3U5MA

Crystal structure of trim33 phd-bromo in the free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
203
structure length
178
Chain Sequence
PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 49
structure length 178
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5mA01
4X3GA 3UW9A 1N87A 2ECWA 5TB6A 5EGUA 4QSWA 4C9ZA 1U6GB 2K17A 5EWDA 1T1HA 5LKXA 1HYJA 5EWHA 3DQVR 2VPGA 5FE4A 1JSPB 5EP7A 4I7CA 3T6RA 4NR9A 2VPEA 5CUAA 5JWMA 5J3XA 5FDZA 4NYXA 2CSYA 2R10A 5CQ5A 5IGNA 2KU3A 4O74A 5FFVA 4BW4A 5IGLA 2H0DB 3LQHA 4MR5A 5DKDA 4IC3A 3RCWA 4YYJA 4WIVA 4QR4A 5D3SA 5E9LA 3V43A 5HENA 2G6QA 2Y43A 4A4CA 4MR4A 2RNYA 5HFQA 5B8DA 4R2YA 5G4RA 5HRVA 4S3OC 4NXJA 4HXKA 2BAYA 4N4IA 5AIUA 2HDPA 5FE8A 5CUDA 1JM7A 2XB1A 5AITA 3M62A 5C8GA 3O70A 5H9MA 4PS5A 5CUBA 5FE9A 2KYUA 5ENEA 3UVXA 2PUYA 5EA1A 5EWCA 4KV1A 3JVMA 5AMEA 5EPBA 4A9IA 5HQ6A 2FUIA 3U5MA 4O7AA 4PTBA 2YSMA 4IR6A 4YATA 4LR6A 3ZVZB 1K2FA 1VFYA 4YH4A 5ENCA 2WP1A 5E7DA 2MT5A 4QUTA 4QBMA 2MJVB 5CUGA 1BORA 2L5UA 4N4GA 2QIZA 4A9MA 5D1LB 3NG2A 5LKUA 3IU5A 4A9NA 2K16A 4ZUXU 1X0JA 3QZSA 5L8UA 2MA5A 4NUEA 5I1QA 4MSXA 2MUMA 2CT2A 4QSXA 4N4HA 4WA6A 4QNSA 5FE7A 5HRXA 4UIYA 2DVQA 1MM3A 2QJ0A 5CRMA 4ZW1A 2YUCA 4FIPA 3RTRB 5H85A 4LYSA 5EWWA 4QSRA 4LK9A 2H0DA 5TDRA 2VJFA 3HMHA 4IOQA 1G25A 5A85A 3HTKC 5D0CA 5D3RA 1X4UA 3C6WA 4OGIA 2N9GA 5H1VA 4J1PA 3U5OA 5E74A 1XWHA 4UYFB 4NQMA 4ZQLA 2L85A 4O76A 5HM0A 3EB6A 5KH9A 4A4BA 5C13A 5ENIA 5EICA 4PY6A 2ECTA 2M6MA 2M85A 5ENBA 4A9OA 3SVFA 1ZBDB 3U5KA 2KTBB 4Q6FA 4FJCA 5HEMA 4CUUA 5JG6A 4LADB 4QUUA 5BT4A 4FO9A 4TYLA 3JVKA 4Z6IA 5F5ZA 5F36A 1ZS5A 4HXRA 3SVGA 5DFDA 5G4SA 4V3LC 5L8TA 3DAIA 5CP5A 2E6SA 2AN6A 3ZVYA 5FH8A 4XYAA 4YYHA 4MR6A 1CHCA 3DPLR 4O64A 4UP0A 1WUMA 2YW8A 4WHWA 4CUTA 4YYMA 5KH3A 5KH7A 3N9OA 4PCIA 3LQJA 4QC1A 5FE2A 2I50A 4CUSA 5CY9A 2YDWA 4YK0A 2YHOA 5KU3A 5CQ4A 4Q0OA 5HCLA 1JM4B 5L98A 5A81A 5A7CA 2RI7A 4NR6A 5CQ3A 4MENA 5I83A 2RS9B 5D7XA 3GL6A 5II1A 4XUBA 3C5KA 3SHBA 4TU6A 5D3NA 3KQIA 4HXNA 4ALHA 4QF3A 2D82A 1WESA 4O71A 4A9JA 5B79A 2G45A 4UYFA 3Q2EA 2D9EA 4C66A 3SOWA 4Z1SA 4QR3A 3P1FA 2DVSA 4HBWA 4HXOA 5L96A 4IR4A 5AD3A 5LVRA 5FH6A 2F42A 2Y1NA 5I7YA 4TS8A 4Z6HA 2KGGA 3ZTGA 3I2DA 2KFTA 2LSPB 5DKHA 4GB0A 4HBVA 2VJFB 5I29A 5ENHA 2F6NA 4GNDA 4IORA 5C89A 4O7FA 4CLBA 4XUAA 2LV9A 5ENJA 2FSAA 2JMDA 1X4JA 2L80A 4TQNA 5D3JA 3N9MA 4OGJA 5HQ5A 2E3KA 4B86C 5II2A 3U5JA 4UYGA 4L7XA 2G43A 4LYIA 3O34A 2NXBA 4QZSA 4C67A 2FUUA 3MHSA 4QSTA 4AYCA 3UV2A 2K4DA 5IGMA 4O75A 5D24A 4HXPA 5CZGA 5F1HA 4YYIA 5DYCA 5C11A 5CRZA 4UIUA 3PUQA 4W4UA 2YYRA 2YYNA 4HXMA 5CS8A 5J0DA 3O7AA 5B77A 4UYHA 4YBTA 5A82A 5H1UA 2DX8A 4NS5A 2OO1A 3LXJA 1LDKC 2MIQA 4FK5A 4NUCA 4ALGA 4E96A 4UIWA 4CFLA 5E0RA 1WEOA 5TBNA 4YY6A 1WEEA 4LZSA 5IG6A 5CGPA 1FBVA 2C2LA 5TDWA 5HJCA 5LJ0A 5G0FA 1WEUA 4UI9B 4A9EA 2G4AA 4MEQA 3HCUA 2EA6A 4QB3A 5BT3A 4NQNA 5HLSA 2RFJA 3UVYA 3RPGB 4GNGA 2ECJA 4A49A 3I3JA 5E9YA 4NR5A 3QZTA 4NUDA 4QSVA 3TLPA 3UVDA 3NXBA 3MXFA 4NYWA 4KV4A 3LRQA 5CQ7A 4O77A 5DBMA 5JI8A 4GNEA 4V3KC 1VD4A 1MM2A 4Q0NA 5I86A 2UZGA 4XI1A 2KWOA 2D8SA 2YU4A 4XY8A 4IR3A 5EPRA 1WEVA 4LZRA 2PNXA 5DKCA 5A5NA 3S91A 2RO1A 3IHPA 3O35A 3K2JA 5D3HA 1WENA 2LQ6A 4LDFA 4O7EA 2LXPC 5BT5A 5E9VA 4O70A 3Q2FA 5A5SA 3U5PA 2L75A 3ZPV1 5FERA 2VPDA 5FE1A 3P1DA 5D1MB 3FL2A 2YW5A 4WZ2A 2KWNA 4TZ2A 2C2VS 5C87A 5ACYA 4NRAA 3MULA 4CUPA 3LJWA 4TZ8A 1IYMA 1WEWA 5B78A 2ECGA 5C7NA 3ZYQA 4YAXA 2LGVA 2YREA 4YC9A 5DLXA 4J0RA 3HCSA 5FFWA 3JVLA 4MR3A 2M3HA 5E73A 4TT6A 5ETDA 5D3PA 2YQLA 4YYGA 4CFKA 2OSSA 5G05B 4LZ2A 4QSUA 2DWWA 5E3DA 3KV5A 3P5OA 2YEMA 5CFWA 2LRIC 3N9QA 5CQ6A 5ENFA 3SVHA 5HRWA 3U5LA 2QICA 4O72A 3ZPVE 4AVXA 5EM3A 4PPEA 4NRBA 4WZ3B 1RMDA 2L43A 3HMFA 5E9KA 5I40A 4LJNA 4FLPA 2KWJA 4NR8A 4QYLA 5TCMA 4A9KA 2VPBA 4NR7A 4CCGX 4YH3A 5FB1A 5C85A 4NN2A 3LQIA 3P1EA 4UYDA 3JVJA 2LXHC 5LVQA 3N9LA 5FB0A 5FG6A 4AYCB 2YELA 5KHMA 2KR4A 5FEYA 5KTXA 1WIMA 1Z2QA 5DKAA 2RSDA 1FP0A 4BJXA 3FKMX 2MA6A 1WFKA 1F68A 5LCWB 3AADA 2LGKA 4YYDA 5HQ7A 5IGKA 4LYWA 5COIA 4CL9A 5DW1A 2M1RA 3IU6A 4Y03A 1WEPA 3L1ZB 5LJ2A 3PURA 1HYIA 3MB4A 3ZYUA 3O36A 5D25A 5B75A 4LKAA 2MD8C 5E3GA 4TT4A 1Z6UA 4CA1A 5DW2A 5EV9A 5E9MA 5A5OA 2R0VA 3UV4A 5KO4A 5CQTA 3ZNIA 4S3OB 4IC2A 2KIZA 5CQAA 1X4IA 3MHHA 5D1KB 2IDAA 5EK9A 4UYEA 4TT2A 4HBXA 2JMJA 2YQDA 5FE3A 2XEUA 2MNZA 1WILA 2YSJA 4BHWA 2L0BA 5LKTA 5EPSA 4QC3A 4X2IA 5CUCA 5A5RA 4MEPA 2F6JA 4QSSA 4CUQA 4YYKA 1F62A 5CU8A 5HELA 4F52B 2JMIA 3VK6A 5ETBA 5L97A 4XY9A 5DYUA 4ZDTA 5K29A 2JRJA 4L58A 4A9FA 2OXQC 4IOOA 5AMFA 2CKLB 4UIXA 5D3TA 2DKWA 5EVAA 5DFCA 2ECVA 4J3IA 4N3WA 4O78A 3GG3A 4BW3A 5AD2A 2MNYA 5F63A 4I7BA 4TU4A 3O37A 5EQ1A 3S92A 4R7EA 4TKPB 2I7KA 5TRBA 2VJEB 5DFBA 2WP2A 5CUEA 4QSQA 1V87A 2EGPA 4IR5A 4I7DA 1E6IA 1DVPA 2H60A 2LGLA 4UIVA 4LLBA 4UITA 3O33A 3M99A 3KNVA 5EYAF 5FE0A 2I8NA 5EISA 1LDJB 3ONIA 1Z60A 3UV5A 3L11A 5C4QA 2DVVA 2RNWA 3D7CA 2DATA 5FG5A 2YHNA 2E7OA 2HYED 5DY7A 5F1LA 5L99A 3HMEA 5LJ1A 2L5EA 5DYXA 5FH7A 4DONA 1WEQA 2NAAA 5FE6A 2E6RA 3RPGC 2KWKA 5LKZA 4AUQB 2ECIA 4QYDA 4O7CA 4QEWA 2ECNA 4GNFA 5A83A 4A0CD 3DWYA 4PKLA 5FG4A 5CPEA 3P1CA 4J0SA 5F60A 5FBXA 1VYXA 2CSZA 2LDRA 1N72A 4YADA 3G0JA 4KCXA 2KGIA 3KV6A 3HCTA 1WE9A 3MB3A 1WUGA 3GV4A 5F2PA 4OUFA 3G0LA 5F62A 5D26A 5FFYA 3SOUA 4A9LA 3ASLA 2R0SA 5CTLA 5I88A 5IIDA 4MVTA 4RVRA 5LUUA 4YABA 2EODA 4YYNA 2RNXA 4NR4A 5KTWA 3N9PA 2GRCA 4HXLA 4QR5A 5A5PA 4CURA 4GPJA 3SOXA 4R8PK 2CKLA 5FE5A 3MQMA 5G04B 4ZC9A 3T7LA 2YEKA 4P5OB 4BW1A 2VP7A 4QEVA 4A9HA 4B7YC 5DINA 2L84A 4UIZA 3MUKA 4TTEA 2VJEA 4LC2A 4YBMA 4QF2A 2LGGA 5I89A 3M63A 3AQAA 2YURA 4UP5A 2R0YA 2ZETC 4YBSA 4NYVA 5HFRA 2DVRA 4QEUA 5F3AA 5EWVA 4HBYA 2YQMA 1EQFA 4YY4A 1JM7B 5I7XA 3UVWA 5F61A 2MD7B 5KTUA 4AP4A 5B76A 5I80A 3QZVA 2KE1A 2K1JA 5CQ8A 4LRGA 4O7BA 5EU1A 4NRCA 3PHDA 5ENGA 4QY4A 5I3LA 2OUOA 5DX4A 1E4UA 5D3LA 1JOCA 4MEOA 2YT5A 5TABA 4BBQA 3L1XA 2E7NA 4PCEA 2Y1MA 5DYAA 1WGMA 2KREA 1WEMA 5E9IA 3U5NA 4N4FA 2VNFA 4Z93A 4F3IA 4Z1QA 5H1TA 5EI4A 2LN0A 3N9NA 4AKNA 4WZ0A 5IBNA 4HXSA 5A5QA 4WHUA 5F25A 4BW2A 3EB5A 4QSPA 5DLZA
