3U5MA

Crystal structure of trim33 phd-bromo in the free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
203
structure length
178
Chain Sequence
PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 49
structure length 178
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5mA01
4TZ8A 5F61A 5II2A 2MT5A 3G0JA 5COIA 4YY4A 4BW3A 2E3KA 1X0JA 4QSQA 4OUFA 4YH4A 5EWCA 5A85A 1LDKC 3T7LA 4XI1A 5H1VA 5FE8A 5FG4A 5FG5A 3L1ZB 5TDRA 3L1XA 2LXPC 3DAIA 4CFKA 5HQ5A 2KE1A 2PNXA 4GNFA 5ENIA 2ECNA 5FE2A 2KWJA 4QEUA 5LVQA 4UP5A 2EA6A 4IOQA 1WGMA 3P1FA 2AN6A 4NQNA 5HENA 5LKTA 5D1MB 4TT6A 3QZSA 5D26A 2RNXA 2DX8A 2CKLA 4ZDTA 3VK6A 4QNSA 4XY9A 4YK0A 1JOCA 3M62A 2RSDA 1WESA 2GRCA 4LZRA 5L8TA 4TS8A 2MNYA 4NXJA 5F63A 1BORA 5D3JA 5EP7A 2KYUA 4HXMA 3DQVR 4PY6A 4YBTA 4OGIA 4N4GA 2DATA 5EPRA 4C67A 1WE9A 4NQMA 5E74A 5EWVA 4UYHA 4PCIA 5CUEA 4A9OA 3O36A 3P5OA 2RO1A 3QZTA 4O7FA 4TQNA 3UVDA 4CLBA 4GNEA 5E9VA 2FSAA 2MA5A 4IR6A 5L99A 2ECIA 3O7AA 5C8GA 2MA6A 5FERA 3G0LA 2L5EA 2RFJA 5FB1A 2QICA 5AITA 4QR5A 4XUBA 4I7BA 4QF2A 4A0CD 2DWWA 4MR6A 4O7AA 5I89A 3N9QA 3SOXA 4QC3A 2MD8C 4HXOA 1JM4B 1VYXA 2DVSA 5FE9A 4PTBA 2ECJA 3MXFA 4MVTA 4QY4A 4V3KC 4NR7A 5KTUA 5C13A 4MEQA 5C7NA 5EICA 3PURA 4GNDA 4Z6HA 4BW4A 3LQHA 4TYLA 5CS8A 4LRGA 2BAYA 2LGKA 5BT3A 3KQIA 5B79A 5D3HA 4UIXA 3Q2FA 3ASLA 5TBNA 4A4CA 3TLPA 4IR3A 3QZVA 1WEEA 4YATA 3FKMX 5CUGA 4X2IA 5A5QA 5F60A 2M3HA 5TDWA 4B86C 4BW1A 4MENA 5LKXA 5D24A 1T1HA 5D3RA 5E73A 2LRIC 4J0RA 5DKCA 5I7YA 1LDJB 3GV4A 3KNVA 2YEMA 2YSMA 5EPBA 5LJ2A 3HMHA 5E9KA 2E7NA 4TT4A 5CUCA 2MUMA 5KU3A 5EU1A 3S91A 1JM7A 4F3IA 4UYFA 2N9GA 5TRBA 1FP0A 4UYDA 3HCTA 5ENGA 2YDWA 5D7XA 5EA1A 5G0FA 3ONIA 4O74A 2VJEB 3U5NA 5IGMA 5CTLA 4MR5A 5IG6A 2CT2A 2MJVB 5DLZA 5FFWA 4CA1A 5LVRA 5JWMA 4IR4A 5DW1A 4C66A 4ZC9A 5EQ1A 2FUIA 5H9MA 2JMIA 4A9MA 5HEMA 4S3OB 4NR5A 2E6SA 3ZTGA 5ETBA 5EISA 5D3SA 5A81A 2L5UA 2MNZA 2H60A 2L43A 4QZSA 5EWHA 3LRQA 4DONA 5ACYA 2I8NA 2YSJA 5E7DA 4A9JA 3LJWA 5A5SA 5IGLA 4HXSA 5HJCA 4WHWA 4CURA 5CQ5A 4L58A 4NUCA 3RCWA 2MD7B 4A9IA 3ZYQA 4UYFB 5KTXA 3HCSA 2M6MA 3JVKA 5E9MA 4Y03A 3U5JA 3U5KA 3SVFA 1WEWA 2F6NA 4HXPA 5IBNA 1EQFA 5KTWA 4IC3A 5FFVA 5L97A 3DWYA 5EI4A 4QEVA 3U5OA 3AADA 5A5NA 1WUMA 4WZ3B 2VP7A 2LV9A 5F1HA 5AIUA 5ENCA 1DVPA 5E9IA 5D0CA 5DYXA 4KV1A 4TU4A 4NUEA 4BJXA 2F6JA 5CRZA 4BBQA 5E9LA 4HBWA 2DVVA 4NRBA 5B8DA 2C2VS 4BW2A 5H1TA 1RMDA 2VPDA 4LC2A 4YH3A 5B75A 4MEOA 1WUGA 5D3PA 2ZETC 5LCWB 2VPBA 3IU5A 5CGPA 4O7BA 4O75A 5I80A 3UVWA 4YYHA 5C85A 3KV6A 5DKHA 5HQ6A 4MSXA 4HXRA 5LJ1A 4OGJA 4HBXA 4YY6A 2YEKA 5DKDA 5I40A 1X4JA 4L7XA 5J3XA 2NXBA 4CUPA 2VPEA 3M63A 5EV9A 4QSRA 2EGPA 4FO9A 5CU8A 4QYLA 4A9HA 1WEMA 4YAXA 5I86A 2R0VA 3U5PA 5ENBA 2DVRA 3N9PA 1WENA 3PHDA 2I50A 2EODA 4B7YC 2I7KA 5E0RA 4IOOA 1WFKA 2LGGA 4UITA 4YC9A 4YYMA 2OXQC 5D1KB 3KV5A 2R0SA 2C2LA 3UV2A 5AMEA 5TCMA 4N4HA 2L80A 5CP5A 5HFQA 4AVXA 5HQ7A 2L0BA 5CQ4A 4IC2A 5BT5A 4HXKA 2XEUA 1XWHA 4Z93A 5F5ZA 4NN2A 4FK5A 4CCGX 5FH6A 4S3OC 1F68A 3LQIA 2HYED 4QR4A 5HRVA 2VJFB 2YURA 5CUDA 5FE6A 2YU4A 5II1A 4LR6A 2G43A 3EB6A 5DINA 3UV5A 4QF3A 4YYDA 3ZYUA 4LZ2A 1HYJA 5EM3A 2OO1A 5E9YA 3GL6A 3U5MA 4J1PA 4WZ2A 4CFLA 4HXNA 5I29A 3MHSA 2RS9B 2Y1NA 5B78A 1ZS5A 4QSUA 3O35A 2HDPA 5DKAA 2VJEA 1JSPB 4F52B 3JVLA 5DW2A 4LJNA 1HYIA 4A9EA 5FE0A 5AMFA 4LADB 5D1LB 2R0YA 5DYUA 4KCXA 5EGUA 3P1EA 5FE1A 3O37A 4O7CA 4UIVA 5A5PA 2WP2A 4YYNA 1WEQA 5KHMA 4ZQLA 3HMEA 2KREA 3IU6A 2ECVA 4LYSA 1FBVA 4BHWA 4O7EA 5HRWA 5I1QA 2D82A 3P1CA 4N3WA 2YQMA 2Y43A 2E7OA 5JI8A 1MM2A 2YW8A 5F3AA 3LQJA 4QSTA 2VJFA 4A4BA 3N9MA 2VPGA 2KGGA 2YQLA 5ENHA 2KWOA 2YYNA 5FE4A 3SOWA 4PS5A 2VNFA 4YABA 3RPGC 2Y1MA 2L85A 4Q0NA 1G25A 4LK9A 4I7CA 4QB3A 4A9FA 5J0DA 2JMJA 3ZVYA 2YUCA 3ZPVE 4R7EA 5CPEA 5C89A 4RVRA 4TZ2A 2KGIA 4QSXA 3MB3A 4WZ0A 3ZVZB 2YT5A 1U6GB 5AD3A 2KFTA 5I3LA 5DYCA 3HMFA 2QJ0A 3RPGB 4ALHA 2YW5A 4QYDA 1WEUA 4W4UA 2G4AA 1E6IA 2K17A 3PUQA 1N87A 5F1LA 2JMDA 2KTBB 3SHBA 1E4UA 5CQAA 5DY7A 3C5KA 2R10A 3O33A 4LLBA 4TKPB 3N9NA 2K16A 5ENJA 4Z6IA 1VD4A 4PPEA 5A83A 2KIZA 1WIMA 4MR3A 2M1RA 4O78A 5G04B 4UYEA 4NRAA 4UIUA 3SVGA 4UP0A 2CSZA 4MEPA 5EK9A 5EWDA 3SVHA 4TTEA 5ENFA 5E3DA 3M99A 4AP4A 2IDAA 4O77A 1WEOA 4UIWA 5A82A 3MHHA 5DFCA 4AYCB 2LSPB 2RNWA 2M85A 4UI9B 4CUTA 3RTRB 4YYJA 4FIPA 5FH8A 5FE3A 2XB1A 4YBMA 5CFWA 4YYIA 4ZW1A 5I88A 4KV4A 1Z6UA 3GG3A 4NR6A 2FUUA 5LKZA 4QR3A 4HXLA 4TU6A 5FE7A 2G6QA 2MIQA 5TABA 2OUOA 2RI7A 4HBVA 2NAAA 4IR5A 2ECWA 5EPSA 5IIDA 4Z1QA 5CZGA 4O72A 4X3GA 3MQMA 4N4IA 5CQ7A 4LZSA 4QSPA 4NR4A 4NYXA 5D3TA 5I83A 5L8UA 1WEVA 4FJCA 3AQAA 3FL2A 5CQTA 3Q2EA 4E96A 5EVAA 4Z1SA 4NRCA 3UVXA 5A5OA 4NS5A 2LDRA 3HTKC 2WP1A 2CKLB 4NR8A 4NYWA 5H1UA 5LUUA 5F25A 5KH7A 5KH3A 4AYCA 2YHNA 5CY9A 1F62A 5FEYA 4NR9A 4XY8A 5E3GA 4CUSA 2JRJA 4QBMA 5AD2A 3UV4A 2KR4A 5D3LA 3U5LA 2ECGA 5B76A 4ALGA 3HCUA 4QUTA 2D9EA 5DFDA 4QC1A 5DYAA 4O64A 4NUDA 4TT2A 2LXHC 2YELA 3IHPA 5G4SA 3O70A 3I2DA 4P5OB 3K2JA 5FFYA 4FLPA 3ZPV1 5B77A 5L96A 3P1DA 2YHOA 4LDFA 1MM3A 5FDZA 5FG6A 4A9NA 1N72A 2OSSA 4A49A 3D7CA 5DFBA 5C87A 4AKNA 5ENEA 1V87A 5F2PA 5A7CA 3T6RA 4YADA 4GPJA 4YYGA 2G45A 4QEWA 3I3JA 2YREA 5IGNA 4C9ZA 2H0DA 1CHCA 4R8PK 2RNYA 3JVMA 4A9KA 5C4QA 3N9OA 5HM0A 5LJ0A 5F62A 4J0SA 4NYVA 2CSYA 2DVQA 4XYAA 5FB0A 4LYIA 5FBXA 4XUAA 1ZBDB 1WEPA 2D8SA 2LN0A 3EB5A 5EYAF 4WHUA 3C6WA 4ZUXU 2KU3A 4QSSA 2ECTA 3JVJA 5DBMA 4V3LC 5DLXA 3ZNIA 5LKUA 5I7XA 3S92A 5HRXA 2PUYA 4PCEA 3N9LA 5K29A 4CL9A 2K1JA 2K4DA 2LQ6A 3V43A 5EWWA 5F36A 4QSVA 5CQ3A 4YYKA 2E6RA 3NG2A 3SOUA 4GNGA 4N4FA 4O76A 4UIZA 5CUAA 4IORA 4QSWA 3UVYA 3DPLR 4MR4A 5HFRA 2LGLA 5FH7A 3MULA 5ETDA 4YBSA 4AUQB 4R2YA 5BT4A 5KO4A 5A5RA 1VFYA 1K2FA 2UZGA 4GB0A 5G4RA 1X4IA 5HLSA 5CQ6A 3MUKA 5IGKA 5KH9A 1Z60A 4WA6A 5DX4A 4CUUA 4UYGA 1JM7B 5L98A 1X4UA 2H0DB 3NXBA 4Q6FA 4HBYA 5HCLA 4LYWA 2LGVA 4I7DA 4UIYA 3UW9A 1WILA 5JG6A 4A9LA 3MB4A 5D3NA 5C11A 2QIZA 5CRMA 2KWNA 2YYRA 1IYMA 4J3IA 2DKWA 2L75A 1Z2QA 3LXJA 2F42A 4WIVA 5G05B 5TB6A 2YQDA 5HELA 4PKLA 4Q0OA 5CQ8A 4LKAA 3O34A 5D25A 5H85A 5FE5A 2KWKA 3L11A 4CUQA 4O70A 5CUBA 2L84A 4QUUA 4O71A
