3U5MA

Crystal structure of trim33 phd-bromo in the free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
203
structure length
178
Chain Sequence
b'PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQSEVAQAGKAVALYFEDKLTEIYSDRTFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 49
structure length 178
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5mA01
3SOUA 4UIZA 2RFJA 5KH3A 2DX8A 3I3JA 4QEVA 4CFKA 2KYUA 3RTRB 1JM7B 5D3JA 1F62A 4BJXA 4FK5A 2K1JA 4I7BA 4YYMA 4BW1A 5B76A 2YYRA 5D3HA 2LXHC 4YC9A 5G05B 3KNVA 4CUTA 4LJNA 4YYGA 2KREA 4O7BA 5C13A 2G4AA 2KWKA 5LJ0A 5HLSA 5EP7A 5DLXA 4LKAA 1WEPA 4J3IA 5ETBA 5I29A 4QYLA 3RCWA 4YYIA 2LXPC 2DWWA 4UITA 4UIXA 5CQ8A 3UVDA 5I3LA 5I40A 5KH7A 4UIWA 3HCUA 5EWWA 3O36A 3LJWA 5L98A 5H1UA 4UYEA 2YUCA 2R0VA 2Y1NA 4PPEA 5L8UA 1K2FA 4FO9A 1X0JA 5FB1A 4NYVA 2RNYA 5KTXA 5D1MB 5G0FA 3AADA 5CQAA 4A9OA 3SVFA 4O76A 5DW2A 4A4BA 4O7FA 2L5UA 4NR4A 5IG6A 4BHWA 3RPGB 3AQAA 2ECIA 4NYWA 5D0CA 3UW9A 5TCMA 5CY9A 2JRJA 5LKUA 2M6MA 4YADA 1WESA 5FB0A 3IHPA 2VPDA 5BT5A 2IDAA 2DVQA 5A5NA 5EWCA 2H0DA 3N9OA 5A7CA 4XY9A 5DW1A 5EWDA 5E9MA 2YEMA 4MEOA 4QEUA 2NXBA 3TLPA 3LRQA 4HBVA 5B8DA 4IOQA 4LC2A 5HQ7A 4WIVA 5EU1A 5I7YA 5F36A 5A82A 5FDZA 2YSJA 4A9JA 5FE3A 4CA1A 4NYXA 5C7NA 2I50A 4KV4A 4UYFB 3ZPVE 4MEQA 4UI9B 4NUEA 5E74A 2RSDA 2RI7A 4CFLA 5FG5A 4IOOA 5DYCA 5EVAA 4QSVA 3I2DA 3G0JA 3O34A 5EICA 5FFVA 2L43A 4NR7A 5C4QA 2YU4A 4R8PK 4O78A 2YQDA 5FE0A 3N9NA 5TB6A 3LQJA 3SVGA 2VPBA 4TKPB 1WEQA 2ECWA 4A9KA 3L1XA 2E6RA 5KO4A 4GNFA 5C11A 4BW4A 2KWNA 5DINA 2KU3A 2G43A 2ZETC 4S3OC 4C67A 2R10A 2Y43A 5CQ6A 2RO1A 5DYUA 3G0LA 4MR4A 4O77A 3ZVYA 2YW8A 4B86C 3C5KA 2AN6A 1WEEA 5LKXA 2D8SA 4HXPA 5DFCA 4YYJA 3HCSA 2L80A 5CUAA 5CUEA 2MJVB 4UIVA 5F63A 1FP0A 5HQ5A 2I7KA 4HBXA 1WEMA 4YABA 1WFKA 2YQMA 4AYCA 4NUDA 5D25A 4OUFA 2LGGA 2I8NA 3GG3A 4A9EA 1U6GB 1HYIA 3KV6A 4QR4A 5COIA 5E0RA 5E3GA 5IGLA 4TT4A 5HJCA 5J0DA 4WZ3B 4IR6A 2L75A 3S92A 5EWVA 3MHHA 5HEMA 4I7DA 5FE8A 4RVRA 2M85A 4YY6A 2R0YA 4CUUA 2PNXA 5H9MA 5D3SA 5DBMA 5I86A 4CUSA 3O33A 2QICA 1Z2QA 1ZBDB 4NRBA 4O75A 4A9HA 5FERA 4CCGX 4UIUA 1Z6UA 2YQLA 4QF3A 2VNFA 5C8GA 4FIPA 2HYED 2YHOA 4YYDA 4NR9A 2KIZA 4PTBA 5F25A 4DONA 3U5JA 5B75A 2KTBB 4QUTA 2JMIA 3HMHA 5KHMA 4HXLA 4QYDA 5F61A 4A9IA 4O64A 4AP4A 2D9EA 4A0CD 4PCEA 5H85A 3U5KA 4QSWA 5EPSA 5CTLA 5I80A 2EA6A 5B78A 5HENA 4O71A 5CP5A 2MA5A 2E7OA 2F6JA 2E7NA 3P1EA 5ENHA 1N87A 2HDPA 5E7DA 2KR4A 4ALGA 2FUIA 4V3LC 4IR5A 3HMFA 5DYAA 3M99A 3M63A 4UYDA 4LYSA 5CUBA 5F60A 2CKLA 3DWYA 4X3GA 3L1ZB 4S3OB 5B77A 1WEOA 2L5EA 3UV2A 3T6RA 2VJFA 5FE4A 5K29A 4HXKA 4MR5A 4X2IA 4QBMA 5F1HA 1N72A 4PS5A 1VFYA 4KV1A 3ZPV1 5DFBA 5JG6A 2LV9A 5KH9A 5ENBA 4MR6A 5DLZA 5FFYA 3JVKA 3U5MA 5HFRA 2EGPA 5E73A 4QC3A 3NG2A 5A5PA 1E4UA 4Z93A 2YYNA 4O7CA 3ZNIA 4UYGA 4YATA 4LR6A 4QSXA 4LYWA 5HRXA 4P5OB 4AYCB 5A81A 3T7LA 2L85A 4YY4A 1LDKC 2YW5A 2MT5A 4PY6A 3VK6A 3DPLR 4QNSA 2MA6A 3N9QA 5EISA 2ECTA 5J3XA 3P5OA 5D26A 3C6WA 5ENJA 1X4IA 2F42A 3EB6A 1WGMA 3JVLA 3LQIA 4NUCA 5G4RA 4V3KC 2RNWA 5FG6A 2XEUA 4NR8A 2C2VS 4HXMA 5AMFA 4TT2A 4GNDA 5CPEA 2OSSA 5IGKA 5LKZA 3K2JA 5L8TA 4ALHA 1EQFA 4LYIA 5CGPA 5AMEA 5FH7A 2DVVA 4TU4A 4A9MA 5ENCA 2G6QA 5G4SA 2VJEA 3N9LA 5D3TA 2BAYA 4CL9A 1CHCA 2D82A 2MD8C 4QR5A 5IGNA 2LSPB 5H1VA 1BORA 4QEWA 5FH8A 2LGLA 3MXFA 2UZGA 4W4UA 3U5PA 4NS5A 4QUUA 5A5RA 4QZSA 5DX4A 3U5NA 4WZ2A 4LADB 5ACYA 5II2A 4I7CA 2WP2A 4F52B 4UP5A 3NXBA 4Z6IA 4FJCA 4J1PA 3MULA 3QZSA 4XI1A 2OXQC 5D7XA 4A9FA 4UIYA 4N4GA 4O7EA 4CUQA 2KGGA 2YT5A 4QF2A 2MNYA 4LZRA 4ZQLA 2CSYA 1WUGA 4BBQA 2YDWA 3M62A 5I83A 2JMJA 4O74A 1WEUA 4MR3A 2KWJA 2H60A 5CS8A 4QB3A 4YH3A 5KU3A 1WEVA 3IU6A 5JI8A 4Z1QA 5LJ2A 4QSRA 5DFDA 3IU5A 4AUQB 3MB3A 4LDFA 4O7AA 5HQ6A 3PUQA 2RS9B 4OGJA 2VJFB 3KQIA 5ENIA 5A85A 2E3KA 1FBVA 2PUYA 4XY8A 3MHSA 3QZVA 4J0SA 4O72A 5I7XA 5EWHA 5TDRA 5EPBA 5C85A 3SOXA 2OO1A 5ENEA 5L99A 3ASLA 2VPGA 2KFTA 5EGUA 5CQ7A 4XUBA 2CSZA 4TZ2A 4XYAA 4WHUA 5HM0A 5E9KA 5JWMA 1JOCA 1LDJB 2OUOA 4YYKA 3O7AA 4E96A 4QY4A 3FKMX 4Y03A 4LZ2A 2H0DB 5F3AA 5CUDA 2DVRA 3HMEA 5CQ3A 3SVHA 3GV4A 4WZ0A 2FUUA 2FSAA 5CZGA 4IORA 1WENA 3JVJA 4QSTA 5BT4A 2CT2A 2N9GA 5D3PA 1WUMA 2E6SA 3N9MA 4MVTA 4LRGA 5HCLA 5D3RA 5CQ4A 2MD7B 3PHDA 5HRVA 4ZW1A 4Z6HA 5G04B 2RNXA 4CLBA 2ECGA 4UYFA 5D3NA 4TZ8A 5KTUA 5EV9A 4QC1A 2LQ6A 2Y1MA 4NR6A 2ECJA 5TABA 2EODA 3MB4A 5CUCA 4HXNA 4N4HA 5CRZA 5L97A 5BT3A 1G25A 5LVQA 2K17A 4GNEA 5A5OA 5A5SA 4WA6A 4OGIA 4F3IA 4IC3A 5KTWA 3ONIA 4UYHA 5EM3A 4QSSA 3MQMA 2F6NA 4NR5A 4FLPA 3FL2A 5TRBA 4TU6A 4Z1SA 5AD2A 2QJ0A 5F5ZA 5H1TA 2DKWA 5L96A 1MM2A 2C2LA 4L7XA 4MSXA 4TS8A 4A49A 5FH6A 4AKNA 3ZYUA 4CURA 1VD4A 5CUGA 5FBXA 4TTEA 3Q2FA 2ECVA 3N9PA 4ZDTA 2K4DA 4YAXA 4L58A 5HRWA 2LRIC 3ZTGA 5FE7A 5D1LB 4QSPA 5E9IA 2VPEA 5EI4A 3SOWA 2DVSA 2ECNA 2MNZA 2NAAA 5ENFA 1VYXA 4TT6A 4TQNA 3DAIA 4CUPA 5LVRA 1F68A 4LZSA 5DKAA 5LCWB 4YH4A 5IIDA 5E9VA 4AVXA 4Q6FA 4UP0A 5FE1A 5CRMA 4Q0OA 5FFWA 2YURA 2MIQA 3O37A 3QZTA 4IC2A 1V87A 5FEYA 4GB0A 4A9LA 3O70A 4QSQA 4ZC9A 4IR3A 5DYXA 2YREA 3P1CA 4WHWA 3UVXA 5I1QA 4YBSA 4NQNA 4J0RA 1X4JA 2DATA 5DKCA 5FE9A 2M3HA 4NQMA 5HFQA 4A4CA 3UVYA 5CU8A 3JVMA 2LN0A 3UVWA 5ENGA 3UV5A 2XB1A 3PURA 5TBNA 5E3DA 5B79A 4BW2A 4QSUA 5DKHA 4PKLA 3U5OA 1WEWA 4N3WA 1JM7A 4NRCA 4O70A 5AIUA 1WILA 5E9YA 5EK9A 5HELA 3DQVR 2QIZA 5EPRA 4Q0NA 3O35A 2YEKA 5CQTA 3HTKC 5DY7A 5EA1A 4HXRA 5AITA 5E9LA 2WP1A 4LLBA 4NXJA 5IGMA 5ETDA 1HYJA 4NN2A 1WE9A 3EB5A 1ZS5A 4GPJA 2L0BA 2VP7A 5C89A 2G45A 2M1RA 5IBNA 5D24A 4YYNA 5C87A 1JM4B 4N4IA 5EYAF 4PCIA 4IR4A 3SHBA 4TYLA 3KV5A 2GRCA 4HXSA 5A5QA 4C9ZA 2KWOA 3GL6A 3U5LA 2CKLB 3LQHA 4XUAA 1WIMA 2LGVA 5LJ1A 4R7EA 5F2PA 4YYHA 5D1KB 4YBTA 4N4FA 4A9NA 5CQ5A 4HBYA 5CFWA 2MUMA 2LGKA 3ZYQA 5D3LA 3Q2EA 4BW3A 2YSMA 5F62A 1MM3A 3RPGC 2K16A 1IYMA 4ZUXU 2YHNA 5FE6A 5I89A 3D7CA 3P1FA 2KE1A 4KCXA 5FE5A 5I88A 5FG4A 5AD3A 2JMDA 4HXOA 2LDRA 5TDWA 2L84A 1Z60A 5FE2A 3HCTA 1E6IA 4HBWA 4MENA 3LXJA 3P1DA 4YK0A 3ZVZB 4GNGA 2KGIA 3V43A 2YELA 5DKDA 4B7YC 5A83A 2R0SA 1JSPB 1RMDA 4R2YA 5LUUA 3S91A 4YBMA 1T1HA 1XWHA 5EQ1A 5LKTA 4QR3A 4MEPA 3L11A 3MUKA 5F1LA 2VJEB 1DVPA 5II1A 4C66A 4NRAA 1X4UA 3UV4A 4LK9A