chains in the Genus database with same CATH superfamily
4X3GA 3UW9A 1N87A 2ECWA 5TB6A 5EGUA 4QSWA 4C9ZA 1U6GB 2K17A 5EWDA 1T1HA 5LKXA 1HYJA 5EWHA 3DQVR 2VPGA 5FE4A 1JSPB 5EP7A 4I7CA 3FANA 3T6RA 4NR9A 2D8UA 5CUAA 2VPEA 5JWMA 3FM8C 5FDZA 5J3XA 4NYXA 2CSYA 2R10A 5CQ5A 5IGNA 2KU3A 4O74A 5FFVA 4BW4A 5IGLA 2H0DB 3LQHA 4MR5A 5DKDA 4IC3A 3RCWA 4YYJA 4WIVA 4QR4A 5D3SA 5E9LA 3V43A 5HENA 2G6QA 2Y43A 4A4CA 4MR4A 2RNYA 5HFQA 5B8DA 4AKGA 4R2YA 5G4RA 5HRVA 4S3OC 4NXJA 4HXKA 2BAYA 4N4IA 5AIUA 2HDPA 5FE8A 5CUDA 1JM7A 2XB1A 3VKHA 5AITA 3M62A 5C8GA 4AKHA 3O70A 5H9MA 2XOZA 4PS5A 5CUBA 5FE9A 2KYUA 5ENEA 3UVXA 2PUYA 5EA1A 5EWCA 4KV1A 3JVMA 2JUNA 5AMEA 5EPBA 4A9IA 2CSVA 4H9DA 5HQ6A 2FUIA 3U5MA 4O7AA 4PTBA 2YSMA 4IR6A 4YATA 4LR6A 3ZVZB 1K2FA 1VFYA 4YH4A 5ENCA 2WP1A 5E7DA 2MT5A 4QUTA 4QBMA 2MJVB 5CUGA 1BORA 2L5UA 4N4GA 2QIZA 4A9MA 5D1LB 3NG2A 5LKUA 3IU5A 4A9NA 2K16A 4ZUXU 1X0JA 3QZSA 5L8UA 2MA5A 4NUEA 5I1QA 4MSXA 2MUMA 2CT2A 4QSXA 4N4HA 2XP0A 4WA6A 4Z0RA 4QNSA 5FE7A 5HRXA 4UIYA 2DVQA 1MM3A 2QJ0A 5CRMA 4ZW1A 2YUCA 4FIPA 3RTRB 5H85A 4LYSA 5EWWA 4QSRA 4LK9A 2H0DA 5TDRA 2VJFA 3HMHA 4IOQA 1G25A 2KKYA 5A85A 3HTKC 5D0CA 5D3RA 1X4UA 3C6WA 4OGIA 2N9GA 5H1VA 4J1PA 3U5OA 5E74A 1XWHA 4UYFB 4NQMA 4ZQLA 2L85A 4O76A 5HM0A 3EB6A 5KH9A 4A4BA 5C13A 5ENIA 5EICA 4PY6A 1PUOA 2ECTA 2M6MA 2M85A 5ENBA 4A9OA 3SVFA 1ZBDB 3U5KA 2KTBB 4Q6FA 4FJCA 3Q1DA 5HEMA 4CUUA 5JG6A 4LADB 4QUUA 5BT4A 3LDYA 4FO9A 4TYLA 3JVKA 4Z6IA 3FEHA 5F5ZA 5F36A 1ZS5A 4HXRA 3SVGA 5DFDA 5G4SA 4V3LC 5L8TA 3DAIA 5CP5A 2E6SA 2AN6A 3ZVYA 5FH8A 4XYAA 4YYHA 4MR6A 1CHCA 3DPLR 4O64A 4UP0A 1WUMA 2YW8A 4WHWA 4CUTA 4YYMA 5KH3A 5KH7A 3N9OA 3DWDA 4PCIA 3LQJA 2XOCA 4QC1A 5FE2A 2FFWA 2I50A 4CUSA 2P57A 3M7KA 5CY9A 2YDWA 4YK0A 2YHOA 5KU3A 5CQ4A 4Q0OA 5HCLA 1JM4B 5L98A 5A81A 5A7CA 2OWAA 2RI7A 4NR6A 5CQ3A 4MENA 3ERRA 2RS9B 5D7XA 5I83A 3GL6A 3LJUX 5II1A 4XUBA 3C5KA 3SHBA 4TU6A 5D3NA 3KQIA 4HXNA 4ALHA 3PLWA 4O62A 4QF3A 2D82A 1WESA 4O71A 4A9JA 2YVRA 5B79A 1DCQA 2G45A 4UYFA 3Q2EA 2D9EA 4C66A 3SOWA 4Z1SA 4QR3A 3P1FA 2DVSA 4HBWA 4HXOA 5L96A 4IR4A 5AD3A 5LVRA 5FH6A 2F42A 2Y1NA 5I7YA 4TS8A 4Z6HA 2KGGA 3ZTGA 3T9KA 3I2DA 2KFTA 2LSPB 2RR4A 5DKHA 4GB0A 4HBVA 2VJFB 5I29A 5ENHA 2F6NA 4GNDA 4IORA 5C89A 4O7FA 4CLBA 4XUAA 2LV9A 5ENJA 2FSAA 2JMDA 1X4JA 2L80A 4TQNA 5D3JA 3N9MA 4OGJA 5HQ5A 2E3KA 4B86C 5II2A 3U5JA 4UYGA 4L7XA 2G43A 4LYIA 3O34A 2NXBA 4QZSA 4C67A 2FUUA 3MHSA 4QSTA 4AYCA 3UV2A 2K4DA 3FAOA 5IGMA 4O75A 5D24A 4HXPA 5CZGA 5F1HA 4YYIA 5DYCA 5C11A 5CRZA 4UIUA 3PUQA 4W4UA 2YYRA 5SVIB 2YYNA 2KKXA 4HXMA 5CS8A 5B77A 5J0DA 2B0OE 3O7AA 4UYHA 4YBTA 5A82A 5H1UA 2DX8A 4NS5A 2OO1A 3LXJA 1LDKC 2EGMA 2MIQA 4FK5A 4NUCA 4ALGA 4E96A 4UIWA 4CFLA 5E0RA 1WEOA 5TBNA 2DJAA 4YY6A 1WEEA 4LZSA 5IG6A 5CGPA 1FBVA 2C2LA 5TDWA 5HJCA 5LJ0A 5G0FA 1WEUA 4UI9B 4A9EA 2G4AA 4MEQA 3VKGA 3HCUA 2EA6A 4QB3A 5BT3A 4NQNA 5HLSA 2RFJA 3UVYA 3KDEC 1ZKRA 4GNGA 2ECJA 3RPGB 4A49A 3I3JA 5E9YA 4NR5A 3QZTA 1MBMA 4NUDA 4QSVA 3TLPA 3UVDA 3NXBA 3MXFA 4NYWA 4KV4A 4QQ4A 3LRQA 5CQ7A 4O77A 5DBMA 5JI8A 4GNEA 4V3KC 1VD4A 1MM2A 4Q0NA 5SVXA 5I86A 2UZGA 4XI1A 2KWOA 2D8SA 2YU4A 4XY8A 4IR3A 5EPRA 1WEVA 4LZRA 2PNXA 5DKCA 5A5NA 3S91A 2RO1A 3IHPA 3O35A 3K2JA 5D3HA 1WENA 2LQ6A 4LDFA 4O7EA 2DSMA 2LXPC 5BT5A 5E9VA 4O70A 3Q2FA 5A5SA 3U5PA 2L75A 3DDTA 3ZPV1 2VPDA 5FERA 5FE1A 3P1DA 5D1MB 3FL2A 2YW5A 4WZ2A 2KWNA 4TZ2A 2C2VS 5C87A 5ACYA 4NRAA 3MULA 4CUPA 3LJWA 4TZ8A 1IYMA 1WEWA 4OGEA 5B78A 2ECGA 5C7NA 3D1BA 3ZYQA 4YAXA 2LGVA 2YREA 5SVIA 4YC9A 5DLXA 4J0RA 3HCSA 5K3QA 5FFWA 3JVLA 4MR3A 2M3HA 3FJUB 5E73A 3LVRE 4TT6A 5ETDA 5D3PA 2YQLA 4YYGA 4CFKA 2OSSA 5G05B 4LZ2A 4QSUA 2DWWA 5E3DA 3KV5A 3P5OA 2YEMA 5CFWA 2EXUA 2LRIC 3N9QA 5CQ6A 5ENFA 3SVHA 5HRWA 3U5LA 2QICA 4O72A 3ZPVE 4AVXA 5EM3A 4PPEA 4NRBA 4WZ3B 1RMDA 2L43A 3HMFA 5E9KA 5I40A 4LJNA 3D1DA 4FLPA 2KWJA 4NR8A 4QYLA 5TCMA 4A9KA 2VPBA 4NR7A 3H7HA 4CCGX 4YH3A 5FB1A 5C85A 4NN2A 3LQIA 3P1EA 4UYDA 3JVJA 2LXHC 5LVQA 3N9LA 5FB0A 5FG6A 4AYCB 2YELA 5KHMA 2KR4A 5FEYA 5KTXA 1WIMA 1Z2QA 5DKAA 2RSDA 1FP0A 4BJXA 3FKMX 2MA6A 1WFKA 1F68A 5LCWB 3AADA 2CRRA 4YYDA 5HQ7A 5IGKA 4LYWA 2LGKA 5COIA 4CL9A 5DW1A 2M1RA 3IU6A 4Y03A 1WEPA 3L1ZB 5LJ2A 3PURA 1HYIA 3MB4A 3ZYUA 2E61A 3O36A 5D25A 5B75A 3E2DA 4LKAA 2MD8C 5E3GA 4TT4A 1Z6UA 4CA1A 5DW2A 5EV9A 5E9MA 5A5OA 2R0VA 3UV4A 5KO4A 5CQTA 3ZNIA 4S3OB 4IC2A 2KIZA 5CQAA 1X4IA 3MHHA 5D1KB 2IDAA 5EK9A 4UYEA 4TT2A 4HBXA 2JMJA 2YQDA 5FE3A 2XEUA 2MNZA 1WILA 2YSJA 4BHWA 2L0BA 5LKTA 5EPSA 4QC3A 4X2IA 5CUCA 5A5RA 2JM3A 4MEPA 2F6JA 4QSSA 4CUQA 4YYKA 2LAUA 1F62A 5CU8A 5HELA 4F52B 2CRWA 2JMIA 3VK6A 5ETBA 5L97A 4XY9A 5DYUA 4F1PA 4ZDTA 5K29A 2JRJA 4L58A 4A9FA 2OXQC 4IOOA 2FD4A 5AMFA 2CKLB 4OGCA 4UIXA 5D3TA 2DKWA 5EVAA 3SUBA 5DFCA 2ECVA 4J3IA 4N3WA 4O78A 3GG3A 4BW3A 5AD2A 2MNYA 5F63A 3JUEA 4TU4A 3O37A 5EQ1A 3S92A 4I7BA 4R7EA 2I7KA 5TRBA 4TKPB 2VJEB 5DFBA 2WP2A 5CUEA 4QSQA 1V87A 2EGPA 4IR5A 4I7DA 1E6IA 1DVPA 2H60A 2LGLA 4UIVA 4LLBA 4UITA 2M13A 3O33A 3M99A 3KNVA 5EYAF 5FE0A 2I8NA 5EISA 1LDJB 3ONIA 1Z60A 3UV5A 3L11A 5C4QA 2DVVA 2RNWA 3D7CA 2DATA 5FG5A 2YHNA 2E7OA 2HYED 5DY7A 5F1LA 5L99A 3HMEA 2IQJA 5LJ1A 2L5EA 5DYXA 5FH7A 4DONA 1WEQA 4Z0OA 2NAAA 5FE6A 2E6RA 3RPGC 2KWKA 