chains in the Genus database with same CATH superfamily
4TZ8A 5F61A 5II2A 2MT5A 3G0JA 5COIA 4YY4A 4BW3A 2E3KA 1X0JA 4QSQA 4OUFA 4YH4A 5EWCA 5A85A 1LDKC 3T7LA 4XI1A 5H1VA 5FE8A 5FG4A 5FG5A 3L1ZB 5TDRA 3L1XA 2LXPC 3DAIA 4CFKA 5HQ5A 2KE1A 2PNXA 4GNFA 5ENIA 2ECNA 5FE2A 3FJUB 2KWJA 3Q1DA 4QEUA 5LVQA 4UP5A 2EA6A 4IOQA 1WGMA 3P1FA 2AN6A 4NQNA 5HENA 5LKTA 2E61A 5D1MB 4TT6A 2FFWA 3QZSA 5D26A 2RNXA 2DX8A 2CKLA 2KKXA 2IQJA 4ZDTA 3VK6A 4QNSA 4XY9A 4YK0A 1JOCA 3M62A 2RSDA 1WESA 2GRCA 4LZRA 5L8TA 4TS8A 2MNYA 4NXJA 5F63A 1BORA 5D3JA 5EP7A 3PLWA 2KYUA 4HXMA 3DQVR 4PY6A 4YBTA 4OGIA 4N4GA 4AKHA 3VKHA 2DATA 5EPRA 4C67A 1WE9A 2EJNA 4NQMA 5E74A 5EWVA 4UYHA 4PCIA 5CUEA 4A9OA 3O36A 3P5OA 2RO1A 3QZTA 4O7FA 4TQNA 3UVDA 4CLBA 4OGEA 2EXUA 4GNEA 5E9VA 2FSAA 2MA5A 4IR6A 5L99A 2ECIA 3O7AA 5C8GA 2MA6A 5FERA 3G0LA 2L5EA 2RFJA 5FB1A 2QICA 5AITA 4QR5A 4XUBA 4I7BA 4QF2A 4A0CD 2DWWA 4MR6A 4O7AA 5I89A 3N9QA 3JUEA 3SOXA 4QC3A 2MD8C 4HXOA 1JM4B 1VYXA 2DVSA 5FE9A 4PTBA 2ECJA 3MXFA 4MVTA 4QY4A 4V3KC 4NR7A 5KTUA 5C13A 4MEQA 5C7NA 5EICA 3PURA 4GNDA 4Z6HA 4BW4A 3LQHA 4TYLA 5CS8A 4LRGA 2BAYA 2LGKA 2XOCA 5BT3A 3KQIA 3MDBC 5B79A 5D3HA 4UIXA 3Q2FA 3ASLA 5TBNA 4A4CA 3TLPA 4IR3A 3QZVA 1WEEA 4YATA 3FKMX 5CUGA 4X2IA 5A5QA 5F60A 2M3HA 5TDWA 4B86C 4BW1A 4MENA 5LKXA 5D24A 1T1HA 5D3RA 5E73A 2LRIC 4J0RA 5DKCA 5I7YA 1LDJB 3GV4A 2P57A 3KNVA 2YEMA 2YSMA 5EPBA 5LJ2A 3HMHA 5E9KA 2E7NA 4TT4A 3DDTA 5CUCA 2MUMA 5KU3A 5EU1A 3S91A 1JM7A 4F3IA 2D8UA 4UYFA 2N9GA 5TRBA 1FP0A 4UYDA 3HCTA 5ENGA 2YDWA 5D7XA 5EA1A 5G0FA 3ONIA 4O74A 2VJEB 3U5NA 5IGMA 5CTLA 4MR5A 5IG6A 2XP0A 2CT2A 2MJVB 5DLZA 5FFWA 4CA1A 5LVRA 5JWMA 4IR4A 5DW1A 4C66A 4ZC9A 5EQ1A 2FUIA 5H9MA 2JMIA 4A9MA 3LVRE 5HEMA 4S3OB 4NR5A 2E6SA 2RR4A 5ETBA 3ZTGA 5EISA 5D3SA 5A81A 2L5UA 2L7PA 2H60A 2MNZA 2L43A 4QZSA 5EWHA 3LRQA 4DONA 5ACYA 2I8NA 3D1BA 2YSJA 5E7DA 4A9JA 3LJWA 5A5SA 3FANA 5IGLA 4HXSA 5HJCA 4WHWA 4CURA 5CQ5A 4L58A 4NUCA 3RCWA 2MD7B 4A9IA 3ZYQA 4UYFB 5KTXA 3HCSA 2M6MA 3JVKA 5E9MA 4Y03A 3T9KA 3U5JA 3U5KA 3SVFA 1WEWA 2F6NA 4HXPA 5IBNA 1EQFA 5KTWA 4IC3A 5FFVA 5L97A 3DWYA 5EI4A 4QEVA 3U5OA 3AADA 5A5NA 1WUMA 4WZ3B 2VP7A 2LV9A 5F1HA 3H7HA 2JUNA 5ENCA 1DVPA 5AIUA 5E9IA 5D0CA 5DYXA 4KV1A 4TU4A 4NUEA 4BJXA 2F6JA 5CRZA 4H9DA 5E9LA 4HBWA 2DVVA 4NRBA 4BBQA 2C2VS 5B8DA 4BW2A 5H1TA 1RMDA 2VPDA 4LC2A 4YH3A 5B75A 4MEOA 1WUGA 5D3PA 3KDEC 2ZETC 5LCWB 2VPBA 3IU5A 5CGPA 4O7BA 4O75A 5I80A 3UVWA 4YYHA 5C85A 2LAUA 3KV6A 5DKHA 5HQ6A 4MSXA 4HXRA 5LJ1A 4F1PA 4OGJA 4HBXA 4YY6A 2YEKA 5DKDA 5I40A 1X4JA 4L7XA 5J3XA 2NXBA 4CUPA 2VPEA 3M63A 4Z0OA 5EV9A 4QSRA 2EGPA 4FO9A 5CU8A 4QYLA 4A9HA 1WEMA 3ERRA 4YAXA 5I86A 2R0VA 3SUBA 3U5PA 5ENBA 2DVRA 3N9PA 1WENA 3PHDA 2I50A 2EODA 3O47A 4B7YC 2I7KA 5E0RA 4IOOA 1WFKA 2LGGA 4UITA 4YC9A 4YYMA 2OXQC 5D1KB 3KV5A 5SVIB 2R0SA 2C2LA 3UV2A 5AMEA 5TCMA 4N4HA 2L80A 5CP5A 5HFQA 4AVXA 3LJUX 5HQ7A 2L0BA 5CQ4A 2B0OE 4IC2A 5BT5A 4HXKA 2XEUA 1XWHA 4Z93A 5F5ZA 4NN2A 4FK5A 4CCGX 5FH6A 4S3OC 1F68A 3LQIA 2HYED 4QR4A 5HRVA 2VJFB 2YURA 5CUDA 5FE6A 2YU4A 5II1A 4LR6A 2G43A 3EB6A 5DINA 3UV5A 4QF3A 4YYDA 3ZYUA 2CSVA 4LZ2A 1HYJA 5EM3A 2OO1A 5E9YA 3FM8C 3E2DA 3GL6A 3U5MA 4J1PA 4WZ2A 4CFLA 4HXNA 5I29A 3MHSA 2RS9B 2Y1NA 5B78A 1ZS5A 4QSUA 3O35A 2CRRA 2HDPA 5DKAA 2VJEA 3FAOA 1JSPB 4F52B 3JVLA 5DW2A 4LJNA 1HYIA 4A9EA 5FE0A 5AMFA 4LADB 5D1LB 2R0YA 5DYUA 4KCXA 5EGUA 3P1EA 5FE1A 3O37A 4O7CA 4UIVA 5A5PA 2WP2A 4YYNA 1WEQA 5KHMA 4ZQLA 3HMEA 2KREA 3IU6A 1DCQA 2ECVA 4LYSA 1FBVA 2CRWA 4BHWA 4O7EA 5HRWA 5I1QA 2D82A 3P1CA 4N3WA 2YQMA 2Y43A 2E7OA 5JI8A 1MM2A 2YW8A 5F3AA 3LQJA 5SVXA 4QSTA 2VJFA 3FEHA 3N9MA 4A4BA 2VPGA 2KGGA 2YQLA 5ENHA 2KWOA 2YYNA 1PUOA 5FE4A 4PS5A 2VNFA 3SOWA 4YABA 3RPGC 2Y1MA 2L85A 4Q0NA 1G25A 4LK9A 4I7CA 4QB3A 4A9FA 5J0DA 2JMJA 3ZVYA 2YUCA 3ZPVE 4R7EA 5CPEA 5C89A 4RVRA 4TZ2A 2KGIA 4QSXA 3MB3A 4WZ0A 3ZVZB 2YT5A 3LDYA 1U6GB 5AD3A 2KFTA 5I3LA 5DYCA 3HMFA 2QJ0A 4AKGA 3LVQE 3RPGB 4ALHA 2YW5A 4QYDA 1WEUA 4W4UA 2G4AA 1E6IA 2K17A 3PUQA 1N87A 5F1LA 2JMDA 2KTBB 4OGCA 3SHBA 1E4UA 5CQAA 5DY7A 3C5KA 2R10A 3O33A 4LLBA 4TKPB 3N9NA 2K16A 5ENJA 4Z6IA 1VD4A 4PPEA 5A83A 2KIZA 1WIMA 4MR3A 1MBMA 2M1RA 4O78A 5G04B 4UYEA 4NRAA 4UIUA 2KKYA 3SVGA 4UP0A 2CSZA 4MEPA 5EK9A 5EWDA 3SVHA 4TTEA 5ENFA 5E3DA 3M99A 4AP4A 2IDAA 4O77A 1WEOA 2FD4A 4UIWA 5A82A 3MHHA 5DFCA 4AYCB 2LSPB 2RNWA 2M85A 4UI9B 4CUTA 3RTRB 1ZKRA 4YYJA 5FH8A 5FE3A 4FIPA 2XB1A 4YBMA 5CFWA 4YYIA 4ZW1A 5I88A 4KV4A 1Z6UA 2XOYA 3GG3A 4NR6A 2DJAA 5SVIA 3D1DA 4O62A 2FUUA 5LKZA 4QR3A 4HXLA 4TU6A 5FE7A 2G6QA 2MIQA 5TABA 2OUOA 2M13A 2RI7A 4HBVA 2NAAA 4IR5A 2ECWA 5EPSA 5IIDA 4Z1QA 5CZGA 3DWDA 4O72A 4X3GA 3MQMA 4N4IA 5CQ7A 5SVYA 4LZSA 4QSPA 4NR4A 4NYXA 5D3TA 5I83A 5L8UA 1WEVA 4FJCA 3AQAA 3FL2A 5CQTA 3Q2EA 4E96A 5EVAA 4Z1SA 4NRCA 3UVXA 5A5OA 4NS5A 2LDRA 3HTKC 2XOZA 2WP1A 2CKLB 4NR8A 4NYWA 5H1UA 5LUUA 5F25A 5KH7A 5KH3A 4AI6A 4AYCA 2YHNA 5CY9A 2MKEA 1F62A 5FEYA 4NR9A 4XY8A 5E3GA 4CUSA 2JRJA 4QBMA 5AD2A 3UV4A 2KR4A 5D3LA 3U5LA 2ECGA 2YVRA 5B76A 4ALGA 3HCUA 4QUTA 2D9EA 5DFDA 4QC1A 5DYAA 4O64A 4NUDA 4TT2A 2LXHC 2YELA 3IHPA 5G4SA 3O70A 3I2DA 4P5OB 3K2JA 5FFYA 4FLPA 3ZPV1 5B77A 5L96A 3P1DA 2YHOA 4LDFA 1MM3A 5FDZA 5FG6A 4A9NA 1N72A 2OSSA 4A49A 