA 5A5RA 3S91A 4QYLA 4NRCA 4Y03A 2JMDA 4IC2A 5CQTA 2KTBB 3U5JA 5EU1A 4QUTA 5DYAA 4Z1SA 5AMFA 2C2LA 4XI1A 4S3OB 4QSXA 5LKTA 2OXQC 2DVVA 4UYFA 1WILA 4YATA 2H0DA 5L96A 5FERA 4YC9A 5BT3A 3MHHA 3GG3A 4QYDA 4BW4A 5COIA 3T6RA 5A5OA 5E3DA 5L99A 2FUIA 5B77A 4J1PA 4QC1A 4YYKA 1N87A 3LXJA 5CUAA 5F60A 5ENIA 5A5PA 5D3TA 2G43A 4R8PK 5G4RA 5C11A 2L85A 4A9LA 5C8GA 2E6SA 2LXHC 4X3GA 1WEUA 4HXRA 4UIYA 4WIVA 1WENA 5EPBA 1IYMA 2MJVB 5CUEA 2YQDA 3MUKA 4RVRA 4QF2A 4UIVA 5TABA 3Q2FA 5CP5A 3SOUA 1JM7B 4ZDTA 5ACYA 4UYGA 5EVAA 2QICA 4GB0A 4CCGX 5IG6A 3EB5A 3SVHA 5EICA 2YEKA 2YELA 4W4UA 4QSUA 5F1HA 2RNWA 2E7OA 5CUGA 4QZSA 5FBXA 4UYHA 4YY6A 1FP0A 5FG5A 4IORA 5FH6A 3LQIA 1WUGA 5ENEA 2Y1NA 4O7FA 5DLZA 4FLPA 5D1MB 3KNVA 2OO1A 4LKAA 5CY9A 3JVMA 4O76A 2VP7A 4NS5A 5LVQA 3ASLA 5HRVA 5HELA 4QBMA 5D1KB 4B7YC 2BAYA 2YQLA 3TLPA 4CUSA 5IGMA 1VFYA 2G4AA 4O7EA 5E9YA 5FE6A 2F6JA 4GNFA 4I7CA 4HXKA 2I7KA 4R2YA 5HQ6A 3ZVZB 1EQFA 4IOQA 4YH4A 4BW3A 3P1DA 4YYNA 5I89A 2G6QA 3MHSA 4WA6A 1G25A 3LQJA 2KR4A 1WGMA 5F1LA 5E73A 4A9OA 5C85A 2XB1A 2YW5A 4LYSA 4UYFB 4CUUA 1WESA 2CSZA 2H0DB 2LSPB 5HQ5A 4XYAA 5B75A 4A9EA 5LVRA 4NXJA 4Z6IA 4IOOA 5I83A 4LYIA 4BHWA 4A4CA 5BT4A 4IR6A 4PCEA 4CUPA 5TB6A 5LJ1A 1WIMA 2M1RA 2MIQA 2D9EA 4GNDA 4LK9A 3T7LA 5G0FA 5FE5A 2MNYA 3ZPV1 1RMDA 5FFVA 1WE9A 3L1XA 5L98A 5DFDA 4Z93A 5D3NA 5EP7A 4O7CA 3HMFA 1WFKA 2LGVA 2KREA 1VD4A 3N9NA 4MENA 5H85A 5I80A 4O74A 4QR3A 3NG2A 2M3HA 4P5OB 5LJ0A 3EB6A 1WEWA 4HXPA 1X4IA 4IR3A 4A9NA 3ZTGA 2NAAA 2UZGA 5LCWB 5FG6A 4C9ZA 4YBSA 3Q2EA 5F25A 4FIPA 5DFCA 2VJEA 4XUAA 4QSRA 2I8NA 4YBTA 3UV5A 5DKHA 4TQNA 3O36A 5EWWA 5KTXA 4N4GA 5I1QA 4V3LC 2KYUA 5DYXA 3M62A 5ENJA 3RPGB 2DX8A 5DW2A 4QSPA 4TT2A 5CRMA 4BW1A 5L8TA 5D24A 3HCSA 5A5QA 2ZETC 5J0DA 4QR4A 5DYUA 2IDAA 2KE1A 3P1CA 2KWJA 2VPEA 3O33A 4YK0A 2D82A 4YYIA 4IR4A 3U5KA 2NXBA 5EPRA 5KHMA 2YSMA 3P1EA 4QSWA 4QR5A 1WEQA 3IHPA 3QZTA 1LDJB 4CURA 1ZS5A 5FFYA 2DVQA 5A81A 1FBVA 5A5SA 5D7XA 4PKLA 5ETDA 5ETBA 2RI7A 4HXLA 2PNXA 2R10A 2E6RA 3JVKA 1ZBDB 3HMEA 4O72A 1JM7A 4KV1A 5F5ZA 1JSPB 4AYCB 5D25A 4TZ2A 3QZVA 5D3JA 4Z6HA 5EA1A 5DBMA 4O78A 5B79A 4CFKA 5HM0A 5E9VA 5LUUA 3LQHA 4TYLA 2CKLA 2MUMA 5EWVA 4UI9B 5AITA 2LV9A 4UYDA 5F2PA 4CUQA 1X4UA 4TZ8A 5ENBA 2E7NA 5CQ3A 5I7XA 4A9HA 2DKWA 2YHOA 4A49A 4NQMA 4WZ3B 2LGLA 3AQAA 3RCWA 1DVPA 2ECIA 4AP4A 4C67A 2RFJA 2LGGA 4DONA 4MSXA 3PHDA 4NRBA 2CSYA 4N4IA 2L5UA 3DQVR 5FEYA 2LRIC 2K17A 4A0CD 2KGIA 4NUDA 5EYAF 4NR4A 4YH3A 5G04B 5LKXA 4Q0NA 3LJWA 4LDFA 4BW2A 5LJ2A 2LQ6A 5TDWA 5C7NA 1WUMA 4HBYA 2YEMA 5KTUA 3UVYA 4OGIA 2VJFB 3AADA 4NYVA 2M85A 3RTRB 4A9FA 3M99A 4YADA 4NR9A 3UVWA 1WEOA 3FL2A 4CUTA 4LRGA 3N9QA 4OUFA 5CUDA 4F52B 3PUQA 5EPSA 4QSQA 2JMIA 4V3KC 5CGPA 1Z6UA 1MM2A 4TT6A 3KQIA 5II2A 3UV4A 3O37A 4XY8A 4A9KA 5TCMA 3KV6A 5D26A 5JI8A 4N4FA 5DKDA 1XWHA 5HQ7A 5FDZA 2YSJA 4QC3A 5D3LA 3L11A 2WP1A 5C87A 5HFRA 5HCLA 5D3SA 5F36A 4CLBA 5DKCA 2LXPC 5CTLA 2YW8A 4I7BA 4AUQB 4MEOA 2L0BA 4ZUXU 5EWHA 5K29A 4QEWA 5FE7A 3O35A 4HBXA 4ZC9A 3K2JA 4A9IA 4WZ2A 5FE2A 3D7CA 3JVLA 5D3HA 4UITA 2VJEB 5CS8A 1T1HA 2RO1A 4TKPB 1Z2QA 5KH3A 2VPGA 5H9MA 5C4QA 4Q6FA 2CKLB 2HYED 2VNFA 5E74A 4UP5A 2ECJA 4NUCA 5FE4A 3PURA 3RPGC 5D0CA 3DAIA 2KGGA 4QF3A 4HXNA 3NXBA 2MT5A 4Q0OA 5E9IA 5FE3A 3GL6A 4BJXA 5CQ6A 3G0LA 5I3LA 5LKZA 5CQ7A 2MD7B 4HXOA 5EGUA 5AD2A 4F3IA 2VPDA 3P5OA 2D8SA 5E9MA 4QNSA 4NR7A 3MXFA 2MA6A 4R7EA 3JVJA 5KU3A 4QY4A 4XY9A 3N9MA 4WZ0A 4HBVA 4J3IA 4J0SA 3U5PA 4PY6A 5BT5A 4KV4A 2JRJA 2ECVA 2YYRA 5EQ1A 4TU6A 5EK9A 3UV2A 3SOXA 5EI4A 5B76A 4AKNA 4LYWA 5H1VA 4UIWA 5LKUA 2VJFA 2N9GA 4MR3A 4NR8A 5IGNA 4UYEA 2F6NA 5A5NA 5KTWA 1WEPA 3C6WA 3DPLR 3ZPVE 3QZSA 2I50A 4A4BA 4QSVA 2LDRA 5CQ8A 3UVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYW A;  4IR5 A;  5F62 A;  3O70 A;  4YYG A;  5E3G A;  2KU3 A;  5FB1 A;  4MR4 