5LKZA 4AUQB 2ECIA 4QYDA 4O7CA 4QEWA 2ECNA 4GNFA 5A83A 4A0CD 3DWYA 4PKLA 5FG4A 5CPEA 3P1CA 4J0SA 5F60A 5FBXA 1VYXA 2CSZA 2LDRA 1N72A 4YADA 2XOYA 3G0JA 4KCXA 2KGIA 3KV6A 3HCTA 1WE9A 3MB3A 1WUGA 3GV4A 5F2PA 4OUFA 3G0LA 5F62A 5D26A 5FFYA 3SOUA 4A9LA 3ASLA 2R0SA 5CTLA 5I88A 5IIDA 4MVTA 4RVRA 5LUUA 4YABA 2EODA 4YYNA 2RNXA 4NR4A 5KTWA 3N9PA 2GRCA 4HXLA 4QR5A 5A5PA 4CURA 4GPJA 3SOXA 4R8PK 2CKLA 5FE5A 3MQMA 5G04B 4ZC9A 3T7LA 2YEKA 4P5OB 4BW1A 2VP7A 4QEVA 4A9HA 4B7YC 5DINA 2L84A 4UIZA 3MUKA 4TTEA 2VJEA 4LC2A 4YBMA 4QF2A 2LGGA 5I89A 3MDBC 3M63A 3AQAA 2YURA 4UP5A 2R0YA 2ZETC 4YBSA 4NYVA 5HFRA 2DVRA 4QEUA 5F3AA 5EWVA 4AI6A 2CONA 4HBYA 2YQMA 1EQFA 4YY4A 1JM7B 5I7XA 3UVWA 5F61A 2MD7B 5KTUA 3LVQE 5SVYA 4AP4A 5B76A 5I80A 2L7PA 3QZVA 2KE1A 2K1JA 5CQ8A 4LRGA 4O7BA 5EU1A 2EJNA 4NRCA 3PHDA 5ENGA 4QY4A 5I3LA 2OUOA 4AKIA 5DX4A 1E4UA 5D3LA 1JOCA 3O47A 4MEOA 2YT5A 5TABA 4BBQA 3L1XA 2E7NA 4PCEA 2Y1MA 5DYAA 1WGMA 2KREA 1WEMA 5E9IA 3U5NA 4N4FA 2MKEA 2VNFA 4Z93A 4F3IA 4Z1QA 5H1TA 5EI4A 2LN0A 3N9NA 4AKNA 4WZ0A 5IBNA 4HXSA 5A5QA 4WHUA 5F25A 4BW2A 3EB5A 4QSPA 5DLZA
chains in the Genus database with same CATH topology
4X3GA 3UW9A 1N87A 2ECWA 5TB6A 5EGUA 4QSWA 4C9ZA 1U6GB 2K17A 5EWDA 1T1HA 5LKXA 1HYJA 5EWHA 3DQVR 2VPGA 5FE4A 1JSPB 5EP7A 4I7CA 3T6RA 4NR9A 2VPEA 5CUAA 5JWMA 5J3XA 5FDZA 4NYXA 2CSYA 2R10A 5CQ5A 5IGNA 2KU3A 4O74A 5FFVA 4BW4A 5IGLA 2H0DB 3LQHA 4MR5A 5DKDA 4IC3A 3RCWA 4YYJA 4WIVA 4QR4A 5D3SA 5E9LA 3V43A 5HENA 2G6QA 2Y43A 4A4CA 4MR4A 2RNYA 5HFQA 5B8DA 4R2YA 5G4RA 5HRVA 4S3OC 4NXJA 4HXKA 2BAYA 4N4IA 5AIUA 2HDPA 5FE8A 5CUDA 1JM7A 2XB1A 5AITA 3M62A 5C8GA 3O70A 5H9MA 4PS5A 5CUBA 5FE9A 2KYUA 5ENEA 3UVXA 2PUYA 5EA1A 5EWCA 4KV1A 3JVMA 5AMEA 5EPBA 4A9IA 5HQ6A 2FUIA 3U5MA 4O7AA 4PTBA 2YSMA 4IR6A 4YATA 4LR6A 3ZVZB 1K2FA 1VFYA 4YH4A 5ENCA 2WP1A 5E7DA 2MT5A 4QUTA 4QBMA 2MJVB 5CUGA 1BORA 2L5UA 4N4GA 2QIZA 4A9MA 5D1LB 3NG2A 5LKUA 3IU5A 4A9NA 2K16A 4ZUXU 1X0JA 3QZSA 5L8UA 2MA5A 4NUEA 5I1QA 4MSXA 2MUMA 2CT2A 4QSXA 4N4HA 4WA6A 4QNSA 5FE7A 5HRXA 4UIYA 2DVQA 1MM3A 2QJ0A 5CRMA 4ZW1A 2YUCA 4FIPA 3RTRB 5H85A 4LYSA 5EWWA 4QSRA 4LK9A 2H0DA 5TDRA 2VJFA 3HMHA 4IOQA 1G25A 5A85A 3HTKC 5D0CA 5D3RA 1X4UA 3C6WA 4OGIA 2N9GA 5H1VA 4J1PA 3U5OA 5E74A 1XWHA 4UYFB 4NQMA 4ZQLA 2L85A 4O76A 5HM0A 3EB6A 5KH9A 4A4BA 5C13A 5ENIA 5EICA 4PY6A 2ECTA 2M6MA 2M85A 5ENBA 4A9OA 3SVFA 1ZBDB 3U5KA 2KTBB 4Q6FA 4FJCA 5HEMA 4CUUA 5JG6A 4LADB 4QUUA 5BT4A 4FO9A 4TYLA 3JVKA 4Z6IA 5F5ZA 5F36A 1ZS5A 4HXRA 3SVGA 5DFDA 5G4SA 4V3LC 5L8TA 3DAIA 5CP5A 2E6SA 2AN6A 3ZVYA 5FH8A 4XYAA 4YYHA 4MR6A 1CHCA 3DPLR 4O64A 4UP0A 1WUMA 2YW8A 4WHWA 4CUTA 4YYMA 5KH3A 5KH7A 3N9OA 4PCIA 3LQJA 4QC1A 5FE2A 2I50A 4CUSA 5CY9A 2YDWA 4YK0A 2YHOA 5KU3A 5CQ4A 4Q0OA 5HCLA 1JM4B 5L98A 5A81A 5A7CA 2RI7A 4NR6A 5CQ3A 4MENA 5I83A 2RS9B 5D7XA 3GL6A 5II1A 4XUBA 3C5KA 3SHBA 4TU6A 5D3NA 3KQIA 4HXNA 4ALHA 4QF3A 2D82A 1WESA 4O71A 4A9JA 5B79A 2G45A 4UYFA 3Q2EA 2D9EA 4C66A 3SOWA 4Z1SA 4QR3A 3P1FA 2DVSA 4HBWA 4HXOA 5L96A 4IR4A 5AD3A 5LVRA 5FH6A 2F42A 2Y1NA 5I7YA 4TS8A 4Z6HA 2KGGA 3ZTGA 3I2DA 2KFTA 2LSPB 5DKHA 4GB0A 4HBVA 2VJFB 5I29A 5ENHA 2F6NA 4GNDA 4IORA 5C89A 4O7FA 4CLBA 4XUAA 2LV9A 5ENJA 2FSAA 2JMDA 1X4JA 2L80A 4TQNA 5D3JA 3N9MA 4OGJA 5HQ5A 2E3KA 4B86C 5II2A 3U5JA 4UYGA 4L7XA 2G43A 4LYIA 3O34A 2NXBA 4QZSA 4C67A 2FUUA 3MHSA 4QSTA 4AYCA 3UV2A 2K4DA 5IGMA 4O75A 5D24A 4HXPA 5CZGA 5F1HA 4YYIA 5DYCA 5C11A 5CRZA 4UIUA 3PUQA 4W4UA 2YYRA 2YYNA 4HXMA 5CS8A 5J0DA 3O7AA 5B77A 4UYHA 4YBTA 5A82A 5H1UA 2DX8A 4NS5A 2OO1A 3LXJA 1LDKC 2MIQA 4FK5A 4NUCA 4ALGA 4E96A 4UIWA 4CFLA 5E0RA 1WEOA 5TBNA 4YY6A 1WEEA 4LZSA 5IG6A 5CGPA 1FBVA 2C2LA 5TDWA 5HJCA 5LJ0A 5G0FA 1WEUA 4UI9B 4A9EA 2G4AA 4MEQA 3HCUA 2EA6A 4QB3A 5BT3A 4NQNA 5HLSA 2RFJA 3UVYA 3RPGB 4GNGA 2ECJA 4A49A 3I3JA 5E9YA 4NR5A 3QZTA 4NUDA 4QSVA 3TLPA 3UVDA 3NXBA 3MXFA 4NYWA 4KV4A 3LRQA 5CQ7A 4O77A 5DBMA 5JI8A 4GNEA 4V3KC 1VD4A 1MM2A 4Q0NA 5I86A 2UZGA 4XI1A 2KWOA 2D8SA 2YU4A 4XY8A 4IR3A 5EPRA 1WEVA 4LZRA 2PNXA 5DKCA 5A5NA 3S91A 2RO1A 3IHPA 3O35A 3K2JA 5D3HA 1WENA 2LQ6A 4LDFA 4O7EA 2LXPC 5BT5A 5E9VA 4O70A 3Q2FA 5A5SA 3U5PA 2L75A 3ZPV1 5FERA 2VPDA 5FE1A 3P1DA 5D1MB 3FL2A 2YW5A 4WZ2A 2KWNA 4TZ2A 2C2VS 5C87A 5ACYA 4NRAA 3MULA 4CUPA 3LJWA 4TZ8A 1IYMA 1WEWA 5B78A 2ECGA 5C7NA 3ZYQA 4YAXA 2LGVA 2YREA 4YC9A 5DLXA 4J0RA 3HCSA 5FFWA 3JVLA 4MR3A 2M3HA 5E73A 4TT6A 5ETDA 5D3PA 2YQLA 4YYGA 4CFKA 2OSSA 5G05B 4LZ2A 4QSUA 2DWWA 5E3DA 3KV5A 3P5OA 2YEMA 5CFWA 2LRIC 3N9QA 5CQ6A 5ENFA 3SVHA 5HRWA 3U5LA 2QICA 4O72A 3ZPVE 4AVXA 5EM3A 4PPEA 4NRBA 4WZ3B 1RMDA 2L43A 3HMFA 5E9KA 5I40A 4LJNA 4FLPA 2KWJA 4NR8A 4QYLA 5TCMA 4A9KA 2VPBA 4NR7A 4CCGX 4YH3A 5FB1A 5C85A 4NN2A 3LQIA 3P1EA 4UYDA 3JVJA 2LXHC 5LVQA 3N9LA 5FB0A 5FG6A 4AYCB 2YELA 5KHMA 2KR4A 5FEYA 5KTXA 1WIMA 1Z2QA 5DKAA 2RSDA 1FP0A 4BJXA 3FKMX 2MA6A 1WFKA 1F68A 5LCWB 3AADA 2LGKA 4YYDA 5HQ7A 5IGKA 4LYWA 5COIA 4CL9A 5DW1A 2M1RA 3IU6A 4Y03A 1WEPA 3L1ZB 5LJ2A 3PURA 1HYIA 3MB4A 3ZYUA 3O36A 5D25A 5B75A 4LKAA 2MD8C 5E3GA 4TT4A 1Z6UA 4CA1A 5DW2A 5EV9A 5E9MA 5A5OA 2R0VA 3UV4A 5KO4A 5CQTA 3ZNIA 4S3OB 4IC2A 2KIZA 5CQAA 1X4IA 3MHHA 5D1KB 2IDAA 5EK9A 4UYEA 4TT2A 4HBXA 2JMJA 2YQDA 5FE3A 2XEUA 2MNZA 1WILA 2YSJA 4BHWA 2L0BA 5LKTA 5EPSA 4QC3A 4X2IA 5CUCA 5A5RA 4MEPA 2F6JA 4QSSA 4CUQA 4YYKA 1F62A 5CU8A 5HELA 4F52B 2JMIA 3VK6A 5ETBA 5L97A 4XY9A 5DYUA 4ZDTA 5K29A 2JRJA 4L58A 4A9FA 2OXQC 4IOOA 5AMFA 2CKLB 4UIXA 5D3TA 2DKWA 5EVAA 5DFCA 2ECVA 4J3IA 4N3WA 4O78A 3GG3A 4BW3A 5AD2A 2MNYA 5F63A 4I7BA 4TU4A 3O37A 5EQ1A 3S92A 4R7EA 4TKPB 2I7KA 5TRBA 2VJEB 5DFBA 2WP2A 5CUEA 4QSQA 1V87A 2EGPA 4IR5A 4I7DA 1E6IA 1DVPA 2H60A 2LGLA 