chains in the Genus database with same CATH superfamily
3SOUA 4UIZA 2RFJA 5KH3A 2DX8A 3I3JA 4QEVA 4CFKA 2KYUA 3RTRB 1DCQA 3FAOA 1JM7B 5D3JA 1F62A 4BJXA 4FK5A 2K1JA 4I7BA 4YYMA 4BW1A 3FJUB 5B76A 2YYRA 5D3HA 5K3QA 2LXHC 4YC9A 5G05B 3KNVA 4CUTA 4LJNA 4YYGA 2KREA 4O7BA 5C13A 2G4AA 2KWKA 5LJ0A 5HLSA 5EP7A 5DLXA 4LKAA 1WEPA 4J3IA 5ETBA 5I29A 3JUEA 4QYLA 3RCWA 4YYIA 2LXPC 2DWWA 4UITA 4UIXA 5CQ8A 3UVDA 5I3LA 5I40A 5KH7A 4UIWA 3HCUA 5EWWA 3O36A 3LJWA 5L98A 5H1UA 4UYEA 2YUCA 2R0VA 2Y1NA 4PPEA 5L8UA 1K2FA 4FO9A 1X0JA 5FB1A 4NYVA 2RNYA 5KTXA 5D1MB 5G0FA 3AADA 5CQAA 4A9OA 3SVFA 4O76A 5DW2A 4A4BA 4O7FA 2L5UA 4NR4A 5IG6A 4BHWA 3RPGB 2EJNA 3AQAA 2ECIA 4NYWA 5D0CA 3UW9A 5TCMA 5CY9A 2JRJA 5LKUA 2M6MA 4YADA 1WESA 5FB0A 5SVIA 2XOYA 3IHPA 2VPDA 5BT5A 2IDAA 2DVQA 5A5NA 5EWCA 2H0DA 3N9OA 5A7CA 4XY9A 5DW1A 3D1BA 5EWDA 5E9MA 2YEMA 4MEOA 4QEUA 2NXBA 3TLPA 3LRQA 4HBVA 5B8DA 4IOQA 4LC2A 5HQ7A 4WIVA 5EU1A 5I7YA 5F36A 5A82A 5FDZA 2YSJA 4A9JA 5FE3A 4CA1A 4NYXA 3KDEC 5C7NA 2I50A 4KV4A 4UYFB 3ZPVE 4MEQA 4UI9B 4NUEA 5E74A 2RSDA 2RI7A 3LDYA 4CFLA 5FG5A 4IOOA 5DYCA 5EVAA 4QSVA 3I2DA 3G0JA 3O34A 5EICA 5FFVA 2L43A 4NR7A 5C4QA 2YU4A 4R8PK 4O78A 2YQDA 5FE0A 3N9NA 5TB6A 3LQJA 3SVGA 2VPBA 4TKPB 1WEQA 2ECWA 4A9KA 3L1XA 3MDBC 2E6RA 5KO4A 4GNFA 5C11A 4BW4A 2KWNA 5DINA 2KU3A 2G43A 3PLWA 2ZETC 4S3OC 4C67A 2R10A 2Y43A 5CQ6A 2RO1A 5DYUA 3G0LA 3VKGA 4MR4A 4O77A 3ZVYA 2YW8A 4B86C 3C5KA 2AN6A 5SVYA 1WEEA 5LKXA 2D8SA 4HXPA 5DFCA 4YYJA 3HCSA 4OGCA 2L80A 5CUAA 5CUEA 2MJVB 4UIVA 5F63A 1FP0A 5HQ5A 2I7KA 4HBXA 1WEMA 4YABA 1WFKA 2YQMA 4AYCA 4NUDA 5D25A 4OUFA 2LGGA 2I8NA 3GG3A 4A9EA 1U6GB 1HYIA 3KV6A 4QR4A 5COIA 5E0RA 5E3GA 5IGLA 2B0OE 4TT4A 5HJCA 5J0DA 4WZ3B 4IR6A 2L75A 3S92A 5SVIB 5EWVA 2CONA 3MHHA 4AI6A 5HEMA 4I7DA 5FE8A 4RVRA 2M85A 4AKHA 4AKIA 4OGEA 2XP0A 4YY6A 2R0YA 4CUUA 2PNXA 5H9MA 5D3SA 5DBMA 5I86A 4CUSA 3O33A 2QICA 1Z2QA 1ZBDB 4NRBA 4O75A 4A9HA 5FERA 4CCGX 4UIUA 1Z6UA 2KKXA 2XOZA 2YQLA 2VNFA 5C8GA 3FANA 4O62A 4QF3A 4F1PA 4FIPA 2HYED 2YHOA 4YYDA 4NR9A 2KIZA 4PTBA 5F25A 4DONA 3U5JA 5B75A 2KTBB 4QUTA 2JMIA 3LVRE 3HMHA 5KHMA 4HXLA 4QYDA 2EGMA 5F61A 4A9IA 4O64A 2FFWA 4AP4A 2D9EA 4A0CD 4PCEA 5H85A 4Z0OA 3U5KA 4QSWA 5EPSA 2XOCA 5CTLA 5I80A 2EA6A 5B78A 5HENA 4O71A 5CP5A 2MA5A 2E7OA 2F6JA 2E7NA 3P1EA 5ENHA 1N87A 2HDPA 5E7DA 2KR4A 4ALGA 2FUIA 4V3LC 2CSVA 4IR5A 3HMFA 5DYAA 3M99A 3M63A 4UYDA 4LYSA 5CUBA 5F60A 2CKLA 3DWYA 2JM3A 4X3GA 3L1ZB 4S3OB 2EXUA 1WEOA 2L5EA 3UV2A 2FD4A 3T6RA 5B77A 2VJFA 5FE4A 5K29A 4HXKA 4MR5A 4X2IA 4QBMA 5F1HA 1N72A 4PS5A 1VFYA 4KV1A 3ZPV1 5DFBA 5JG6A 2LV9A 5KH9A 5ENBA 4MR6A 5DLZA 5FFYA 3JVKA 3U5MA 5HFRA 2EGPA 5E73A 4QC3A 3NG2A 5A5PA 1E4UA 4Z93A 2YYNA 4O7CA 3ZNIA 4UYGA 4YATA 4LR6A 4QSXA 4LYWA 5HRXA 4P5OB 4AYCB 5A81A 3T7LA 2L85A 4YY4A 1LDKC 2YW5A 2MT5A 4PY6A 3FEHA 3VK6A 3DPLR 4QNSA 2MA6A 3N9QA 5EISA 2ECTA 5J3XA 3P5OA 5SVXA 5D26A 3C6WA 5ENJA 1X4IA 2F42A 3EB6A 1WGMA 3JVLA 3LQIA 4NUCA 5G4RA 4V3KC 2RNWA 5FG6A 2XEUA 4NR8A 2C2VS 4HXMA 5AMFA 4TT2A 4GNDA 5CPEA 2OSSA 5IGKA 4H9DA 5LKZA 3K2JA 5L8TA 4ALHA 1EQFA 4LYIA 5CGPA 5AMEA 5FH7A 2DVVA 4TU4A 4A9MA 5ENCA 2G6QA 5G4SA 2VJEA 3N9LA 5D3TA 2BAYA 4CL9A 1CHCA 2D82A 2MD8C 4QR5A 5IGNA 2JUNA 2LSPB 5H1VA 1BORA 4QEWA 5FH8A 2LGLA 3O47A 3MXFA 2UZGA 4W4UA 3U5PA 4NS5A 4QUUA 5A5RA 4QZSA 5DX4A 3U5NA 2MKEA 4WZ2A 4LADB 5ACYA 5II2A 4I7CA 2WP2A 4F52B 4UP5A 3NXBA 4Z6IA 4FJCA 4J1PA 3MULA 3QZSA 4XI1A 2OXQC 5D7XA 4A9FA 3DDTA 4UIYA 4N4GA 4O7EA 4CUQA 2KGGA 2YT5A 4QF2A 2MNYA 4LZRA 4ZQLA 2CSYA 1WUGA 4BBQA 2RR4A 2YDWA 3M62A 5I83A 2JMJA 4O74A 1WEUA 4MR3A 2KWJA 2H60A 5CS8A 4QB3A 4YH3A 5KU3A 1WEVA 3IU6A 5JI8A 4Z1QA 5LJ2A 4QSRA 5DFDA 3IU5A 4AUQB 3MB3A 4LDFA 4O7AA 5HQ6A 3PUQA 2RS9B 4OGJA 2VJFB 3KQIA 5ENIA 5A85A 2E3KA 1FBVA 2PUYA 4XY8A 3MHSA 3QZVA 4J0SA 4O72A 5I7XA 5EWHA 5TDRA 5EPBA 5C85A 3SOXA 2OO1A 5ENEA 5L99A 1MBMA 2VPGA 2KFTA 3ASLA 5EGUA 5CQ7A 4XUBA 2CSZA 4TZ2A 4XYAA 4WHUA 5HM0A 5E9KA 5JWMA 1JOCA 1LDJB 2OUOA 4YYKA 3O7AA 4E96A 4QY4A 3FKMX 4Y03A 4LZ2A 2H0DB 5F3AA 5CUDA 2DVRA 3HMEA 5CQ3A 3SVHA 3GV4A 4WZ0A 2FUUA 2FSAA 5CZGA 4IORA 1WENA 3JVJA 4QSTA 5BT4A 2CT2A 2N9GA 5D3PA 1WUMA 2E6SA 3N9MA 4MVTA 4LRGA 5HCLA 4QQ4A 5D3RA 5CQ4A 2MD7B 3PHDA 5HRVA 4ZW1A 4Z6HA 5G04B 2RNXA 4CLBA 2ECGA 4UYFA 5D3NA 4TZ8A 5KTUA 5EV9A 4QC1A 2LQ6A 2Y1MA 4NR6A 2ECJA 2LAUA 5TABA 2EODA 3VKHA 3MB4A 5CUCA 4HXNA 4N4HA 5CRZA 5L97A 5BT3A 1G25A 5LVQA 2K17A 4GNEA 5A5OA 5A5SA 4WA6A 4OGIA 4F3IA 4IC3A 5KTWA 3ONIA 4UYHA 5EM3A 4QSSA 3MQMA 2F6NA 4NR5A 4FLPA 3FL2A 5TRBA 4TU6A 4Z1SA 5AD2A 2QJ0A 4AKGA 5F5ZA 5H1TA 2DKWA 5L96A 1MM2A 2C2LA 4L7XA 4MSXA 4TS8A 4A49A 5FH6A 4AKNA 3ZYUA 4CURA 1VD4A 5CUGA 5FBXA 4TTEA 3Q2FA 2ECVA 3N9PA 4ZDTA 2K4DA 4YAXA 4L58A 5HRWA 2LRIC 3ZTGA 5FE7A 5D1LB 4QSPA 5E9IA 2VPEA 5EI4A 3Q1DA 3SOWA 2DVSA 2ECNA 2MNZA 2NAAA 5ENFA 1VYXA 4TT6A 4TQNA 3DAIA 4CUPA 5LVRA 1F68A 4LZSA 5DKAA 5LCWB 4YH4A 5IIDA 5E9VA 4AVXA 2IQJA 4Q6FA 4UP0A 5FE1A 5CRMA 4Q0OA 5FFWA 2L7PA 2YURA 2MIQA 3O37A 3QZTA 4IC2A 1V87A 5FEYA 4GB0A 4A9LA 3O70A 4QSQA 4ZC9A 4IR3A 2E61A 5DYXA 2YREA 3P1CA 4WHWA 2YVRA 1ZKRA 3UVXA 5I1QA 4YBSA 4NQNA 4J0RA 3ERRA 1X4JA 2DATA 5DKCA 5FE9A 