3U5MA

Crystal structure of trim33 phd-bromo in the free state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
203
structure length
178
Chain Sequence
PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase TRIM33
source organism Homo sapiens
molecule tags Transcription
total genus 49
structure length 178
sequence length 203
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5mA01
3N9QA 2EGPA 4OGJA 5EA1A 4C9ZA 1EQFA 2QICA 4WZ2A 5JI8A 4YC9A 4UIWA 3V43A 4MENA 5EGUA 1T1HA 4NR5A 5C11A 4YYNA 2JMDA 3MHHA 3N9NA 4QF3A 4A9KA 5D3JA 4O7EA 2L84A 4XUBA 2FUUA 3T7LA 4L7XA 5DY7A 2G6QA 5DKHA 4LYSA 5A5RA 4LR6A 3O7AA 5G4RA 1WEOA 2C2LA 4WHWA 2IDAA 2YURA 5DLXA 1WUGA 4LYIA 1WEPA 5C85A 1F62A 4LYWA 1LDJB 2VJFA 2E3KA 5D3PA 5D3RA 5EWCA 2D8SA 4HXOA 1VD4A 2YHOA 4UYEA 3SVFA 5F36A 4BHWA 3DQVR 4UYHA 5E9LA 5ENEA 4TYLA 3MUKA 3P1EA 4WHUA 3HCSA 3SVGA 3IU6A 4NRCA 4QSVA 3O36A 4YYKA 3I2DA 5TRBA 5L96A 4B7YC 5A82A 3MXFA 4TQNA 5DFCA 3U5JA 5FE8A 3G0JA 2MJVB 4QUTA 3MHSA 4BW1A 4Q6FA 5JWMA 2Y1MA 1WILA 5CQTA 3UVYA 3UVDA 4NUDA 2FSAA 4MR6A 4R8PK 5DFBA 4AUQB 4NRBA 4NYXA 5F63A 5FE6A 2D9EA 5CP5A 5C89A 5C13A 2F6JA 2WP1A 3DWYA 4TTEA 5E0RA 3SOWA 4TZ2A 1WEUA 5ENGA 3ZPVE 5DINA 5LKUA 4S3OB 4A9EA 5EWHA 1XWHA 4CFLA 5EM3A 4DONA 5DW2A 5JG6A 2CT2A 3ONIA 5D0CA 4YYGA 5B76A 5FE1A 5KH7A 4PTBA 4HBVA 4UIUA 1LDKC 3O37A 4O74A 4UIVA 4C66A 2CKLA 2H0DB 2Y43A 5I7YA 4R7EA 5FE7A 5CRMA 1X4IA 2E6SA 4O7BA 4ZW1A 5LJ0A 3JVLA 4X3GA 5I80A 3U5KA 3QZTA 2CKLB 3U5PA 2PUYA 2EA6A 5HLSA 5EWVA 5H85A 4E96A 3LQHA 5F62A 3O33A 5CTLA 2YW8A 3SOUA 5E9KA 4A9FA 5D3TA 4IOOA 5K29A 5DYAA 5DKCA 4NUEA 3VK6A 4CURA 5FE2A 5HCLA 4LZSA 2KGIA 3TLPA 5CQ4A 5EK9A 2LRIC 2G45A 2HDPA 4GB0A 5LKTA 2L0BA 4N3WA 3PHDA 3N9MA 2KTBB 5D3HA 4IC2A 5A7CA 5B79A 4UYFB 5IGNA 2JMIA 4MR5A 2R0SA 5IBNA 4CUTA 4YAXA 5A85A 4HXMA 5AITA 5DLZA 2LGGA 2YT5A 2E7OA 4UYGA 5CZGA 5FG5A 5J3XA 5II1A 2MNZA 5EWWA 4TT2A 2I50A 3N9PA 4LZ2A 1WUMA 5G4SA 2KFTA 2YHNA 5CPEA 5EWDA 3S92A 2MD8C 5H1VA 5HEMA 5ENBA 4YYJA 4HBXA 4I7DA 4YK0A 5EPRA 2LN0A 4IR6A 5A81A 3GG3A 4HXNA 5CUGA 2LSPB 2LGKA 5D26A 3JVJA 4XY9A 4CUPA 1JM7B 3ZYQA 5H1UA 5CFWA 5IG6A 4O7CA 5BT4A 3ZNIA 4QSPA 4NS5A 4N4IA 3ZYUA 4A9OA 2K4DA 2YYNA 4J3IA 4UYDA 5CU8A 5AMEA 4QSWA 5F3AA 2LGLA 5CUDA 3UV5A 4O64A 4UI9B 2YW5A 2RNWA 2F6NA 3NXBA 2DVQA 3L1ZB 2MIQA 4HXSA 3M99A 4A4CA 4IC3A 2VPDA 3HMHA 4S3OC 5HENA 4QY4A 3RTRB 1Z60A 4HBYA 1JOCA 3KNVA 2YQLA 4QBMA 4XYAA 5CQ7A 2DVVA 4QSXA 4X2IA 2YEMA 2KREA 3GL6A 2I7KA 3FL2A 2NXBA 4AYCA 5E9MA 4L58A 5CQ3A 1F68A 3MQMA 2WP2A 4LDFA 5EI4A 3SOXA 2AN6A 3O35A 4MR3A 5E3GA 2JMJA 1N72A 4AYCB 5C7NA 3N9OA 2CSZA 2KWJA 2VNFA 5DKAA 2N9GA 5LCWB 5BT3A 4IORA 3DPLR 5H9MA 3U5LA 4UIZA 4WZ0A 3AADA 4XY8A 4NR7A 3RPGC 2VJFB 4IR5A 4KV1A 1BORA 5IIDA 4V3LC 2QIZA 1N87A 5FE5A 4BW4A 1WIMA 2G4AA 5FE9A 3PUQA 2EODA 1WGMA 5FH8A 4XUAA 2L85A 2YU4A 2VJEA 4NR6A 1VYXA 