3D7CA 5DFBA 5C87A 4AKNA 5ENEA 1V87A 5F2PA 4Z0RA 5A7CA 3T6RA 4YADA 4GPJA 4YYGA 2G45A 4QEWA 3I3JA 2YREA 5IGNA 4C9ZA 2H0DA 1CHCA 4R8PK 2CONA 2RNYA 3JVMA 4A9KA 5C4QA 3N9OA 2JM3A 5HM0A 5LJ0A 5F62A 4J0SA 4NYVA 2CSYA 2DVQA 4XYAA 5FB0A 4LYIA 5FBXA 4XUAA 1ZBDB 1WEPA 2D8SA 2LN0A 3EB5A 5EYAF 4WHUA 3C6WA 4ZUXU 2KU3A 4QSSA 2ECTA 3JVJA 5DBMA 4V3LC 5DLXA 5K3QA 3ZNIA 4AKIA 5LKUA 2OWAA 5I7XA 3S92A 5HRXA 2PUYA 4PCEA 3N9LA 5K29A 4CL9A 2K1JA 2K4DA 2LQ6A 3V43A 5EWWA 3M7KA 5F36A 4QSVA 5CQ3A 4YYKA 2E6RA 3NG2A 3SOUA 4GNGA 4N4FA 4O76A 4UIZA 5CUAA 4IORA 4QSWA 3UVYA 3DPLR 4MR4A 5HFRA 2LGLA 5FH7A 3MULA 5ETDA 4YBSA 4QQ4A 4R2YA 5BT4A 4AUQB 5KO4A 2DSMA 5A5RA 1VFYA 1K2FA 2UZGA 4GB0A 5G4RA 1X4IA 5HLSA 5CQ6A 3MUKA 5IGKA 5KH9A 1Z60A 4WA6A 5DX4A 4CUUA 4UYGA 1JM7B 5L98A 1X4UA 2H0DB 3NXBA 4Q6FA 4HBYA 5HCLA 3VKGA 4LYWA 2LGVA 4I7DA 4UIYA 3UW9A 1WILA 5JG6A 4A9LA 3MB4A 5D3NA 5C11A 2QIZA 5CRMA 2KWNA 2YYRA 1IYMA 4J3IA 2DKWA 2L75A 1Z2QA 3LXJA 2F42A 4WIVA 5G05B 5TB6A 2YQDA 2EGMA 5HELA 4PKLA 4Q0OA 5CQ8A 4LKAA 3O34A 5D25A 5H85A 5FE5A 2KWKA 3L11A 4CUQA 4O70A 5CUBA 2L84A 4QUUA 4O71A
chains in the Genus database with same CATH topology
4TZ8A 5F61A 5II2A 2MT5A 3G0JA 5COIA 4YY4A 4BW3A 2E3KA 1X0JA 4QSQA 4OUFA 4YH4A 5EWCA 5A85A 1LDKC 3T7LA 4XI1A 5H1VA 5FE8A 5FG4A 5FG5A 3L1ZB 5TDRA 3L1XA 2LXPC 3DAIA 4CFKA 5HQ5A 2KE1A 2PNXA 4GNFA 5ENIA 2ECNA 5FE2A 2KWJA 4QEUA 5LVQA 4UP5A 2EA6A 4IOQA 1WGMA 3P1FA 2AN6A 4NQNA 5HENA 5LKTA 5D1MB 4TT6A 3QZSA 5D26A 2RNXA 2DX8A 2CKLA 4ZDTA 3VK6A 4QNSA 4XY9A 4YK0A 1JOCA 3M62A 2RSDA 1WESA 2GRCA 4LZRA 5L8TA 4TS8A 2MNYA 4NXJA 5F63A 1BORA 5D3JA 5EP7A 2KYUA 4HXMA 3DQVR 4PY6A 4YBTA 4OGIA 4N4GA 2DATA 5EPRA 4C67A 1WE9A 4NQMA 5E74A 5EWVA 4UYHA 4PCIA 5CUEA 4A9OA 3O36A 3P5OA 2RO1A 3QZTA 4O7FA 4TQNA 3UVDA 4CLBA 4GNEA 5E9VA 2FSAA 2MA5A 4IR6A 5L99A 2ECIA 3O7AA 5C8GA 2MA6A 5FERA 3G0LA 2L5EA 2RFJA 5FB1A 2QICA 5AITA 4QR5A 4XUBA 4I7BA 4QF2A 4A0CD 2DWWA 4MR6A 4O7AA 5I89A 3N9QA 3SOXA 4QC3A 2MD8C 4HXOA 1JM4B 1VYXA 2DVSA 5FE9A 4PTBA 2ECJA 3MXFA 4MVTA 4QY4A 4V3KC 4NR7A 5KTUA 5C13A 4MEQA 5C7NA 5EICA 3PURA 4GNDA 4Z6HA 4BW4A 3LQHA 4TYLA 5CS8A 4LRGA 2BAYA 2LGKA 5BT3A 3KQIA 5B79A 5D3HA 4UIXA 3Q2FA 3ASLA 5TBNA 4A4CA 3TLPA 4IR3A 3QZVA 1WEEA 4YATA 3FKMX 5CUGA 4X2IA 5A5QA 5F60A 2M3HA 5TDWA 4B86C 4BW1A 4MENA 5LKXA 5D24A 1T1HA 5D3RA 5E73A 2LRIC 4J0RA 5DKCA 5I7YA 1LDJB 3GV4A 3KNVA 2YEMA 2YSMA 5EPBA 5LJ2A 3HMHA 5E9KA 2E7NA 4TT4A 5CUCA 2MUMA 5KU3A 5EU1A 3S91A 1JM7A 4F3IA 4UYFA 2N9GA 5TRBA 1FP0A 4UYDA 3HCTA 5ENGA 2YDWA 5D7XA 5EA1A 5G0FA 3ONIA 4O74A 2VJEB 3U5NA 5IGMA 5CTLA 4MR5A 5IG6A 2CT2A 2MJVB 5DLZA 5FFWA 4CA1A 5LVRA 5JWMA 4IR4A 5DW1A 4C66A 4ZC9A 5EQ1A 2FUIA 5H9MA 2JMIA 4A9MA 5HEMA 4S3OB 4NR5A 2E6SA 3ZTGA 5ETBA 5EISA 5D3SA 5A81A 2L5UA 2MNZA 2H60A 2L43A 4QZSA 5EWHA 3LRQA 4DONA 5ACYA 2I8NA 2YSJA 5E7DA 4A9JA 3LJWA 5A5SA 5IGLA 4HXSA 5HJCA 4WHWA 4CURA 5CQ5A 4L58A 4NUCA 3RCWA 2MD7B 4A9IA 3ZYQA 4UYFB 5KTXA 3HCSA 2M6MA 3JVKA 5E9MA 4Y03A 3U5JA 3U5KA 3SVFA 1WEWA 2F6NA 4HXPA 5IBNA 1EQFA 5KTWA 4IC3A 5FFVA 5L97A 3DWYA 5EI4A 4QEVA 3U5OA 3AADA 5A5NA 1WUMA 4WZ3B 2VP7A 2LV9A 5F1HA 5AIUA 5ENCA 1DVPA 5E9IA 5D0CA 5DYXA 4KV1A 4TU4A 4NUEA 4BJXA 2F6JA 5CRZA 4BBQA 5E9LA 4HBWA 2DVVA 4NRBA 5B8DA 2C2VS 4BW2A 5H1TA 1RMDA 2VPDA 4LC2A 4YH3A 5B75A 4MEOA 1WUGA 5D3PA 2ZETC 5LCWB 2VPBA 3IU5A 5CGPA 4O7BA 4O75A 5I80A 3UVWA 4YYHA 5C85A 3KV6A 5DKHA 5HQ6A 4MSXA 4HXRA 5LJ1A 4OGJA 4HBXA 4YY6A 2YEKA 5DKDA 5I40A 1X4JA 4L7XA 5J3XA 2NXBA 4CUPA 2VPEA 3M63A 5EV9A 4QSRA 2EGPA 4FO9A 5CU8A 4QYLA 4A9HA 1WEMA 4YAXA 5I86A 2R0VA 3U5PA 5ENBA 2DVRA 3N9PA 1WENA 3PHDA 2I50A 2EODA 4B7YC 2I7KA 5E0RA 4IOOA 1WFKA 2LGGA 4UITA 4YC9A 4YYMA 2OXQC 5D1KB 3KV5A 2R0SA 2C2LA 3UV2A 5AMEA 5TCMA 4N4HA 2L80A 5CP5A 5HFQA 4AVXA 5HQ7A 2L0BA 5CQ4A 4IC2A 5BT5A 4HXKA 2XEUA 1XWHA 4Z93A 5F5ZA 4NN2A 4FK5A 4CCGX 5FH6A 4S3OC 1F68A 3LQIA 2HYED 4QR4A 5HRVA 2VJFB 2YURA 5CUDA 5FE6A 2YU4A 5II1A 4LR6A 2G43A 3EB6A 5DINA 3UV5A 4QF3A 4YYDA 3ZYUA 4LZ2A 1HYJA 5EM3A 2OO1A 5E9YA 3GL6A 3U5MA 4J1PA 4WZ2A 4CFLA 4HXNA 5I29A 3MHSA 2RS9B 2Y1NA 5B78A 1ZS5A 4QSUA 3O35A 2HDPA 5DKAA 2VJEA 1JSPB 4F52B 3JVLA 5DW2A 4LJNA 1HYIA 4A9EA 5FE0A 5AMFA 4LADB 5D1LB 2R0YA 5DYUA 4KCXA 5EGUA 3P1EA 5FE1A 3O37A 4O7CA 4UIVA 5A5PA 2WP2A 4YYNA 1WEQA 5KHMA 4ZQLA 3HMEA 2KREA 3IU6A 2ECVA 4LYSA 1FBVA 4BHWA 4O7EA 5HRWA 5I1QA 2D82A 3P1CA 4N3WA 2YQMA 2Y43A 2E7OA 5JI8A 1MM2A 2YW8A 5F3AA 3LQJA 4QSTA 2VJFA 4A4BA 3N9MA 2VPGA 2KGGA 2YQLA 5ENHA 2KWOA 2YYNA 5FE4A 3SOWA 4PS5A 2VNFA 4YABA 3RPGC 2Y1MA 2L85A 4Q0NA 1G25A 4LK9A 4I7CA 4QB3A 4A9FA 5J0DA 2JMJA 3ZVYA 2YUCA 3ZPVE 4R7EA 5CPEA 5C89A 4RVRA 4TZ2A 2KGIA 4QSXA 3MB3A 4WZ0A 3ZVZB 2YT5A 1U6GB 5AD3A 2KFTA 5I3LA 5DYCA 3HMFA 2QJ0A 3RPGB 4ALHA 2YW5A 4QYDA 1WEUA 4W4UA 2G4AA 1E6IA 2K17A 3PUQA 1N87A 5F1LA 2JMDA 2KTBB 3SHBA 1E4UA 5CQAA 5DY7A 3C5KA 2R10A 3O33A 4LLBA 4TKPB 3N9NA 2K16A 5ENJA 4Z6IA 1VD4A 4PPEA 5A83A 2KIZA 1WIMA 4MR3A 2M1RA 4O78A 5G04B 4UYEA 4NRAA 4UIUA 3SVGA 4UP0A 2CSZA 4MEPA 5EK9A 5EWDA 3SVHA 4TTEA 5ENFA 5E3DA 3M99A 4AP4A 2IDAA 4O77A 1WEOA 4UIWA 5A82A 3MHHA 5DFCA 4AYCB 2LSPB 2RNWA 2M85A 4UI9B 4CUTA 3RTRB 4YYJA 4FIPA 5FH8A 5FE3A 2XB1A 4YBMA 5CFWA 4YYIA 4ZW1A 5I88A 4KV4A 1Z6UA 3GG3A 4NR6A 2FUUA 5LKZA 4QR3A 4HXLA 4TU6A 5FE7A 2G6QA 2MIQA 5TABA 2OUOA 2RI7A 4HBVA 2NAAA 4IR5A 2ECWA 5EPSA 5IIDA 4Z1QA 5CZGA 4O72A 4X3GA 3MQMA 4N4IA 5CQ7A 4LZSA 4QSPA 4NR4A 4NYXA 5D3TA 5I83A 5L8UA 1WEVA 4FJCA 3AQAA 3FL2A 5CQTA 3Q2EA 4E96A 5EVAA 4Z1SA 4NRCA 3UVXA 5A5OA 4NS5A 2LDRA 3HTKC 2WP1A 2CKLB 4NR8A 4NYWA 5H1UA 5LUUA 5F25A 5KH7A 5KH3A 4AYCA 2YHNA 5CY9A 1F62A 5FEYA 4NR9A 4XY8A 5E3GA 4CUSA 2JRJA 4QBMA 5AD2A 