A;  2L5E A;  2CT2 A;  4GPJ A;  4O75 A;  3SOW A;  4NQN A;  5HJC A;  4YYH A;  2YUR A;  5DLX A;  5I88 A;  4UIX A;  5CFW A;  2GRC A;  4QB3 A;  4YY4 A;  2KWK A;  5ENF A;  2L80 A;  5D1L B;  4GNE A;  4OGJ A;  5C89 A;  4HBW A;  4X2I A;  1JOC A;  4C66 A;  3V43 A;  3UVD A;  3N9L A;  4O7A A;  5CU8 A;  2C2V S;  4B86 C;  5DFB A;  5DW1 A;  1HYI A;  5FFW A;  4A9J A;  5CZG A;  3ZYU A;  5II1 A;  2YUC A;  5E7D A;  4L58 A;  3N9P A;  3ZNI A;  5JWM A;  4PCI A;  3N9O A;  1E4U A;  5CQ4 A;  4MR5 A;  2QIZ A;  3MB3 A;  3GV4 A;  5CPE A;  1X0J A;  1F68 A;  5EIS A;  4XUB A;  2XEU A;  3I2D A;  4LAD B;  4LZR A;  4BBQ A;  3I3J A;  2RNY A;  3U5O A;  5E0R A;  1V87 A;  2YT5 A;  3SVG A;  2DAT A;  4NYX A;  3SHB A;  3HTK C;  5DX4 A;  5FB0 A;  4CFL A;  2R0S A;  5L8U A;  5FE1 A;  3MQM A;  4NRA A;  2EGP A;  4ALG A;  3U5L A;  2K4D A;  3SVF A;  5DYC A;  5ENG A;  1N72 A;  2YHN A;  4NR6 A;  4TU4 A;  2L84 A;  3O34 A;  1HYJ A;  5I86 A;  5FH7 A;  5FE9 A;  4S3O C;  5DY7 A;  4NUE A;  5IGL A;  5DKA A;  4QUU A;  4ZQL A;  5TDR A;  5TBN A;  5F63 A;  2OSS A;  4N3W A;  4QST A;  5ENC A;  1U6G B;  2PUY A;  4UIZ A;  5FE8 A;  2YU4 A;  4YYD A;  1VYX A;  1WEM A;  4QSS A;  5EWC A;  3O7A A;  5FH8 A;  5B78 A;  2EOD A;  2HDP A;  3HCU A;  5I29 A;  4KCX A;  5J3X A;  4LZS A;  2ECW A;  4UP0 A;  4WHW A;  2VPB A;  2DVS A;  5D3P A;  4N4H A;  5HEM A;  5IID A;  2K1J A;  4FK5 A;  3C5K A;  2RS9 B;  3KV5 A;  4UIU A;  5AME A;  2QJ0 A;  2YDW A;  2LN0 A;  2K16 A;  4LLB A;  5CUC A;  3L1Z B;  5HRW A;  2RNX A;  2JMJ A;  2Y1M A;  5AIU A;  5HLS A;  1JM4 B;  2E3K A;  1CHC A;  4MVT A;  3S92 A;  5FE0 A;  3MUL A;  5HRX A;  2R0V A;  3FKM X;  5AD3 A;  4A9M A;  4YYM A;  5JG6 A;  5IGK A;  2FUU A;  3LRQ A;  4LC2 A;  2ECT A;  4AVX A;  5CQA A;  4HXM A;  1F62 A;  2Y43 A;  2L43 A;  5H1U A;  5ENH A;  4O71 A;  2M6M A;  5D3R A;  4YAB A;  4GNG A;  3ONI A;  4O77 A;  4FO9 A;  4QEU A;  4QEV A;  3DWY A;  4PTB A;  4LZ2 A;  3U5M A;  5HFQ A;  1LDK C;  2H60 A;  5A82 A;  4O7B A;  5EM3 A;  3U5N A;  4YYJ A;  4TT4 A;  4ZW1 A;  4E96 A;  5CUB A;  3G0J A;  4MR6 A;  4HXS A;  3P1F A;  2DVR A;  5E9L A;  4TTE A;  5A83 A;  4O64 A;  4TS8 A;  5TRB A;  4PPE A;  5A85 A;  4AYC A;  4CA1 A;  5E9K A;  2KWN A;  5HEN A;  2ECN A;  5F61 A;  5I7Y A;  3UW9 A;  5KH7 A;  2ECG A;  4LR6 A;  5KH9 A;  2MD8 C;  4YBM A;  2FSA A;  5B8D A;  5KO4 A;  2KFT A;  3M63 A;  4LJN A;  4YAX A;  1K2F A;  2WP2 A;  5IBN A;  3IU5 A;  2L75 A;  4PS5 A;  4NN2 A;  4WHU A;  2MNZ A;  2YQM A;  5G05 B;  4IC3 A;  3ZVY A;  3HMH A;  5C13 A;  4L7X A;  4I7D A;  5CQ5 A;  3MB4 A;  2F42 A;  2RSD A;  2G45 A;  2KIZ A;  2YRE A;  1X4J A;  2OUO A;  4O70 A;  2R0Y A;  2KWO A;  4MEP A;  5H1T A;  2EA6 A;  5L97 A;  4J0R A;  5I40 A;  2DWW A;  5DIN A;  4ALH A;  5G4S A;  1BOR A;  4FJC A;  4Z1Q A;  3HCT A;  5FG4 A;  1WEV A;  5F3A A;  2AN6 A;  5EV9 A;  3ZYQ A;  4MEQ A;  1E6I A;  2MA5 A;  1WEE A;  4NR5 A;  1MM3 A;  5EWD A;  5A7C A;  3IU6 A;  1Z60 A;  3VK6 A;  5CRZ A;  4CL9 A;  2LGK A;  2YYN A;  5A5R A;  3S91 A;  4QYL A;  4NRC A;  4Y03 A;  2JMD A;  4IC2 A;  5CQT A;  2KTB B;  3U5J A;  5EU1 A;  4QUT A;  5DYA A;  4Z1S A;  5AMF A;  2C2L A;  4XI1 A;  4S3O B;  4QSX A;  5LKT A;  2OXQ C;  2DVV A;  4UYF A;  1WIL A;  4YAT A;  2H0D A;  5L96 A;  5FER A;  4YC9 A;  5BT3 A;  3MHH A;  3GG3 A;  4QYD A;  4BW4 A;  5COI A;  3T6R A;  5A5O A;  5E3D A;  5L99 A;  2FUI A;  5B77 A;  4J1P A;  4QC1 A;  4YYK A;  1N87 A;  3LXJ A;  5CUA A;  5F60 A;  5ENI A;  5A5P A;  5D3T A;  2G43 A;  4R8P K;  5G4R A;  5C11 A;  2L85 A;  4A9L A;  5C8G A;  2E6S A;  2LXH C;  4X3G A;  1WEU A;  4HXR A;  4UIY A;  4WIV A;  1WEN A;  5EPB A;  1IYM A;  2MJV B;  5CUE A;  2YQD A;  3MUK A;  4RVR A;  4QF2 A;  4UIV A;  5TAB A;  3Q2F A;  5CP5 A;  3SOU A;  1JM7 B;  4ZDT A;  5ACY A;  4UYG A;  5EVA