4UIVA 4LLBA 4UITA 3O33A 3M99A 3KNVA 5EYAF 5FE0A 2I8NA 5EISA 1LDJB 3ONIA 1Z60A 3UV5A 3L11A 5C4QA 2DVVA 2RNWA 3D7CA 2DATA 5FG5A 2YHNA 2E7OA 2HYED 5DY7A 5F1LA 5L99A 3HMEA 5LJ1A 2L5EA 5DYXA 5FH7A 4DONA 1WEQA 2NAAA 5FE6A 2E6RA 3RPGC 2KWKA 5LKZA 4AUQB 2ECIA 4QYDA 4O7CA 4QEWA 2ECNA 4GNFA 5A83A 4A0CD 3DWYA 4PKLA 5FG4A 5CPEA 3P1CA 4J0SA 5F60A 5FBXA 1VYXA 2CSZA 2LDRA 1N72A 4YADA 3G0JA 4KCXA 2KGIA 3KV6A 3HCTA 1WE9A 3MB3A 1WUGA 3GV4A 5F2PA 4OUFA 3G0LA 5F62A 5D26A 5FFYA 3SOUA 4A9LA 3ASLA 2R0SA 5CTLA 5I88A 5IIDA 4MVTA 4RVRA 5LUUA 4YABA 2EODA 4YYNA 2RNXA 4NR4A 5KTWA 3N9PA 2GRCA 4HXLA 4QR5A 5A5PA 4CURA 4GPJA 3SOXA 4R8PK 2CKLA 5FE5A 3MQMA 5G04B 4ZC9A 3T7LA 2YEKA 4P5OB 4BW1A 2VP7A 4QEVA 4A9HA 4B7YC 5DINA 2L84A 4UIZA 3MUKA 4TTEA 2VJEA 4LC2A 4YBMA 4QF2A 2LGGA 5I89A 3M63A 3AQAA 2YURA 4UP5A 2R0YA 2ZETC 4YBSA 4NYVA 5HFRA 2DVRA 4QEUA 5F3AA 5EWVA 4HBYA 2YQMA 1EQFA 4YY4A 1JM7B 5I7XA 3UVWA 5F61A 2MD7B 5KTUA 4AP4A 5B76A 5I80A 3QZVA 2KE1A 2K1JA 5CQ8A 4LRGA 4O7BA 5EU1A 4NRCA 3PHDA 5ENGA 4QY4A 5I3LA 2OUOA 5DX4A 1E4UA 5D3LA 1JOCA 4MEOA 2YT5A 5TABA 4BBQA 3L1XA 2E7NA 4PCEA 2Y1MA 5DYAA 1WGMA 2KREA 1WEMA 5E9IA 3U5NA 4N4FA 2VNFA 4Z93A 4F3IA 4Z1QA 5H1TA 5EI4A 2LN0A 3N9NA 4AKNA 4WZ0A 5IBNA 4HXSA 5A5QA 4WHUA 5F25A 4BW2A 3EB5A 4QSPA 5DLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3G A;  3UW9 A;  1N87 A;  2ECW A;  5TB6 A;  5EGU A;  4QSW A;  4C9Z A;  1U6G B;  2K17 A;  5EWD A;  1T1H A;  5LKX A;  1HYJ A;  5EWH A;  3DQV R;  2VPG A;  5FE4 A;  1JSP B;  5EP7 A;  4I7C A;  3T6R A;  4NR9 A;  2VPE A;  5CUA A;  5JWM A;  5J3X A;  5FDZ A;  4NYX A;  2CSY A;  2R10 A;  5CQ5 A;  5IGN A;  2KU3 A;  4O74 A;  5FFV A;  4BW4 A;  5IGL A;  2H0D B;  3LQH A;  4MR5 A;  5DKD A;  4IC3 A;  3RCW A;  4YYJ A;  4WIV A;  4QR4 A;  5D3S A;  5E9L A;  3V43 A;  5HEN A;  2G6Q A;  2Y43 A;  4A4C A;  4MR4 A;  2RNY A;  5HFQ A;  5B8D A;  4R2Y A;  5G4R A;  5HRV A;  4S3O C;  4NXJ A;  4HXK A;  2BAY A;  4N4I A;  5AIU A;  2HDP A;  5FE8 A;  5CUD A;  1JM7 A;  2XB1 A;  5AIT A;  3M62 A;  5C8G A;  3O70 A;  5H9M A;  4PS5 A;  5CUB A;  5FE9 A;  2KYU A;  5ENE A;  3UVX A;  2PUY A;  5EA1 A;  5EWC A;  4KV1 A;  3JVM A;  5AME A;  5EPB A;  4A9I A;  5HQ6 A;  2FUI A;  3U5M A;  4O7A A;  4PTB A;  2YSM A;  4IR6 A;  4YAT A;  4LR6 A;  3ZVZ B;  1K2F A;  1VFY A;  4YH4 A;  5ENC A;  2WP1 A;  5E7D A;  2MT5 A;  4QUT A;  4QBM A;  2MJV B;  5CUG A;  1BOR A;  2L5U A;  4N4G A;  2QIZ A;  4A9M A;  5D1L B;  3NG2 A;  5LKU A;  3IU5 A;  4A9N A;  2K16 A;  4ZUX U;  1X0J A;  3QZS A;  5L8U A;  2MA5 A;  4NUE A;  5I1Q A;  4MSX A;  2MUM A;  2CT2 A;  4QSX A;  4N4H A;  4WA6 A;  4QNS A;  5FE7 A;  5HRX A;  4UIY A;  2DVQ A;  1MM3 A;  2QJ0 A;  5CRM A;  4ZW1 A;  2YUC A;  4FIP A;  3RTR B;  5H85 A;  4LYS A;  5EWW A;  4QSR A;  4LK9 A;  2H0D A;  5TDR A;  2VJF A;  3HMH A;  4IOQ A;  1G25 A;  5A85 A;  3HTK C;  5D0C A;  5D3R A;  1X4U A;  3C6W A;  4OGI A;  2N9G A;  5H1V A;  4J1P A;  3U5O A;  5E74 A;  1XWH A;  4UYF B;  4NQM A;  4ZQL A;  2L85 A;  4O76 A;  5HM0 A;  3EB6 A;  5KH9 A;  4A4B A;  5C13 A;  5ENI A;  5EIC A;  4PY6 A;  2ECT A;  2M6M A;  2M85 A;  5ENB A;  4A9O A;  3SVF A;  1ZBD B;  3U5K A;  2KTB B;  4Q6F A;  4FJC A;  5HEM A;  4CUU A;  5JG6 A;  4LAD B;  4QUU A;  5BT4 A;  4FO9 A;  4TYL A;  3JVK A;  4Z6I A;  5F5Z A;  5F36 A;  1ZS5 A;  4HXR A;  3SVG A;  5DFD A;  5G4S A;  4V3L C;  5L8T A;  3DAI A;  5CP5 A;  2E6S A;  2AN6 A;  3ZVY A;  5FH8 A;  4XYA A;  4YYH A;  4MR6 A;  1CHC A;  3DPL R;  4O64 A;  4UP0 A;  1WUM A;  2YW8 A;  4WHW A;  4CUT A;  4YYM A;  5KH3 A;  5KH7 A;  3N9O A;  4PCI A;  3LQJ A;  4QC1 A;  5FE2 A;  2I50 A;  4CUS A;  5CY9 A;  2YDW A;  4YK0 A;  2YHO A;  5KU3 A;  5CQ4 A;  4Q0O A;  5HCL A;  1JM4 B;  5L98 A;  5A81 A;  5A7C A;  2RI7 A;  4NR6 A;  5CQ3 A;  4MEN A;  5I83 A;  2RS9 B;  5D7X A;  3GL6 A;  5II1 A;  4XUB A;  3C5K A;  3SHB A;  4TU6 A;  5D3N A;  3KQI A;  4HXN A;  4ALH A;  4QF3 A;  2D82 A;  1WES A;  4O71 A;  4A9J A;  5B79 A;  2G45 A;  4UYF A;  3Q2E A;  2D9E A;  4C66 A;  3SOW A;  4Z1S A;  4QR3 A;  3P1F A;  2DVS A;  4HBW A;  4HXO A;  5L96 A;  4IR4 A;  5AD3 A;  5LVR A;  5FH6 A;  2F42 A;  2Y1N A;  5I7Y A;  4TS8 A;  4Z6H A;  2KGG A;  3ZTG A;  3I2D A;  2KFT A;  2LSP B;  5DKH A;  4GB0 A;  4HBV A;  2VJF B;  5I29 A;  5ENH A;  2F6N A;  4GND A;  4IOR A;  5C89 A;  4O7F A;  4CLB A;  4XUA A;  2LV9 A;  5ENJ A;  2FSA A;  2JMD A;  1X4J A;  2L80 A;  4TQN A;  5D3J A;  3N9M A;  4OGJ A;  5HQ5 A;  2E3K A;  4B86 C;  5II2 A;  3U5J A;  4UYG A;  4L7X A;  2G43 A;  4LYI A;  3O34 A;  2NXB A;  4QZS A;  4C67 A;  2FUU A;  3MHS A;  4QST A;  4AYC A;  3UV2 A;  2K4D A;  5IGM A;  4O75 A;  5D24 A;  4HXP A;  5CZG A;  5F1H A;  4YYI A;  5DYC A;  5C11 A;  5CRZ A;  4UIU A;  3PUQ A;  4W4U A;  2YYR A;  2YYN A;  4HXM A;  5CS8 A;  5J0D A;  3O7A A;  5B77 A;  4UYH A;  4YBT A;  5A82 A;  5H1U A;  2DX8 A;  4NS5 A;  2OO1 A;  3LXJ A;  1LDK C;  2MIQ A;  4FK5 A;  4NUC A;  4ALG A;  4E96 A;  4UIW A;  4CFL A;  5E0R A;  1WEO A;  5TBN A;  4YY6 A;  1WEE A;  4LZS A;  5IG6 A;  5CGP A;  1FBV A;  2C2L A;  5TDW A;  5HJC A;  5LJ0 A;  5G0F A;  1WEU A;  4UI9 B;  4A9E A;  2G4A A;  4MEQ A;  3HCU A;  2EA6 A;  4QB3 A;  5BT3 A;  4NQN A;  5HLS A;  2RFJ A;  3UVY A;  3RPG B;  4GNG A;  2ECJ A;  4A49 A;  3I3J A;  5E9Y A;  4NR5 A;  3QZT A;  4NUD A;  4QSV A;  3TLP A;  3UVD A;  3NXB A;  3MXF A;  4NYW A;  4KV4 A;  3LRQ A;  5CQ7 A;  4O77 A;  5DBM A;  5JI8 A;  4GNE A;  4V3K C;  1VD4 A;  1MM2 A;  4Q0N A;  5I86 A;  2UZG A;  4XI1 A;  2KWO A;  2D8S A;  2YU4 A;  4XY8 A;  4IR3 A;  5EPR A;  1WEV A;  4LZR A;  2PNX A;  5DKC A;  5A5N A;  3S91 A;  2RO1 A;  