4CA1A 2RNYA 4NRAA 2ECJA 5CQ5A 5DFDA 2Y1NA 5D1KB 5E74A 5C8GA 5E7DA 2RS9B 1Z2QA 1WE9A 4O78A 2L75A 4KCXA 4YBTA 5ETBA 5KO4A 5EV9A 2FUIA 2RI7A 4LRGA 4YY6A 3O34A 4QEUA 1JM4B 4UIXA 3ASLA 5TCMA 4QF2A 3LQJA 4O7FA 5FE3A 5G0FA 2E6RA 2MA6A 5I7XA 3C5KA 2G43A 3SHBA 3Q2EA 4QUUA 2UZGA 4CUUA 4O71A 4MEOA 4YYMA 5LJ1A 1WENA 3P5OA 4YYIA 2OUOA 1V87A 5L99A 3MB4A 5HQ7A 2OXQC 4NYVA 5FE0A 3DAIA 4BW3A 4QSRA 2LXHC 2RO1A 4XI1A 4O75A 4O72A 3JVMA 4QR3A 5CQ8A 5D24A 3UVWA 2LDRA 5LUUA 3HTKC 3SVHA 2YQMA 4W4UA 3S91A 3K2JA 4NR8A 3L11A 4HXPA 2R0VA 4PKLA 4FIPA 5B77A 4TT6A 4TU4A 2YELA 4QYLA 3PURA 2MT5A 5BT5A 2GRCA 1CHCA 4YYDA 5FFVA 2ECGA 2LQ6A 5A5SA 3D7CA 4UIYA 4FLPA 2YEKA 4CUQA 1E6IA 2YQDA 3HCTA 1MM2A 5L97A 1WFKA 2M85A 3LQIA 5LJ2A 3U5NA 4QZSA 3P1FA 5LKZA 3T6RA 2KIZA 1FBVA 3HMFA 4GPJA 2MNYA 2YSMA 5CUEA 5KTUA 4B86C 5CQ6A 5IGLA 5B78A 4GNGA 5FG6A 4Z6IA 5HQ6A 4YABA 1FP0A 4QSQA 5KHMA 3N9LA 4LLBA 5EYAF 2RSDA 4OUFA 5HRVA 4LKAA 4BJXA 5A5NA 2NAAA 3LJWA 5FDZA 5F1LA 5EPSA 4MSXA 5EU1A 2R10A 3KQIA 2DKWA 3UVXA 4GNDA 4UITA 1X4JA 5D1MB 3Q2FA 4QYDA 4OGIA 5KTWA 5TABA 5I86A 4IR4A 4WIVA 2MD7B 2KWOA 3LXJA 3P1DA 4Y03A 4MVTA 5D3LA 2YUCA 4A9IA 2I8NA 4UP0A 1JSPB 4J0RA 3KV5A 5CUAA 3UW9A 5FFWA 2KR4A 3I3JA 5EVAA 4Z6HA 3GV4A 4Q0OA 5I29A 3MULA 3QZVA 2JRJA 4YY4A 5ETDA 5ENHA 4O76A 3MB3A 5E9YA 4CFKA 4QEVA 1HYJA 4A9NA 2XB1A 5FH7A 2VP7A 4YATA 3JVKA 4GNEA 4NR4A 4RVRA 5CY9A 5G05B 5DW1A 2RFJA 4QC3A 4AKNA 3LRQA 5HRXA 2DX8A 2K17A 2DATA 4PCIA 3ZVZB 5ENIA 2C2VS 4MEQA 2VPGA 5KTXA 4MR4A 5I3LA 3M62A 5FERA 2L43A 5D3SA 2YDWA 5CS8A 3HMEA 5IGMA 2KGGA 1X4UA 2BAYA 4N4HA 5CGPA 5I1QA 2KWNA 3EB6A 4QR5A 4I7BA 5FEYA 4YH3A 5D25A 4UP5A 4ALGA 2KWKA 4R2YA 2VPBA 1WEVA 2VPEA 2H60A 2KU3A 4IR3A 5ENJA 1IYMA 2R0YA 5HM0A 2MA5A 4N4FA 2VJEB 4FK5A 5F25A 3IU5A 5E9VA 4ZUXU 4ZDTA 5EP7A 1HYIA 4NYWA 4QEWA 4F52B 2DVSA 3L1XA 2PNXA 5IGKA 1E4UA 5H1TA 2K16A 3AQAA 5L98A 2XEUA 4TZ8A 4CL9A 4CUSA 5HELA 5TDWA 3EB5A 4LJNA 4PCEA 2ECWA 5FB1A 4PPEA 4BBQA 4HXRA 4TS8A 4NN2A 5G04B 2KYUA 1MM3A 5HRWA 5AD3A 4FO9A 4BW2A 4LZRA 4A9JA 4NQMA 4QSTA 5A5OA 1G25A 4V3KC 5DX4A 1WEEA 5I89A 1K2FA 4TU6A 4YH4A 2M3HA 3NG2A 1Z6UA 2DVRA 2YSJA 4J1PA 5I40A 3G0LA 4QC1A 4O77A 3P1CA 4I7CA 2L5EA 4QSSA 2MUMA 5DYXA 4ALHA 2H0DA 3FKMX 5FBXA 4CLBA 5LVRA 2ECNA 5B8DA 5F61A 4NQNA 4QB3A 4WZ3B 4TKPB 5D1LB 5E73A 5CUCA 5ACYA 1ZS5A 1WESA 2HYED 5CUBA 2QJ0A 4F3IA 5C87A 5J0DA 2LV9A 5F5ZA 2F42A 5KU3A 4Q0NA 5A5PA 4Z1SA 3QZSA 5EISA 2OSSA 1VFYA 4HXKA 5FH6A 1WEQA 3HCUA 5CQAA 5A83A 5HJCA 3RCWA 2LGVA 5DKDA 3ZVYA 4FJCA 5HQ5A 5FE4A 4HXLA 5A5QA 2RNXA 3C6WA 1ZBDB 2DWWA 3RPGB 2L80A 4NXJA 5D7XA 5EICA 4Z93A 5ENFA 4YYHA 3KV6A 1DVPA 5FG4A 1RMDA 2YYRA 4QR4A 5E3DA 4WA6A 4AP4A 5I83A 4PS5A 5TB6A 5KH3A 4A9HA 5HFQA 1WEMA 3U5OA 4LK9A 1X0JA 4NR9A 4UYFA 5FFYA 5D3NA 4O70A 4QNSA 2D82A 4TT4A 5EQ1A 5F60A 2E7NA 5TDRA 4QSUA 2L5UA 3UV2A 3IHPA 4LADB 5COIA 4AVXA 