2M3HA 4NQMA 5HFQA 4A4CA 2OWAA 3UVYA 5CU8A 3JVMA 2LN0A 3UVWA 5ENGA 3UV5A 2XB1A 3PURA 2DSMA 5TBNA 5E3DA 5B79A 4BW2A 2KKYA 4QSUA 5DKHA 4PKLA 3U5OA 1WEWA 3SUBA 4N3WA 1JM7A 4NRCA 4O70A 5AIUA 1WILA 5E9YA 5EK9A 5HELA 3DQVR 2QIZA 5EPRA 4Q0NA 3O35A 2YEKA 5CQTA 3HTKC 5DY7A 5EA1A 4HXRA 3T9KA 5AITA 5E9LA 2WP1A 4LLBA 4NXJA 5IGMA 5ETDA 1HYJA 4NN2A 1WE9A 3EB5A 1ZS5A 4GPJA 2L0BA 2VP7A 5C89A 2G45A 2M1RA 5IBNA 5D24A 4YYNA 5C87A 1JM4B 4N4IA 2CRWA 4PCIA 4IR4A 3H7HA 4TYLA 3KV5A 5EYAF 2GRCA 4HXSA 5A5QA 3SHBA 2KWOA 3GL6A 4C9ZA 3U5LA 2CKLB 3LQHA 4XUAA 1WIMA 2LGVA 5LJ1A 4R7EA 5F2PA 4YYHA 5D1KB 4YBTA 4N4FA 4A9NA 2CRRA 5CQ5A 4HBYA 2P57A 5CFWA 2MUMA 2LGKA 3ZYQA 5D3LA 3Q2EA 4BW3A 2YSMA 5F62A 1MM3A 3RPGC 2K16A 3E2DA 1IYMA 4ZUXU 3FM8C 2YHNA 5FE6A 5I89A 2M13A 3D7CA 3P1FA 2KE1A 4KCXA 5FE5A 5I88A 1PUOA 5FG4A 5AD3A 2JMDA 4HXOA 2LDRA 5TDWA 2L84A 1Z60A 5FE2A 3HCTA 1E6IA 4HBWA 4MENA 3LXJA 3P1DA 4YK0A 3ZVZB 2D8UA 4GNGA 2KGIA 3V43A 2YELA 5DKDA 4B7YC 5A83A 2R0SA 1JSPB 1RMDA 4R2YA 5LUUA 3S91A 4YBMA 1T1HA 1XWHA 5EQ1A 5LKTA 4QR3A 4MEPA 3L11A 3LVQE 3M7KA 4Z0RA 3MUKA 5F1LA 3DWDA 2VJEB 1DVPA 5II1A 3LJUX 4C66A 3D1DA 4NRAA 1X4UA 2DJAA 3UV4A 4LK9A
chains in the Genus database with same CATH topology
3SOUA 4UIZA 2RFJA 5KH3A 2DX8A 3I3JA 4QEVA 4CFKA 2KYUA 3RTRB 1JM7B 5D3JA 1F62A 4BJXA 4FK5A 2K1JA 4I7BA 4YYMA 4BW1A 5B76A 2YYRA 5D3HA 2LXHC 4YC9A 5G05B 3KNVA 4CUTA 4LJNA 4YYGA 2KREA 4O7BA 5C13A 2G4AA 2KWKA 5LJ0A 5HLSA 5EP7A 5DLXA 4LKAA 1WEPA 4J3IA 5ETBA 5I29A 4QYLA 3RCWA 4YYIA 2LXPC 2DWWA 4UITA 4UIXA 5CQ8A 3UVDA 5I3LA 5I40A 5KH7A 4UIWA 3HCUA 5EWWA 3O36A 3LJWA 5L98A 5H1UA 4UYEA 2YUCA 2R0VA 2Y1NA 4PPEA 5L8UA 1K2FA 4FO9A 1X0JA 5FB1A 4NYVA 2RNYA 5KTXA 5D1MB 5G0FA 3AADA 5CQAA 4A9OA 3SVFA 4O76A 5DW2A 4A4BA 4O7FA 2L5UA 4NR4A 5IG6A 4BHWA 3RPGB 3AQAA 2ECIA 4NYWA 5D0CA 3UW9A 5TCMA 5CY9A 2JRJA 5LKUA 2M6MA 4YADA 1WESA 5FB0A 3IHPA 2VPDA 5BT5A 2IDAA 2DVQA 5A5NA 5EWCA 2H0DA 3N9OA 5A7CA 4XY9A 5DW1A 5EWDA 5E9MA 2YEMA 4MEOA 4QEUA 2NXBA 3TLPA 3LRQA 4HBVA 5B8DA 4IOQA 4LC2A 5HQ7A 4WIVA 5EU1A 5I7YA 5F36A 5A82A 5FDZA 2YSJA 4A9JA 5FE3A 4CA1A 4NYXA 5C7NA 2I50A 4KV4A 4UYFB 3ZPVE 4MEQA 4UI9B 4NUEA 5E74A 2RSDA 2RI7A 4CFLA 5FG5A 4IOOA 5DYCA 5EVAA 4QSVA 3I2DA 3G0JA 3O34A 5EICA 5FFVA 2L43A 4NR7A 5C4QA 2YU4A 4R8PK 4O78A 2YQDA 5FE0A 3N9NA 5TB6A 3LQJA 3SVGA 2VPBA 4TKPB 1WEQA 2ECWA 4A9KA 3L1XA 2E6RA 5KO4A 4GNFA 5C11A 4BW4A 2KWNA 5DINA 2KU3A 2G43A 2ZETC 4S3OC 4C67A 2R10A 2Y43A 5CQ6A 2RO1A 5DYUA 3G0LA 4MR4A 4O77A 3ZVYA 2YW8A 4B86C 3C5KA 2AN6A 1WEEA 5LKXA 2D8SA 4HXPA 5DFCA 4YYJA 3HCSA 2L80A 5CUAA 5CUEA 2MJVB 4UIVA 5F63A 1FP0A 5HQ5A 2I7KA 4HBXA 1WEMA 4YABA 1WFKA 2YQMA 4AYCA 4NUDA 5D25A 4OUFA 2LGGA 2I8NA 3GG3A 4A9EA 1U6GB 1HYIA 3KV6A 4QR4A 5COIA 5E0RA 5E3GA 5IGLA 4TT4A 5HJCA 5J0DA 4WZ3B 4IR6A 2L75A 3S92A 5EWVA 3MHHA 5HEMA 4I7DA 5FE8A 4RVRA 2M85A 4YY6A 2R0YA 4CUUA 2PNXA 5H9MA 5D3SA 5DBMA 5I86A 4CUSA 3O33A 2QICA 1Z2QA 1ZBDB 4NRBA 4O75A 4A9HA 5FERA 4CCGX 4UIUA 1Z6UA 2YQLA 4QF3A 2VNFA 5C8GA 4FIPA 2HYED 2YHOA 4YYDA 4NR9A 2KIZA 4PTBA 5F25A 4DONA 3U5JA 5B75A 2KTBB 4QUTA 2JMIA 3HMHA 5KHMA 4HXLA 4QYDA 5F61A 4A9IA 4O64A 4AP4A 2D9EA 4A0CD 4PCEA 5H85A 3U5KA 4QSWA 5EPSA 5CTLA 5I80A 2EA6A 5B78A 5HENA 4O71A 5CP5A 2MA5A 2E7OA 2F6JA 2E7NA 3P1EA 5ENHA 1N87A 2HDPA 5E7DA 2KR4A 4ALGA 2FUIA 4V3LC 4IR5A 3HMFA 5DYAA 3M99A 3M63A 4UYDA 4LYSA 5CUBA 5F60A 2CKLA 3DWYA 4X3GA 3L1ZB 4S3OB 5B77A 1WEOA 2L5EA 3UV2A 3T6RA 2VJFA 5FE4A 5K29A 4HXKA 4MR5A 4X2IA 4QBMA 5F1HA 1N72A 4PS5A 1VFYA 4KV1A 3ZPV1 5DFBA 5JG6A 2LV9A 5KH9A 5ENBA 4MR6A 5DLZA 5FFYA 3JVKA 3U5MA 5HFRA 2EGPA 5E73A 4QC3A 3NG2A 5A5PA 1E4UA 4Z93A 2YYNA 4O7CA 3ZNIA 4UYGA 4YATA 4LR6A 4QSXA 4LYWA 5HRXA 4P5OB 4AYCB 5A81A 3T7LA 2L85A 4YY4A 1LDKC 2YW5A 2MT5A 4PY6A 3VK6A 3DPLR 4QNSA 2MA6A 3N9QA 5EISA 2ECTA 5J3XA 3P5OA 5D26A 3C6WA 5ENJA 1X4IA 2F42A 3EB6A 1WGMA 3JVLA 3LQIA 4NUCA 5G4RA 4V3KC 2RNWA 5FG6A 2XEUA 4NR8A 2C2VS 4HXMA 5AMFA 4TT2A 4GNDA 5CPEA 2OSSA 5IGKA 5LKZA 3K2JA 5L8TA 4ALHA 1EQFA 4LYIA 5CGPA 5AMEA 5FH7A 2DVVA 4TU4A 4A9MA 5ENCA 2G6QA 5G4SA 2VJEA 3N9LA 5D3TA 2BAYA 4CL9A 1CHCA 2D82A 2MD8C 4QR5A 5IGNA 2LSPB 5H1VA 1BORA 4QEWA 5FH8A 2LGLA 3MXFA 2UZGA 4W4UA 3U5PA 4NS5A 4QUUA 5A5RA 4QZSA 5DX4A 3U5NA 4WZ2A 4LADB 5ACYA 5II2A 4I7CA 2WP2A 4F52B 4UP5A 3NXBA 4Z6IA 4FJCA 4J1PA 3MULA 3QZSA 4XI1A 2OXQC 5D7XA 4A9FA 4UIYA 4N4GA 4O7EA 4CUQA 2KGGA 2YT5A 4QF2A 2MNYA 4LZRA 4ZQLA 2CSYA 1WUGA 4BBQA 2YDWA 3M62A 5I83A 2JMJA 4O74A 1WEUA 4MR3A 2KWJA 2H60A 5CS8A 4QB3A 4YH3A 5KU3A 1WEVA 3IU6A 5JI8A 4Z1QA 5LJ2A 4QSRA 5DFDA 3IU5A 4AUQB 3MB3A 4LDFA 4O7AA 5HQ6A 3PUQA 2RS9B 4OGJA 2VJFB 3KQIA 5ENIA 5A85A 2E3KA 1FBVA 2PUYA 4XY8A 3MHSA 3QZVA 4J0SA 4O72A 5I7XA 5EWHA 5TDRA 5EPBA 5C85A 3SOXA 2OO1A 5ENEA 5L99A 3ASLA 2VPGA 2KFTA 5EGUA 5CQ7A 4XUBA 2CSZA 4TZ2A 4XYAA 4WHUA 5HM0A 5E9KA 5JWMA 1JOCA 1LDJB 2OUOA 4YYKA 3O7AA 4E96A 4QY4A 3FKMX 4Y03A 4LZ2A 2H0DB 5F3AA 5CUDA 2DVRA 3HMEA 5CQ3A 3SVHA 3GV4A 4WZ0A 2FUUA 2FSAA 5CZGA 4IORA 1WENA 3JVJA 4QSTA 5BT4A 2CT2A 2N9GA 5D3PA 1WUMA 2E6SA 3N9MA 4MVTA 4LRGA 5HCLA 5D3RA 5CQ4A 2MD7B 3PHDA 5HRVA 4ZW1A 4Z6HA 5G04B 2RNXA 4CLBA 2ECGA 4UYFA 5D3NA 4TZ8A 5KTUA 5EV9A 4QC1A 2LQ6A 2Y1MA 4NR6A 2ECJA 5TABA 2EODA 3MB4A 5CUCA 4HXNA 4N4HA 5CRZA 5L97A 5BT3A 1G25A 5LVQA 2K17A 4GNEA 5A5OA 5A5SA 4WA6A 4OGIA 4F3IA 4IC3A 5KTWA 3ONIA 4UYHA 5EM3A 4QSSA 3MQMA 2F6NA 4NR5A 4FLPA 3FL2A 5TRBA 4TU6A 4Z1SA 5AD2A 2QJ0A 5F5ZA 5H1TA 2DKWA 5L96A 1MM2A 2C2LA 4L7XA 4MSXA 4TS8A 4A49A 5FH6A 4AKNA 3ZYUA 4CURA 1VD4A 5CUGA 5FBXA 4TTEA 3Q2FA 2ECVA 3N9PA 4ZDTA 2K4DA 4YAXA 4L58A 5HRWA 2LRIC 3ZTGA 5FE7A 5D1LB 4QSPA 5E9IA 2VPEA 5EI4A 3SOWA 2DVSA 2ECNA 2MNZA 2NAAA 