3IHP A;  3O35 A;  3K2J A;  5D3H A;  1WEN A;  2LQ6 A;  4LDF A;  4O7E A;  2LXP C;  5BT5 A;  5E9V A;  4O70 A;  3Q2F A;  5A5S A;  3U5P A;  2L75 A;  3ZPV 1;  5FER A;  2VPD A;  5FE1 A;  3P1D A;  5D1M B;  3FL2 A;  2YW5 A;  4WZ2 A;  2KWN A;  4TZ2 A;  2C2V S;  5C87 A;  5ACY A;  4NRA A;  3MUL A;  4CUP A;  3LJW A;  4TZ8 A;  1IYM A;  1WEW A;  5B78 A;  2ECG A;  5C7N A;  3ZYQ A;  4YAX A;  2LGV A;  2YRE A;  4YC9 A;  5DLX A;  4J0R A;  3HCS A;  5FFW A;  3JVL A;  4MR3 A;  2M3H A;  5E73 A;  4TT6 A;  5ETD A;  5D3P A;  2YQL A;  4YYG A;  4CFK A;  2OSS A;  5G05 B;  4LZ2 A;  4QSU A;  2DWW A;  5E3D A;  3KV5 A;  3P5O A;  2YEM A;  5CFW A;  2LRI C;  3N9Q A;  5CQ6 A;  5ENF A;  3SVH A;  5HRW A;  3U5L A;  2QIC A;  4O72 A;  3ZPV E;  4AVX A;  5EM3 A;  4PPE A;  4NRB A;  4WZ3 B;  1RMD A;  2L43 A;  3HMF A;  5E9K A;  5I40 A;  4LJN A;  4FLP A;  2KWJ A;  4NR8 A;  4QYL A;  5TCM A;  4A9K A;  2VPB A;  4NR7 A;  4CCG X;  4YH3 A;  5FB1 A;  5C85 A;  4NN2 A;  3LQI A;  3P1E A;  4UYD A;  3JVJ A;  2LXH C;  5LVQ A;  3N9L A;  5FB0 A;  5FG6 A;  4AYC B;  2YEL A;  5KHM A;  2KR4 A;  5FEY A;  5KTX A;  1WIM A;  1Z2Q A;  5DKA A;  2RSD A;  1FP0 A;  4BJX A;  3FKM X;  2MA6 A;  1WFK A;  1F68 A;  5LCW B;  3AAD A;  2LGK A;  4YYD A;  5HQ7 A;  5IGK A;  4LYW A;  5COI A;  4CL9 A;  5DW1 A;  2M1R A;  3IU6 A;  4Y03 A;  1WEP A;  3L1Z B;  5LJ2 A;  3PUR A;  1HYI A;  3MB4 A;  3ZYU A;  3O36 A;  5D25 A;  5B75 A;  4LKA A;  2MD8 C;  5E3G A;  4TT4 A;  1Z6U A;  4CA1 A;  5DW2 A;  5EV9 A;  5E9M A;  5A5O A;  2R0V A;  3UV4 A;  5KO4 A;  5CQT A;  3ZNI A;  4S3O B;  4IC2 A;  2KIZ A;  5CQA A;  1X4I A;  3MHH A;  5D1K B;  2IDA A;  5EK9 A;  4UYE A;  4TT2 A;  4HBX A;  2JMJ A;  2YQD A;  5FE3 A;  2XEU A;  2MNZ A;  1WIL A;  2YSJ A;  4BHW A;  2L0B A;  5LKT A;  5EPS A;  4QC3 A;  4X2I A;  5CUC A;  5A5R A;  4MEP A;  2F6J A;  4QSS A;  4CUQ A;  4YYK A;  1F62 A;  5CU8 A;  5HEL A;  4F52 B;  2JMI A;  3VK6 A;  5ETB A;  5L97 A;  4XY9 A;  5DYU A;  4ZDT A;  5K29 A;  2JRJ A;  4L58 A;  4A9F A;  2OXQ C;  4IOO A;  5AMF A;  2CKL B;  4UIX A;  5D3T A;  2DKW A;  5EVA A;  5DFC A;  2ECV A;  4J3I A;  4N3W A;  4O78 A;  3GG3 A;  4BW3 A;  5AD2 A;  2MNY A;  5F63 A;  4I7B A;  4TU4 A;  3O37 A;  5EQ1 A;  3S92 A;  4R7E A;  4TKP B;  2I7K A;  5TRB A;  2VJE B;  5DFB A;  2WP2 A;  5CUE A;  4QSQ A;  1V87 A;  2EGP A;  4IR5 A;  4I7D A;  1E6I A;  1DVP A;  2H60 A;  2LGL A;  4UIV A;  4LLB A;  4UIT A;  3O33 A;  3M99 A;  3KNV A;  5EYA F;  5FE0 A;  2I8N A;  5EIS A;  1LDJ B;  3ONI A;  1Z60 A;  3UV5 A;  3L11 A;  5C4Q A;  2DVV A;  2RNW A;  3D7C A;  2DAT A;  5FG5 A;  2YHN A;  2E7O A;  2HYE D;  5DY7 A;  5F1L A;  5L99 A;  3HME A;  5LJ1 A;  2L5E A;  5DYX A;  5FH7 A;  4DON A;  1WEQ A;  2NAA A;  5FE6 A;  2E6R A;  3RPG C;  2KWK A;  5LKZ A;  4AUQ B;  2ECI A;  4QYD A;  4O7C A;  4QEW A;  2ECN A;  4GNF A;  5A83 A;  4A0C D;  3DWY A;  4PKL A;  5FG4 A;  5CPE A;  3P1C A;  4J0S A;  5F60 A;  5FBX A;  1VYX A;  2CSZ A;  2LDR A;  1N72 A;  4YAD A;  3G0J A;  4KCX A;  2KGI A;  3KV6 A;  3HCT A;  1WE9 A;  3MB3 A;  1WUG A;  3GV4 A;  5F2P A;  4OUF A;  3G0L A;  5F62 A;  5D26 A;  5FFY A;  3SOU A;  4A9L A;  3ASL A;  2R0S A;  5CTL A;  5I88 A;  5IID A;  4MVT A;  4RVR A;  5LUU A;  4YAB A;  2EOD A;  4YYN A;  2RNX A;  4NR4 A;  5KTW A;  3N9P A;  2GRC A;  4HXL A;  4QR5 A;  5A5P A;  4CUR A;  4GPJ A;  3SOX A;  4R8P K;  2CKL A;  5FE5 A;  3MQM A;  5G04 B;  4ZC9 A;  3T7L A;  2YEK A;  4P5O B;  4BW1 A;  2VP7 A;  4QEV A;  4A9H A;  4B7Y C;  5DIN A;  2L84 A;  4UIZ A;  3MUK A;  4TTE A;  2VJE A;  4LC2 A;  4YBM A;  4QF2 A;  2LGG A;  5I89 A;  3M63 A;  3AQA A;  2YUR A;  4UP5 A;  2R0Y A;  2ZET C;  4YBS A;  4NYV A;  5HFR A;  2DVR A;  4QEU A;  5F3A A;  5EWV A;  4HBY A;  2YQM A;  1EQF A;  4YY4 A;  1JM7 B;  5I7X A;  3UVW A;  5F61 A;  2MD7 B;  5KTU A;  4AP4 A;  5B76 A;  5I80 A;  3QZV A;  2KE1 A;  2K1J A;  5CQ8 A;  4LRG A;  4O7B A;  5EU1 A;  4NRC A;  3PHD A;  5ENG A;  4QY4 A;  5I3L A;  2OUO A;  5DX4 A;  1E4U A;  5D3L A;  1JOC A;  4MEO A;  2YT5 A;  5TAB A;  4BBQ A;  3L1X A;  2E7N A;  4PCE A;  2Y1M A;  5DYA A;  1WGM A;  2KRE A;  1WEM A;  5E9I A;  3U5N A;  4N4F A;  2VNF A;  4Z93 A;  4F3I A;  4Z1Q A;  5H1T A;  5EI4 A;  2LN0 A;  3N9N A;  4AKN A;  4WZ0 A;  5IBN A;  4HXS A;  5A5Q A;  4WHU A;  5F25 A;  4BW2 A;  3EB5 A;  4QSP A;  5DLZ A; 
#chains in the Genus database with same CATH topology
 4X3G A;  3UW9 A;  1N87 A;  2ECW A;  5TB6 A;  5EGU A;  4QSW A;  4C9Z A;  1U6G B;  2K17 A;  5EWD A;  1T1H A;  5LKX A;  1HYJ A;  5EWH A;  3DQV R;  2VPG A;  5FE4 A;  1JSP B;  5EP7 A;  4I7C A;  3FAN A;  3T6R A;  4NR9 A;  2D8U A;  5CUA A;  2VPE A;  5JWM A;  3FM8 C;  5FDZ A;  5J3X A;  4NYX A;  2CSY A;  2R10 A;  5CQ5 A;  5IGN A;  2KU3 A;  4O74 A;  5FFV A;  4BW4 A;  5IGL A;  2H0D B;  3LQH A;  4MR5 A;  5DKD A;  4IC3 A;  3RCW A;  4YYJ A;  4WIV A;  4QR4 A;  5D3S A;  5E9L A;  3V43 A;  5HEN A;  2G6Q A;  2Y43 A;  4A4C A;  4MR4 A;  2RNY A;  5HFQ A;  5B8D A;  4AKG A;  4R2Y A;  5G4R A;  5HRV A;  4S3O C;  4NXJ A;  4HXK A;  2BAY A;  4N4I A;  5AIU A;  2HDP A;  5FE8 A;  5CUD A;  1JM7 A;  2XB1 A;  3VKH A;  5AIT A;  3M62 A;  5C8G A;  4AKH A;  3O70 A;  5H9M A;  2XOZ A;  4PS5 A;  5CUB A;  5FE9 A;  2KYU A;  5ENE A;  3UVX A;  2PUY A;  5EA1 A;  5EWC A;  4KV1 A;  3JVM A;  2JUN A;  5AME A;  5EPB A;  4A9I A;  2CSV A;  4H9D A;  5HQ6 A;  2FUI A;  3U5M A;  4O7A A;  4PTB A;  2YSM A;  4IR6 A;  4YAT A;  4LR6 A;  3ZVZ B;  1K2F A;  1VFY A;  4YH4 A;  5ENC A;  2WP1 A;  5E7D A;  2MT5 A;  4QUT A;  4QBM A;  2MJV B;  5CUG A;  1BOR A;  2L5U A;  4N4G A;  2QIZ A;  4A9M A;  5D1L B;  3NG2 A;  5LKU