5L8UA 2M1RA 5AMFA 4P5OB 4KV4A 5B75A 5AIUA 5ENCA 4O7AA 4YBSA 4Z1QA 4A9LA 4A4BA 4GNFA 5DYCA 5L8TA 5AD2A 4ZC9A 3ZTGA 4A0CD 4PY6A 4A9MA 5HFRA 1U6GB 5I88A 1WEWA 5KH9A 4C67A 5EPBA 1JM7A 3M63A 2M6MA 5TBNA 2YREA 5DBMA 2K1JA 3U5MA 2KE1A 4LC2A 4N4GA 4CCGX 2OO1A 4IOQA 4MEPA 5LKXA 5LVQA 5CRZA 5FB0A 3UV4A 2ZETC 2LXPC 2ECVA 5E9IA 5F1HA 4HBWA 4ZQLA 4YBMA 2ECIA 4A49A 4J0SA 3ZPV1 2CSYA 4YADA 5C4QA 3O70A 4NUCA 5DYUA 5II2A 5F2PA 2ECTA
chains in the Genus database with same CATH superfamily
3N9QA 2EGPA 4OGJA 5EA1A 4C9ZA 1EQFA 2QICA 4WZ2A 5JI8A 4YC9A 4UIWA 3V43A 4MENA 5EGUA 1T1HA 4NR5A 5C11A 4YYNA 2JMDA 3MHHA 3N9NA 4QF3A 4A9KA 5D3JA 2CONA 4O7EA 2L84A 4XUBA 2FUUA 3T7LA 4L7XA 5DY7A 2G6QA 5DKHA 4LYSA 5A5RA 4LR6A 3O7AA 5G4RA 1WEOA 2C2LA 4WHWA 2IDAA 2YURA 5DLXA 1WUGA 4LYIA 1WEPA 5C85A 1F62A 4LYWA 1LDJB 2VJFA 2E3KA 5D3PA 5D3RA 5EWCA 2D8SA 4HXOA 1VD4A 2FFWA 2YHOA 4UYEA 3SVFA 5F36A 4BHWA 3DQVR 4UYHA 5E9LA 2EXUA 5ENEA 4TYLA 3PLWA 3MUKA 3P1EA 4WHUA 3HCSA 3SVGA 3IU6A 4NRCA 4QSVA 3O36A 4YYKA 3I2DA 5TRBA 5L96A 4B7YC 3D1DA 5A82A 3MXFA 4TQNA 5DFCA 3U5JA 5FE8A 3G0JA 2MJVB 4QUTA 3MHSA 4BW1A 3VKGA 4Q6FA 5JWMA 2Y1MA 1WILA 5CQTA 3UVYA 3UVDA 4NUDA 2FSAA 4MR6A 4R8PK 5DFBA 4AUQB 4NRBA 3KDEC 4NYXA 5F63A 5FE6A 2D9EA 5CP5A 5C89A 5C13A 2F6JA 2WP1A 3DWYA 4TTEA 5E0RA 3SOWA 5K3QA 4TZ2A 1WEUA 5ENGA 3ZPVE 5DINA 5LKUA 4AKHA 4S3OB 4A9EA 5EWHA 1XWHA 3E2DA 4CFLA 5EM3A 4DONA 5DW2A 2FD4A 5JG6A 2CT2A 3ONIA 5D0CA 4YYGA 5B76A 5FE1A 5KH7A 4PTBA 4HBVA 4UIUA 1LDKC 3O37A 4O74A 4UIVA 4C66A 2CKLA 2H0DB 2Y43A 5I7YA 4R7EA 5FE7A 5CRMA 1X4IA 2E6SA 4O7BA 4ZW1A 5LJ0A 3JVLA 4X3GA 5I80A 3U5KA 3QZTA 2CKLB 3U5PA 2PUYA 2EA6A 5HLSA 5EWVA 5H85A 4Z0OA 4E96A 3LQHA 5F62A 3O33A 5CTLA 2YW8A 3FJUB 3SOUA 5E9KA 4A9FA 5D3TA 4IOOA 5K29A 5DYAA 2JUNA 5DKCA 4NUEA 3VK6A 4CURA 5FE2A 5HCLA 4LZSA 2KGIA 3TLPA 5CQ4A 5EK9A 3LVRE 2LRIC 2G45A 2HDPA 4GB0A 5LKTA 2L0BA 4N3WA 3PHDA 3N9MA 2KTBB 5D3HA 4IC2A 5A7CA 5B79A 4UYFB 5IGNA 2JMIA 4MR5A 2R0SA 5IBNA 4CUTA 4YAXA 5A85A 4HXMA 5AITA 5DLZA 2LGGA 2YT5A 2E7OA 4UYGA 5CZGA 5FG5A 5J3XA 5II1A 2MNZA 5EWWA 4TT2A 2I50A 3N9PA 4LZ2A 1WUMA 3Q1DA 5G4SA 2KFTA 2YHNA 5CPEA 5EWDA 2DSMA 3S92A 2MD8C 5H1VA 5HEMA 5ENBA 4YYJA 4HBXA 4I7DA 4YK0A 5EPRA 2LN0A 4IR6A 5A81A 3GG3A 1ZKRA 4HXNA 2LSPB 5CUGA 5D26A 3JVJA 4XY9A 4CUPA 2LGKA 1JM7B 3ZYQA 4Z0RA 5H1UA 4OGEA 5CFWA 5IG6A 2CSVA 4O7CA 5BT4A 2L7PA 3ZNIA 3D1BA 4QSPA 4NS5A 4N4IA 3ZYUA 4A9OA 2K4DA 2YYNA 3T9KA 4J3IA 4UYDA 5CU8A 5AMEA 4QSWA 5F3AA 2LGLA 5CUDA 3UV5A 4O64A 4UI9B 3DWDA 2YW5A 2RNWA 2P57A 2F6NA 3NXBA 2DVQA 3L1ZB 2MIQA 4HXSA 3M99A 4A4CA 4IC3A 2VPDA 3HMHA 2CRRA 4S3OC 5HENA 4QY4A 3RTRB 1Z60A 4HBYA 1JOCA 3M7KA 3KNVA 2YQLA 4QBMA 4XYAA 5CQ7A 2DVVA 4QSXA 4X2IA 2YEMA 2KREA 3GL6A 2I7KA 3FL2A 2NXBA 4AYCA 5E9MA 4L58A 5CQ3A 1F68A 3MQMA 2WP2A 4LDFA 5EI4A 3FAOA 3SOXA 2AN6A 3O35A 4MR3A 5E3GA 2JMJA 