5ENFA 1VYXA 4TT6A 4TQNA 3DAIA 4CUPA 5LVRA 1F68A 4LZSA 5DKAA 5LCWB 4YH4A 5IIDA 5E9VA 4AVXA 4Q6FA 4UP0A 5FE1A 5CRMA 4Q0OA 5FFWA 2YURA 2MIQA 3O37A 3QZTA 4IC2A 1V87A 5FEYA 4GB0A 4A9LA 3O70A 4QSQA 4ZC9A 4IR3A 5DYXA 2YREA 3P1CA 4WHWA 3UVXA 5I1QA 4YBSA 4NQNA 4J0RA 1X4JA 2DATA 5DKCA 5FE9A 2M3HA 4NQMA 5HFQA 4A4CA 3UVYA 5CU8A 3JVMA 2LN0A 3UVWA 5ENGA 3UV5A 2XB1A 3PURA 5TBNA 5E3DA 5B79A 4BW2A 4QSUA 5DKHA 4PKLA 3U5OA 1WEWA 4N3WA 1JM7A 4NRCA 4O70A 5AIUA 1WILA 5E9YA 5EK9A 5HELA 3DQVR 2QIZA 5EPRA 4Q0NA 3O35A 2YEKA 5CQTA 3HTKC 5DY7A 5EA1A 4HXRA 5AITA 5E9LA 2WP1A 4LLBA 4NXJA 5IGMA 5ETDA 1HYJA 4NN2A 1WE9A 3EB5A 1ZS5A 4GPJA 2L0BA 2VP7A 5C89A 2G45A 2M1RA 5IBNA 5D24A 4YYNA 5C87A 1JM4B 4N4IA 5EYAF 4PCIA 4IR4A 3SHBA 4TYLA 3KV5A 2GRCA 4HXSA 5A5QA 4C9ZA 2KWOA 3GL6A 3U5LA 2CKLB 3LQHA 4XUAA 1WIMA 2LGVA 5LJ1A 4R7EA 5F2PA 4YYHA 5D1KB 4YBTA 4N4FA 4A9NA 5CQ5A 4HBYA 5CFWA 2MUMA 2LGKA 3ZYQA 5D3LA 3Q2EA 4BW3A 2YSMA 5F62A 1MM3A 3RPGC 2K16A 1IYMA 4ZUXU 2YHNA 5FE6A 5I89A 3D7CA 3P1FA 2KE1A 4KCXA 5FE5A 5I88A 5FG4A 5AD3A 2JMDA 4HXOA 2LDRA 5TDWA 2L84A 1Z60A 5FE2A 3HCTA 1E6IA 4HBWA 4MENA 3LXJA 3P1DA 4YK0A 3ZVZB 4GNGA 2KGIA 3V43A 2YELA 5DKDA 4B7YC 5A83A 2R0SA 1JSPB 1RMDA 4R2YA 5LUUA 3S91A 4YBMA 1T1HA 1XWHA 5EQ1A 5LKTA 4QR3A 4MEPA 3L11A 3MUKA 5F1LA 2VJEB 1DVPA 5II1A 4C66A 4NRAA 1X4UA 3UV4A 4LK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOU A;  4UIZ A;  2RFJ A;  5KH3 A;  2DX8 A;  3I3J A;  4QEV A;  4CFK A;  2KYU A;  3RTR B;  1JM7 B;  5D3J A;  1F62 A;  4BJX A;  4FK5 A;  2K1J A;  4I7B A;  4YYM A;  4BW1 A;  5B76 A;  2YYR A;  5D3H A;  2LXH C;  4YC9 A;  5G05 B;  3KNV A;  4CUT A;  4LJN A;  4YYG A;  2KRE A;  4O7B A;  5C13 A;  2G4A A;  2KWK A;  5LJ0 A;  5HLS A;  5EP7 A;  5DLX A;  4LKA A;  1WEP A;  4J3I A;  5ETB A;  5I29 A;  4QYL A;  3RCW A;  4YYI A;  2LXP C;  2DWW A;  4UIT A;  4UIX A;  5CQ8 A;  3UVD A;  5I3L A;  5I40 A;  5KH7 A;  4UIW A;  3HCU A;  5EWW A;  3O36 A;  3LJW A;  5L98 A;  5H1U A;  4UYE A;  2YUC A;  2R0V A;  2Y1N A;  4PPE A;  5L8U A;  1K2F A;  4FO9 A;  1X0J A;  5FB1 A;  4NYV A;  2RNY A;  5KTX A;  5D1M B;  5G0F A;  3AAD A;  5CQA A;  4A9O A;  3SVF A;  4O76 A;  5DW2 A;  4A4B A;  4O7F A;  2L5U A;  4NR4 A;  5IG6 A;  4BHW A;  3RPG B;  3AQA A;  2ECI A;  4NYW A;  5D0C A;  3UW9 A;  5TCM A;  5CY9 A;  2JRJ A;  5LKU A;  2M6M A;  4YAD A;  1WES A;  5FB0 A;  3IHP A;  2VPD A;  5BT5 A;  2IDA A;  2DVQ A;  5A5N A;  5EWC A;  2H0D A;  3N9O A;  5A7C A;  4XY9 A;  5DW1 A;  5EWD A;  5E9M A;  2YEM A;  4MEO A;  4QEU A;  2NXB A;  3TLP A;  3LRQ A;  4HBV A;  5B8D A;  4IOQ A;  4LC2 A;  5HQ7 A;  4WIV A;  5EU1 A;  5I7Y A;  5F36 A;  5A82 A;  5FDZ A;  2YSJ A;  4A9J A;  5FE3 A;  4CA1 A;  4NYX A;  5C7N A;  2I50 A;  4KV4 A;  4UYF B;  3ZPV E;  4MEQ A;  4UI9 B;  4NUE A;  5E74 A;  2RSD A;  2RI7 A;  4CFL A;  5FG5 A;  4IOO A;  5DYC A;  5EVA A;  4QSV A;  3I2D A;  3G0J A;  3O34 A;  5EIC A;  5FFV A;  2L43 A;  4NR7 A;  5C4Q A;  2YU4 A;  4R8P K;  4O78 A;  2YQD A;  5FE0 A;  3N9N A;  5TB6 A;  3LQJ A;  3SVG A;  2VPB A;  4TKP B;  1WEQ A;  2ECW A;  4A9K A;  3L1X A;  2E6R A;  5KO4 A;  4GNF A;  5C11 A;  4BW4 A;  2KWN A;  5DIN A;  2KU3 A;  2G43 A;  2ZET C;  4S3O C;  4C67 A;  2R10 A;  2Y43 A;  5CQ6 A;  2RO1 A;  5DYU A;  3G0L A;  4MR4 A;  4O77 A;  3ZVY A;  2YW8 A;  4B86 C;  3C5K A;  2AN6 A;  1WEE A;  5LKX A;  2D8S A;  4HXP A;  5DFC A;  4YYJ A;  3HCS A;  2L80 A;  5CUA A;  5CUE A;  2MJV B;  4UIV A;  5F63 A;  1FP0 A;  5HQ5 A;  2I7K A;  4HBX A;  1WEM A;  4YAB A;  1WFK A;  2YQM A;  4AYC A;  4NUD A;  5D25 A;  4OUF A;  2LGG A;  2I8N A;  3GG3 A;  4A9E A;  1U6G B;  1HYI A;  3KV6 A;  4QR4 A;  5COI A;  5E0R A;  5E3G A;  5IGL A;  4TT4 A;  5HJC A;  5J0D A;  4WZ3 B;  4IR6 A;  2L75 A;  3S92 A;  5EWV A;  3MHH A;  5HEM A;  4I7D A;  5FE8 A;  4RVR A;  2M85 A;  4YY6 A;  2R0Y A;  4CUU A;  2PNX A;  5H9M A;  5D3S A;  5DBM A;  5I86 A;  4CUS A;  3O33 A;  2QIC A;  1Z2Q A;  1ZBD B;  4NRB A;  4O75 A;  4A9H A;  5FER A;  4CCG X;  4UIU A;  1Z6U A;  2YQL A;  4QF3 A;  2VNF A;  5C8G A;  4FIP A;  2HYE D;  2YHO A;  4YYD A;  4NR9 A;  2KIZ A;  4PTB A;  5F25 A;  4DON A;  3U5J A;  5B75 A;  2KTB B;  4QUT A;  2JMI A;  3HMH A;  5KHM A;  4HXL A;  4QYD A;  5F61 A;  4A9I A;  4O64 A;  4AP4 A;  2D9E A;  4A0C D;  4PCE A;  5H85 A;  3U5K A;  4QSW A;  5EPS A;  5CTL A;  5I80 A;  2EA6 A;  5B78 A;  5HEN A;  4O71 A;  5CP5 A;  2MA5 A;  2E7O A;  2F6J A;  2E7N A;  3P1E A;  5ENH A;  1N87 A;  2HDP A;  5E7D A;  2KR4 A;  4ALG A;  2FUI A;  4V3L C;  4IR5 A;  3HMF A;  5DYA A;  3M99 A;  3M63 A;  4UYD A;  4LYS A;  5CUB A;  5F60 A;  2CKL A;  3DWY A;  4X3G A;  3L1Z B;  4S3O B;  5B77 A;  1WEO A;  2L5E A;  3UV2 A;  3T6R A;  2VJF A;  5FE4 A;  5K29 A;  4HXK A;  4MR5 A;  4X2I A;  4QBM A;  5F1H A;  1N72 A;  4PS5 A;  1VFY A;  4KV1 A;  3ZPV 1;  5DFB A;  5JG6 A;  2LV9 A;  5KH9 A;  5ENB A;  4MR6 A;  5DLZ A;  5FFY A;  3JVK A;  3U5M A;  5HFR A;  2EGP A;  5E73 A;  4QC3 A;  3NG2 A;  5A5P A;  1E4U A;  4Z93 A;  2YYN A;  4O7C A;  3ZNI A;  4UYG A;  4YAT A;  4LR6 A;  4QSX A;  4LYW A;  5HRX A;  4P5O B;  4AYC B;  5A81 A;  3T7L A;  2L85 A;  4YY4 A;  1LDK C;  2YW5 A;  2MT5 A;  4PY6 A;  3VK6 A;  3DPL R;  4QNS A;  2MA6 A;  3N9Q A;  5EIS A;  2ECT A;  5J3X A;  3P5O A;  5D26 A;  3C6W A;  5ENJ A;  1X4I A;  2F42 A;  3EB6 A;  1WGM A;  3JVL A;  3LQI A;  4NUC A;  5G4R A;  4V3K C;  2RNW A;  5FG6 A;  2XEU A;  4NR8 A;  2C2V S;  4HXM A;  5AMF A;  4TT2 A;  4GND A;  5CPE A;  2OSS A;  5IGK A;  5LKZ A;  3K2J A;  5L8T A;  4ALH A;  1EQF A;  4LYI A;  5CGP A;  5AME A;  5FH7 A;  2DVV A;  4TU4 A;  4A9M A;  5ENC A;  2G6Q A;  5G4S A;  2VJE A;  