A;  3IU5 A;  4A9N A;  2K16 A;  4ZUX U;  1X0J A;  3QZS A;  5L8U A;  2MA5 A;  4NUE A;  5I1Q A;  4MSX A;  2MUM A;  2CT2 A;  4QSX A;  4N4H A;  2XP0 A;  4WA6 A;  4Z0R A;  4QNS A;  5FE7 A;  5HRX A;  4UIY A;  2DVQ A;  1MM3 A;  2QJ0 A;  5CRM A;  4ZW1 A;  2YUC A;  4FIP A;  3RTR B;  5H85 A;  4LYS A;  5EWW A;  4QSR A;  4LK9 A;  2H0D A;  5TDR A;  2VJF A;  3HMH A;  4IOQ A;  1G25 A;  2KKY A;  5A85 A;  3HTK C;  5D0C A;  5D3R A;  1X4U A;  3C6W A;  4OGI A;  2N9G A;  5H1V A;  4J1P A;  3U5O A;  5E74 A;  1XWH A;  4UYF B;  4NQM A;  4ZQL A;  2L85 A;  4O76 A;  5HM0 A;  3EB6 A;  5KH9 A;  4A4B A;  5C13 A;  5ENI A;  5EIC A;  4PY6 A;  1PUO A;  2ECT A;  2M6M A;  2M85 A;  5ENB A;  4A9O A;  3SVF A;  1ZBD B;  3U5K A;  2KTB B;  4Q6F A;  4FJC A;  3Q1D A;  5HEM A;  4CUU A;  5JG6 A;  4LAD B;  4QUU A;  5BT4 A;  3LDY A;  4FO9 A;  4TYL A;  3JVK A;  4Z6I A;  3FEH A;  5F5Z A;  5F36 A;  1ZS5 A;  4HXR A;  3SVG A;  5DFD A;  5G4S A;  4V3L C;  5L8T A;  3DAI A;  5CP5 A;  2E6S A;  2AN6 A;  3ZVY A;  5FH8 A;  4XYA A;  4YYH A;  4MR6 A;  1CHC A;  3DPL R;  4O64 A;  4UP0 A;  1WUM A;  2YW8 A;  4WHW A;  4CUT A;  4YYM A;  5KH3 A;  5KH7 A;  3N9O A;  3DWD A;  4PCI A;  3LQJ A;  2XOC A;  4QC1 A;  5FE2 A;  2FFW A;  2I50 A;  4CUS A;  2P57 A;  3M7K A;  5CY9 A;  2YDW A;  4YK0 A;  2YHO A;  5KU3 A;  5CQ4 A;  4Q0O A;  5HCL A;  1JM4 B;  5L98 A;  5A81 A;  5A7C A;  2OWA A;  2RI7 A;  4NR6 A;  5CQ3 A;  4MEN A;  3ERR A;  2RS9 B;  5D7X A;  5I83 A;  3GL6 A;  3LJU X;  5II1 A;  4XUB A;  3C5K A;  3SHB A;  4TU6 A;  5D3N A;  3KQI A;  4HXN A;  4ALH A;  3PLW A;  4O62 A;  4QF3 A;  2D82 A;  1WES A;  4O71 A;  4A9J A;  2YVR A;  5B79 A;  1DCQ A;  2G45 A;  4UYF A;  3Q2E A;  2D9E A;  4C66 A;  3SOW A;  4Z1S A;  4QR3 A;  3P1F A;  2DVS A;  4HBW A;  4HXO A;  5L96 A;  4IR4 A;  5AD3 A;  5LVR A;  5FH6 A;  2F42 A;  2Y1N A;  5I7Y A;  4TS8 A;  4Z6H A;  2KGG A;  3ZTG A;  3T9K A;  3I2D A;  2KFT A;  2LSP B;  2RR4 A;  5DKH A;  4GB0 A;  4HBV A;  2VJF B;  5I29 A;  5ENH A;  2F6N A;  4GND A;  4IOR A;  5C89 A;  4O7F A;  4CLB A;  4XUA A;  2LV9 A;  5ENJ A;  2FSA A;  2JMD A;  1X4J A;  2L80 A;  4TQN A;  5D3J A;  3N9M A;  4OGJ A;  5HQ5 A;  2E3K A;  4B86 C;  5II2 A;  3U5J A;  4UYG A;  4L7X A;  2G43 A;  4LYI A;  3O34 A;  2NXB A;  4QZS A;  4C67 A;  2FUU A;  3MHS A;  4QST A;  4AYC A;  3UV2 A;  2K4D A;  3FAO A;  5IGM A;  4O75 A;  5D24 A;  4HXP A;  5CZG A;  5F1H A;  4YYI A;  5DYC A;  5C11 A;  5CRZ A;  4UIU A;  3PUQ A;  4W4U A;  2YYR A;  5SVI B;  2YYN A;  2KKX A;  4HXM A;  5CS8 A;  5B77 A;  5J0D A;  2B0O E;  3O7A A;  4UYH A;  4YBT A;  5A82 A;  5H1U A;  2DX8 A;  4NS5 A;  2OO1 A;  3LXJ A;  1LDK C;  2EGM A;  2MIQ A;  4FK5 A;  4NUC A;  4ALG A;  4E96 A;  4UIW A;  4CFL A;  5E0R A;  1WEO A;  5TBN A;  2DJA A;  4YY6 A;  1WEE A;  4LZS A;  5IG6 A;  5CGP A;  1FBV A;  2C2L A;  5TDW A;  5HJC A;  5LJ0 A;  5G0F A;  1WEU A;  4UI9 B;  4A9E A;  2G4A A;  4MEQ A;  3VKG A;  3HCU A;  2EA6 A;  4QB3 A;  5BT3 A;  4NQN A;  5HLS A;  2RFJ A;  3UVY A;  3KDE C;  1ZKR A;  4GNG A;  2ECJ A;  3RPG B;  4A49 A;  3I3J A;  5E9Y A;  4NR5 A;  3QZT A;  1MBM A;  4NUD A;  4QSV A;  3TLP A;  3UVD A;  3NXB A;  3MXF A;  4NYW A;  4KV4 A;  4QQ4 A;  3LRQ A;  5CQ7 A;  4O77 A;  5DBM A;  5JI8 A;  4GNE A;  4V3K C;  1VD4 A;  1MM2 A;  4Q0N A;  5SVX A;  5I86 A;  2UZG A;  4XI1 A;  2KWO A;  2D8S A;  2YU4 A;  4XY8 A;  4IR3 A;  5EPR A;  1WEV A;  4LZR A;  2PNX A;  5DKC A;  5A5N A;  3S91 A;  2RO1 A;  3IHP A;  3O35 A;  3K2J A;  5D3H A;  1WEN A;  2LQ6 A;  4LDF A;  4O7E A;  2DSM A;  2LXP C;  5BT5 A;  5E9V A;  4O70 A;  3Q2F A;  5A5S A;  3U5P A;  2L75 A;  3DDT A;  3ZPV 1;  2VPD A;  5FER A;  5FE1 A;  3P1D A;  5D1M B;  3FL2 A;  2YW5 A;  4WZ2 A;  2KWN A;  4TZ2 A;  2C2V S;  5C87 A;  5ACY A;  4NRA A;  3MUL A;  4CUP A;  3LJW A;  4TZ8 A;  1IYM A;  1WEW A;  4OGE A;  5B78 A;  2ECG A;  5C7N A;  3D1B A;  3ZYQ A;  4YAX A;  2LGV A;  2YRE A;  5SVI A;  4YC9 A;  5DLX A;  4J0R A;  3HCS A;  5K3Q A;  5FFW A;  3JVL A;  4MR3 A;  2M3H A;  3FJU B;  5E73 A;  3LVR E;  4TT6 A;  5ETD A;  5D3P A;  2YQL A;  4YYG A;  4CFK A;  2OSS A;  5G05 B;  4LZ2 A;  4QSU A;  2DWW A;  5E3D A;  3KV5 A;  3P5O A;  2YEM A;  5CFW A;  2EXU A;  2LRI C;  3N9Q A;  5CQ6 A;  5ENF A;  3SVH A;  5HRW A;  3U5L A;  2QIC A;  4O72 A;  3ZPV E;  4AVX A;  5EM3 A;  4PPE A;  4NRB A;  4WZ3 B;  1RMD A;  2L43 A;  3HMF A;  5E9K A;  5I40 A;  4LJN A;  3D1D A;  4FLP A;  2KWJ A;  4NR8 A;  4QYL A;  5TCM A;  4A9K A;  2VPB A;  4NR7 A;  3H7H A;  4CCG X;  4YH3 A;  5FB1 A;  5C85 A;  4NN2 A;  3LQI A;  3P1E A;  4UYD A;  3JVJ A;  2LXH C;  5LVQ A;  3N9L A;  5FB0 A;  5FG6 A;  4AYC B;  2YEL A;  5KHM A;  2KR4 A;  5FEY A;  5KTX A;  1WIM A;  1Z2Q A;  5DKA A;  2RSD A;  1FP0 A;  4BJX A;  3FKM X;  2MA6 A;  1WFK A;  1F68 A;  5LCW B;  3AAD A;  2CRR A;  4YYD A;  5HQ7 A;  5IGK A;  4LYW A;  2LGK A;  5COI A;  4CL9 A;  5DW1 A;  2M1R A;  3IU6 A;  4Y03 A;  1WEP A;  3L1Z B;  5LJ2 A;  3PUR A;  1HYI A;  3MB4 A;  3ZYU A;  2E61 A;  3O36 A;  5D25 A;  5B75 A;  3E2D A;  4LKA A;  2MD8 C;  5E3G A;  4TT4 A;  1Z6U A;  4CA1 A;  5DW2 A;  5EV9 A;  5E9M A;  5A5O A;  2R0V A;  3UV4 A;  5KO4 A;  5CQT A;  3ZNI A;  4S3O B;  4IC2 A;  2KIZ A;  5CQA A;  1X4I A;  3MHH A;  5D1K B;  2IDA A;  5EK9 A;  4UYE A;  4TT2 A;  4HBX A;  2JMJ A;  2YQD A;  5FE3 A;  2XEU A;  2MNZ A;  1WIL A;  2YSJ A;  4BHW A;  2L0B A;  5LKT A;  5EPS A;  4QC3 A;  4X2I A;  5CUC A;  5A5R A;  2JM3 A;  4MEP A;  2F6J A;  4QSS A;  4CUQ A;  4YYK A;  2LAU A;  1F62 A;  5CU8 A;  5HEL A;  4F52 B;  2CRW A;  2JMI A;  3VK6 A;  5ETB A;  5L97 A;  4XY9 A;  5DYU A;  4F1P A;  4ZDT A;  