1N72A 4AYCB 5C7NA 3N9OA 2CSZA 2KWJA 2VNFA 5DKAA 2N9GA 5LCWB 5BT3A 5SVIA 4IORA 3DPLR 5H9MA 3U5LA 4UIZA 4WZ0A 3AADA 4XY8A 4NR7A 3RPGC 2VJFB 4IR5A 4KV1A 1BORA 5IIDA 4V3LC 2QIZA 1N87A 5FE5A 2MKEA 4BW4A 1WIMA 2G4AA 5SVXA 5FE9A 3PUQA 1DCQA 1WGMA 5FH8A 2EODA 4XUAA 2L85A 2YU4A 2VJEA 4NR6A 1VYXA 4CA1A 2RNYA 4NRAA 2ECJA 5CQ5A 5DFDA 2Y1NA 5D1KB 5E74A 5C8GA 5E7DA 2RS9B 1Z2QA 1WE9A 4O78A 2L75A 4KCXA 4YBTA 5ETBA 5KO4A 5EV9A 2FUIA 2RI7A 4LRGA 4YY6A 3O34A 4QEUA 1JM4B 4UIXA 3ASLA 5TCMA 4QF2A 3LQJA 4O7FA 5FE3A 3FEHA 5G0FA 2E6RA 2MA6A 5I7XA 3C5KA 2G43A 3SHBA 3Q2EA 4QUUA 2UZGA 4CUUA 4O71A 4MEOA 4YYMA 5LJ1A 1WENA 3P5OA 4YYIA 2OUOA 1V87A 5L99A 3MB4A 5HQ7A 2OXQC 4NYVA 5FE0A 3DAIA 4BW3A 4QSRA 2LXHC 2RO1A 4XI1A 4O75A 4O72A 3JVMA 4AKIA 4QR3A 5CQ8A 5D24A 3UVWA 2LDRA 5LUUA 3HTKC 3SVHA 2YQMA 4W4UA 3S91A 3K2JA 4NR8A 3L11A 4HXPA 2R0VA 4PKLA 4FIPA 5B77A 1PUOA 4TT6A 4TU4A 2YELA 4QYLA 3O47A 3PURA 2MT5A 5BT5A 5SVYA 2GRCA 1CHCA 4YYDA 5FFVA 2ECGA 2LQ6A 5A5SA 3D7CA 4UIYA 4FLPA 2YEKA 4CUQA 1E6IA 2YQDA 3HCTA 1MM2A 5L97A 1WFKA 2M85A 3LQIA 5LJ2A 3U5NA 4QZSA 3P1FA 5LKZA 3T6RA 2KIZA 1FBVA 3HMFA 4GPJA 2MNYA 2YSMA 5CUEA 4AI6A 5KTUA 4B86C 5CQ6A 5IGLA 5B78A 4GNGA 5FG6A 4Z6IA 5HQ6A 4YABA 1FP0A 4QSQA 5KHMA 3N9LA 4LLBA 5EYAF 2RSDA 4OUFA 5HRVA 4LKAA 4BJXA 5A5NA 2NAAA 3LJWA 5FDZA 5F1LA 5EPSA 3VKHA 4MSXA 5EU1A 2R10A 3KQIA 1MBMA 2DKWA 3UVXA 4GNDA 4UITA 1X4JA 5D1MB 3Q2FA 2EGMA 4H9DA 4QYDA 4OGIA 3SUBA 5KTWA 5TABA 5I86A 4IR4A 4WIVA 2MD7B 2KWOA 3FM8C 3LXJA 3P1DA 4Y03A 4MVTA 5D3LA 2YUCA 4A9IA 2I8NA 2B0OE 4UP0A 1JSPB 4J0RA 4AKGA 3KV5A 5CUAA 3UW9A 5FFWA 2KR4A 3I3JA 2E61A 5EVAA 4Z6HA 2LAUA 3GV4A 4Q0OA 5I29A 3MULA 3QZVA 2JRJA 4YY4A 5ETDA 5ENHA 4O76A 3MB3A 5E9YA 4CFKA 2CRWA 4QEVA 1HYJA 4QQ4A 4A9NA 2XP0A 2XB1A 5FH7A 2KKXA 2VP7A 4YATA 3JVKA 4GNEA 4NR4A 4RVRA 3ERRA 5CY9A 5G05B 5DW1A 2RFJA 4QC3A 4AKNA 3LRQA 5HRXA 2DX8A 4OGCA 2K17A 2DATA 4PCIA 2XOYA 2XOZA 3ZVZB 5ENIA 2C2VS 4MEQA 2VPGA 5KTXA 4MR4A 5I3LA 3M62A 5FERA 2L43A 5D3SA 5SVIB 2YDWA 5CS8A 3HMEA 5IGMA 2KGGA 1X4UA 2BAYA 4N4HA 5CGPA 5I1QA 2KWNA 3EB6A 4QR5A 4I7BA 5FEYA 4YH3A 5D25A 4UP5A 4ALGA 2KWKA 4R2YA 2VPBA 4F1PA 1WEVA 2VPEA 2H60A 2KU3A 4IR3A 5ENJA 1IYMA 2R0YA 5HM0A 2EJNA 4N4FA 2MA5A 2VJEB 4FK5A 5F25A 3IU5A 5E9VA 4ZUXU 4ZDTA 2D8UA 5EP7A 2IQJA 1HYIA 4NYWA 4QEWA 4F52B 2DVSA 3L1XA 2PNXA 5IGKA 1E4UA 5H1TA 2K16A 3AQAA 5L98A 3LVQE 2XEUA 4TZ8A 4CL9A 4CUSA 5HELA 5TDWA 3EB5A 4LJNA 4PCEA 2ECWA 3DDTA 5FB1A 4PPEA 4BBQA 4HXRA 4TS8A 4NN2A 5G04B 2KYUA 1MM3A 5HRWA 3FANA 5AD3A 3MDBC 4FO9A 4BW2A 4LZRA 4A9JA 4NQMA 4QSTA 5A5OA 1G25A 4V3KC 5DX4A 1WEEA 5I89A 1K2FA 4TU6A 4YH4A 2M3HA 3NG2A 1Z6UA 2DVRA 2YSJA 4J1PA 5I40A 3G0LA 4QC1A 4O77A 3P1CA 2KKYA 4I7CA 2L5EA 4QSSA 2MUMA 5DYXA 4ALHA 2H0DA 3FKMX 5FBXA 4CLBA 5LVRA 2ECNA 5B8DA 5F61A 4NQNA 4QB3A 4WZ3B 4TKPB 3JUEA 5E73A 5CUCA 5ACYA 1ZS5A 1WESA 2HYED 5D1LB 