3N9L A;  5D3T A;  2BAY A;  4CL9 A;  1CHC A;  2D82 A;  2MD8 C;  4QR5 A;  5IGN A;  2LSP B;  5H1V A;  1BOR A;  4QEW A;  5FH8 A;  2LGL A;  3MXF A;  2UZG A;  4W4U A;  3U5P A;  4NS5 A;  4QUU A;  5A5R A;  4QZS A;  5DX4 A;  3U5N A;  4WZ2 A;  4LAD B;  5ACY A;  5II2 A;  4I7C A;  2WP2 A;  4F52 B;  4UP5 A;  3NXB A;  4Z6I A;  4FJC A;  4J1P A;  3MUL A;  3QZS A;  4XI1 A;  2OXQ C;  5D7X A;  4A9F A;  4UIY A;  4N4G A;  4O7E A;  4CUQ A;  2KGG A;  2YT5 A;  4QF2 A;  2MNY A;  4LZR A;  4ZQL A;  2CSY A;  1WUG A;  4BBQ A;  2YDW A;  3M62 A;  5I83 A;  2JMJ A;  4O74 A;  1WEU A;  4MR3 A;  2KWJ A;  2H60 A;  5CS8 A;  4QB3 A;  4YH3 A;  5KU3 A;  1WEV A;  3IU6 A;  5JI8 A;  4Z1Q A;  5LJ2 A;  4QSR A;  5DFD A;  3IU5 A;  4AUQ B;  3MB3 A;  4LDF A;  4O7A A;  5HQ6 A;  3PUQ A;  2RS9 B;  4OGJ A;  2VJF B;  3KQI A;  5ENI A;  5A85 A;  2E3K A;  1FBV A;  2PUY A;  4XY8 A;  3MHS A;  3QZV A;  4J0S A;  4O72 A;  5I7X A;  5EWH A;  5TDR A;  5EPB A;  5C85 A;  3SOX A;  2OO1 A;  5ENE A;  5L99 A;  3ASL A;  2VPG A;  2KFT A;  5EGU A;  5CQ7 A;  4XUB A;  2CSZ A;  4TZ2 A;  4XYA A;  4WHU A;  5HM0 A;  5E9K A;  5JWM A;  1JOC A;  1LDJ B;  2OUO A;  4YYK A;  3O7A A;  4E96 A;  4QY4 A;  3FKM X;  4Y03 A;  4LZ2 A;  2H0D B;  5F3A A;  5CUD A;  2DVR A;  3HME A;  5CQ3 A;  3SVH A;  3GV4 A;  4WZ0 A;  2FUU A;  2FSA A;  5CZG A;  4IOR A;  1WEN A;  3JVJ A;  4QST A;  5BT4 A;  2CT2 A;  2N9G A;  5D3P A;  1WUM A;  2E6S A;  3N9M A;  4MVT A;  4LRG A;  5HCL A;  5D3R A;  5CQ4 A;  2MD7 B;  3PHD A;  5HRV A;  4ZW1 A;  4Z6H A;  5G04 B;  2RNX A;  4CLB A;  2ECG A;  4UYF A;  5D3N A;  4TZ8 A;  5KTU A;  5EV9 A;  4QC1 A;  2LQ6 A;  2Y1M A;  4NR6 A;  2ECJ A;  5TAB A;  2EOD A;  3MB4 A;  5CUC A;  4HXN A;  4N4H A;  5CRZ A;  5L97 A;  5BT3 A;  1G25 A;  5LVQ A;  2K17 A;  4GNE A;  5A5O A;  5A5S A;  4WA6 A;  4OGI A;  4F3I A;  4IC3 A;  5KTW A;  3ONI A;  4UYH A;  5EM3 A;  4QSS A;  3MQM A;  2F6N A;  4NR5 A;  4FLP A;  3FL2 A;  5TRB A;  4TU6 A;  4Z1S A;  5AD2 A;  2QJ0 A;  5F5Z A;  5H1T A;  2DKW A;  5L96 A;  1MM2 A;  2C2L A;  4L7X A;  4MSX A;  4TS8 A;  4A49 A;  5FH6 A;  4AKN A;  3ZYU A;  4CUR A;  1VD4 A;  5CUG A;  5FBX A;  4TTE A;  3Q2F A;  2ECV A;  3N9P A;  4ZDT A;  2K4D A;  4YAX A;  4L58 A;  5HRW A;  2LRI C;  3ZTG A;  5FE7 A;  5D1L B;  4QSP A;  5E9I A;  2VPE A;  5EI4 A;  3SOW A;  2DVS A;  2ECN A;  2MNZ A;  2NAA A;  5ENF A;  1VYX A;  4TT6 A;  4TQN A;  3DAI A;  4CUP A;  5LVR A;  1F68 A;  4LZS A;  5DKA A;  5LCW B;  4YH4 A;  5IID A;  5E9V A;  4AVX A;  4Q6F A;  4UP0 A;  5FE1 A;  5CRM A;  4Q0O A;  5FFW A;  2YUR A;  2MIQ A;  3O37 A;  3QZT A;  4IC2 A;  1V87 A;  5FEY A;  4GB0 A;  4A9L A;  3O70 A;  4QSQ A;  4ZC9 A;  4IR3 A;  5DYX A;  2YRE A;  3P1C A;  4WHW A;  3UVX A;  5I1Q A;  4YBS A;  4NQN A;  4J0R A;  1X4J A;  2DAT A;  5DKC A;  5FE9 A;  2M3H A;  4NQM A;  5HFQ A;  4A4C A;  3UVY A;  5CU8 A;  3JVM A;  2LN0 A;  3UVW A;  5ENG A;  3UV5 A;  2XB1 A;  3PUR A;  5TBN A;  5E3D A;  5B79 A;  4BW2 A;  4QSU A;  5DKH A;  4PKL A;  3U5O A;  1WEW A;  4N3W A;  1JM7 A;  4NRC A;  4O70 A;  5AIU A;  1WIL A;  5E9Y A;  5EK9 A;  5HEL A;  3DQV R;  2QIZ A;  5EPR A;  4Q0N A;  3O35 A;  2YEK A;  5CQT A;  3HTK C;  5DY7 A;  5EA1 A;  4HXR A;  5AIT A;  5E9L A;  2WP1 A;  4LLB A;  4NXJ A;  5IGM A;  5ETD A;  1HYJ A;  4NN2 A;  1WE9 A;  3EB5 A;  1ZS5 A;  4GPJ A;  2L0B A;  2VP7 A;  5C89 A;  2G45 A;  2M1R A;  5IBN A;  5D24 A;  4YYN A;  5C87 A;  1JM4 B;  4N4I A;  5EYA F;  4PCI A;  4IR4 A;  3SHB A;  4TYL A;  3KV5 A;  2GRC A;  4HXS A;  5A5Q A;  4C9Z A;  2KWO A;  3GL6 A;  3U5L A;  2CKL B;  3LQH A;  4XUA A;  1WIM A;  2LGV A;  5LJ1 A;  4R7E A;  5F2P A;  4YYH A;  5D1K B;  4YBT A;  4N4F A;  4A9N A;  5CQ5 A;  4HBY A;  5CFW A;  2MUM A;  2LGK A;  3ZYQ A;  5D3L A;  3Q2E A;  4BW3 A;  2YSM A;  5F62 A;  1MM3 A;  3RPG C;  2K16 A;  1IYM A;  4ZUX U;  2YHN A;  5FE6 A;  5I89 A;  3D7C A;  3P1F A;  2KE1 A;  4KCX A;  5FE5 A;  5I88 A;  5FG4 A;  5AD3 A;  2JMD A;  4HXO A;  2LDR A;  5TDW A;  2L84 A;  1Z60 A;  5FE2 A;  3HCT A;  1E6I A;  4HBW A;  4MEN A;  3LXJ A;  3P1D A;  4YK0 A;  3ZVZ B;  4GNG A;  2KGI A;  3V43 A;  2YEL A;  5DKD A;  4B7Y C;  5A83 A;  2R0S A;  1JSP B;  1RMD A;  4R2Y A;  5LUU A;  3S91 A;  4YBM A;  1T1H A;  1XWH A;  5EQ1 A;  5LKT A;  4QR3 A;  4MEP A;  3L11 A;  3MUK A;  5F1L A;  2VJE B;  1DVP A;  5II1 A;  4C66 A;  4NRA A;  1X4U A;  3UV4 A;  4LK9 A; 
#chains in the Genus database with same CATH topology
 3SOU A;  4UIZ A;  2RFJ A;  5KH3 A;  2DX8 A;  3I3J A;  4QEV A;  4CFK A;  2KYU A;  3RTR B;  1DCQ A;  3FAO A;  1JM7 B;  5D3J A;  1F62 A;  4BJX A;  4FK5 A;  2K1J A;  4I7B A;  4YYM A;  4BW1 A;  3FJU B;  5B76 A;  2YYR A;  5D3H A;  5K3Q A;  2LXH C;  4YC9 A;  5G05 B;  3KNV A;  4CUT A;  4LJN A;  4YYG A;  2KRE A;  4O7B A;  5C13 A;  2G4A A;  2KWK A;  5LJ0 A;  5HLS A;  5EP7 A;  5DLX A;  4LKA A;  1WEP A;  4J3I A;  5ETB A;  5I29 A;  3JUE A;  4QYL A;  3RCW A;  4YYI A;  2LXP C;  2DWW A;  4UIT A;  4UIX A;  5CQ8 A;  3UVD A;  5I3L A;  5I40 A;  5KH7 A;  4UIW A;  3HCU A;  5EWW A;  3O36 A;  3LJW A;  5L98 A;  5H1U A;  4UYE A;  2YUC A;  2R0V A;  2Y1N A;  4PPE A;  5L8U A;  1K2F A;  4FO9 A;  1X0J A;  5FB1 A;  4NYV A;  2RNY A;  5KTX A;  5D1M B;  5G0F A;  3AAD A;  5CQA A;  4A9O A;  3SVF A;  4O76 A;  5DW2 A;  4A4B A;  4O7F A;  2L5U A;  4NR4 A;  5IG6 A;  4BHW A;  3RPG B;  2EJN A;  3AQA A;  2ECI A;  4NYW A;  5D0C A;  3UW9 A;  5TCM A;  5CY9 A;  2JRJ A;  5LKU A;  2M6M A;  4YAD A;  1WES A;  5FB0 A;  5SVI A;  2XOY A;  3IHP A;  2VPD A;  5BT5 A;  2IDA A;  2DVQ A;  5A5N A;  5EWC A;  2H0D A;  3N9O A;  5A7C A;  4XY9 A;  5DW1 A;  3D1B A;  5EWD A;  5E9M A;  