A;  2QIC A;  4GB0 A;  4CCG X;  5IG6 A;  3EB5 A;  3SVH A;  5EIC A;  2YEK A;  2YEL A;  4W4U A;  4QSU A;  5F1H A;  2RNW A;  2E7O A;  5CUG A;  4QZS A;  5FBX A;  4UYH A;  4YY6 A;  1FP0 A;  5FG5 A;  4IOR A;  5FH6 A;  3LQI A;  1WUG A;  5ENE A;  2Y1N A;  4O7F A;  5DLZ A;  4FLP A;  5D1M B;  3KNV A;  2OO1 A;  4LKA A;  5CY9 A;  3JVM A;  4O76 A;  2VP7 A;  4NS5 A;  5LVQ A;  3ASL A;  5HRV A;  5HEL A;  4QBM A;  5D1K B;  4B7Y C;  2BAY A;  2YQL A;  3TLP A;  4CUS A;  5IGM A;  1VFY A;  2G4A A;  4O7E A;  5E9Y A;  5FE6 A;  2F6J A;  4GNF A;  4I7C A;  4HXK A;  2I7K A;  4R2Y A;  5HQ6 A;  3ZVZ B;  1EQF A;  4IOQ A;  4YH4 A;  4BW3 A;  3P1D A;  4YYN A;  5I89 A;  2G6Q A;  3MHS A;  4WA6 A;  1G25 A;  3LQJ A;  2KR4 A;  1WGM A;  5F1L A;  5E73 A;  4A9O A;  5C85 A;  2XB1 A;  2YW5 A;  4LYS A;  4UYF B;  4CUU A;  1WES A;  2CSZ A;  2H0D B;  2LSP B;  5HQ5 A;  4XYA A;  5B75 A;  4A9E A;  5LVR A;  4NXJ A;  4Z6I A;  4IOO A;  5I83 A;  4LYI A;  4BHW A;  4A4C A;  5BT4 A;  4IR6 A;  4PCE A;  4CUP A;  5TB6 A;  5LJ1 A;  1WIM A;  2M1R A;  2MIQ A;  2D9E A;  4GND A;  4LK9 A;  3T7L A;  5G0F A;  5FE5 A;  2MNY A;  3ZPV 1;  1RMD A;  5FFV A;  1WE9 A;  3L1X A;  5L98 A;  5DFD A;  4Z93 A;  5D3N A;  5EP7 A;  4O7C A;  3HMF A;  1WFK A;  2LGV A;  2KRE A;  1VD4 A;  3N9N A;  4MEN A;  5H85 A;  5I80 A;  4O74 A;  4QR3 A;  3NG2 A;  2M3H A;  4P5O B;  5LJ0 A;  3EB6 A;  1WEW A;  4HXP A;  1X4I A;  4IR3 A;  4A9N A;  3ZTG A;  2NAA A;  2UZG A;  5LCW B;  5FG6 A;  4C9Z A;  4YBS A;  3Q2E A;  5F25 A;  4FIP A;  5DFC A;  2VJE A;  4XUA A;  4QSR A;  2I8N A;  4YBT A;  3UV5 A;  5DKH A;  4TQN A;  3O36 A;  5EWW A;  5KTX A;  4N4G A;  5I1Q A;  4V3L C;  2KYU A;  5DYX A;  3M62 A;  5ENJ A;  3RPG B;  2DX8 A;  5DW2 A;  4QSP A;  4TT2 A;  5CRM A;  4BW1 A;  5L8T A;  5D24 A;  3HCS A;  5A5Q A;  2ZET C;  5J0D A;  4QR4 A;  5DYU A;  2IDA A;  2KE1 A;  3P1C A;  2KWJ A;  2VPE A;  3O33 A;  4YK0 A;  2D82 A;  4YYI A;  4IR4 A;  3U5K A;  2NXB A;  5EPR A;  5KHM A;  2YSM A;  3P1E A;  4QSW A;  4QR5 A;  1WEQ A;  3IHP A;  3QZT A;  1LDJ B;  4CUR A;  1ZS5 A;  5FFY A;  2DVQ A;  5A81 A;  1FBV A;  5A5S A;  5D7X A;  4PKL A;  5ETD A;  5ETB A;  2RI7 A;  4HXL A;  2PNX A;  2R10 A;  2E6R A;  3JVK A;  1ZBD B;  3HME A;  4O72 A;  1JM7 A;  4KV1 A;  5F5Z A;  1JSP B;  4AYC B;  5D25 A;  4TZ2 A;  3QZV A;  5D3J A;  4Z6H A;  5EA1 A;  5DBM A;  4O78 A;  5B79 A;  4CFK A;  5HM0 A;  5E9V A;  5LUU A;  3LQH A;  4TYL A;  2CKL A;  2MUM A;  5EWV A;  4UI9 B;  5AIT A;  2LV9 A;  4UYD A;  5F2P A;  4CUQ A;  1X4U A;  4TZ8 A;  5ENB A;  2E7N A;  5CQ3 A;  5I7X A;  4A9H A;  2DKW A;  2YHO A;  4A49 A;  4NQM A;  4WZ3 B;  2LGL A;  3AQA A;  3RCW A;  1DVP A;  2ECI A;  4AP4 A;  4C67 A;  2RFJ A;  2LGG A;  4DON A;  4MSX A;  3PHD A;  4NRB A;  2CSY A;  4N4I A;  2L5U A;  3DQV R;  5FEY A;  2LRI C;  2K17 A;  4A0C D;  2KGI A;  4NUD A;  5EYA F;  4NR4 A;  4YH3 A;  5G04 B;  5LKX A;  4Q0N A;  3LJW A;  4LDF A;  4BW2 A;  5LJ2 A;  2LQ6 A;  5TDW A;  5C7N A;  1WUM A;  4HBY A;  2YEM A;  5KTU A;  3UVY A;  4OGI A;  2VJF B;  3AAD A;  4NYV A;  2M85 A;  3RTR B;  4A9F A;  3M99 A;  4YAD A;  4NR9 A;  3UVW A;  1WEO A;  3FL2 A;  4CUT A;  4LRG A;  3N9Q A;  4OUF A;  5CUD A;  4F52 B;  3PUQ A;  5EPS A;  4QSQ A;  2JMI A;  4V3K C;  5CGP A;  1Z6U A;  1MM2 A;  4TT6 A;  3KQI A;  5II2 A;  3UV4 A;  3O37 A;  4XY8 A;  4A9K A;  5TCM A;  3KV6 A;  5D26 A;  5JI8 A;  4N4F A;  5DKD A;  1XWH A;  5HQ7 A;  5FDZ A;  2YSJ A;  4QC3 A;  5D3L A;  3L11 A;  2WP1 A;  5C87 A;  5HFR A;  5HCL A;  5D3S A;  5F36 A;  4CLB A;  5DKC A;  2LXP C;  5CTL A;  2YW8 A;  4I7B A;  4AUQ B;  4MEO A;  2L0B A;  4ZUX U;  5EWH A;  5K29 A;  4QEW A;  5FE7 A;  3O35 A;  4HBX A;  4ZC9 A;  3K2J A;  4A9I A;  4WZ2 A;  5FE2 A;  3D7C A;  3JVL A;  5D3H A;  4UIT A;  2VJE B;  5CS8 A;  1T1H A;  2RO1 A;  