3UV4A 2KR4A 5D3LA 3U5LA 2ECGA 5B76A 4ALGA 3HCUA 4QUTA 2D9EA 5DFDA 4QC1A 5DYAA 4O64A 4NUDA 4TT2A 2LXHC 2YELA 3IHPA 5G4SA 3O70A 3I2DA 4P5OB 3K2JA 5FFYA 4FLPA 3ZPV1 5B77A 5L96A 3P1DA 2YHOA 4LDFA 1MM3A 5FDZA 5FG6A 4A9NA 1N72A 2OSSA 4A49A 3D7CA 5DFBA 5C87A 4AKNA 5ENEA 1V87A 5F2PA 5A7CA 3T6RA 4YADA 4GPJA 4YYGA 2G45A 4QEWA 3I3JA 2YREA 5IGNA 4C9ZA 2H0DA 1CHCA 4R8PK 2RNYA 3JVMA 4A9KA 5C4QA 3N9OA 5HM0A 5LJ0A 5F62A 4J0SA 4NYVA 2CSYA 2DVQA 4XYAA 5FB0A 4LYIA 5FBXA 4XUAA 1ZBDB 1WEPA 2D8SA 2LN0A 3EB5A 5EYAF 4WHUA 3C6WA 4ZUXU 2KU3A 4QSSA 2ECTA 3JVJA 5DBMA 4V3LC 5DLXA 3ZNIA 5LKUA 5I7XA 3S92A 5HRXA 2PUYA 4PCEA 3N9LA 5K29A 4CL9A 2K1JA 2K4DA 2LQ6A 3V43A 5EWWA 5F36A 4QSVA 5CQ3A 4YYKA 2E6RA 3NG2A 3SOUA 4GNGA 4N4FA 4O76A 4UIZA 5CUAA 4IORA 4QSWA 3UVYA 3DPLR 4MR4A 5HFRA 2LGLA 5FH7A 3MULA 5ETDA 4YBSA 4AUQB 4R2YA 5BT4A 5KO4A 5A5RA 1VFYA 1K2FA 2UZGA 4GB0A 5G4RA 1X4IA 5HLSA 5CQ6A 3MUKA 5IGKA 5KH9A 1Z60A 4WA6A 5DX4A 4CUUA 4UYGA 1JM7B 5L98A 1X4UA 2H0DB 3NXBA 4Q6FA 4HBYA 5HCLA 4LYWA 2LGVA 4I7DA 4UIYA 3UW9A 1WILA 5JG6A 4A9LA 3MB4A 5D3NA 5C11A 2QIZA 5CRMA 2KWNA 2YYRA 1IYMA 4J3IA 2DKWA 2L75A 1Z2QA 3LXJA 2F42A 4WIVA 5G05B 5TB6A 2YQDA 5HELA 4PKLA 4Q0OA 5CQ8A 4LKAA 3O34A 5D25A 5H85A 5FE5A 2KWKA 3L11A 4CUQA 4O70A 5CUBA 2L84A 4QUUA 4O71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZ8 A;  5F61 A;  5II2 A;  2MT5 A;  3G0J A;  5COI A;  4YY4 A;  4BW3 A;  2E3K A;  1X0J A;  4QSQ A;  4OUF A;  4YH4 A;  5EWC A;  5A85 A;  1LDK C;  3T7L A;  4XI1 A;  5H1V A;  5FE8 A;  5FG4 A;  5FG5 A;  3L1Z B;  5TDR A;  3L1X A;  2LXP C;  3DAI A;  4CFK A;  5HQ5 A;  2KE1 A;  2PNX A;  4GNF A;  5ENI A;  2ECN A;  5FE2 A;  2KWJ A;  4QEU A;  5LVQ A;  4UP5 A;  2EA6 A;  4IOQ A;  1WGM A;  3P1F A;  2AN6 A;  4NQN A;  5HEN A;  5LKT A;  5D1M B;  4TT6 A;  3QZS A;  5D26 A;  2RNX A;  2DX8 A;  2CKL A;  4ZDT A;  3VK6 A;  4QNS A;  4XY9 A;  4YK0 A;  1JOC A;  3M62 A;  2RSD A;  1WES A;  2GRC A;  4LZR A;  5L8T A;  4TS8 A;  2MNY A;  4NXJ A;  5F63 A;  1BOR A;  5D3J A;  5EP7 A;  2KYU A;  4HXM A;  3DQV R;  4PY6 A;  4YBT A;  4OGI A;  4N4G A;  2DAT A;  5EPR A;  4C67 A;  1WE9 A;  4NQM A;  5E74 A;  5EWV A;  4UYH A;  4PCI A;  5CUE A;  4A9O A;  3O36 A;  3P5O A;  2RO1 A;  3QZT A;  4O7F A;  4TQN A;  3UVD A;  4CLB A;  4GNE A;  5E9V A;  2FSA A;  2MA5 A;  4IR6 A;  5L99 A;  2ECI A;  3O7A A;  5C8G A;  2MA6 A;  5FER A;  3G0L A;  2L5E A;  2RFJ A;  5FB1 A;  2QIC A;  5AIT A;  4QR5 A;  4XUB A;  4I7B A;  4QF2 A;  4A0C D;  2DWW A;  4MR6 A;  4O7A A;  5I89 A;  3N9Q A;  3SOX A;  4QC3 A;  2MD8 C;  4HXO A;  1JM4 B;  1VYX A;  2DVS A;  5FE9 A;  4PTB A;  2ECJ A;  3MXF A;  4MVT A;  4QY4 A;  4V3K C;  4NR7 A;  5KTU A;  5C13 A;  4MEQ A;  5C7N A;  5EIC A;  3PUR A;  4GND A;  4Z6H A;  4BW4 A;  3LQH A;  4TYL A;  5CS8 A;  4LRG A;  2BAY A;  2LGK A;  5BT3 A;  3KQI A;  5B79 A;  5D3H A;  4UIX A;  3Q2F A;  3ASL A;  5TBN A;  4A4C A;  3TLP A;  4IR3 A;  3QZV A;  1WEE A;  4YAT A;  3FKM X;  5CUG A;  4X2I A;  5A5Q A;  5F60 A;  2M3H A;  5TDW A;  4B86 C;  4BW1 A;  4MEN A;  5LKX A;  5D24 A;  1T1H A;  5D3R A;  5E73 A;  2LRI C;  4J0R A;  5DKC A;  5I7Y A;  1LDJ B;  3GV4 A;  3KNV A;  2YEM A;  2YSM A;  5EPB A;  5LJ2 A;  3HMH A;  5E9K A;  2E7N A;  4TT4 A;  5CUC A;  2MUM A;  5KU3 A;  5EU1 A;  3S91 A;  1JM7 A;  4F3I A;  4UYF A;  2N9G A;  5TRB A;  1FP0 A;  4UYD A;  3HCT A;  5ENG A;  2YDW A;  5D7X A;  5EA1 A;  5G0F A;  3ONI A;  4O74 A;  2VJE B;  3U5N A;  5IGM A;  5CTL A;  4MR5 A;  5IG6 A;  2CT2 A;  2MJV B;  5DLZ A;  5FFW A;  4CA1 A;  5LVR A;  5JWM A;  4IR4 A;  5DW1 A;  4C66 A;  4ZC9 A;  5EQ1 A;  2FUI A;  5H9M A;  2JMI A;  4A9M A;  5HEM A;  4S3O B;  4NR5 A;  2E6S A;  3ZTG A;  5ETB A;  5EIS A;  5D3S A;  5A81 A;  2L5U A;  2MNZ A;  2H60 A;  2L43 A;  4QZS A;  5EWH A;  3LRQ A;  4DON A;  5ACY A;  2I8N A;  2YSJ A;  5E7D A;  4A9J A;  3LJW A;  5A5S A;  5IGL A;  4HXS A;  5HJC A;  4WHW A;  4CUR A;  5CQ5 A;  4L58 A;  4NUC A;  3RCW A;  2MD7 B;  4A9I A;  3ZYQ A;  4UYF B;  5KTX A;  3HCS A;  2M6M A;  3JVK A;  5E9M A;  4Y03 A;  3U5J A;  3U5K A;  3SVF A;  1WEW A;  2F6N A;  4HXP A;  5IBN A;  1EQF A;  5KTW A;  4IC3 A;  5FFV A;  5L97 A;  3DWY A;  5EI4 A;  4QEV A;  3U5O A;  3AAD A;  5A5N A;  1WUM A;  4WZ3 B;  2VP7 A;  2LV9 A;  5F1H A;  5AIU A;  5ENC A;  1DVP A;  5E9I A;  5D0C A;  5DYX A;  4KV1 A;  4TU4 A;  4NUE A;  4BJX A;  2F6J A;  5CRZ A;  4BBQ A;  5E9L A;  4HBW A;  2DVV A;  4NRB A;  5B8D A;  2C2V S;  4BW2 A;  5H1T A;  1RMD A;  2VPD A;  4LC2 A;  4YH3 A;  5B75 A;  4MEO A;  1WUG A;  5D3P A;  2ZET C;  5LCW B;  2VPB A;  3IU5 A;  5CGP A;  4O7B A;  4O75 A;  5I80 A;  3UVW A;  4YYH A;  5C85 A;  3KV6 A;  5DKH A;  5HQ6 A;  4MSX A;  4HXR A;  5LJ1 A;  4OGJ A;  4HBX A;  4YY6 A;  2YEK A;  5DKD A;  5I40 A;  1X4J A;  4L7X A;  5J3X A;  2NXB A;  4CUP A;  2VPE A;  3M63 A;  5EV9 A;  4QSR A;  2EGP A;  4FO9 A;  5CU8 A;  4QYL A;  4A9H A;  1WEM A;  4YAX A;  5I86 A;  2R0V A;  3U5P A;  5ENB A;  2DVR A;  3N9P A;  1WEN A;  3PHD A;  2I50 A;  2EOD A;  4B7Y C;  2I7K A;  5E0R A;  4IOO A;  1WFK A;  2LGG A;  4UIT A;  4YC9 A;  4YYM A;  2OXQ C;  5D1K B;  3KV5 A;  2R0S A;  2C2L A;  3UV2 A;  5AME A;  5TCM A;  4N4H A;  2L80 A;  5CP5 A;  5HFQ A;  4AVX A;  5HQ7 A;  2L0B A;  5CQ4 A;  4IC2 A;  5BT5 A;  4HXK A;  2XEU A;  1XWH A;  4Z93 A;  5F5Z A;  4NN2 A;  4FK5 A;  4CCG X;  5FH6 A;  4S3O C;  1F68 A;  3LQI A;  2HYE D;  4QR4 A;  5HRV A;  2VJF B;  2YUR A;  5CUD A;  5FE6 A;  2YU4 A;  5II1 A;  4LR6 A;  2G43 A;  3EB6 A;  5DIN A;  3UV5 A;  4QF3 A;  4YYD A;  3ZYU A;  4LZ2 A;  1HYJ A;  5EM3 A;  2OO1 A;  5E9Y A;  3GL6 A;  3U5M A;  4J1P A;  4WZ2 A;  