5K29 A;  2JRJ A;  4L58 A;  4A9F A;  2OXQ C;  4IOO A;  2FD4 A;  5AMF A;  2CKL B;  4OGC A;  4UIX A;  5D3T A;  2DKW A;  5EVA A;  3SUB A;  5DFC A;  2ECV A;  4J3I A;  4N3W A;  4O78 A;  3GG3 A;  4BW3 A;  5AD2 A;  2MNY A;  5F63 A;  3JUE A;  4TU4 A;  3O37 A;  5EQ1 A;  3S92 A;  4I7B A;  4R7E A;  2I7K A;  5TRB A;  4TKP B;  2VJE B;  5DFB A;  2WP2 A;  5CUE A;  4QSQ A;  1V87 A;  2EGP A;  4IR5 A;  4I7D A;  1E6I A;  1DVP A;  2H60 A;  2LGL A;  4UIV A;  4LLB A;  4UIT A;  2M13 A;  3O33 A;  3M99 A;  3KNV A;  5EYA F;  5FE0 A;  2I8N A;  5EIS A;  1LDJ B;  3ONI A;  1Z60 A;  3UV5 A;  3L11 A;  5C4Q A;  2DVV A;  2RNW A;  3D7C A;  2DAT A;  5FG5 A;  2YHN A;  2E7O A;  2HYE D;  5DY7 A;  5F1L A;  5L99 A;  3HME A;  2IQJ A;  5LJ1 A;  2L5E A;  5DYX A;  5FH7 A;  4DON A;  1WEQ A;  4Z0O A;  2NAA A;  5FE6 A;  2E6R A;  3RPG C;  2KWK A;  5LKZ A;  4AUQ B;  2ECI A;  4QYD A;  4O7C A;  4QEW A;  2ECN A;  4GNF A;  5A83 A;  4A0C D;  3DWY A;  4PKL A;  5FG4 A;  5CPE A;  3P1C A;  4J0S A;  5F60 A;  5FBX A;  1VYX A;  2CSZ A;  2LDR A;  1N72 A;  4YAD A;  2XOY A;  3G0J A;  4KCX A;  2KGI A;  3KV6 A;  3HCT A;  1WE9 A;  3MB3 A;  1WUG A;  3GV4 A;  5F2P A;  4OUF A;  3G0L A;  5F62 A;  5D26 A;  5FFY A;  3SOU A;  4A9L A;  3ASL A;  2R0S A;  5CTL A;  5I88 A;  5IID A;  4MVT A;  4RVR A;  5LUU A;  4YAB A;  2EOD A;  4YYN A;  2RNX A;  4NR4 A;  5KTW A;  3N9P A;  2GRC A;  4HXL A;  4QR5 A;  5A5P A;  4CUR A;  4GPJ A;  3SOX A;  4R8P K;  2CKL A;  5FE5 A;  3MQM A;  5G04 B;  4ZC9 A;  3T7L A;  2YEK A;  4P5O B;  4BW1 A;  2VP7 A;  4QEV A;  4A9H A;  4B7Y C;  5DIN A;  2L84 A;  4UIZ A;  3MUK A;  4TTE A;  2VJE A;  4LC2 A;  4YBM A;  4QF2 A;  2LGG A;  5I89 A;  3MDB C;  3M63 A;  3AQA A;  2YUR A;  4UP5 A;  2R0Y A;  2ZET C;  4YBS A;  4NYV A;  5HFR A;  2DVR A;  4QEU A;  5F3A A;  5EWV A;  4AI6 A;  2CON A;  4HBY A;  2YQM A;  1EQF A;  4YY4 A;  1JM7 B;  5I7X A;  3UVW A;  5F61 A;  2MD7 B;  5KTU A;  3LVQ E;  5SVY A;  4AP4 A;  5B76 A;  5I80 A;  2L7P A;  3QZV A;  2KE1 A;  2K1J A;  5CQ8 A;  4LRG A;  4O7B A;  5EU1 A;  2EJN A;  4NRC A;  3PHD A;  5ENG A;  4QY4 A;  5I3L A;  2OUO A;  4AKI A;  5DX4 A;  1E4U A;  5D3L A;  1JOC A;  3O47 A;  4MEO A;  2YT5 A;  5TAB A;  4BBQ A;  3L1X A;  2E7N A;  4PCE A;  2Y1M A;  5DYA A;  1WGM A;  2KRE A;  1WEM A;  5E9I A;  3U5N A;  4N4F A;  2MKE A;  2VNF A;  4Z93 A;  4F3I A;  4Z1Q A;  5H1T A;  5EI4 A;  2LN0 A;  3N9N A;  4AKN A;  4WZ0 A;  5IBN A;  4HXS A;  5A5Q A;  4WHU A;  5F25 A;  4BW2 A;  3EB5 A;  4QSP A;  5DLZ A; 
#chains in the Genus database with same CATH homology
 4X3G A;  3UW9 A;  1N87 A;  2ECW A;  5TB6 A;  5EGU A;  4QSW A;  4C9Z A;  1U6G B;  2K17 A;  5EWD A;  1T1H A;  5LKX A;  1HYJ A;  5EWH A;  3DQV R;  2VPG A;  5FE4 A;  1JSP B;  5EP7 A;  4I7C A;  3T6R A;  4NR9 A;  2VPE A;  5CUA A;  5JWM A;  5J3X A;  5FDZ A;  4NYX A;  2CSY A;  2R10 A;  5CQ5 A;  5IGN A;  2KU3 A;  4O74 A;  5FFV A;  4BW4 A;  5IGL A;  2H0D B;  3LQH A;  4MR5 A;  5DKD A;  4IC3 A;  3RCW A;  4YYJ A;  4WIV A;  4QR4 A;  5D3S A;  5E9L A;  3V43 A;  5HEN A;  2G6Q A;  2Y43 A;  4A4C A;  4MR4 A;  2RNY A;  5HFQ A;  5B8D A;  4R2Y A;  5G4R A;  5HRV A;  4S3O C;  4NXJ A;  4HXK A;  2BAY A;  4N4I A;  5AIU A;  2HDP A;  5FE8 A;  5CUD A;  1JM7 A;  2XB1 A;  5AIT A;  3M62 A;  5C8G A;  3O70 A;  5H9M A;  4PS5 A;  5CUB A;  5FE9 A;  2KYU A;  5ENE A;  3UVX A;  2PUY A;  5EA1 A;  5EWC A;  4KV1 A;  3JVM A;  5AME A;  5EPB A;  4A9I A;  5HQ6 A;  2FUI A;  3U5M A;  4O7A A;  4PTB A;  2YSM A;  4IR6 A;  4YAT A;  4LR6 A;  3ZVZ B;  1K2F A;  1VFY A;  4YH4 A;  5ENC A;  2WP1 A;  5E7D A;  2MT5 A;  4QUT A;  4QBM A;  2MJV B;  5CUG A;  1BOR A;  2L5U A;  4N4G A;  2QIZ A;  4A9M A;  5D1L B;  3NG2 A;  5LKU A;  3IU5 A;  4A9N A;  2K16 A;  4ZUX U;  1X0J A;  3QZS A;  5L8U A;  2MA5 A;  4NUE A;  5I1Q A;  4MSX A;  2MUM A;  2CT2 A;  4QSX A;  4N4H A;  4WA6 A;  4QNS A;  5FE7 A;  5HRX A;  4UIY A;  2DVQ A;  1MM3 A;  2QJ0 A;  5CRM A;  4ZW1 A;  2YUC A;  4FIP A;  3RTR B;  5H85 A;  4LYS A;  5EWW A;  4QSR A;  4LK9 A;  2H0D A;  5TDR A;  2VJF A;  3HMH A;  4IOQ A;  1G25 A;  5A85 A;  3HTK C;  5D0C A;  5D3R A;  1X4U A;  3C6W A;  4OGI A;  2N9G A;  5H1V A;  4J1P A;  3U5O A;  5E74 A;  1XWH A;  4UYF B;  4NQM A;  4ZQL A;  2L85 A;  4O76 A;  5HM0 A;  3EB6 A;  5KH9 A;  4A4B A;  5C13 A;  5ENI A;  5EIC A;  4PY6 A;  2ECT A;  2M6M A;  2M85 A;  5ENB A;  4A9O A;  3SVF A;  1ZBD B;  3U5K A;  2KTB B;  4Q6F A;  4FJC A;  5HEM A;  4CUU A;  5JG6 A;  4LAD B;  4QUU A;  5BT4 A;  4FO9 A;  4TYL A;  3JVK A;  4Z6I A;  5F5Z A;  5F36 A;  1ZS5 A;  4HXR A;  3SVG A;  5DFD A;  5G4S A;  4V3L C;  5L8T A;  3DAI A;  5CP5 A;  2E6S A;  2AN6 A;  3ZVY A;  5FH8 A;  4XYA A;  4YYH A;  4MR6 A;  1CHC A;  3DPL R;  4O64 A;  4UP0 A;  1WUM A;  2YW8 A;  4WHW A;  4CUT A;  4YYM A;  5KH3 A;  5KH7 A;  3N9O A;  4PCI A;  3LQJ A;  4QC1 A;  5FE2 A;  2I50 A;  4CUS A;  5CY9 A;  2YDW A;  4YK0 A;  2YHO A;  5KU3 A;  5CQ4 A;  4Q0O A;  5HCL A;  1JM4 B;  5L98 A;  5A81 A;  5A7C A;  2RI7 A;  4NR6 A;  5CQ3 A;  4MEN A;  5I83 A;  2RS9 B;  5D7X A;  3GL6 A;  5II1 A;  4XUB A;  3C5K A;  3SHB A;  4TU6 A;  5D3N A;  3KQI A;  4HXN A;  4ALH A;  4QF3 A;  2D82 A;  1WES A;  4O71 A;  4A9J A;  5B79 A;  2G45 A;  4UYF A;  3Q2E A;  2D9E A;  4C66 A;  3SOW A;  4Z1S A;  4QR3 A;  3P1F A;  2DVS A;  4HBW A;  4HXO A;  5L96 A;  4IR4 A;  5AD3 A;  5LVR A;  5FH6 A;  2F42 A;  2Y1N A;  5I7Y A;  4TS8 A;  4Z6H A;  2KGG A;  3ZTG A;  3I2D A;  2KFT A;  2LSP B;  5DKH A;  4GB0 A;  4HBV A;  2VJF B;  5I29 A;  5ENH A;  2F6N A;  4GND A;  4IOR A;  5C89 A;  4O7F A;  4CLB A;  4XUA A;  2LV9 A;  5ENJ A;  2FSA A;  2JMD A;  