5CUBA 2QJ0A 4F3IA 2JM3A 5C87A 5J0DA 2LV9A 5F5ZA 2F42A 5KU3A 4Q0NA 5A5PA 4Z1SA 3QZSA 5EISA 2OSSA 1VFYA 4HXKA 5FH6A 1WEQA 3HCUA 5CQAA 5A83A 5HJCA 3RCWA 2LGVA 5DKDA 2DJAA 3ZVYA 2YVRA 4FJCA 5HQ5A 5FE4A 4HXLA 5A5QA 2RNXA 2RR4A 1ZBDB 3C6WA 2DWWA 3RPGB 2L80A 4NXJA 5D7XA 5EICA 4Z93A 5ENFA 4YYHA 3KV6A 1DVPA 5FG4A 1RMDA 2YYRA 4QR4A 5E3DA 3LJUX 4WA6A 5I83A 4PS5A 5TB6A 5KH3A 4A9HA 5HFQA 1WEMA 3U5OA 4LK9A 1X0JA 4NR9A 4UYFA 5FFYA 5D3NA 4O70A 4QNSA 2D82A 4O62A 4TT4A 5EQ1A 5F60A 2OWAA 2E7NA 5TDRA 4QSUA 2L5UA 3UV2A 3IHPA 3H7HA 4LADB 5COIA 4AVXA 5L8UA 2M1RA 5AMFA 4P5OB 4KV4A 5B75A 5AIUA 5ENCA 4O7AA 4YBSA 4Z1QA 4A9LA 4A4BA 4GNFA 5DYCA 5L8TA 5AD2A 2M13A 4ZC9A 3ZTGA 4A0CD 4PY6A 4A9MA 5HFRA 1U6GB 5I88A 1WEWA 5KH9A 4C67A 5EPBA 1JM7A 3M63A 2M6MA 2XOCA 5TBNA 2YREA 5DBMA 2K1JA 3U5MA 2KE1A 4LC2A 4N4GA 4CCGX 2OO1A 4IOQA 4MEPA 5LKXA 5LVQA 5CRZA 5FB0A 3UV4A 2ZETC 2LXPC 2ECVA 5E9IA 5F1HA 4HBWA 4ZQLA 4YBMA 2ECIA 4AP4A 4A49A 4J0SA 3ZPV1 2CSYA 4YADA 5C4QA 3O70A 4NUCA 5DYUA 5II2A 3LDYA 5F2PA 2ECTA
chains in the Genus database with same CATH topology
3N9QA 2EGPA 4OGJA 5EA1A 4C9ZA 1EQFA 2QICA 4WZ2A 5JI8A 4YC9A 4UIWA 3V43A 4MENA 5EGUA 1T1HA 4NR5A 5C11A 4YYNA 2JMDA 3MHHA 3N9NA 4QF3A 4A9KA 5D3JA 4O7EA 2L84A 4XUBA 2FUUA 3T7LA 4L7XA 5DY7A 2G6QA 5DKHA 4LYSA 5A5RA 4LR6A 3O7AA 5G4RA 1WEOA 2C2LA 4WHWA 2IDAA 2YURA 5DLXA 1WUGA 4LYIA 1WEPA 5C85A 1F62A 4LYWA 1LDJB 2VJFA 2E3KA 5D3PA 5D3RA 5EWCA 2D8SA 4HXOA 1VD4A 2YHOA 4UYEA 3SVFA 5F36A 4BHWA 3DQVR 4UYHA 5E9LA 5ENEA 4TYLA 3MUKA 3P1EA 4WHUA 3HCSA 3SVGA 3IU6A 4NRCA 4QSVA 3O36A 4YYKA 3I2DA 5TRBA 5L96A 4B7YC 5A82A 3MXFA 4TQNA 5DFCA 3U5JA 5FE8A 3G0JA 2MJVB 4QUTA 3MHSA 4BW1A 4Q6FA 5JWMA 2Y1MA 1WILA 5CQTA 3UVYA 3UVDA 4NUDA 2FSAA 4MR6A 4R8PK 5DFBA 4AUQB 4NRBA 4NYXA 5F63A 5FE6A 2D9EA 5CP5A 5C89A 5C13A 2F6JA 2WP1A 3DWYA 4TTEA 5E0RA 3SOWA 4TZ2A 1WEUA 5ENGA 3ZPVE 5DINA 5LKUA 4S3OB 4A9EA 5EWHA 1XWHA 4CFLA 5EM3A 4DONA 5DW2A 5JG6A 2CT2A 3ONIA 5D0CA 4YYGA 5B76A 5FE1A 5KH7A 4PTBA 4HBVA 4UIUA 1LDKC 3O37A 4O74A 4UIVA 4C66A 2CKLA 2H0DB 2Y43A 5I7YA 4R7EA 5FE7A 5CRMA 1X4IA 2E6SA 4O7BA 4ZW1A 5LJ0A 3JVLA 4X3GA 5I80A 3U5KA 3QZTA 2CKLB 3U5PA 2PUYA 2EA6A 5HLSA 5EWVA 5H85A 4E96A 3LQHA 5F62A 3O33A 5CTLA 2YW8A 3SOUA 5E9KA 4A9FA 5D3TA 4IOOA 5K29A 5DYAA 5DKCA 4NUEA 3VK6A 4CURA 5FE2A 5HCLA 4LZSA 2KGIA 3TLPA 5CQ4A 5EK9A 2LRIC 2G45A 2HDPA 4GB0A 5LKTA 2L0BA 4N3WA 3PHDA 3N9MA 2KTBB 5D3HA 4IC2A 5A7CA 5B79A 4UYFB 5IGNA 2JMIA 4MR5A 2R0SA 5IBNA 4CUTA 4YAXA 5A85A 4HXMA 5AITA 5DLZA 2LGGA 2YT5A 2E7OA 4UYGA 5CZGA 5FG5A 5J3XA 5II1A 2MNZA 5EWWA 4TT2A 2I50A 3N9PA 4LZ2A 1WUMA 5G4SA 2KFTA 2YHNA 5CPEA 5EWDA 3S92A 2MD8C 5H1VA 5HEMA 5ENBA 4YYJA 4HBXA 4I7DA 4YK0A 5EPRA 2LN0A 4IR6A 5A81A 3GG3A 4HXNA 5CUGA 2LSPB 2LGKA 5D26A 3JVJA 4XY9A 4CUPA 1JM7B 3ZYQA 5H1UA 5CFWA 5IG6A 4O7CA 5BT4A 3ZNIA 4QSPA 4NS5A 4N4IA 3ZYUA 