4CFL A;  4HXN A;  5I29 A;  3MHS A;  2RS9 B;  2Y1N A;  5B78 A;  1ZS5 A;  4QSU A;  3O35 A;  2HDP A;  5DKA A;  2VJE A;  1JSP B;  4F52 B;  3JVL A;  5DW2 A;  4LJN A;  1HYI A;  4A9E A;  5FE0 A;  5AMF A;  4LAD B;  5D1L B;  2R0Y A;  5DYU A;  4KCX A;  5EGU A;  3P1E A;  5FE1 A;  3O37 A;  4O7C A;  4UIV A;  5A5P A;  2WP2 A;  4YYN A;  1WEQ A;  5KHM A;  4ZQL A;  3HME A;  2KRE A;  3IU6 A;  2ECV A;  4LYS A;  1FBV A;  4BHW A;  4O7E A;  5HRW A;  5I1Q A;  2D82 A;  3P1C A;  4N3W A;  2YQM A;  2Y43 A;  2E7O A;  5JI8 A;  1MM2 A;  2YW8 A;  5F3A A;  3LQJ A;  4QST A;  2VJF A;  4A4B A;  3N9M A;  2VPG A;  2KGG A;  2YQL A;  5ENH A;  2KWO A;  2YYN A;  5FE4 A;  3SOW A;  4PS5 A;  2VNF A;  4YAB A;  3RPG C;  2Y1M A;  2L85 A;  4Q0N A;  1G25 A;  4LK9 A;  4I7C A;  4QB3 A;  4A9F A;  5J0D A;  2JMJ A;  3ZVY A;  2YUC A;  3ZPV E;  4R7E A;  5CPE A;  5C89 A;  4RVR A;  4TZ2 A;  2KGI A;  4QSX A;  3MB3 A;  4WZ0 A;  3ZVZ B;  2YT5 A;  1U6G B;  5AD3 A;  2KFT A;  5I3L A;  5DYC A;  3HMF A;  2QJ0 A;  3RPG B;  4ALH A;  2YW5 A;  4QYD A;  1WEU A;  4W4U A;  2G4A A;  1E6I A;  2K17 A;  3PUQ A;  1N87 A;  5F1L A;  2JMD A;  2KTB B;  3SHB A;  1E4U A;  5CQA A;  5DY7 A;  3C5K A;  2R10 A;  3O33 A;  4LLB A;  4TKP B;  3N9N A;  2K16 A;  5ENJ A;  4Z6I A;  1VD4 A;  4PPE A;  5A83 A;  2KIZ A;  1WIM A;  4MR3 A;  2M1R A;  4O78 A;  5G04 B;  4UYE A;  4NRA A;  4UIU A;  3SVG A;  4UP0 A;  2CSZ A;  4MEP A;  5EK9 A;  5EWD A;  3SVH A;  4TTE A;  5ENF A;  5E3D A;  3M99 A;  4AP4 A;  2IDA A;  4O77 A;  1WEO A;  4UIW A;  5A82 A;  3MHH A;  5DFC A;  4AYC B;  2LSP B;  2RNW A;  2M85 A;  4UI9 B;  4CUT A;  3RTR B;  4YYJ A;  4FIP A;  5FH8 A;  5FE3 A;  2XB1 A;  4YBM A;  5CFW A;  4YYI A;  4ZW1 A;  5I88 A;  4KV4 A;  1Z6U A;  3GG3 A;  4NR6 A;  2FUU A;  5LKZ A;  4QR3 A;  4HXL A;  4TU6 A;  5FE7 A;  2G6Q A;  2MIQ A;  5TAB A;  2OUO A;  2RI7 A;  4HBV A;  2NAA A;  4IR5 A;  2ECW A;  5EPS A;  5IID A;  4Z1Q A;  5CZG A;  4O72 A;  4X3G A;  3MQM A;  4N4I A;  5CQ7 A;  4LZS A;  4QSP A;  4NR4 A;  4NYX A;  5D3T A;  5I83 A;  5L8U A;  1WEV A;  4FJC A;  3AQA A;  3FL2 A;  5CQT A;  3Q2E A;  4E96 A;  5EVA A;  4Z1S A;  4NRC A;  3UVX A;  5A5O A;  4NS5 A;  2LDR A;  3HTK C;  2WP1 A;  2CKL B;  4NR8 A;  4NYW A;  5H1U A;  5LUU A;  5F25 A;  5KH7 A;  5KH3 A;  4AYC A;  2YHN A;  5CY9 A;  1F62 A;  5FEY A;  4NR9 A;  4XY8 A;  5E3G A;  4CUS A;  2JRJ A;  4QBM A;  5AD2 A;  3UV4 A;  2KR4 A;  5D3L A;  3U5L A;  2ECG A;  5B76 A;  4ALG A;  3HCU A;  4QUT A;  2D9E A;  5DFD A;  4QC1 A;  5DYA A;  4O64 A;  4NUD A;  4TT2 A;  2LXH C;  2YEL A;  3IHP A;  5G4S A;  3O70 A;  3I2D A;  4P5O B;  3K2J A;  5FFY A;  4FLP A;  3ZPV 1;  5B77 A;  5L96 A;  3P1D A;  2YHO A;  4LDF A;  1MM3 A;  5FDZ A;  5FG6 A;  4A9N A;  1N72 A;  2OSS A;  4A49 A;  3D7C A;  5DFB A;  5C87 A;  4AKN A;  5ENE A;  1V87 A;  5F2P A;  5A7C A;  3T6R A;  4YAD A;  4GPJ A;  4YYG A;  2G45 A;  4QEW A;  3I3J A;  2YRE A;  5IGN A;  4C9Z A;  2H0D A;  1CHC A;  4R8P K;  2RNY A;  3JVM A;  4A9K A;  5C4Q A;  3N9O A;  5HM0 A;  5LJ0 A;  5F62 A;  4J0S A;  4NYV A;  2CSY A;  2DVQ A;  4XYA A;  5FB0 A;  4LYI A;  5FBX A;  4XUA A;  1ZBD B;  1WEP A;  2D8S A;  2LN0 A;  3EB5 A;  5EYA F;  4WHU A;  3C6W A;  4ZUX U;  2KU3 A;  4QSS A;  2ECT A;  3JVJ A;  5DBM A;  4V3L C;  5DLX A;  3ZNI A;  5LKU A;  5I7X A;  3S92 A;  5HRX A;  2PUY A;  4PCE A;  3N9L A;  5K29 A;  4CL9 A;  2K1J A;  2K4D A;  2LQ6 A;  3V43 A;  5EWW A;  5F36 A;  4QSV A;  5CQ3 A;  4YYK A;  2E6R A;  3NG2 A;  3SOU A;  4GNG A;  4N4F A;  4O76 A;  4UIZ A;  5CUA A;  4IOR A;  4QSW A;  3UVY A;  3DPL R;  4MR4 A;  5HFR A;  2LGL A;  5FH7 A;  3MUL A;  5ETD A;  4YBS A;  4AUQ B;  4R2Y A;  5BT4 A;  5KO4 A;  5A5R A;  1VFY A;  1K2F A;  2UZG A;  4GB0 A;  5G4R A;  1X4I A;  5HLS A;  5CQ6 A;  3MUK A;  5IGK A;  5KH9 A;  1Z60 A;  4WA6 A;  5DX4 A;  4CUU A;  4UYG A;  1JM7 B;  5L98 A;  1X4U A;  2H0D B;  3NXB A;  4Q6F A;  4HBY A;  5HCL A;  4LYW A;  2LGV A;  4I7D A;  4UIY A;  3UW9 A;  1WIL A;  5JG6 A;  4A9L A;  3MB4 A;  5D3N A;  5C11 A;  2QIZ A;  5CRM A;  2KWN A;  2YYR A;  1IYM A;  4J3I A;  2DKW A;  2L75 A;  1Z2Q A;  3LXJ A;  2F42 A;  4WIV A;  5G05 B;  5TB6 A;  2YQD A;  5HEL A;  4PKL A;  4Q0O A;  5CQ8 A;  4LKA A;  3O34 A;  5D25 A;  5H85 A;  5FE5 A;  2KWK A;  3L11 A;  4CUQ A;  4O70 A;  5CUB A;  2L84 A;  4QUU A;  4O71 A; 
#chains in the Genus database with same CATH topology
 4TZ8 A;  5F61 A;  5II2 A;  2MT5 A;  3G0J A;  5COI A;  4YY4 A;  4BW3 A;  2E3K A;  1X0J A;  4QSQ A;  4OUF A;  4YH4 A;  5EWC A;  5A85 A;  1LDK C;  3T7L A;  4XI1 A;  5H1V A;  5FE8 A;  5FG4 A;  5FG5 A;  3L1Z B;  5TDR A;  3L1X A;  2LXP C;  3DAI A;  4CFK A;  5HQ5 A;  2KE1 A;  2PNX A;  4GNF A;  5ENI A;  2ECN A;  5FE2 A;  3FJU B;  2KWJ A;  3Q1D A;  4QEU A;  5LVQ A;  4UP5 A;  2EA6 A;  4IOQ A;  1WGM A;  3P1F A;  2AN6 A;  4NQN A;  5HEN A;  5LKT A;  2E61 A;  5D1M B;  4TT6 A;  2FFW A;  3QZS A;  5D26 A;  2RNX A;  2DX8 A;  2CKL A;  2KKX A;  2IQJ A;  4ZDT A;  3VK6 A;  4QNS A;  4XY9 A;  4YK0 A;  1JOC A;  3M62 A;  2RSD A;  1WES A;  2GRC A;  4LZR A;  5L8T A;  4TS8 A;  2MNY A;  4NXJ A;  5F63 A;  1BOR A;  5D3J A;  5EP7 A;  3PLW A;  2KYU A;  4HXM A;  3DQV R;  4PY6 A;  4YBT A;  4OGI A;  4N4G A;  4AKH A;  3VKH A;  2DAT A;  5EPR A;  4C67 A;  1WE9 A;  2EJN A;  4NQM A;  5E74 A;  5EWV A;  4UYH A;  4PCI A;  5CUE A;  4A9O A;  3O36 A;  3P5O A;  2RO1 A;  3QZT A;  4O7F A;  4TQN A;  3UVD A;  4CLB A;  4OGE A;  2EXU A;  4GNE A;  5E9V A;  2FSA A;  2MA5 A;  4IR6 A;  5L99 A;  2ECI A;  3O7A A;  5C8G A;  2MA6 A;  5FER A;  3G0L A;  2L5E A;  2RFJ A;  5FB1 A;  2QIC A;  5AIT A;  4QR5 A;  4XUB