4TKP B;  1Z2Q A;  5KH3 A;  2VPG A;  5H9M A;  5C4Q A;  4Q6F A;  2CKL B;  2HYE D;  2VNF A;  5E74 A;  4UP5 A;  2ECJ A;  4NUC A;  5FE4 A;  3PUR A;  3RPG C;  5D0C A;  3DAI A;  2KGG A;  4QF3 A;  4HXN A;  3NXB A;  2MT5 A;  4Q0O A;  5E9I A;  5FE3 A;  3GL6 A;  4BJX A;  5CQ6 A;  3G0L A;  5I3L A;  5LKZ A;  5CQ7 A;  2MD7 B;  4HXO A;  5EGU A;  5AD2 A;  4F3I A;  2VPD A;  3P5O A;  2D8S A;  5E9M A;  4QNS A;  4NR7 A;  3MXF A;  2MA6 A;  4R7E A;  3JVJ A;  5KU3 A;  4QY4 A;  4XY9 A;  3N9M A;  4WZ0 A;  4HBV A;  4J3I A;  4J0S A;  3U5P A;  4PY6 A;  5BT5 A;  4KV4 A;  2JRJ A;  2ECV A;  2YYR A;  5EQ1 A;  4TU6 A;  5EK9 A;  3UV2 A;  3SOX A;  5EI4 A;  5B76 A;  4AKN A;  4LYW A;  5H1V A;  4UIW A;  5LKU A;  2VJF A;  2N9G A;  4MR3 A;  4NR8 A;  5IGN A;  4UYE A;  2F6N A;  5A5N A;  5KTW A;  1WEP A;  3C6W A;  3DPL R;  3ZPV E;  3QZS A;  2I50 A;  4A4B A;  4QSV A;  2LDR A;  5CQ8 A;  3UVX A; 
#chains in the Genus database with same CATH topology
 4NYW A;  4IR5 A;  5F62 A;  3O70 A;  4YYG A;  5E3G A;  4Z0O A;  2KU3 A;  5FB1 A;  4MR4 A;  2L5E A;  2CT2 A;  4GPJ A;  4O75 A;  3SOW A;  4NQN A;  5HJC A;  4YYH A;  2YUR A;  5DLX A;  5I88 A;  4UIX A;  5CFW A;  2DJA A;  2GRC A;  4QB3 A;  4YY4 A;  2KWK A;  5ENF A;  2L80 A;  5D1L B;  4GNE A;  4OGJ A;  5C89 A;  4HBW A;  4X2I A;  1JOC A;  4C66 A;  3V43 A;  3UVD A;  3N9L A;  4O7A A;  5CU8 A;  2C2V S;  4B86 C;  5DFB A;  4QQ4 A;  5DW1 A;  1HYI A;  5FFW A;  4A9J A;  5CZG A;  3ZYU A;  5II1 A;  2YUC A;  5E7D A;  5SVI A;  4L58 A;  5SVX A;  3N9P A;  3ZNI A;  5JWM A;  4PCI A;  3N9O A;  1E4U A;  5CQ4 A;  4MR5 A;  2QIZ A;  3MB3 A;  3GV4 A;  5CPE A;  1X0J A;  1F68 A;  5EIS A;  4XUB A;  4AKH A;  2XEU A;  3I2D A;  4LAD B;  4LZR A;  4BBQ A;  3I3J A;  2RNY A;  3U5O A;  5E0R A;  1V87 A;  2YT5 A;  3SVG A;  2DAT A;  4NYX A;  3SHB A;  3HTK C;  5DX4 A;  5FB0 A;  4H9D A;  4CFL A;  2R0S A;  5L8U A;  5FE1 A;  3MQM A;  4NRA A;  2EGP A;  4ALG A;  3U5L A;  2K4D A;  3SVF A;  5DYC A;  5ENG A;  1N72 A;  2YHN A;  4NR6 A;  4TU4 A;  2L84 A;  3JUE A;  3O34 A;  1HYJ A;  5I86 A;  5FH7 A;  5FE9 A;  4S3O C;  5DY7 A;  4NUE A;  5IGL A;  5DKA A;  4QUU A;  4ZQL A;  5TDR A;  5TBN A;  5F63 A;  2OSS A;  4N3W A;  4QST A;  5ENC A;  1U6G B;  2PUY A;  4UIZ A;  5FE8 A;  2YU4 A;  4YYD A;  1VYX A;  1WEM A;  3D1D A;  4QSS A;  5EWC A;  3O7A A;  2CRW A;  5FH8 A;  5B78 A;  2EOD A;  2HDP A;  3HCU A;  5I29 A;  4KCX A;  3LVR E;  5J3X A;  4LZS A;  2ECW A;  4UP0 A;  4WHW A;  2VPB A;  2DVS A;  5D3P A;  4N4H A;  5HEM A;  5IID A;  2K1J A;  4FK5 A;  3C5K A;  2RS9 B;  3KV5 A;  4UIU A;  5AME A;  2QJ0 A;  2YDW A;  2LN0 A;  2K16 A;  4LLB A;  5CUC A;  3L1Z B;  5HRW A;  2RNX A;  2JMJ A;  2Y1M A;  5AIU A;  5HLS A;  1JM4 B;  2E3K A;  1CHC A;  2P57 A;  1PUO A;  4MVT A;  3S92 A;  5FE0 A;  2CON A;  3MUL A;  5HRX A;  2R0V A;  3FKM X;  5AD3 A;  4AKI A;  4A9M A;  4YYM A;  5JG6 A;  5IGK A;  2FFW A;  2FUU A;  3LRQ A;  4LC2 A;  2ECT A;  3SUB A;  5CQA A;  4AVX A;  4HXM A;  1F62 A;  2Y43 A;  2L43 A;  5H1U A;  5ENH A;  4O71 A;  2M6M A;  5D3R A;  4YAB A;  4GNG A;  3ONI A;  3DDT A;  4O77 A;  4FO9 A;  4QEU A;  4QEV A;  1DCQ A;  3DWY A;  4PTB A;  4LZ2 A;  3U5M A;  5HFQ A;  1LDK C;  2H60 A;  5A82 A;  4O7B A;  5EM3 A;  3U5N A;  4YYJ A;  4TT4 A;  2RR4 A;  4ZW1 A;  4E96 A;  5CUB A;  3G0J A;  4MR6 A;  4HXS A;  3P1F A;  2DVR A;  2E61 A;  5E9L A;  4TTE A;  5A83 A;  4O64 A;  4TS8 A;  5TRB A;  4PPE A;  5A85 A;  4AYC A;  4CA1 A;  5E9K A;  2KWN A;  5HEN A;  2ECN A;  5F61 A;  5I7Y A;  3UW9 A;  5KH7 A;  2ECG A;  4LR6 A;  3N9N A;  5KH9 A;  2XOC A;  2MD8 C;  4YBM A;  2FSA A;  5B8D A;  5KO4 A;  2KFT A;  3LVQ E;  3M63 A;  4LJN A;  4YAX A;  1K2F A;  2WP2 A;  5IBN A;  3IU5 A;  2L75 A;  3FAO A;  4PS5 A;  4NN2 A;  4WHU A;  2MNZ A;  2YQM A;  5G05 B;  4IC3 A;  3ZVY