4A9OA 2K4DA 2YYNA 4J3IA 4UYDA 5CU8A 5AMEA 4QSWA 5F3AA 2LGLA 5CUDA 3UV5A 4O64A 4UI9B 2YW5A 2RNWA 2F6NA 3NXBA 2DVQA 3L1ZB 2MIQA 4HXSA 3M99A 4A4CA 4IC3A 2VPDA 3HMHA 4S3OC 5HENA 4QY4A 3RTRB 1Z60A 4HBYA 1JOCA 3KNVA 2YQLA 4QBMA 4XYAA 5CQ7A 2DVVA 4QSXA 4X2IA 2YEMA 2KREA 3GL6A 2I7KA 3FL2A 2NXBA 4AYCA 5E9MA 4L58A 5CQ3A 1F68A 3MQMA 2WP2A 4LDFA 5EI4A 3SOXA 2AN6A 3O35A 4MR3A 5E3GA 2JMJA 1N72A 4AYCB 5C7NA 3N9OA 2CSZA 2KWJA 2VNFA 5DKAA 2N9GA 5LCWB 5BT3A 4IORA 3DPLR 5H9MA 3U5LA 4UIZA 4WZ0A 3AADA 4XY8A 4NR7A 3RPGC 2VJFB 4IR5A 4KV1A 1BORA 5IIDA 4V3LC 2QIZA 1N87A 5FE5A 4BW4A 1WIMA 2G4AA 5FE9A 3PUQA 2EODA 1WGMA 5FH8A 4XUAA 2L85A 2YU4A 2VJEA 4NR6A 1VYXA 4CA1A 2RNYA 4NRAA 2ECJA 5CQ5A 5DFDA 2Y1NA 5D1KB 5E74A 5C8GA 5E7DA 2RS9B 1Z2QA 1WE9A 4O78A 2L75A 4KCXA 4YBTA 5ETBA 5KO4A 5EV9A 2FUIA 2RI7A 4LRGA 4YY6A 3O34A 4QEUA 1JM4B 4UIXA 3ASLA 5TCMA 4QF2A 3LQJA 4O7FA 5FE3A 5G0FA 2E6RA 2MA6A 5I7XA 3C5KA 2G43A 3SHBA 3Q2EA 4QUUA 2UZGA 4CUUA 4O71A 4MEOA 4YYMA 5LJ1A 1WENA 3P5OA 4YYIA 2OUOA 1V87A 5L99A 3MB4A 5HQ7A 2OXQC 4NYVA 5FE0A 3DAIA 4BW3A 4QSRA 2LXHC 2RO1A 4XI1A 4O75A 4O72A 3JVMA 4QR3A 5CQ8A 5D24A 3UVWA 2LDRA 5LUUA 3HTKC 3SVHA 2YQMA 4W4UA 3S91A 3K2JA 4NR8A 3L11A 4HXPA 2R0VA 4PKLA 4FIPA 5B77A 4TT6A 4TU4A 2YELA 4QYLA 3PURA 2MT5A 5BT5A 2GRCA 1CHCA 4YYDA 5FFVA 2ECGA 2LQ6A 5A5SA 3D7CA 4UIYA 4FLPA 2YEKA 4CUQA 1E6IA 2YQDA 3HCTA 1MM2A 5L97A 1WFKA 2M85A 3LQIA 5LJ2A 3U5NA 4QZSA 3P1FA 5LKZA 3T6RA 2KIZA 1FBVA 3HMFA 4GPJA 2MNYA 2YSMA 5CUEA 5KTUA 4B86C 5CQ6A 5IGLA 5B78A 4GNGA 5FG6A 4Z6IA 5HQ6A 4YABA 1FP0A 4QSQA 5KHMA 3N9LA 4LLBA 5EYAF 2RSDA 4OUFA 5HRVA 4LKAA 4BJXA 5A5NA 2NAAA 3LJWA 5FDZA 5F1LA 5EPSA 4MSXA 5EU1A 2R10A 3KQIA 2DKWA 3UVXA 4GNDA 4UITA 1X4JA 5D1MB 3Q2FA 4QYDA 4OGIA 5KTWA 5TABA 5I86A 4IR4A 4WIVA 2MD7B 2KWOA 3LXJA 3P1DA 4Y03A 4MVTA 5D3LA 2YUCA 4A9IA 2I8NA 4UP0A 1JSPB 4J0RA 3KV5A 5CUAA 3UW9A 5FFWA 2KR4A 3I3JA 5EVAA 4Z6HA 3GV4A 4Q0OA 5I29A 3MULA 3QZVA 2JRJA 4YY4A 5ETDA 5ENHA 4O76A 3MB3A 5E9YA 4CFKA 4QEVA 1HYJA 4A9NA 2XB1A 5FH7A 2VP7A 4YATA 3JVKA 4GNEA 4NR4A 4RVRA 5CY9A 5G05B 5DW1A 2RFJA 4QC3A 4AKNA 3LRQA 5HRXA 2DX8A 2K17A 2DATA 4PCIA 3ZVZB 5ENIA 2C2VS 4MEQA 2VPGA 5KTXA 4MR4A 5I3LA 3M62A 5FERA 2L43A 5D3SA 2YDWA 5CS8A 3HMEA 5IGMA 2KGGA 1X4UA 2BAYA 4N4HA 5CGPA 5I1QA 2KWNA 3EB6A 4QR5A 4I7BA 5FEYA 4YH3A 5D25A 4UP5A 4ALGA 2KWKA 4R2YA 2VPBA 1WEVA 2VPEA 2H60A 2KU3A 4IR3A 5ENJA 1IYMA 2R0YA 5HM0A 2MA5A 4N4FA 2VJEB 4FK5A 5F25A 3IU5A 5E9VA 4ZUXU 4ZDTA 5EP7A 1HYIA 4NYWA 4QEWA 4F52B 2DVSA 3L1XA 2PNXA 5IGKA 1E4UA 5H1TA 2K16A 3AQAA 5L98A 2XEUA 4TZ8A 4CL9A 4CUSA 5HELA 5TDWA 3EB5A 4LJNA 4PCEA 2ECWA 5FB1A 4PPEA 4BBQA 4HXRA 4TS8A 4NN2A 5G04B 2KYUA 1MM3A 5HRWA 5AD3A 4FO9A 4BW2A 4LZRA 4A9JA 4NQMA 4QSTA 5A5OA 1G25A 4V3KC 5DX4A 1WEEA 5I89A 1K2FA 4TU6A 4YH4A 2M3HA 3NG2A 1Z6UA 2DVRA 2YSJA 4J1PA 5I40A 3G0LA 4QC1A 4O77A 3P1CA 