1X4J A;  2L80 A;  4TQN A;  5D3J A;  3N9M A;  4OGJ A;  5HQ5 A;  2E3K A;  4B86 C;  5II2 A;  3U5J A;  4UYG A;  4L7X A;  2G43 A;  4LYI A;  3O34 A;  2NXB A;  4QZS A;  4C67 A;  2FUU A;  3MHS A;  4QST A;  4AYC A;  3UV2 A;  2K4D A;  5IGM A;  4O75 A;  5D24 A;  4HXP A;  5CZG A;  5F1H A;  4YYI A;  5DYC A;  5C11 A;  5CRZ A;  4UIU A;  3PUQ A;  4W4U A;  2YYR A;  2YYN A;  4HXM A;  5CS8 A;  5J0D A;  3O7A A;  5B77 A;  4UYH A;  4YBT A;  5A82 A;  5H1U A;  2DX8 A;  4NS5 A;  2OO1 A;  3LXJ A;  1LDK C;  2MIQ A;  4FK5 A;  4NUC A;  4ALG A;  4E96 A;  4UIW A;  4CFL A;  5E0R A;  1WEO A;  5TBN A;  4YY6 A;  1WEE A;  4LZS A;  5IG6 A;  5CGP A;  1FBV A;  2C2L A;  5TDW A;  5HJC A;  5LJ0 A;  5G0F A;  1WEU A;  4UI9 B;  4A9E A;  2G4A A;  4MEQ A;  3HCU A;  2EA6 A;  4QB3 A;  5BT3 A;  4NQN A;  5HLS A;  2RFJ A;  3UVY A;  3RPG B;  4GNG A;  2ECJ A;  4A49 A;  3I3J A;  5E9Y A;  4NR5 A;  3QZT A;  4NUD A;  4QSV A;  3TLP A;  3UVD A;  3NXB A;  3MXF A;  4NYW A;  4KV4 A;  3LRQ A;  5CQ7 A;  4O77 A;  5DBM A;  5JI8 A;  4GNE A;  4V3K C;  1VD4 A;  1MM2 A;  4Q0N A;  5I86 A;  2UZG A;  4XI1 A;  2KWO A;  2D8S A;  2YU4 A;  4XY8 A;  4IR3 A;  5EPR A;  1WEV A;  4LZR A;  2PNX A;  5DKC A;  5A5N A;  3S91 A;  2RO1 A;  3IHP A;  3O35 A;  3K2J A;  5D3H A;  1WEN A;  2LQ6 A;  4LDF A;  4O7E A;  2LXP C;  5BT5 A;  5E9V A;  4O70 A;  3Q2F A;  5A5S A;  3U5P A;  2L75 A;  3ZPV 1;  5FER A;  2VPD A;  5FE1 A;  3P1D A;  5D1M B;  3FL2 A;  2YW5 A;  4WZ2 A;  2KWN A;  4TZ2 A;  2C2V S;  5C87 A;  5ACY A;  4NRA A;  3MUL A;  4CUP A;  3LJW A;  4TZ8 A;  1IYM A;  1WEW A;  5B78 A;  2ECG A;  5C7N A;  3ZYQ A;  4YAX A;  2LGV A;  2YRE A;  4YC9 A;  5DLX A;  4J0R A;  3HCS A;  5FFW A;  3JVL A;  4MR3 A;  2M3H A;  5E73 A;  4TT6 A;  5ETD A;  5D3P A;  2YQL A;  4YYG A;  4CFK A;  2OSS A;  5G05 B;  4LZ2 A;  4QSU A;  2DWW A;  5E3D A;  3KV5 A;  3P5O A;  2YEM A;  5CFW A;  2LRI C;  3N9Q A;  5CQ6 A;  5ENF A;  3SVH A;  5HRW A;  3U5L A;  2QIC A;  4O72 A;  3ZPV E;  4AVX A;  5EM3 A;  4PPE A;  4NRB A;  4WZ3 B;  1RMD A;  2L43 A;  3HMF A;  5E9K A;  5I40 A;  4LJN A;  4FLP A;  2KWJ A;  4NR8 A;  4QYL A;  5TCM A;  4A9K A;  2VPB A;  4NR7 A;  4CCG X;  4YH3 A;  5FB1 A;  5C85 A;  4NN2 A;  3LQI A;  3P1E A;  4UYD A;  3JVJ A;  2LXH C;  5LVQ A;  3N9L A;  5FB0 A;  5FG6 A;  4AYC B;  2YEL A;  5KHM A;  2KR4 A;  5FEY A;  5KTX A;  1WIM A;  1Z2Q A;  5DKA A;  2RSD A;  1FP0 A;  4BJX A;  3FKM X;  2MA6 A;  1WFK A;  1F68 A;  5LCW B;  3AAD A;  2LGK A;  4YYD A;  5HQ7 A;  5IGK A;  4LYW A;  5COI A;  4CL9 A;  5DW1 A;  2M1R A;  3IU6 A;  4Y03 A;  1WEP A;  3L1Z B;  5LJ2 A;  3PUR A;  1HYI A;  3MB4 A;  3ZYU A;  3O36 A;  5D25 A;  5B75 A;  4LKA A;  2MD8 C;  5E3G A;  4TT4 A;  1Z6U A;  4CA1 A;  5DW2 A;  5EV9 A;  5E9M A;  5A5O A;  2R0V A;  3UV4 A;  5KO4 A;  5CQT A;  3ZNI A;  4S3O B;  4IC2 A;  2KIZ A;  5CQA A;  1X4I A;  3MHH A;  5D1K B;  2IDA A;  5EK9 A;  4UYE A;  4TT2 A;  4HBX A;  2JMJ A;  2YQD A;  5FE3 A;  2XEU A;  2MNZ A;  1WIL A;  2YSJ A;  4BHW A;  2L0B A;  5LKT A;  5EPS A;  4QC3 A;  4X2I A;  5CUC A;  5A5R A;  4MEP A;  2F6J A;  4QSS A;  4CUQ A;  4YYK A;  1F62 A;  5CU8 A;  5HEL A;  4F52 B;  2JMI A;  3VK6 A;  5ETB A;  5L97 A;  4XY9 A;  5DYU A;  4ZDT A;  5K29 A;  2JRJ A;  4L58 A;  4A9F A;  2OXQ C;  4IOO A;  5AMF A;  2CKL B;  4UIX A;  5D3T A;  2DKW A;  5EVA A;  5DFC A;  2ECV A;  4J3I A;  4N3W A;  4O78 A;  3GG3 A;  4BW3 A;  5AD2 A;  2MNY A;  5F63 A;  4I7B A;  4TU4 A;  3O37 A;  5EQ1 A;  3S92 A;  4R7E A;  4TKP B;  2I7K A;  5TRB A;  2VJE B;  5DFB A;  2WP2 A;  5CUE A;  4QSQ A;  1V87 A;  2EGP A;  4IR5 A;  4I7D A;  1E6I A;  1DVP A;  2H60 A;  2LGL A;  4UIV A;  4LLB A;  4UIT A;  3O33 A;  3M99 A;  3KNV A;  5EYA F;  5FE0 A;  2I8N A;  5EIS A;  1LDJ B;  3ONI A;  1Z60 A;  3UV5 A;  3L11 A;  5C4Q A;  2DVV A;  2RNW A;  3D7C A;  2DAT A;  5FG5 A;  2YHN A;  2E7O A;  2HYE D;  5DY7 A;  5F1L A;  5L99 A;  3HME A;  5LJ1 A;  2L5E A;  5DYX A;  5FH7 A;  4DON A;  1WEQ A;  2NAA A;  5FE6 A;  2E6R A;  3RPG C;  2KWK A;  5LKZ A;  4AUQ B;  2ECI A;  4QYD A;  4O7C A;  4QEW A;  2ECN A;  4GNF A;  5A83 A;  4A0C D;  3DWY A;  4PKL A;  5FG4 A;  5CPE A;  3P1C A;  4J0S A;  5F60 A;  5FBX A;  1VYX A;  2CSZ A;  2LDR A;  1N72 A;  4YAD A;  3G0J A;  4KCX A;  2KGI A;  3KV6 A;  3HCT A;  1WE9 A;  3MB3 A;  1WUG A;  3GV4 A;  5F2P A;  4OUF A;  3G0L A;  5F62 A;  5D26 A;  5FFY A;  3SOU A;  4A9L A;  3ASL A;  2R0S A;  5CTL A;  5I88 A;  5IID A;  4MVT A;  4RVR A;  5LUU A;  4YAB A;  2EOD A;  4YYN A;  2RNX A;  4NR4 A;  5KTW A;  3N9P A;  2GRC A;  4HXL A;  4QR5 A;  5A5P A;  4CUR A;  4GPJ A;  3SOX A;  4R8P K;  2CKL A;  5FE5 A;  3MQM A;  5G04 B;  4ZC9 A;  3T7L A;  2YEK A;  4P5O B;  4BW1 A;  2VP7 A;  4QEV A;  4A9H A;  4B7Y C;  5DIN A;  2L84 A;  4UIZ A;  3MUK A;  4TTE A;  2VJE A;  4LC2 A;  4YBM A;  4QF2 A;  2LGG A;  5I89 A;  3M63 A;  3AQA A;  2YUR A;  4UP5 A;  2R0Y A;  2ZET C;  4YBS A;  4NYV A;  5HFR A;  2DVR A;  4QEU A;  5F3A A;  5EWV A;  4HBY A;  2YQM A;  1EQF A;  4YY4 A;  1JM7 B;  5I7X A;  3UVW A;  5F61 A;  2MD7 B;  5KTU A;  4AP4 A;  5B76 A;  5I80 A;  3QZV A;  2KE1 A;  2K1J A;  5CQ8 A;  4LRG A;  4O7B A;  5EU1 A;  4NRC A;  3PHD A;  5ENG A;  4QY4 A;  5I3L A;  2OUO A;  5DX4 A;  1E4U A;  5D3L A;  1JOC A;  4MEO A;  2YT5 A;  5TAB A;  4BBQ A;  3L1X A;  2E7N A;  4PCE A;  2Y1M A;  5DYA A;  1WGM A;  2KRE A;  1WEM A;  5E9I A;  3U5N A;  4N4F A;  2VNF A;  4Z93 A;  4F3I A;  4Z1Q A;  5H1T A;  5EI4 A;  2LN0 A;  3N9N A;  4AKN A;  4WZ0 A;  5IBN A;  4HXS A;  5A5Q A;  4WHU A;  5F25 A;  4BW2 A;  3EB5 A;  4QSP A;  5DLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...