A;  4I7B A;  4QF2 A;  4A0C D;  2DWW A;  4MR6 A;  4O7A A;  5I89 A;  3N9Q A;  3JUE A;  3SOX A;  4QC3 A;  2MD8 C;  4HXO A;  1JM4 B;  1VYX A;  2DVS A;  5FE9 A;  4PTB A;  2ECJ A;  3MXF A;  4MVT A;  4QY4 A;  4V3K C;  4NR7 A;  5KTU A;  5C13 A;  4MEQ A;  5C7N A;  5EIC A;  3PUR A;  4GND A;  4Z6H A;  4BW4 A;  3LQH A;  4TYL A;  5CS8 A;  4LRG A;  2BAY A;  2LGK A;  2XOC A;  5BT3 A;  3KQI A;  3MDB C;  5B79 A;  5D3H A;  4UIX A;  3Q2F A;  3ASL A;  5TBN A;  4A4C A;  3TLP A;  4IR3 A;  3QZV A;  1WEE A;  4YAT A;  3FKM X;  5CUG A;  4X2I A;  5A5Q A;  5F60 A;  2M3H A;  5TDW A;  4B86 C;  4BW1 A;  4MEN A;  5LKX A;  5D24 A;  1T1H A;  5D3R A;  5E73 A;  2LRI C;  4J0R A;  5DKC A;  5I7Y A;  1LDJ B;  3GV4 A;  2P57 A;  3KNV A;  2YEM A;  2YSM A;  5EPB A;  5LJ2 A;  3HMH A;  5E9K A;  2E7N A;  4TT4 A;  3DDT A;  5CUC A;  2MUM A;  5KU3 A;  5EU1 A;  3S91 A;  1JM7 A;  4F3I A;  2D8U A;  4UYF A;  2N9G A;  5TRB A;  1FP0 A;  4UYD A;  3HCT A;  5ENG A;  2YDW A;  5D7X A;  5EA1 A;  5G0F A;  3ONI A;  4O74 A;  2VJE B;  3U5N A;  5IGM A;  5CTL A;  4MR5 A;  5IG6 A;  2XP0 A;  2CT2 A;  2MJV B;  5DLZ A;  5FFW A;  4CA1 A;  5LVR A;  5JWM A;  4IR4 A;  5DW1 A;  4C66 A;  4ZC9 A;  5EQ1 A;  2FUI A;  5H9M A;  2JMI A;  4A9M A;  3LVR E;  5HEM A;  4S3O B;  4NR5 A;  2E6S A;  2RR4 A;  5ETB A;  3ZTG A;  5EIS A;  5D3S A;  5A81 A;  2L5U A;  2L7P A;  2H60 A;  2MNZ A;  2L43 A;  4QZS A;  5EWH A;  3LRQ A;  4DON A;  5ACY A;  2I8N A;  3D1B A;  2YSJ A;  5E7D A;  4A9J A;  3LJW A;  5A5S A;  3FAN A;  5IGL A;  4HXS A;  5HJC A;  4WHW A;  4CUR A;  5CQ5 A;  4L58 A;  4NUC A;  3RCW A;  2MD7 B;  4A9I A;  3ZYQ A;  4UYF B;  5KTX A;  3HCS A;  2M6M A;  3JVK A;  5E9M A;  4Y03 A;  3T9K A;  3U5J A;  3U5K A;  3SVF A;  1WEW A;  2F6N A;  4HXP A;  5IBN A;  1EQF A;  5KTW A;  4IC3 A;  5FFV A;  5L97 A;  3DWY A;  5EI4 A;  4QEV A;  3U5O A;  3AAD A;  5A5N A;  1WUM A;  4WZ3 B;  2VP7 A;  2LV9 A;  5F1H A;  3H7H A;  2JUN A;  5ENC A;  1DVP A;  5AIU A;  5E9I A;  5D0C A;  5DYX A;  4KV1 A;  4TU4 A;  4NUE A;  4BJX A;  2F6J A;  5CRZ A;  4H9D A;  5E9L A;  4HBW A;  2DVV A;  4NRB A;  4BBQ A;  2C2V S;  5B8D A;  4BW2 A;  5H1T A;  1RMD A;  2VPD A;  4LC2 A;  4YH3 A;  5B75 A;  4MEO A;  1WUG A;  5D3P A;  3KDE C;  2ZET C;  5LCW B;  2VPB A;  3IU5 A;  5CGP A;  4O7B A;  4O75 A;  5I80 A;  3UVW A;  4YYH A;  5C85 A;  2LAU A;  3KV6 A;  5DKH A;  5HQ6 A;  4MSX A;  4HXR A;  5LJ1 A;  4F1P A;  4OGJ A;  4HBX A;  4YY6 A;  2YEK A;  5DKD A;  5I40 A;  1X4J A;  4L7X A;  5J3X A;  2NXB A;  4CUP A;  2VPE A;  3M63 A;  4Z0O A;  5EV9 A;  4QSR A;  2EGP A;  4FO9 A;  5CU8 A;  4QYL A;  4A9H A;  1WEM A;  3ERR A;  4YAX A;  5I86 A;  2R0V A;  3SUB A;  3U5P A;  5ENB A;  2DVR A;  3N9P A;  1WEN A;  3PHD A;  2I50 A;  2EOD A;  3O47 A;  4B7Y C;  2I7K A;  5E0R A;  4IOO A;  1WFK A;  2LGG A;  4UIT A;  4YC9 A;  4YYM A;  2OXQ C;  5D1K B;  3KV5 A;  5SVI B;  2R0S A;  2C2L A;  3UV2 A;  5AME A;  5TCM A;  4N4H A;  2L80 A;  5CP5 A;  5HFQ A;  4AVX A;  3LJU X;  5HQ7 A;  2L0B A;  5CQ4 A;  2B0O E;  4IC2 A;  5BT5 A;  4HXK A;  2XEU A;  1XWH A;  4Z93 A;  5F5Z A;  4NN2 A;  4FK5 A;  4CCG X;  5FH6 A;  4S3O C;  1F68 A;  3LQI A;  2HYE D;  4QR4 A;  5HRV A;  2VJF B;  2YUR A;  5CUD A;  5FE6 A;  2YU4 A;  5II1 A;  4LR6 A;  2G43 A;  3EB6 A;  5DIN A;  3UV5 A;  4QF3 A;  4YYD A;  3ZYU A;  2CSV A;  4LZ2 A;  1HYJ A;  5EM3 A;  2OO1 A;  5E9Y A;  3FM8 C;  3E2D A;  3GL6 A;  3U5M A;  4J1P A;  4WZ2 A;  4CFL A;  4HXN A;  5I29 A;  3MHS A;  2RS9 B;  2Y1N A;  5B78 A;  1ZS5 A;  4QSU A;  3O35 A;  2CRR A;  2HDP A;  5DKA A;  2VJE A;  3FAO A;  1JSP B;  4F52 B;  3JVL A;  5DW2 A;  4LJN A;  1HYI A;  4A9E A;  5FE0 A;  5AMF A;  4LAD B;  5D1L B;  2R0Y A;  5DYU A;  4KCX A;  5EGU A;  3P1E A;  5FE1 A;  3O37 A;  4O7C A;  4UIV A;  5A5P A;  2WP2 A;  4YYN A;  1WEQ A;  5KHM A;  4ZQL A;  3HME A;  2KRE A;  3IU6 A;  1DCQ A;  2ECV A;  4LYS A;  1FBV A;  2CRW A;  4BHW A;  4O7E A;  5HRW A;  5I1Q A;  2D82 A;  3P1C A;  4N3W A;  2YQM A;  2Y43 A;  2E7O A;  5JI8 A;  1MM2 A;  2YW8 A;  5F3A A;  3LQJ A;  5SVX A;  4QST A;  2VJF A;  3FEH A;  3N9M A;  4A4B A;  2VPG A;  2KGG A;  2YQL A;  5ENH A;  2KWO A;  2YYN A;  1PUO A;  5FE4 A;  4PS5 A;  2VNF A;  3SOW A;  4YAB A;  3RPG C;  2Y1M A;  2L85 A;  4Q0N A;  1G25 A;  4LK9 A;  4I7C A;  4QB3 A;  4A9F A;  5J0D A;  2JMJ A;  3ZVY A;  2YUC A;  3ZPV E;  4R7E A;  5CPE A;  5C89 A;  4RVR A;  4TZ2 A;  2KGI A;  4QSX A;  3MB3 A;  4WZ0 A;  3ZVZ B;  2YT5 A;  3LDY A;  1U6G B;  5AD3 A;  2KFT A;  5I3L A;  5DYC A;  3HMF A;  2QJ0 A;  4AKG A;  3LVQ E;  3RPG B;  4ALH A;  2YW5 A;  4QYD A;  1WEU A;  4W4U A;  2G4A A;  1E6I A;  2K17 A;  3PUQ A;  1N87 A;  5F1L A;  2JMD A;  2KTB B;  4OGC A;  3SHB A;  1E4U A;  5CQA A;  5DY7 A;  3C5K A;  2R10 A;  3O33 A;  4LLB A;  4TKP B;  3N9N A;  2K16 A;  5ENJ A;  4Z6I A;  1VD4 A;  4PPE A;  5A83 A;  2KIZ A;  1WIM A;  4MR3 A;  1MBM A;  2M1R A;  4O78 A;  5G04 B;  4UYE A;  4NRA A;  4UIU A;  2KKY A;  3SVG A;  4UP0 A;  2CSZ A;  4MEP A;  5EK9 A;  5EWD A;  3SVH A;  4TTE A;  5ENF A;  5E3D A;  3M99 A;  4AP4 A;  2IDA A;  4O77 A;  1WEO A;  2FD4 A;  4UIW A;  5A82 A;  3MHH A;  5DFC A;  4AYC B;  2LSP B;  2RNW A;  2M85 A;  4UI9 B;  4CUT A;  3RTR B;  1ZKR A;  4YYJ A;  5FH8 A;  5FE3 A;  4FIP A;  2XB1 A;  4YBM A;  5CFW A;  4YYI A;  4ZW1 A;  5I88 A;  4KV4 A;  1Z6U A;  2XOY A;  3GG3 A;  4NR6 A;  2DJA A;  5SVI A;  3D1D A;  4O62 A;  2FUU A;  5LKZ A;  4QR3 A;  4HXL A;  4TU6 A;  5FE7 A;  2G6Q A;  2MIQ A;  5TAB A;  2OUO A;  2M13 A;  2RI7 A;  4HBV A;  2NAA A;  4IR5 A;  2ECW A;  5EPS A;  5IID A;  4Z1Q A;  5CZG A;  3DWD A;  4O72 A;  4X3G A;  