4I7CA 2L5EA 4QSSA 2MUMA 5DYXA 4ALHA 2H0DA 3FKMX 5FBXA 4CLBA 5LVRA 2ECNA 5B8DA 5F61A 4NQNA 4QB3A 4WZ3B 4TKPB 5D1LB 5E73A 5CUCA 5ACYA 1ZS5A 1WESA 2HYED 5CUBA 2QJ0A 4F3IA 5C87A 5J0DA 2LV9A 5F5ZA 2F42A 5KU3A 4Q0NA 5A5PA 4Z1SA 3QZSA 5EISA 2OSSA 1VFYA 4HXKA 5FH6A 1WEQA 3HCUA 5CQAA 5A83A 5HJCA 3RCWA 2LGVA 5DKDA 3ZVYA 4FJCA 5HQ5A 5FE4A 4HXLA 5A5QA 2RNXA 3C6WA 1ZBDB 2DWWA 3RPGB 2L80A 4NXJA 5D7XA 5EICA 4Z93A 5ENFA 4YYHA 3KV6A 1DVPA 5FG4A 1RMDA 2YYRA 4QR4A 5E3DA 4WA6A 4AP4A 5I83A 4PS5A 5TB6A 5KH3A 4A9HA 5HFQA 1WEMA 3U5OA 4LK9A 1X0JA 4NR9A 4UYFA 5FFYA 5D3NA 4O70A 4QNSA 2D82A 4TT4A 5EQ1A 5F60A 2E7NA 5TDRA 4QSUA 2L5UA 3UV2A 3IHPA 4LADB 5COIA 4AVXA 5L8UA 2M1RA 5AMFA 4P5OB 4KV4A 5B75A 5AIUA 5ENCA 4O7AA 4YBSA 4Z1QA 4A9LA 4A4BA 4GNFA 5DYCA 5L8TA 5AD2A 4ZC9A 3ZTGA 4A0CD 4PY6A 4A9MA 5HFRA 1U6GB 5I88A 1WEWA 5KH9A 4C67A 5EPBA 1JM7A 3M63A 2M6MA 5TBNA 2YREA 5DBMA 2K1JA 3U5MA 2KE1A 4LC2A 4N4GA 4CCGX 2OO1A 4IOQA 4MEPA 5LKXA 5LVQA 5CRZA 5FB0A 3UV4A 2ZETC 2LXPC 2ECVA 5E9IA 5F1HA 4HBWA 4ZQLA 4YBMA 2ECIA 4A49A 4J0SA 3ZPV1 2CSYA 4YADA 5C4QA 3O70A 4NUCA 5DYUA 5II2A 5F2PA 2ECTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9Q A;  2EGP A;  4OGJ A;  5EA1 A;  4C9Z A;  1EQF A;  2QIC A;  4WZ2 A;  5JI8 A;  4YC9 A;  4UIW A;  3V43 A;  4MEN A;  5EGU A;  1T1H A;  4NR5 A;  5C11 A;  4YYN A;  2JMD A;  3MHH A;  3N9N A;  4QF3 A;  4A9K A;  5D3J A;  4O7E A;  2L84 A;  4XUB A;  2FUU A;  3T7L A;  4L7X A;  5DY7 A;  2G6Q A;  5DKH A;  4LYS A;  5A5R A;  4LR6 A;  3O7A A;  5G4R A;  1WEO A;  2C2L A;  4WHW A;  2IDA A;  2YUR A;  5DLX A;  1WUG A;  4LYI A;  1WEP A;  5C85 A;  1F62 A;  4LYW A;  1LDJ B;  2VJF A;  2E3K A;  5D3P A;  5D3R A;  5EWC A;  2D8S A;  4HXO A;  1VD4 A;  2YHO A;  4UYE A;  3SVF A;  5F36 A;  4BHW A;  3DQV R;  4UYH A;  5E9L A;  5ENE A;  4TYL A;  3MUK A;  3P1E A;  4WHU A;  3HCS A;  3SVG A;  3IU6 A;  4NRC A;  4QSV A;  3O36 A;  4YYK A;  3I2D A;  5TRB A;  5L96 A;  4B7Y C;  5A82 A;  3MXF A;  4TQN A;  5DFC A;  3U5J A;  5FE8 A;  3G0J A;  2MJV B;  4QUT A;  3MHS A;  4BW1 A;  4Q6F A;  5JWM A;  2Y1M A;  1WIL A;  5CQT A;  3UVY A;  3UVD A;  4NUD A;  2FSA A;  4MR6 A;  4R8P K;  5DFB A;  4AUQ B;  4NRB A;  4NYX A;  5F63 A;  5FE6 A;  2D9E A;  5CP5 A;  5C89 A;  5C13 A;  2F6J A;  2WP1 A;  3DWY A;  4TTE A;  5E0R A;  3SOW A;  4TZ2 A;  1WEU A;  5ENG A;  3ZPV E;  5DIN A;  5LKU A;  4S3O B;  4A9E A;  5EWH A;  1XWH A;  4CFL A;  5EM3 A;  4DON A;  5DW2 A;  5JG6 A;  2CT2 A;  3ONI A;  5D0C A;  4YYG A;  5B76 A;  5FE1 A;  5KH7 A;  4PTB A;  4HBV A;  4UIU A;  1LDK C;  3O37 A;  4O74 A;  4UIV A;  4C66 A;  2CKL A;  2H0D B;  2Y43 A;  5I7Y A;  4R7E A;  5FE7 A;  5CRM A;  1X4I A;  2E6S A;  4O7B A;  4ZW1 A;  5LJ0 A;  3JVL A;  4X3G A;  5I80 A;  3U5K A;  3QZT A;  2CKL B;  3U5P A;  2PUY A;  2EA6 A;  5HLS A;  5EWV A;  5H85 A;  4E96 A;  3LQH A;  