2YEM A;  4MEO A;  4QEU A;  2NXB A;  3TLP A;  3LRQ A;  4HBV A;  5B8D A;  4IOQ A;  4LC2 A;  5HQ7 A;  4WIV A;  5EU1 A;  5I7Y A;  5F36 A;  5A82 A;  5FDZ A;  2YSJ A;  4A9J A;  5FE3 A;  4CA1 A;  4NYX A;  3KDE C;  5C7N A;  2I50 A;  4KV4 A;  4UYF B;  3ZPV E;  4MEQ A;  4UI9 B;  4NUE A;  5E74 A;  2RSD A;  2RI7 A;  3LDY A;  4CFL A;  5FG5 A;  4IOO A;  5DYC A;  5EVA A;  4QSV A;  3I2D A;  3G0J A;  3O34 A;  5EIC A;  5FFV A;  2L43 A;  4NR7 A;  5C4Q A;  2YU4 A;  4R8P K;  4O78 A;  2YQD A;  5FE0 A;  3N9N A;  5TB6 A;  3LQJ A;  3SVG A;  2VPB A;  4TKP B;  1WEQ A;  2ECW A;  4A9K A;  3L1X A;  3MDB C;  2E6R A;  5KO4 A;  4GNF A;  5C11 A;  4BW4 A;  2KWN A;  5DIN A;  2KU3 A;  2G43 A;  3PLW A;  2ZET C;  4S3O C;  4C67 A;  2R10 A;  2Y43 A;  5CQ6 A;  2RO1 A;  5DYU A;  3G0L A;  3VKG A;  4MR4 A;  4O77 A;  3ZVY A;  2YW8 A;  4B86 C;  3C5K A;  2AN6 A;  5SVY A;  1WEE A;  5LKX A;  2D8S A;  4HXP A;  5DFC A;  4YYJ A;  3HCS A;  4OGC A;  2L80 A;  5CUA A;  5CUE A;  2MJV B;  4UIV A;  5F63 A;  1FP0 A;  5HQ5 A;  2I7K A;  4HBX A;  1WEM A;  4YAB A;  1WFK A;  2YQM A;  4AYC A;  4NUD A;  5D25 A;  4OUF A;  2LGG A;  2I8N A;  3GG3 A;  4A9E A;  1U6G B;  1HYI A;  3KV6 A;  4QR4 A;  5COI A;  5E0R A;  5E3G A;  5IGL A;  2B0O E;  4TT4 A;  5HJC A;  5J0D A;  4WZ3 B;  4IR6 A;  2L75 A;  3S92 A;  5SVI B;  5EWV A;  2CON A;  3MHH A;  4AI6 A;  5HEM A;  4I7D A;  5FE8 A;  4RVR A;  2M85 A;  4AKH A;  4AKI A;  4OGE A;  2XP0 A;  4YY6 A;  2R0Y A;  4CUU A;  2PNX A;  5H9M A;  5D3S A;  5DBM A;  5I86 A;  4CUS A;  3O33 A;  2QIC A;  1Z2Q A;  1ZBD B;  4NRB A;  4O75 A;  4A9H A;  5FER A;  4CCG X;  4UIU A;  1Z6U A;  2KKX A;  2XOZ A;  2YQL A;  2VNF A;  5C8G A;  3FAN A;  4O62 A;  4QF3 A;  4F1P A;  4FIP A;  2HYE D;  2YHO A;  4YYD A;  4NR9 A;  2KIZ A;  4PTB A;  5F25 A;  4DON A;  3U5J A;  5B75 A;  2KTB B;  4QUT A;  2JMI A;  3LVR E;  3HMH A;  5KHM A;  4HXL A;  4QYD A;  2EGM A;  5F61 A;  4A9I A;  4O64 A;  2FFW A;  4AP4 A;  2D9E A;  4A0C D;  4PCE A;  5H85 A;  4Z0O A;  3U5K A;  4QSW A;  5EPS A;  2XOC A;  5CTL A;  5I80 A;  2EA6 A;  5B78 A;  5HEN A;  4O71 A;  5CP5 A;  2MA5 A;  2E7O A;  2F6J A;  2E7N A;  3P1E A;  5ENH A;  1N87 A;  2HDP A;  5E7D A;  2KR4 A;  4ALG A;  2FUI A;  4V3L C;  2CSV A;  4IR5 A;  3HMF A;  5DYA A;  3M99 A;  3M63 A;  4UYD A;  4LYS A;  5CUB A;  5F60 A;  2CKL A;  3DWY A;  2JM3 A;  4X3G A;  3L1Z B;  4S3O B;  2EXU A;  1WEO A;  2L5E A;  3UV2 A;  2FD4 A;  3T6R A;  5B77 A;  2VJF A;  5FE4 A;  5K29 A;  4HXK A;  4MR5 A;  4X2I A;  4QBM A;  5F1H A;  1N72 A;  4PS5 A;  1VFY A;  4KV1 A;  3ZPV 1;  5DFB A;  5JG6 A;  2LV9 A;  5KH9 A;  5ENB A;  4MR6 A;  5DLZ A;  5FFY A;  3JVK A;  3U5M A;  5HFR A;  2EGP A;  5E73 A;  4QC3 A;  3NG2 A;  5A5P A;  1E4U A;  4Z93 A;  2YYN A;  4O7C A;  3ZNI A;  4UYG A;  4YAT A;  4LR6 A;  4QSX A;  4LYW A;  5HRX A;  4P5O B;  4AYC B;  5A81 A;  3T7L A;  2L85 A;  4YY4 A;  1LDK C;  2YW5 A;  2MT5 A;  4PY6 A;  3FEH A;  3VK6 A;  3DPL R;  4QNS A;  2MA6 A;  3N9Q A;  5EIS A;  2ECT A;  5J3X A;  3P5O A;  5SVX A;  5D26 A;  3C6W A;  5ENJ A;  1X4I A;  2F42 A;  3EB6 A;  1WGM A;  3JVL A;  3LQI A;  4NUC A;  5G4R A;  4V3K C;  2RNW A;  5FG6 A;  2XEU A;  4NR8 A;  2C2V S;  4HXM A;  5AMF A;  4TT2 A;  4GND A;  5CPE A;  2OSS A;  5IGK A;  4H9D A;  5LKZ A;  3K2J A;  5L8T A;  4ALH A;  1EQF A;  4LYI A;  5CGP A;  5AME A;  5FH7 A;  2DVV A;  4TU4 A;  4A9M A;  5ENC A;  2G6Q A;  5G4S A;  2VJE A;  3N9L A;  5D3T A;  2BAY A;  4CL9 A;  1CHC A;  2D82 A;  2MD8 C;  4QR5 A;  5IGN A;  2JUN A;  2LSP B;  5H1V A;  1BOR A;  4QEW A;  5FH8 A;  2LGL A;  3O47 A;  3MXF A;  2UZG A;  4W4U A;  3U5P A;  4NS5 A;  4QUU A;  5A5R A;  4QZS A;  5DX4 A;  3U5N A;  2MKE A;  4WZ2 A;  4LAD B;  5ACY A;  5II2 A;  4I7C A;  2WP2 A;  4F52 B;  4UP5 A;  3NXB A;  4Z6I A;  4FJC A;  4J1P A;  3MUL A;  3QZS A;  4XI1 A;  2OXQ C;  5D7X A;  4A9F A;  3DDT A;  4UIY A;  4N4G A;  4O7E A;  4CUQ A;  2KGG A;  2YT5 A;  4QF2 A;  2MNY A;  4LZR A;  4ZQL A;  2CSY A;  1WUG A;  4BBQ A;  2RR4 A;  2YDW A;  3M62 A;  5I83 A;  2JMJ A;  4O74 A;  1WEU A;  4MR3 A;  2KWJ A;  2H60 A;  5CS8 A;  4QB3 A;  4YH3 A;  5KU3 A;  1WEV A;  3IU6 A;  5JI8 A;  4Z1Q A;  5LJ2 A;  4QSR A;  5DFD A;  3IU5 A;  4AUQ B;  3MB3 A;  4LDF A;  4O7A A;  5HQ6 A;  3PUQ A;  2RS9 B;  4OGJ A;  2VJF B;  3KQI A;  5ENI A;  5A85 A;  2E3K A;  1FBV A;  2PUY A;  4XY8 A;  3MHS A;  3QZV A;  4J0S A;  4O72 A;  5I7X A;  5EWH A;  5TDR A;  5EPB A;  5C85 A;  3SOX A;  2OO1 A;  5ENE A;  5L99 A;  1MBM A;  2VPG A;  2KFT A;  3ASL A;  5EGU A;  5CQ7 A;  4XUB A;  2CSZ A;  4TZ2 A;  4XYA A;  4WHU A;  5HM0 A;  5E9K A;  5JWM A;  1JOC A;  1LDJ B;  2OUO A;  4YYK A;  3O7A A;  4E96 A;  4QY4 A;  3FKM X;  4Y03 A;  4LZ2 A;  2H0D B;  5F3A A;  5CUD A;  2DVR A;  3HME A;  5CQ3 A;  3SVH A;  3GV4 A;  4WZ0 A;  2FUU A;  2FSA A;  5CZG A;  4IOR A;  1WEN A;  3JVJ A;  4QST A;  5BT4 A;  2CT2 A;  2N9G A;  5D3P A;  1WUM A;  2E6S A;  3N9M A;  4MVT A;  4LRG A;  5HCL A;  4QQ4 A;  5D3R A;  5CQ4 A;  2MD7 B;  3PHD A;  5HRV A;  4ZW1 A;  4Z6H A;  5G04 B;  2RNX A;  4CLB A;  2ECG A;  4UYF A;  5D3N A;  4TZ8 A;  5KTU A;  5EV9 A;  4QC1 A;  2LQ6 A;  2Y1M A;  4NR6 A;  2ECJ A;  2LAU A;  5TAB A;  2EOD A;  3VKH A;  3MB4 A;  5CUC A;  4HXN A;  4N4H A;  5CRZ A;  5L97 A;  5BT3 A;  1G25 A;  5LVQ A;  2K17 A;  4GNE A;  5A5O A;  5A5S A;  4WA6 A;  4OGI A;  4F3I A;  4IC3 A;  5KTW A;  3ONI A;  4UYH A;  5EM3 A;  4QSS A;  3MQM A;  2F6N A;  4NR5 A;  4FLP A;  3FL2 A;  5TRB A;  4TU6 A;  4Z1S A;  5AD2 A;  2QJ0 A;  4AKG A;  5F5Z A;  5H1T A;  2DKW A;  5L96 A;  1MM2 A;  2C2L A;  4L7X A;  4MSX A;  4TS8 A;  4A49 A;  5FH6 A;  4AKN A;  