A;  3HMH A;  5C13 A;  4L7X A;  4I7D A;  5CQ5 A;  3MB4 A;  2F42 A;  2RSD A;  2G45 A;  2KIZ A;  2YRE A;  1X4J A;  2OUO A;  4O70 A;  2R0Y A;  2KWO A;  4MEP A;  5H1T A;  2EA6 A;  5L97 A;  4J0R A;  5I40 A;  2DWW A;  5DIN A;  4ALH A;  5G4S A;  1BOR A;  4FJC A;  4Z1Q A;  3HCT A;  5FG4 A;  1WEV A;  5F3A A;  2AN6 A;  5EV9 A;  3ZYQ A;  4MEQ A;  1E6I A;  2MA5 A;  1WEE A;  4NR5 A;  1MM3 A;  5EWD A;  5A7C A;  3IU6 A;  1Z60 A;  3VK6 A;  5CRZ A;  4CL9 A;  3FAN A;  2EXU A;  2KKX A;  2LGK A;  2YYN A;  5A5R A;  3S91 A;  4QYL A;  4NRC A;  4Y03 A;  2JMD A;  4IC2 A;  4AI6 A;  5CQT A;  2KTB B;  3U5J A;  5EU1 A;  4QUT A;  5DYA A;  4Z1S A;  5AMF A;  2C2L A;  4XI1 A;  4S3O B;  4QSX A;  5LKT A;  2OXQ C;  2DVV A;  4UYF A;  1WIL A;  4YAT A;  2H0D A;  5L96 A;  5FER A;  2DSM A;  4YC9 A;  5BT3 A;  3MHH A;  3GG3 A;  4QYD A;  4BW4 A;  5COI A;  3T6R A;  2YVR A;  5A5O A;  5E3D A;  5L99 A;  4F1P A;  2FUI A;  5B77 A;  4J1P A;  4QC1 A;  4YYK A;  1N87 A;  3LXJ A;  5CUA A;  5F60 A;  5ENI A;  5A5P A;  5D3T A;  3E2D A;  2G43 A;  4R8P K;  5G4R A;  5C11 A;  2L85 A;  4A9L A;  5C8G A;  2E6S A;  2JUN A;  2LXH C;  2M13 A;  4X3G A;  1WEU A;  4HXR A;  4UIY A;  4WIV A;  1WEN A;  5EPB A;  1IYM A;  2MJV B;  5CUE A;  2YQD A;  3MUK A;  4RVR A;  4QF2 A;  4UIV A;  5TAB A;  3Q2F A;  5CP5 A;  3SOU A;  3Q1D A;  1JM7 B;  4ZDT A;  5ACY A;  4UYG A;  5EVA A;  2QIC A;  4GB0 A;  4CCG X;  5IG6 A;  3EB5 A;  3SVH A;  5EIC A;  2YEK A;  2YEL A;  4W4U A;  4QSU A;  5F1H A;  2L7P A;  2RNW A;  2E7O A;  5CUG A;  4QZS A;  5FBX A;  4UYH A;  4YY6 A;  1FP0 A;  3FJU B;  5FG5 A;  4IOR A;  5FH6 A;  3LQI A;  1WUG A;  5ENE A;  2Y1N A;  4O7F A;  5DLZ A;  4FLP A;  5D1M B;  3KNV A;  2OO1 A;  4LKA A;  5CY9 A;  3JVM A;  4O76 A;  2VP7 A;  4NS5 A;  5LVQ A;  3ASL A;  5HRV A;  5HEL A;  4QBM A;  5D1K B;  4B7Y C;  2BAY A;  2YQL A;  3TLP A;  4CUS A;  5IGM A;  1VFY A;  2G4A A;  4O7E A;  5E9Y A;  5FE6 A;  2F6J A;  4GNF A;  4I7C A;  4HXK A;  2I7K A;  4R2Y A;  5HQ6 A;  3ZVZ B;  1EQF A;  4IOQ A;  4YH4 A;  4BW3 A;  3P1D A;  4YYN A;  5I89 A;  2G6Q A;  3MHS A;  4WA6 A;  1G25 A;  3LQJ A;  2KR4 A;  1WGM A;  5SVY A;  5F1L A;  5E73 A;  4A9O A;  5C85 A;  2XB1 A;  2YW5 A;  4LYS A;  4UYF B;  4CUU A;  1WES A;  2CSZ A;  2H0D B;  2LSP B;  5HQ5 A;  4XYA A;  5B75 A;  4A9E A;  5LVR A;  4NXJ A;  4Z6I A;  4IOO A;  5I83 A;  4LYI A;  4BHW A;  4A4C A;  5BT4 A;  4IR6 A;  4PCE A;  4CUP A;  5TB6 A;  5LJ1 A;  1WIM A;  2M1R A;  2MIQ A;  2D9E A;  2KKY A;  4GND A;  4LK9 A;  4Z0R A;  3T7L A;  5G0F A;  5FE5 A;  2B0O E;  2MNY A;  3ZPV 1;  3O47 A;  1RMD A;  5FFV A;  1WE9 A;  3L1X A;  5L98 A;  5DFD A;  4Z93 A;  5D3N A;  5EP7 A;  4O7C A;  3HMF A;  1WFK A;  2LGV A;  2KRE A;  1VD4 A;  3MDB C;  4MEN A;  5H85 A;  5I80 A;  4O74 A;  4QR3 A;  3NG2 A;  2M3H A;  4P5O B;  5LJ0 A;  3EB6 A;  1WEW A;  4HXP A;  1X4I A;  4IR3 A;  4A9N A;  3LJU X;  3ZTG A;  2NAA A;  2UZG A;  5LCW B;  3M7K A;  5FG6 A;  4C9Z A;  4YBS A;  3Q2E A;  5F25 A;  3VKH A;  2XOY A;  2JM3 A;  4FIP A;  5DFC A;  2VJE A;  4XUA A;  3PLW A;  4QSR A;  2I8N A;  4YBT A;  3UV5 A;  5DKH A;  4TQN A;  3O36 A;  5EWW A;  5KTX A;  3DWD A;  4N4G A;  5I1Q A;  4V3L C;  2KYU A;  5DYX A;  3T9K A;  3M62 A;  5ENJ A;  3RPG B;  2DX8 A;  5DW2 A;  4QSP A;  4TT2 A;  5CRM A;  4BW1 A;  5L8T A;  5D24 A;  3HCS A;  5A5Q A;  2ZET C;  5J0D A;  4QR4 A;  5DYU A;  2IDA A;  2KE1 A;  3P1C A;  2KWJ A;  2VPE A;  3O33 A;  2MKE A;  4YK0 A;  2D82 A;  4YYI A;  4IR4 A;  3U5K A;  2NXB A;  5EPR A;  5KHM A;  2YSM A;  3P1E A;  4QSW A;  4QR5 A;  4AKG A;  1WEQ A;  3IHP A;  5SVI B;  3QZT A;  1LDJ B;  4CUR A;  1ZS5 A;  5FFY A;  2DVQ A;  5A81 A;  1FBV A;  5A5S A;  5D7X A;  4PKL A;  5ETD A;  5ETB A;  2RI7 A;  4HXL A;  2PNX A;  2R10 A;  2E6R A;  3JVK A;  1ZBD B;  3HME A;  4O72 