3MQM A;  4N4I A;  5CQ7 A;  5SVY A;  4LZS A;  4QSP A;  4NR4 A;  4NYX A;  5D3T A;  5I83 A;  5L8U A;  1WEV A;  4FJC A;  3AQA A;  3FL2 A;  5CQT A;  3Q2E A;  4E96 A;  5EVA A;  4Z1S A;  4NRC A;  3UVX A;  5A5O A;  4NS5 A;  2LDR A;  3HTK C;  2XOZ A;  2WP1 A;  2CKL B;  4NR8 A;  4NYW A;  5H1U A;  5LUU A;  5F25 A;  5KH7 A;  5KH3 A;  4AI6 A;  4AYC A;  2YHN A;  5CY9 A;  2MKE A;  1F62 A;  5FEY A;  4NR9 A;  4XY8 A;  5E3G A;  4CUS A;  2JRJ A;  4QBM A;  5AD2 A;  3UV4 A;  2KR4 A;  5D3L A;  3U5L A;  2ECG A;  2YVR A;  5B76 A;  4ALG A;  3HCU A;  4QUT A;  2D9E A;  5DFD A;  4QC1 A;  5DYA A;  4O64 A;  4NUD A;  4TT2 A;  2LXH C;  2YEL A;  3IHP A;  5G4S A;  3O70 A;  3I2D A;  4P5O B;  3K2J A;  5FFY A;  4FLP A;  3ZPV 1;  5B77 A;  5L96 A;  3P1D A;  2YHO A;  4LDF A;  1MM3 A;  5FDZ A;  5FG6 A;  4A9N A;  1N72 A;  2OSS A;  4A49 A;  3D7C A;  5DFB A;  5C87 A;  4AKN A;  5ENE A;  1V87 A;  5F2P A;  4Z0R A;  5A7C A;  3T6R A;  4YAD A;  4GPJ A;  4YYG A;  2G45 A;  4QEW A;  3I3J A;  2YRE A;  5IGN A;  4C9Z A;  2H0D A;  1CHC A;  4R8P K;  2CON A;  2RNY A;  3JVM A;  4A9K A;  5C4Q A;  3N9O A;  2JM3 A;  5HM0 A;  5LJ0 A;  5F62 A;  4J0S A;  4NYV A;  2CSY A;  2DVQ A;  4XYA A;  5FB0 A;  4LYI A;  5FBX A;  4XUA A;  1ZBD B;  1WEP A;  2D8S A;  2LN0 A;  3EB5 A;  5EYA F;  4WHU A;  3C6W A;  4ZUX U;  2KU3 A;  4QSS A;  2ECT A;  3JVJ A;  5DBM A;  4V3L C;  5DLX A;  5K3Q A;  3ZNI A;  4AKI A;  5LKU A;  2OWA A;  5I7X A;  3S92 A;  5HRX A;  2PUY A;  4PCE A;  3N9L A;  5K29 A;  4CL9 A;  2K1J A;  2K4D A;  2LQ6 A;  3V43 A;  5EWW A;  3M7K A;  5F36 A;  4QSV A;  5CQ3 A;  4YYK A;  2E6R A;  3NG2 A;  3SOU A;  4GNG A;  4N4F A;  4O76 A;  4UIZ A;  5CUA A;  4IOR A;  4QSW A;  3UVY A;  3DPL R;  4MR4 A;  5HFR A;  2LGL A;  5FH7 A;  3MUL A;  5ETD A;  4YBS A;  4QQ4 A;  4R2Y A;  5BT4 A;  4AUQ B;  5KO4 A;  2DSM A;  5A5R A;  1VFY A;  1K2F A;  2UZG A;  4GB0 A;  5G4R A;  1X4I A;  5HLS A;  5CQ6 A;  3MUK A;  5IGK A;  5KH9 A;  1Z60 A;  4WA6 A;  5DX4 A;  4CUU A;  4UYG A;  1JM7 B;  5L98 A;  1X4U A;  2H0D B;  3NXB A;  4Q6F A;  4HBY A;  5HCL A;  3VKG A;  4LYW A;  2LGV A;  4I7D A;  4UIY A;  3UW9 A;  1WIL A;  5JG6 A;  4A9L A;  3MB4 A;  5D3N A;  5C11 A;  2QIZ A;  5CRM A;  2KWN A;  2YYR A;  1IYM A;  4J3I A;  2DKW A;  2L75 A;  1Z2Q A;  3LXJ A;  2F42 A;  4WIV A;  5G05 B;  5TB6 A;  2YQD A;  2EGM A;  5HEL A;  4PKL A;  4Q0O A;  5CQ8 A;  4LKA A;  3O34 A;  5D25 A;  5H85 A;  5FE5 A;  2KWK A;  3L11 A;  4CUQ A;  4O70 A;  5CUB A;  2L84 A;  4QUU A;  4O71 A; 
#chains in the Genus database with same CATH homology
 4TZ8 A;  5F61 A;  5II2 A;  2MT5 A;  3G0J A;  5COI A;  4YY4 A;  4BW3 A;  2E3K A;  1X0J A;  4QSQ A;  4OUF A;  4YH4 A;  5EWC A;  5A85 A;  1LDK C;  3T7L A;  4XI1 A;  5H1V A;  5FE8 A;  5FG4 A;  5FG5 A;  3L1Z B;  5TDR A;  3L1X A;  2LXP C;  3DAI A;  4CFK A;  5HQ5 A;  2KE1 A;  2PNX A;  4GNF A;  5ENI A;  2ECN A;  5FE2 A;  2KWJ A;  4QEU A;  5LVQ A;  4UP5 A;  2EA6 A;  4IOQ A;  1WGM A;  3P1F A;  2AN6 A;  4NQN A;  5HEN A;  5LKT A;  5D1M B;  4TT6 A;  3QZS A;  5D26 A;  2RNX A;  2DX8 A;  2CKL A;  4ZDT A;  3VK6 A;  4QNS A;  4XY9 A;  4YK0 A;  1JOC A;  3M62 A;  2RSD A;  1WES A;  2GRC A;  4LZR A;  5L8T A;  4TS8 A;  2MNY A;  4NXJ A;  5F63 A;  1BOR A;  5D3J A;  5EP7 A;  2KYU A;  4HXM A;  3DQV R;  4PY6 A;  4YBT A;  4OGI A;  4N4G A;  2DAT A;  5EPR A;  4C67 A;  1WE9 A;  4NQM A;  5E74 A;  5EWV A;  4UYH A;  4PCI A;  5CUE A;  4A9O A;  3O36 A;  3P5O A;  2RO1 A;  3QZT A;  4O7F A;  4TQN A;  3UVD A;  4CLB A;  4GNE A;  5E9V A;  2FSA A;  2MA5 A;  4IR6 A;  5L99 A;  2ECI A;  3O7A A;  5C8G A;  2MA6 A;  5FER A;  3G0L A;  2L5E A;  2RFJ A;  5FB1 A;  2QIC A;  5AIT A;  4QR5 A;  4XUB A;  4I7B A;  4QF2 A;  4A0C D;  2DWW A;  4MR6 A;  4O7A A;  5I89 A;  3N9Q A;  3SOX A;  4QC3 A;  2MD8 C;  4HXO A;  1JM4 B;  1VYX A;  2DVS A;  5FE9 A;  4PTB A;  2ECJ A;  3MXF A;  4MVT A;  4QY4 A;  4V3K C;  4NR7 A;  5KTU A;  5C13 A;  4MEQ A;  5C7N A;  5EIC A;  3PUR A;  4GND A;  4Z6H A;  4BW4 A;  3LQH A;  4TYL A;  5CS8 A;  4LRG A;  2BAY A;  2LGK A;  5BT3 A;  3KQI A;  5B79 A;  5D3H A;  4UIX A;  3Q2F A;  3ASL A;  5TBN A;  4A4C A;  3TLP A;  4IR3 A;  3QZV A;  1WEE A;  4YAT A;  3FKM X;  5CUG A;  4X2I A;  5A5Q A;  5F60 A;  2M3H A;  5TDW A;  4B86 C;  4BW1 A;  4MEN A;  5LKX A;  5D24 A;  1T1H A;  5D3R A;  5E73 A;  2LRI C;  4J0R A;  5DKC A;  5I7Y A;  1LDJ B;  3GV4 A;  3KNV A;  2YEM A;  2YSM A;  5EPB A;  5LJ2 A;  3HMH A;  5E9K A;  2E7N A;  4TT4 A;  5CUC A;  2MUM A;  5KU3 A;  5EU1 A;  3S91 A;  1JM7 A;  4F3I A;  4UYF A;  2N9G A;  5TRB A;  1FP0 A;  4UYD A;  3HCT A;  5ENG A;  2YDW A;  5D7X A;  5EA1 A;  5G0F A;  3ONI A;  4O74 A;  2VJE B;  3U5N A;  5IGM A;  5CTL A;  4MR5 A;  5IG6 A;  2CT2 A;  2MJV B;  5DLZ A;  5FFW A;  4CA1 A;  5LVR A;  5JWM A;  4IR4 A;  5DW1 A;  4C66 A;  4ZC9 A;  5EQ1 A;  2FUI A;  5H9M A;  2JMI A;  4A9M A;  5HEM A;  4S3O B;  4NR5 A;  2E6S A;  3ZTG A;  5ETB A;  5EIS A;  5D3S A;  5A81 A;  2L5U A;  2MNZ A;  2H60 A;  2L43 A;  4QZS A;  5EWH A;  3LRQ A;  4DON A;  5ACY A;  2I8N A;  2YSJ A;  5E7D A;  4A9J A;  3LJW A;  5A5S A;  5IGL A;  4HXS A;  5HJC A;  4WHW A;  4CUR A;  5CQ5 A;  4L58 A;  4NUC A;  3RCW A;  2MD7 B;  4A9I A;  3ZYQ A;  4UYF B;  5KTX A;  3HCS A;  2M6M A;  3JVK A;  5E9M A;  4Y03 A;  3U5J A;  3U5K A;  3SVF A;  1WEW A;  2F6N A;  4HXP A;  5IBN A;  1EQF A;  5KTW A;  4IC3 A;  5FFV A;  5L97 A;  3DWY A;  5EI4 A;  4QEV A;  3U5O A;  3AAD A;  5A5N A;  1WUM A;  4WZ3 B;  2VP7 A;  2LV9 A;  5F1H A;  5AIU A;  5ENC A;  1DVP A;  5E9I A;  5D0C A;  5DYX A;  4KV1 A;  4TU4 A;  4NUE A;  4BJX A;  2F6J A;  5CRZ A;  4BBQ A;  