3ZYU A;  4CUR A;  1VD4 A;  5CUG A;  5FBX A;  4TTE A;  3Q2F A;  2ECV A;  3N9P A;  4ZDT A;  2K4D A;  4YAX A;  4L58 A;  5HRW A;  2LRI C;  3ZTG A;  5FE7 A;  5D1L B;  4QSP A;  5E9I A;  2VPE A;  5EI4 A;  3Q1D A;  3SOW A;  2DVS A;  2ECN A;  2MNZ A;  2NAA A;  5ENF A;  1VYX A;  4TT6 A;  4TQN A;  3DAI A;  4CUP A;  5LVR A;  1F68 A;  4LZS A;  5DKA A;  5LCW B;  4YH4 A;  5IID A;  5E9V A;  4AVX A;  2IQJ A;  4Q6F A;  4UP0 A;  5FE1 A;  5CRM A;  4Q0O A;  5FFW A;  2L7P A;  2YUR A;  2MIQ A;  3O37 A;  3QZT A;  4IC2 A;  1V87 A;  5FEY A;  4GB0 A;  4A9L A;  3O70 A;  4QSQ A;  4ZC9 A;  4IR3 A;  2E61 A;  5DYX A;  2YRE A;  3P1C A;  4WHW A;  2YVR A;  1ZKR A;  3UVX A;  5I1Q A;  4YBS A;  4NQN A;  4J0R A;  3ERR A;  1X4J A;  2DAT A;  5DKC A;  5FE9 A;  2M3H A;  4NQM A;  5HFQ A;  4A4C A;  2OWA A;  3UVY A;  5CU8 A;  3JVM A;  2LN0 A;  3UVW A;  5ENG A;  3UV5 A;  2XB1 A;  3PUR A;  2DSM A;  5TBN A;  5E3D A;  5B79 A;  4BW2 A;  2KKY A;  4QSU A;  5DKH A;  4PKL A;  3U5O A;  1WEW A;  3SUB A;  4N3W A;  1JM7 A;  4NRC A;  4O70 A;  5AIU A;  1WIL A;  5E9Y A;  5EK9 A;  5HEL A;  3DQV R;  2QIZ A;  5EPR A;  4Q0N A;  3O35 A;  2YEK A;  5CQT A;  3HTK C;  5DY7 A;  5EA1 A;  4HXR A;  3T9K A;  5AIT A;  5E9L A;  2WP1 A;  4LLB A;  4NXJ A;  5IGM A;  5ETD A;  1HYJ A;  4NN2 A;  1WE9 A;  3EB5 A;  1ZS5 A;  4GPJ A;  2L0B A;  2VP7 A;  5C89 A;  2G45 A;  2M1R A;  5IBN A;  5D24 A;  4YYN A;  5C87 A;  1JM4 B;  4N4I A;  2CRW A;  4PCI A;  4IR4 A;  3H7H A;  4TYL A;  3KV5 A;  5EYA F;  2GRC A;  4HXS A;  5A5Q A;  3SHB A;  2KWO A;  3GL6 A;  4C9Z A;  3U5L A;  2CKL B;  3LQH A;  4XUA A;  1WIM A;  2LGV A;  5LJ1 A;  4R7E A;  5F2P A;  4YYH A;  5D1K B;  4YBT A;  4N4F A;  4A9N A;  2CRR A;  5CQ5 A;  4HBY A;  2P57 A;  5CFW A;  2MUM A;  2LGK A;  3ZYQ A;  5D3L A;  3Q2E A;  4BW3 A;  2YSM A;  5F62 A;  1MM3 A;  3RPG C;  2K16 A;  3E2D A;  1IYM A;  4ZUX U;  3FM8 C;  2YHN A;  5FE6 A;  5I89 A;  2M13 A;  3D7C A;  3P1F A;  2KE1 A;  4KCX A;  5FE5 A;  5I88 A;  1PUO A;  5FG4 A;  5AD3 A;  2JMD A;  4HXO A;  2LDR A;  5TDW A;  2L84 A;  1Z60 A;  5FE2 A;  3HCT A;  1E6I A;  4HBW A;  4MEN A;  3LXJ A;  3P1D A;  4YK0 A;  3ZVZ B;  2D8U A;  4GNG A;  2KGI A;  3V43 A;  2YEL A;  5DKD A;  4B7Y C;  5A83 A;  2R0S A;  1JSP B;  1RMD A;  4R2Y A;  5LUU A;  3S91 A;  4YBM A;  1T1H A;  1XWH A;  5EQ1 A;  5LKT A;  4QR3 A;  4MEP A;  3L11 A;  3LVQ E;  3M7K A;  4Z0R A;  3MUK A;  5F1L A;  3DWD A;  2VJE B;  1DVP A;  5II1 A;  3LJU X;  4C66 A;  3D1D A;  4NRA A;  1X4U A;  2DJA A;  3UV4 A;  4LK9 A; 
#chains in the Genus database with same CATH homology
 3SOU A;  4UIZ A;  2RFJ A;  5KH3 A;  2DX8 A;  3I3J A;  4QEV A;  4CFK A;  2KYU A;  3RTR B;  1JM7 B;  5D3J A;  1F62 A;  4BJX A;  4FK5 A;  2K1J A;  4I7B A;  4YYM A;  4BW1 A;  5B76 A;  2YYR A;  5D3H A;  2LXH C;  4YC9 A;  5G05 B;  3KNV A;  4CUT A;  4LJN A;  4YYG A;  2KRE A;  4O7B A;  5C13 A;  2G4A A;  2KWK A;  5LJ0 A;  5HLS A;  5EP7 A;  5DLX A;  4LKA A;  1WEP A;  4J3I A;  5ETB A;  5I29 A;  4QYL A;  3RCW A;  4YYI A;  2LXP C;  2DWW A;  4UIT A;  4UIX A;  5CQ8 A;  3UVD A;  5I3L A;  5I40 A;  5KH7 A;  4UIW A;  3HCU A;  5EWW A;  3O36 A;  3LJW A;  5L98 A;  5H1U A;  4UYE A;  2YUC A;  2R0V A;  2Y1N A;  4PPE A;  5L8U A;  1K2F A;  4FO9 A;  1X0J A;  5FB1 A;  4NYV A;  2RNY A;  5KTX A;  5D1M B;  5G0F A;  3AAD A;  5CQA A;  4A9O A;  3SVF A;  4O76 A;  5DW2 A;  4A4B A;  4O7F A;  2L5U A;  4NR4 A;  5IG6 A;  4BHW A;  3RPG B;  3AQA A;  2ECI A;  4NYW A;  5D0C A;  3UW9 A;  5TCM A;  5CY9 A;  2JRJ A;  5LKU A;  2M6M A;  4YAD A;  1WES A;  5FB0 A;  3IHP A;  2VPD A;  5BT5 A;  2IDA A;  2DVQ A;  5A5N A;  5EWC A;  2H0D A;  3N9O A;  5A7C A;  4XY9 A;  5DW1 A;  5EWD A;  5E9M A;  2YEM A;  4MEO A;  4QEU A;  2NXB A;  3TLP A;  3LRQ A;  4HBV A;  5B8D A;  4IOQ A;  4LC2 A;  5HQ7 A;  4WIV A;  5EU1 A;  5I7Y A;  5F36 A;  5A82 A;  5FDZ A;  2YSJ A;  4A9J A;  5FE3 A;  4CA1 A;  4NYX A;  5C7N A;  2I50 A;  4KV4 A;  4UYF B;  3ZPV E;  4MEQ A;  4UI9 B;  4NUE A;  5E74 A;  2RSD A;  2RI7 A;  4CFL A;  5FG5 A;  4IOO A;  5DYC A;  5EVA A;  4QSV A;  3I2D A;  3G0J A;  3O34 A;  5EIC A;  5FFV A;  2L43 A;  4NR7 A;  5C4Q A;  2YU4 A;  4R8P K;  4O78 A;  2YQD A;  5FE0 A;  3N9N A;  5TB6 A;  3LQJ A;  3SVG A;  2VPB A;  4TKP B;  1WEQ A;  2ECW A;  4A9K A;  3L1X A;  2E6R A;  5KO4 A;  4GNF A;  5C11 A;  4BW4 A;  2KWN A;  5DIN A;  2KU3 A;  2G43 A;  2ZET C;  4S3O C;  4C67 A;  2R10 A;  2Y43 A;  5CQ6 A;  2RO1 A;  5DYU A;  3G0L A;  4MR4 A;  4O77 A;  3ZVY A;  2YW8 A;  4B86 C;  3C5K A;  2AN6 A;  1WEE A;  5LKX A;  2D8S A;  4HXP A;  5DFC A;  4YYJ A;  3HCS A;  2L80 A;  5CUA A;  5CUE A;  2MJV B;  4UIV A;  5F63 A;  1FP0 A;  5HQ5 A;  2I7K A;  4HBX A;  1WEM A;  4YAB A;  1WFK A;  2YQM A;  4AYC A;  4NUD A;  5D25 A;  4OUF A;  2LGG A;  2I8N A;  3GG3 A;  4A9E A;  1U6G B;  1HYI A;  3KV6 A;  4QR4 A;  5COI A;  5E0R A;  5E3G A;  5IGL A;  4TT4 A;  5HJC A;  5J0D A;  4WZ3 B;  4IR6 A;  2L75 A;  3S92 A;  5EWV A;  3MHH A;  5HEM A;  4I7D A;  5FE8 A;  4RVR A;  2M85 A;  4YY6 A;  2R0Y A;  4CUU A;  2PNX A;  5H9M A;  5D3S A;  5DBM A;  5I86 A;  4CUS A;  3O33 A;  2QIC A;  1Z2Q A;  1ZBD B;  4NRB A;  4O75 A;  4A9H A;  5FER A;  4CCG X;  4UIU A;  1Z6U A;  2YQL A;  4QF3 A;  2VNF A;  5C8G A;  4FIP A;  2HYE D;  2YHO A;  4YYD A;  4NR9 A;  2KIZ A;  4PTB A;  5F25 A;  4DON A;  3U5J A;  5B75 A;  2KTB B;  4QUT A;  2JMI A;  3HMH A;  5KHM A;  4HXL A;  4QYD A;  5F61 A;  4A9I A;  4O64 A;  4AP4 A;  2D9E A;  4A0C D;  4PCE A;  5H85 A;  3U5K A;  4QSW A;  5EPS A;  5CTL A;  5I80 A;  2EA6 A;  5B78 A;  5HEN A;  4O71 A;  5CP5 A;  2MA5 A;  2E7O A;  2F6J A;  2E7N A;  3P1E