A;  1JM7 A;  4KV1 A;  5F5Z A;  1JSP B;  4AYC B;  5D25 A;  2XOZ A;  4TZ2 A;  3FM8 C;  3QZV A;  5D3J A;  4Z6H A;  5EA1 A;  5DBM A;  1MBM A;  4O78 A;  5B79 A;  4CFK A;  5HM0 A;  5E9V A;  5LUU A;  3LQH A;  4TYL A;  2CKL A;  2MUM A;  5EWV A;  4UI9 B;  5AIT A;  2LV9 A;  4UYD A;  5F2P A;  4CUQ A;  1X4U A;  4TZ8 A;  5ENB A;  2E7N A;  5CQ3 A;  5I7X A;  4A9H A;  2DKW A;  2FD4 A;  2YHO A;  4A49 A;  4NQM A;  4WZ3 B;  2LGL A;  3AQA A;  3RCW A;  1DVP A;  2ECI A;  4AP4 A;  4C67 A;  2RFJ A;  2LGG A;  4DON A;  4MSX A;  3PHD A;  4NRB A;  2CSY A;  4N4I A;  2L5U A;  3DQV R;  5FEY A;  2LRI C;  2K17 A;  4A0C D;  2KGI A;  4NUD A;  5EYA F;  4NR4 A;  4YH3 A;  5G04 B;  5LKX A;  4Q0N A;  3LJW A;  4LDF A;  4BW2 A;  5LJ2 A;  2LQ6 A;  5TDW A;  5C7N A;  1WUM A;  4O62 A;  4HBY A;  2YEM A;  5KTU A;  3UVY A;  4OGI A;  2VJF B;  3AAD A;  4NYV A;  2M85 A;  3RTR B;  4A9F A;  3M99 A;  4YAD A;  4OGE A;  4NR9 A;  3UVW A;  1WEO A;  3FL2 A;  4CUT A;  4LRG A;  3N9Q A;  4OUF A;  5CUD A;  2CRR A;  3PUQ A;  4F52 B;  5EPS A;  4QSQ A;  2EJN A;  2JMI A;  4V3K C;  5CGP A;  3LDY A;  1Z6U A;  1MM2 A;  4TT6 A;  3KQI A;  5II2 A;  3UV4 A;  3O37 A;  4XY8 A;  4A9K A;  5TCM A;  3KV6 A;  5D26 A;  5JI8 A;  4N4F A;  5DKD A;  3ERR A;  3D1B A;  1XWH A;  5HQ7 A;  5FDZ A;  2YSJ A;  4QC3 A;  5D3L A;  3FEH A;  3L11 A;  2WP1 A;  2IQJ A;  5C87 A;  5HFR A;  5HCL A;  5D3S A;  5F36 A;  4CLB A;  5DKC A;  2LXP C;  5CTL A;  2YW8 A;  4I7B A;  2OWA A;  3H7H A;  4AUQ B;  4MEO A;  2L0B A;  4ZUX U;  5EWH A;  5K29 A;  2LAU A;  4QEW A;  5FE7 A;  3O35 A;  3VKG A;  4HBX A;  4ZC9 A;  3K2J A;  4A9I A;  4WZ2 A;  5FE2 A;  2EGM A;  3D7C A;  3JVL A;  5K3Q A;  2D8U A;  5D3H A;  4UIT A;  2VJE B;  5CS8 A;  1T1H A;  2RO1 A;  4TKP B;  1Z2Q A;  5KH3 A;  2VPG A;  5H9M A;  5C4Q A;  4Q6F A;  2CKL B;  2HYE D;  2VNF A;  5E74 A;  4UP5 A;  2ECJ A;  4NUC A;  5FE4 A;  3PUR A;  3RPG C;  5D0C A;  3DAI A;  2KGG A;  4QF3 A;  4HXN A;  3NXB A;  2MT5 A;  4Q0O A;  5E9I A;  5FE3 A;  3GL6 A;  4BJX A;  4OGC A;  5CQ6 A;  3G0L A;  5I3L A;  5LKZ A;  5CQ7 A;  2MD7 B;  4HXO A;  5EGU A;  5AD2 A;  4F3I A;  2VPD A;  3P5O A;  2D8S A;  5E9M A;  4QNS A;  4NR7 A;  3MXF A;  2MA6 A;  4R7E A;  3JVJ A;  5KU3 A;  4QY4 A;  4XY9 A;  2CSV A;  3N9M A;  4HBV A;  4WZ0 A;  4J3I A;  4J0S A;  3U5P A;  4PY6 A;  5BT5 A;  4KV4 A;  2JRJ A;  2ECV A;  2YYR A;  5EQ1 A;  4TU6 A;  5EK9 A;  3UV2 A;  3SOX A;  5EI4 A;  5B76 A;  4AKN A;  4LYW A;  5H1V A;  4UIW A;  5LKU A;  2VJF A;  1ZKR A;  2N9G A;  4MR3 A;  4NR8 A;  5IGN A;  4UYE A;  2F6N A;  5A5N A;  5KTW A;  1WEP A;  3C6W A;  3DPL R;  3ZPV E;  3QZS A;  2I50 A;  3KDE C;  4A4B A;  4QSV A;  2LDR A;  5CQ8 A;  3UVX A;  2XP0 A; 
#chains in the Genus database with same CATH homology
 4NYW A;  4IR5 A;  5F62 A;  3O70 A;  4YYG A;  5E3G A;  2KU3 A;  5FB1 A;  4MR4 A;  2L5E A;  2CT2 A;  4GPJ A;  4O75 A;  3SOW A;  4NQN A;  5HJC A;  4YYH A;  2YUR A;  5DLX A;  5I88 A;  4UIX A;  5CFW A;  2GRC A;  4QB3 A;  4YY4 A;  2KWK A;  5ENF A;  2L80 A;  5D1L B;  4GNE A;  4OGJ A;  5C89 A;  4HBW A;  4X2I A;  1JOC A;  4C66 A;  3V43 A;  3UVD A;  3N9L A;  4O7A A;  5CU8 A;  2C2V S;  4B86 C;  5DFB A;  5DW1 A;  1HYI A;  5FFW A;  4A9J A;  5CZG A;  3ZYU A;  5II1 A;  2YUC A;  5E7D A;  4L58 A;  3N9P A;  3ZNI A;  5JWM A;  4PCI A;  3N9O A;  1E4U A;  5CQ4 A;  4MR5 A;  2QIZ A;  3MB3 A;  3GV4 A;  5CPE A;  1X0J A;  1F68 A;  5EIS A;  4XUB A;  2XEU A;  3I2D A;  4LAD B;  4LZR A;  4BBQ A;  3I3J A;  2RNY A;  3U5O A;  5E0R A;  1V87 A;  2YT5 A;  3SVG A;  2DAT A;  4NYX A;  3SHB A;  3HTK C;  5DX4 A;  5FB0 A;  4CFL A;  2R0S A;  5L8U A;  5FE1 A;  3MQM A;  4NRA A;  2EGP A;  4ALG A;  3U5L A;  2K4D A;  3SVF A;  5DYC A;  5ENG A;  1N72 A;  2YHN A;  4NR6 A;  4TU4 A;  2L84 A;  3O34 A;  1HYJ A;  5I86 A;  5FH7 A;  