5E9L A;  4HBW A;  2DVV A;  4NRB A;  5B8D A;  2C2V S;  4BW2 A;  5H1T A;  1RMD A;  2VPD A;  4LC2 A;  4YH3 A;  5B75 A;  4MEO A;  1WUG A;  5D3P A;  2ZET C;  5LCW B;  2VPB A;  3IU5 A;  5CGP A;  4O7B A;  4O75 A;  5I80 A;  3UVW A;  4YYH A;  5C85 A;  3KV6 A;  5DKH A;  5HQ6 A;  4MSX A;  4HXR A;  5LJ1 A;  4OGJ A;  4HBX A;  4YY6 A;  2YEK A;  5DKD A;  5I40 A;  1X4J A;  4L7X A;  5J3X A;  2NXB A;  4CUP A;  2VPE A;  3M63 A;  5EV9 A;  4QSR A;  2EGP A;  4FO9 A;  5CU8 A;  4QYL A;  4A9H A;  1WEM A;  4YAX A;  5I86 A;  2R0V A;  3U5P A;  5ENB A;  2DVR A;  3N9P A;  1WEN A;  3PHD A;  2I50 A;  2EOD A;  4B7Y C;  2I7K A;  5E0R A;  4IOO A;  1WFK A;  2LGG A;  4UIT A;  4YC9 A;  4YYM A;  2OXQ C;  5D1K B;  3KV5 A;  2R0S A;  2C2L A;  3UV2 A;  5AME A;  5TCM A;  4N4H A;  2L80 A;  5CP5 A;  5HFQ A;  4AVX A;  5HQ7 A;  2L0B A;  5CQ4 A;  4IC2 A;  5BT5 A;  4HXK A;  2XEU A;  1XWH A;  4Z93 A;  5F5Z A;  4NN2 A;  4FK5 A;  4CCG X;  5FH6 A;  4S3O C;  1F68 A;  3LQI A;  2HYE D;  4QR4 A;  5HRV A;  2VJF B;  2YUR A;  5CUD A;  5FE6 A;  2YU4 A;  5II1 A;  4LR6 A;  2G43 A;  3EB6 A;  5DIN A;  3UV5 A;  4QF3 A;  4YYD A;  3ZYU A;  4LZ2 A;  1HYJ A;  5EM3 A;  2OO1 A;  5E9Y A;  3GL6 A;  3U5M A;  4J1P A;  4WZ2 A;  4CFL A;  4HXN A;  5I29 A;  3MHS A;  2RS9 B;  2Y1N A;  5B78 A;  1ZS5 A;  4QSU A;  3O35 A;  2HDP A;  5DKA A;  2VJE A;  1JSP B;  4F52 B;  3JVL A;  5DW2 A;  4LJN A;  1HYI A;  4A9E A;  5FE0 A;  5AMF A;  4LAD B;  5D1L B;  2R0Y A;  5DYU A;  4KCX A;  5EGU A;  3P1E A;  5FE1 A;  3O37 A;  4O7C A;  4UIV A;  5A5P A;  2WP2 A;  4YYN A;  1WEQ A;  5KHM A;  4ZQL A;  3HME A;  2KRE A;  3IU6 A;  2ECV A;  4LYS A;  1FBV A;  4BHW A;  4O7E A;  5HRW A;  5I1Q A;  2D82 A;  3P1C A;  4N3W A;  2YQM A;  2Y43 A;  2E7O A;  5JI8 A;  1MM2 A;  2YW8 A;  5F3A A;  3LQJ A;  4QST A;  2VJF A;  4A4B A;  3N9M A;  2VPG A;  2KGG A;  2YQL A;  5ENH A;  2KWO A;  2YYN A;  5FE4 A;  3SOW A;  4PS5 A;  2VNF A;  4YAB A;  3RPG C;  2Y1M A;  2L85 A;  4Q0N A;  1G25 A;  4LK9 A;  4I7C A;  4QB3 A;  4A9F A;  5J0D A;  2JMJ A;  3ZVY A;  2YUC A;  3ZPV E;  4R7E A;  5CPE A;  5C89 A;  4RVR A;  4TZ2 A;  2KGI A;  4QSX A;  3MB3 A;  4WZ0 A;  3ZVZ B;  2YT5 A;  1U6G B;  5AD3 A;  2KFT A;  5I3L A;  5DYC A;  3HMF A;  2QJ0 A;  3RPG B;  4ALH A;  2YW5 A;  4QYD A;  1WEU A;  4W4U A;  2G4A A;  1E6I A;  2K17 A;  3PUQ A;  1N87 A;  5F1L A;  2JMD A;  2KTB B;  3SHB A;  1E4U A;  5CQA A;  5DY7 A;  3C5K A;  2R10 A;  3O33 A;  4LLB A;  4TKP B;  3N9N A;  2K16 A;  5ENJ A;  4Z6I A;  1VD4 A;  4PPE A;  5A83 A;  2KIZ A;  1WIM A;  4MR3 A;  2M1R A;  4O78 A;  5G04 B;  4UYE A;  4NRA A;  4UIU A;  3SVG A;  4UP0 A;  2CSZ A;  4MEP A;  5EK9 A;  5EWD A;  3SVH A;  4TTE A;  5ENF A;  5E3D A;  3M99 A;  4AP4 A;  2IDA A;  4O77 A;  1WEO A;  4UIW A;  5A82 A;  3MHH A;  5DFC A;  4AYC B;  2LSP B;  2RNW A;  2M85 A;  4UI9 B;  4CUT A;  3RTR B;  4YYJ A;  4FIP A;  5FH8 A;  5FE3 A;  2XB1 A;  4YBM A;  5CFW A;  4YYI A;  4ZW1 A;  5I88 A;  4KV4 A;  1Z6U A;  3GG3 A;  4NR6 A;  2FUU A;  5LKZ A;  4QR3 A;  4HXL A;  4TU6 A;  5FE7 A;  2G6Q A;  2MIQ A;  5TAB A;  2OUO A;  2RI7 A;  4HBV A;  2NAA A;  4IR5 A;  2ECW A;  5EPS A;  5IID A;  4Z1Q A;  5CZG A;  4O72 A;  4X3G A;  3MQM A;  4N4I A;  5CQ7 A;  4LZS A;  4QSP A;  4NR4 A;  4NYX A;  5D3T A;  5I83 A;  5L8U A;  1WEV A;  4FJC A;  3AQA A;  3FL2 A;  5CQT A;  3Q2E A;  4E96 A;  5EVA A;  4Z1S A;  4NRC A;  3UVX A;  5A5O A;  4NS5 A;  2LDR A;  3HTK C;  2WP1 A;  2CKL B;  4NR8 A;  4NYW A;  5H1U A;  5LUU A;  5F25 A;  5KH7 A;  5KH3 A;  4AYC A;  2YHN A;  5CY9 A;  1F62 A;  5FEY A;  4NR9 A;  4XY8 A;  5E3G A;  4CUS A;  2JRJ A;  4QBM A;  5AD2 A;  3UV4 A;  2KR4 A;  5D3L A;  3U5L A;  2ECG A;  5B76 A;  4ALG A;  3HCU A;  4QUT A;  2D9E A;  5DFD A;  4QC1 A;  5DYA A;  4O64 A;  4NUD A;  4TT2 A;  2LXH C;  2YEL A;  3IHP A;  5G4S A;  3O70 A;  3I2D A;  4P5O B;  3K2J A;  5FFY A;  4FLP A;  3ZPV 1;  5B77 A;  5L96 A;  3P1D A;  2YHO A;  4LDF A;  1MM3 A;  5FDZ A;  5FG6 A;  4A9N A;  1N72 A;  2OSS A;  4A49 A;  3D7C A;  5DFB A;  5C87 A;  4AKN A;  5ENE A;  1V87 A;  5F2P A;  5A7C A;  3T6R A;  4YAD A;  4GPJ A;  4YYG A;  2G45 A;  4QEW A;  3I3J A;  2YRE A;  5IGN A;  4C9Z A;  2H0D A;  1CHC A;  4R8P K;  2RNY A;  3JVM A;  4A9K A;  5C4Q A;  3N9O A;  5HM0 A;  5LJ0 A;  5F62 A;  4J0S A;  4NYV A;  2CSY A;  2DVQ A;  4XYA A;  5FB0 A;  4LYI A;  5FBX A;  4XUA A;  1ZBD B;  1WEP A;  2D8S A;  2LN0 A;  3EB5 A;  5EYA F;  4WHU A;  3C6W A;  4ZUX U;  2KU3 A;  4QSS A;  2ECT A;  3JVJ A;  5DBM A;  4V3L C;  5DLX A;  3ZNI A;  5LKU A;  5I7X A;  3S92 A;  5HRX A;  2PUY A;  4PCE A;  3N9L A;  5K29 A;  4CL9 A;  2K1J A;  2K4D A;  2LQ6 A;  3V43 A;  5EWW A;  5F36 A;  4QSV A;  5CQ3 A;  4YYK A;  2E6R A;  3NG2 A;  3SOU A;  4GNG A;  4N4F A;  4O76 A;  4UIZ A;  5CUA A;  4IOR A;  4QSW A;  3UVY A;  3DPL R;  4MR4 A;  5HFR A;  2LGL A;  5FH7 A;  3MUL A;  5ETD A;  4YBS A;  4AUQ B;  4R2Y A;  5BT4 A;  5KO4 A;  5A5R A;  1VFY A;  1K2F A;  2UZG A;  4GB0 A;  5G4R A;  1X4I A;  5HLS A;  5CQ6 A;  3MUK A;  5IGK A;  5KH9 A;  1Z60 A;  4WA6 A;  5DX4 A;  4CUU A;  4UYG A;  1JM7 B;  5L98 A;  1X4U A;  2H0D B;  3NXB A;  4Q6F A;  4HBY A;  5HCL A;  4LYW A;  2LGV A;  4I7D A;  4UIY A;  3UW9 A;  1WIL A;  5JG6 A;  4A9L A;  3MB4 A;  5D3N A;  5C11 A;  2QIZ A;  5CRM A;  2KWN A;  2YYR A;  1IYM A;  4J3I A;  2DKW A;  2L75 A;  1Z2Q A;  3LXJ A;  2F42 A;  4WIV A;  5G05 B;  5TB6 A;  2YQD A;  5HEL A;  4PKL A;  4Q0O A;  5CQ8 A;  4LKA A;  3O34 A;  5D25 A;  5H85 A;  5FE5 A;  2KWK A;  3L11 A;  4CUQ A;  4O70 A;  5CUB A;  2L84 A;  4QUU A;  4O71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...