A;  5ENH A;  1N87 A;  2HDP A;  5E7D A;  2KR4 A;  4ALG A;  2FUI A;  4V3L C;  4IR5 A;  3HMF A;  5DYA A;  3M99 A;  3M63 A;  4UYD A;  4LYS A;  5CUB A;  5F60 A;  2CKL A;  3DWY A;  4X3G A;  3L1Z B;  4S3O B;  5B77 A;  1WEO A;  2L5E A;  3UV2 A;  3T6R A;  2VJF A;  5FE4 A;  5K29 A;  4HXK A;  4MR5 A;  4X2I A;  4QBM A;  5F1H A;  1N72 A;  4PS5 A;  1VFY A;  4KV1 A;  3ZPV 1;  5DFB A;  5JG6 A;  2LV9 A;  5KH9 A;  5ENB A;  4MR6 A;  5DLZ A;  5FFY A;  3JVK A;  3U5M A;  5HFR A;  2EGP A;  5E73 A;  4QC3 A;  3NG2 A;  5A5P A;  1E4U A;  4Z93 A;  2YYN A;  4O7C A;  3ZNI A;  4UYG A;  4YAT A;  4LR6 A;  4QSX A;  4LYW A;  5HRX A;  4P5O B;  4AYC B;  5A81 A;  3T7L A;  2L85 A;  4YY4 A;  1LDK C;  2YW5 A;  2MT5 A;  4PY6 A;  3VK6 A;  3DPL R;  4QNS A;  2MA6 A;  3N9Q A;  5EIS A;  2ECT A;  5J3X A;  3P5O A;  5D26 A;  3C6W A;  5ENJ A;  1X4I A;  2F42 A;  3EB6 A;  1WGM A;  3JVL A;  3LQI A;  4NUC A;  5G4R A;  4V3K C;  2RNW A;  5FG6 A;  2XEU A;  4NR8 A;  2C2V S;  4HXM A;  5AMF A;  4TT2 A;  4GND A;  5CPE A;  2OSS A;  5IGK A;  5LKZ A;  3K2J A;  5L8T A;  4ALH A;  1EQF A;  4LYI A;  5CGP A;  5AME A;  5FH7 A;  2DVV A;  4TU4 A;  4A9M A;  5ENC A;  2G6Q A;  5G4S A;  2VJE A;  3N9L A;  5D3T A;  2BAY A;  4CL9 A;  1CHC A;  2D82 A;  2MD8 C;  4QR5 A;  5IGN A;  2LSP B;  5H1V A;  1BOR A;  4QEW A;  5FH8 A;  2LGL A;  3MXF A;  2UZG A;  4W4U A;  3U5P A;  4NS5 A;  4QUU A;  5A5R A;  4QZS A;  5DX4 A;  3U5N A;  4WZ2 A;  4LAD B;  5ACY A;  5II2 A;  4I7C A;  2WP2 A;  4F52 B;  4UP5 A;  3NXB A;  4Z6I A;  4FJC A;  4J1P A;  3MUL A;  3QZS A;  4XI1 A;  2OXQ C;  5D7X A;  4A9F A;  4UIY A;  4N4G A;  4O7E A;  4CUQ A;  2KGG A;  2YT5 A;  4QF2 A;  2MNY A;  4LZR A;  4ZQL A;  2CSY A;  1WUG A;  4BBQ A;  2YDW A;  3M62 A;  5I83 A;  2JMJ A;  4O74 A;  1WEU A;  4MR3 A;  2KWJ A;  2H60 A;  5CS8 A;  4QB3 A;  4YH3 A;  5KU3 A;  1WEV A;  3IU6 A;  5JI8 A;  4Z1Q A;  5LJ2 A;  4QSR A;  5DFD A;  3IU5 A;  4AUQ B;  3MB3 A;  4LDF A;  4O7A A;  5HQ6 A;  3PUQ A;  2RS9 B;  4OGJ A;  2VJF B;  3KQI A;  5ENI A;  5A85 A;  2E3K A;  1FBV A;  2PUY A;  4XY8 A;  3MHS A;  3QZV A;  4J0S A;  4O72 A;  5I7X A;  5EWH A;  5TDR A;  5EPB A;  5C85 A;  3SOX A;  2OO1 A;  5ENE A;  5L99 A;  3ASL A;  2VPG A;  2KFT A;  5EGU A;  5CQ7 A;  4XUB A;  2CSZ A;  4TZ2 A;  4XYA A;  4WHU A;  5HM0 A;  5E9K A;  5JWM A;  1JOC A;  1LDJ B;  2OUO A;  4YYK A;  3O7A A;  4E96 A;  4QY4 A;  3FKM X;  4Y03 A;  4LZ2 A;  2H0D B;  5F3A A;  5CUD A;  2DVR A;  3HME A;  5CQ3 A;  3SVH A;  3GV4 A;  4WZ0 A;  2FUU A;  2FSA A;  5CZG A;  4IOR A;  1WEN A;  3JVJ A;  4QST A;  5BT4 A;  2CT2 A;  2N9G A;  5D3P A;  1WUM A;  2E6S A;  3N9M A;  4MVT A;  4LRG A;  5HCL A;  5D3R A;  5CQ4 A;  2MD7 B;  3PHD A;  5HRV A;  4ZW1 A;  4Z6H A;  5G04 B;  2RNX A;  4CLB A;  2ECG A;  4UYF A;  5D3N A;  4TZ8 A;  5KTU A;  5EV9 A;  4QC1 A;  2LQ6 A;  2Y1M A;  4NR6 A;  2ECJ A;  5TAB A;  2EOD A;  3MB4 A;  5CUC A;  4HXN A;  4N4H A;  5CRZ A;  5L97 A;  5BT3 A;  1G25 A;  5LVQ A;  2K17 A;  4GNE A;  5A5O A;  5A5S A;  4WA6 A;  4OGI A;  4F3I A;  4IC3 A;  5KTW A;  3ONI A;  4UYH A;  5EM3 A;  4QSS A;  3MQM A;  2F6N A;  4NR5 A;  4FLP A;  3FL2 A;  5TRB A;  4TU6 A;  4Z1S A;  5AD2 A;  2QJ0 A;  5F5Z A;  5H1T A;  2DKW A;  5L96 A;  1MM2 A;  2C2L A;  4L7X A;  4MSX A;  4TS8 A;  4A49 A;  5FH6 A;  4AKN A;  3ZYU A;  4CUR A;  1VD4 A;  5CUG A;  5FBX A;  4TTE A;  3Q2F A;  2ECV A;  3N9P A;  4ZDT A;  2K4D A;  4YAX A;  4L58 A;  5HRW A;  2LRI C;  3ZTG A;  5FE7 A;  5D1L B;  4QSP A;  5E9I A;  2VPE A;  5EI4 A;  3SOW A;  2DVS A;  2ECN A;  2MNZ A;  2NAA A;  5ENF A;  1VYX A;  4TT6 A;  4TQN A;  3DAI A;  4CUP A;  5LVR A;  1F68 A;  4LZS A;  5DKA A;  5LCW B;  4YH4 A;  5IID A;  5E9V A;  4AVX A;  4Q6F A;  4UP0 A;  5FE1 A;  5CRM A;  4Q0O A;  5FFW A;  2YUR A;  2MIQ A;  3O37 A;  3QZT A;  4IC2 A;  1V87 A;  5FEY A;  4GB0 A;  4A9L A;  3O70 A;  4QSQ A;  4ZC9 A;  4IR3 A;  5DYX A;  2YRE A;  3P1C A;  4WHW A;  3UVX A;  5I1Q A;  4YBS A;  4NQN A;  4J0R A;  1X4J A;  2DAT A;  5DKC A;  5FE9 A;  2M3H A;  4NQM A;  5HFQ A;  4A4C A;  3UVY A;  5CU8 A;  3JVM A;  2LN0 A;  3UVW A;  5ENG A;  3UV5 A;  2XB1 A;  3PUR A;  5TBN A;  5E3D A;  5B79 A;  4BW2 A;  4QSU A;  5DKH A;  4PKL A;  3U5O A;  1WEW A;  4N3W A;  1JM7 A;  4NRC A;  4O70 A;  5AIU A;  1WIL A;  5E9Y A;  5EK9 A;  5HEL A;  3DQV R;  2QIZ A;  5EPR A;  4Q0N A;  3O35 A;  2YEK A;  5CQT A;  3HTK C;  5DY7 A;  5EA1 A;  4HXR A;  5AIT A;  5E9L A;  2WP1 A;  4LLB A;  4NXJ A;  5IGM A;  5ETD A;  1HYJ A;  4NN2 A;  1WE9 A;  3EB5 A;  1ZS5 A;  4GPJ A;  2L0B A;  2VP7 A;  5C89 A;  2G45 A;  2M1R A;  5IBN A;  5D24 A;  4YYN A;  5C87 A;  1JM4 B;  4N4I A;  5EYA F;  4PCI A;  4IR4 A;  3SHB A;  4TYL A;  3KV5 A;  2GRC A;  4HXS A;  5A5Q A;  4C9Z A;  2KWO A;  3GL6 A;  3U5L A;  2CKL B;  3LQH A;  4XUA A;  1WIM A;  2LGV A;  5LJ1 A;  4R7E A;  5F2P A;  4YYH A;  5D1K B;  4YBT A;  4N4F A;  4A9N A;  5CQ5 A;  4HBY A;  5CFW A;  2MUM A;  2LGK A;  3ZYQ A;  5D3L A;  3Q2E A;  4BW3 A;  2YSM A;  5F62 A;  1MM3 A;  3RPG C;  2K16 A;  1IYM A;  4ZUX U;  2YHN A;  5FE6 A;  5I89 A;  3D7C A;  3P1F A;  2KE1 A;  4KCX A;  5FE5 A;  5I88 A;  5FG4 A;  5AD3 A;  2JMD A;  4HXO A;  2LDR A;  5TDW A;  2L84 A;  1Z60 A;  5FE2 A;  3HCT A;  1E6I A;  4HBW A;  4MEN A;  3LXJ A;  3P1D A;  4YK0 A;  3ZVZ B;  4GNG A;  2KGI A;  3V43 A;  2YEL A;  5DKD A;  4B7Y C;  5A83 A;  2R0S A;  1JSP B;  1RMD A;  4R2Y A;  5LUU A;  3S91 A;  4YBM A;  1T1H A;  1XWH A;  5EQ1 A;  5LKT A;  4QR3 A;  4MEP A;  3L11 A;  3MUK A;  5F1L A;  2VJE B;  1DVP A;  5II1 A;  4C66 A;  4NRA A;  1X4U A;  3UV4 A;  4LK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...