5FE9 A;  4S3O C;  5DY7 A;  4NUE A;  5IGL A;  5DKA A;  4QUU A;  4ZQL A;  5TDR A;  5TBN A;  5F63 A;  2OSS A;  4N3W A;  4QST A;  5ENC A;  1U6G B;  2PUY A;  4UIZ A;  5FE8 A;  2YU4 A;  4YYD A;  1VYX A;  1WEM A;  4QSS A;  5EWC A;  3O7A A;  5FH8 A;  5B78 A;  2EOD A;  2HDP A;  3HCU A;  5I29 A;  4KCX A;  5J3X A;  4LZS A;  2ECW A;  4UP0 A;  4WHW A;  2VPB A;  2DVS A;  5D3P A;  4N4H A;  5HEM A;  5IID A;  2K1J A;  4FK5 A;  3C5K A;  2RS9 B;  3KV5 A;  4UIU A;  5AME A;  2QJ0 A;  2YDW A;  2LN0 A;  2K16 A;  4LLB A;  5CUC A;  3L1Z B;  5HRW A;  2RNX A;  2JMJ A;  2Y1M A;  5AIU A;  5HLS A;  1JM4 B;  2E3K A;  1CHC A;  4MVT A;  3S92 A;  5FE0 A;  3MUL A;  5HRX A;  2R0V A;  3FKM X;  5AD3 A;  4A9M A;  4YYM A;  5JG6 A;  5IGK A;  2FUU A;  3LRQ A;  4LC2 A;  2ECT A;  4AVX A;  5CQA A;  4HXM A;  1F62 A;  2Y43 A;  2L43 A;  5H1U A;  5ENH A;  4O71 A;  2M6M A;  5D3R A;  4YAB A;  4GNG A;  3ONI A;  4O77 A;  4FO9 A;  4QEU A;  4QEV A;  3DWY A;  4PTB A;  4LZ2 A;  3U5M A;  5HFQ A;  1LDK C;  2H60 A;  5A82 A;  4O7B A;  5EM3 A;  3U5N A;  4YYJ A;  4TT4 A;  4ZW1 A;  4E96 A;  5CUB A;  3G0J A;  4MR6 A;  4HXS A;  3P1F A;  2DVR A;  5E9L A;  4TTE A;  5A83 A;  4O64 A;  4TS8 A;  5TRB A;  4PPE A;  5A85 A;  4AYC A;  4CA1 A;  5E9K A;  2KWN A;  5HEN A;  2ECN A;  5F61 A;  5I7Y A;  3UW9 A;  5KH7 A;  2ECG A;  4LR6 A;  5KH9 A;  2MD8 C;  4YBM A;  2FSA A;  5B8D A;  5KO4 A;  2KFT A;  3M63 A;  4LJN A;  4YAX A;  1K2F A;  2WP2 A;  5IBN A;  3IU5 A;  2L75 A;  4PS5 A;  4NN2 A;  4WHU A;  2MNZ A;  2YQM A;  5G05 B;  4IC3 A;  3ZVY A;  3HMH A;  5C13 A;  4L7X A;  4I7D A;  5CQ5 A;  3MB4 A;  2F42 A;  2RSD A;  2G45 A;  2KIZ A;  2YRE A;  1X4J A;  2OUO A;  4O70 A;  2R0Y A;  2KWO A;  4MEP A;  5H1T A;  2EA6 A;  5L97 A;  4J0R A;  5I40 A;  2DWW A;  5DIN A;  4ALH A;  5G4S A;  1BOR A;  4FJC A;  4Z1Q A;  3HCT A;  5FG4 A;  1WEV A;  5F3A A;  2AN6 A;  5EV9 A;  3ZYQ A;  4MEQ A;  1E6I A;  2MA5 A;  1WEE A;  4NR5 A;  1MM3 A;  5EWD A;  5A7C A;  3IU6 A;  1Z60 A;  3VK6 A;  5CRZ A;  4CL9 A;  2LGK A;  2YYN A;  5A5R A;  3S91 A;  4QYL A;  4NRC A;  4Y03 A;  2JMD A;  4IC2 A;  5CQT A;  2KTB B;  3U5J A;  5EU1 A;  4QUT A;  5DYA A;  4Z1S A;  5AMF A;  2C2L A;  4XI1 A;  4S3O B;  4QSX A;  5LKT A;  2OXQ C;  2DVV A;  4UYF A;  1WIL A;  4YAT A;  2H0D A;  5L96 A;  5FER A;  4YC9 A;  5BT3 A;  3MHH A;  3GG3 A;  4QYD A;  4BW4 A;  5COI A;  3T6R A;  5A5O A;  5E3D A;  5L99 A;  2FUI A;  5B77 A;  4J1P A;  4QC1 A;  4YYK A;  1N87 A;  3LXJ A;  5CUA A;  5F60 A;  5ENI A;  5A5P A;  5D3T A;  2G43 A;  4R8P K;  5G4R A;  5C11 A;  2L85 A;  4A9L A;  5C8G A;  2E6S A;  2LXH C;  4X3G A;  1WEU A;  4HXR A;  4UIY A;  4WIV A;  1WEN A;  5EPB A;  1IYM A;  2MJV B;  5CUE A;  2YQD A;  3MUK A;  4RVR A;  4QF2 A;  4UIV A;  5TAB A;  3Q2F A;  5CP5 A;  3SOU A;  1JM7 B;  4ZDT A;  5ACY A;  4UYG A;  5EVA A;  2QIC A;  4GB0 A;  4CCG X;  5IG6 A;  3EB5 A;  3SVH A;  5EIC A;  2YEK A;  2YEL A;  4W4U A;  4QSU A;  5F1H A;  2RNW A;  2E7O A;  5CUG A;  4QZS A;  5FBX A;  4UYH A;  4YY6 A;  1FP0 A;  5FG5 A;  4IOR A;  5FH6 A;  3LQI A;  1WUG A;  5ENE A;  2Y1N A;  4O7F A;  5DLZ A;  4FLP A;  5D1M B;  3KNV A;  2OO1 A;  4LKA A;  5CY9 A;  3JVM A;  4O76 A;  2VP7 A;  4NS5 A;  5LVQ A;  3ASL A;  5HRV A;  5HEL A;  4QBM A;  5D1K B;  4B7Y C;  2BAY A;  2YQL A;  3TLP A;  4CUS A;  5IGM A;  1VFY A;  2G4A A;  4O7E A;  5E9Y A;  5FE6 A;  2F6J A;  4GNF A;  4I7C A;  4HXK A;  2I7K A;  4R2Y A;  5HQ6 A;  3ZVZ B;  1EQF A;  4IOQ A;  4YH4 A;  4BW3 A;  3P1D A;  4YYN A;  5I89 A;  2G6Q A;  3MHS A;  4WA6 A;  1G25 A;  3LQJ A;  2KR4 A;  1WGM A;  5F1L A;  5E73 A;  4A9O A;  5C85 A;  2XB1 A;  2YW5 A;  4LYS A;  4UYF B;  4CUU A;  1WES A;  2CSZ A;  2H0D B;  2LSP B;  5HQ5 A;  4XYA A;  5B75 A;  4A9E A;  5LVR A;  4NXJ A;  4Z6I A;  4IOO A;  5I83 A;  4LYI A;  4BHW A;  4A4C A;  5BT4 A;  4IR6 A;  4PCE A;  4CUP A;  5TB6 A;  5LJ1 A;  1WIM A;  2M1R A;  2MIQ A;  2D9E A;  4GND A;  4LK9 A;  3T7L A;  5G0F A;  5FE5 A;  2MNY A;  3ZPV 1;  1RMD A;  5FFV A;  1WE9 A;  3L1X A;  5L98 A;  5DFD A;  4Z93 A;  5D3N A;  5EP7 A;  4O7C A;  3HMF A;  1WFK A;  2LGV A;  2KRE A;  1VD4 A;  3N9N A;  4MEN A;  5H85 A;  5I80 A;  4O74 A;  4QR3 A;  3NG2 A;  2M3H A;  4P5O B;  5LJ0 A;  3EB6 A;  1WEW A;  4HXP A;  1X4I A;  4IR3 A;  4A9N A;  3ZTG A;  2NAA A;  2UZG A;  5LCW B;  5FG6 A;  4C9Z A;  4YBS A;  3Q2E A;  5F25 A;  4FIP A;  5DFC A;  2VJE A;  4XUA A;  4QSR A;  2I8N A;  4YBT A;  3UV5 A;  5DKH A;  4TQN A;  3O36 A;  5EWW A;  5KTX A;  4N4G A;  5I1Q A;  4V3L C;  2KYU A;  5DYX A;  3M62 A;  5ENJ A;  3RPG B;  2DX8 A;  5DW2 A;  4QSP A;  4TT2 A;  5CRM A;  4BW1 A;  5L8T A;  5D24 A;  3HCS A;  5A5Q A;  2ZET C;  5J0D A;  4QR4 A;  5DYU A;  2IDA A;  2KE1 A;  3P1C A;  2KWJ A;  2VPE A;  3O33 A;  4YK0 A;  2D82 A;  4YYI A;  4IR4 A;  3U5K A;  2NXB A;  5EPR A;  5KHM A;  2YSM A;  3P1E A;  4QSW A;  4QR5 A;  1WEQ A;  3IHP A;  3QZT A;  1LDJ B;  4CUR A;  1ZS5 A;  5FFY A;  2DVQ A;  5A81 A;  1FBV A;  5A5S A;  5D7X A;  4PKL A;  5ETD A;  5ETB A;  2RI7 A;  4HXL A;  2PNX A;  2R10 A;  2E6R A;  3JVK A;  1ZBD B;  3HME A;  4O72 A;  1JM7 A;  4KV1 A;  5F5Z A;  1JSP B;  4AYC B;  5D25 A;  4TZ2 A;  3QZV A;  5D3J A;  4Z6H A;  5EA1 A;  5DBM A;  4O78 A;  5B79 A;  4CFK A;  5HM0 A;  5E9V A;  5LUU A;  3LQH A;  4TYL A;  2CKL A;  2MUM A;  5EWV A;  4UI9 B;  5AIT A;  2LV9 A;  4UYD A;  5F2P A;  4CUQ A;  1X4U A;  4TZ8 A;  5ENB A;  2E7N A;  5CQ3 A;  5I7X A;  4A9H A;  2DKW A;  2YHO A;  4A49 A;  4NQM A;  4WZ3 B;  2LGL A;  3AQA A;  3RCW A;  1DVP A;  2ECI A;  4AP4 A;  4C67 A;  2RFJ A;  2LGG A;  4DON A;  4MSX A;  3PHD A;  4NRB A;  2CSY A;  4N4I A;  2L5U A;  3DQV R;  5FEY A;  2LRI C;  2K17 A;  4A0C D;  2KGI A;  4NUD A;  5EYA F;  4NR4 A;  4YH3 A;  5G04 B;  5LKX A;  4Q0N A;  3LJW A;  4LDF A;  4BW2 A;  5LJ2 A;  2LQ6 A;  5TDW A;  5C7N A;  1WUM A;  4HBY A;  2YEM A;  5KTU A;  3UVY A;  4OGI A;  2VJF B;  3AAD A;  4NYV A;  2M85 A;  3RTR B;  4A9F A;  3M99 A;  4YAD A;  4NR9 A;  3UVW A;  1WEO A;  3FL2 A;  4CUT A;  4LRG A;  3N9Q A;  4OUF A;  5CUD A;  4F52 B;  3PUQ A;  5EPS A;  4QSQ A;  2JMI A;  4V3K C;  5CGP A;  1Z6U A;  1MM2 A;  4TT6 A;  3KQI A;  5II2 A;  3UV4 A;  3O37 A;  4XY8 A;  4A9K A;  5TCM A;  3KV6 A;  5D26 A;  5JI8 A;  4N4F A;  5DKD A;  1XWH A;  5HQ7 A;  5FDZ A;  2YSJ A;  4QC3 A;  5D3L A;  3L11 A;  2WP1 A;  5C87 A;  5HFR A;  5HCL A;  5D3S A;  5F36 A;  4CLB A;  5DKC A;  2LXP C;  5CTL A;  2YW8 A;  4I7B A;  4AUQ B;  4MEO A;  2L0B A;  4ZUX U;  5EWH A;  5K29 A;  4QEW A;  5FE7 A;  3O35 A;  4HBX A;  4ZC9 A;  3K2J A;  4A9I A;  4WZ2 A;  5FE2 A;  3D7C A;  3JVL A;  5D3H A;  4UIT A;  2VJE B;  5CS8 A;  1T1H A;  2RO1 A;  4TKP B;  1Z2Q A;  5KH3 A;  2VPG A;  5H9M A;  5C4Q A;  4Q6F A;  2CKL B;  2HYE D;  2VNF A;  5E74 A;  4UP5 A;  2ECJ A;  4NUC A;  5FE4 A;  3PUR A;  3RPG C;  5D0C A;  3DAI A;  2KGG A;  4QF3 A;  4HXN A;  3NXB A;  2MT5 A;  4Q0O A;  5E9I A;  5FE3 A;  3GL6 A;  4BJX A;  5CQ6 A;  3G0L A;  5I3L A;  5LKZ A;  5CQ7 A;  2MD7 B;  4HXO A;  5EGU A;  5AD2 A;  4F3I A;  2VPD A;  3P5O A;  2D8S A;  5E9M A;  4QNS A;  4NR7 A;  3MXF A;  2MA6 A;  4R7E A;  3JVJ A;  5KU3 A;  4QY4 A;  4XY9 A;  3N9M A;  4WZ0 A;  4HBV A;  4J3I A;  4J0S A;  3U5P A;  4PY6 A;  5BT5 A;  4KV4 A;  2JRJ A;  2ECV A;  2YYR A;  5EQ1 A;  4TU6 A;  5EK9 A;  3UV2 A;  3SOX A;  5EI4 A;  5B76 A;  4AKN A;  4LYW A;  5H1V A;  4UIW A;  5LKU A;  2VJF A;  2N9G A;  4MR3 A;  4NR8 A;  5IGN A;  4UYE A;  2F6N A;  5A5N A;  5KTW A;  1WEP A;  3C6W A;  3DPL R;  3ZPV E;  3QZS A;  2I50 A;  4A4B A;  4QSV A;  2LDR A;  5CQ8 A;  3UVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...