5F62 A;  3O33 A;  5CTL A;  2YW8 A;  3SOU A;  5E9K A;  4A9F A;  5D3T A;  4IOO A;  5K29 A;  5DYA A;  5DKC A;  4NUE A;  3VK6 A;  4CUR A;  5FE2 A;  5HCL A;  4LZS A;  2KGI A;  3TLP A;  5CQ4 A;  5EK9 A;  2LRI C;  2G45 A;  2HDP A;  4GB0 A;  5LKT A;  2L0B A;  4N3W A;  3PHD A;  3N9M A;  2KTB B;  5D3H A;  4IC2 A;  5A7C A;  5B79 A;  4UYF B;  5IGN A;  2JMI A;  4MR5 A;  2R0S A;  5IBN A;  4CUT A;  4YAX A;  5A85 A;  4HXM A;  5AIT A;  5DLZ A;  2LGG A;  2YT5 A;  2E7O A;  4UYG A;  5CZG A;  5FG5 A;  5J3X A;  5II1 A;  2MNZ A;  5EWW A;  4TT2 A;  2I50 A;  3N9P A;  4LZ2 A;  1WUM A;  5G4S A;  2KFT A;  2YHN A;  5CPE A;  5EWD A;  3S92 A;  2MD8 C;  5H1V A;  5HEM A;  5ENB A;  4YYJ A;  4HBX A;  4I7D A;  4YK0 A;  5EPR A;  2LN0 A;  4IR6 A;  5A81 A;  3GG3 A;  4HXN A;  5CUG A;  2LSP B;  2LGK A;  5D26 A;  3JVJ A;  4XY9 A;  4CUP A;  1JM7 B;  3ZYQ A;  5H1U A;  5CFW A;  5IG6 A;  4O7C A;  5BT4 A;  3ZNI A;  4QSP A;  4NS5 A;  4N4I A;  3ZYU A;  4A9O A;  2K4D A;  2YYN A;  4J3I A;  4UYD A;  5CU8 A;  5AME A;  4QSW A;  5F3A A;  2LGL A;  5CUD A;  3UV5 A;  4O64 A;  4UI9 B;  2YW5 A;  2RNW A;  2F6N A;  3NXB A;  2DVQ A;  3L1Z B;  2MIQ A;  4HXS A;  3M99 A;  4A4C A;  4IC3 A;  2VPD A;  3HMH A;  4S3O C;  5HEN A;  4QY4 A;  3RTR B;  1Z60 A;  4HBY A;  1JOC A;  3KNV A;  2YQL A;  4QBM A;  4XYA A;  5CQ7 A;  2DVV A;  4QSX A;  4X2I A;  2YEM A;  2KRE A;  3GL6 A;  2I7K A;  3FL2 A;  2NXB A;  4AYC A;  5E9M A;  4L58 A;  5CQ3 A;  1F68 A;  3MQM A;  2WP2 A;  4LDF A;  5EI4 A;  3SOX A;  2AN6 A;  3O35 A;  4MR3 A;  5E3G A;  2JMJ A;  1N72 A;  4AYC B;  5C7N A;  3N9O A;  2CSZ A;  2KWJ A;  2VNF A;  5DKA A;  2N9G A;  5LCW B;  5BT3 A;  4IOR A;  3DPL R;  5H9M A;  3U5L A;  4UIZ A;  4WZ0 A;  3AAD A;  4XY8 A;  4NR7 A;  3RPG C;  2VJF B;  4IR5 A;  4KV1 A;  1BOR A;  5IID A;  4V3L C;  2QIZ A;  1N87 A;  5FE5 A;  4BW4 A;  1WIM A;  2G4A A;  5FE9 A;  3PUQ A;  2EOD A;  1WGM A;  5FH8 A;  4XUA A;  2L85 A;  2YU4 A;  2VJE A;  4NR6 A;  1VYX A;  4CA1 A;  2RNY A;  4NRA A;  2ECJ A;  5CQ5 A;  5DFD A;  2Y1N A;  5D1K B;  5E74 A;  5C8G A;  5E7D A;  2RS9 B;  1Z2Q A;  1WE9 A;  4O78 A;  2L75 A;  4KCX A;  4YBT A;  5ETB A;  5KO4 A;  5EV9 A;  2FUI A;  2RI7 A;  4LRG A;  4YY6 A;  3O34 A;  4QEU A;  1JM4 B;  4UIX A;  3ASL A;  5TCM A;  4QF2 A;  3LQJ A;  4O7F A;  5FE3 A;  5G0F A;  2E6R A;  2MA6 A;  5I7X A;  3C5K A;  2G43 A;  3SHB A;  3Q2E A;  4QUU A;  2UZG A;  4CUU A;  4O71 A;  4MEO A;  4YYM A;  5LJ1 A;  1WEN A;  3P5O A;  4YYI A;  2OUO A;  1V87 A;  5L99 A;  3MB4 A;  5HQ7 A;  2OXQ C;  4NYV A;  5FE0 A;  3DAI A;  4BW3 A;  4QSR A;  2LXH C;  2RO1 A;  4XI1 A;  4O75 A;  4O72 A;  3JVM A;  4QR3 A;  5CQ8 A;  5D24 A;  3UVW A;  2LDR A;  5LUU A;  3HTK C;  3SVH A;  2YQM A;  4W4U A;  3S91 A;  3K2J A;  4NR8 A;  3L11 A;  4HXP A;  2R0V A;  4PKL A;  4FIP A;  5B77 A;  4TT6 A;  4TU4 A;  2YEL A;  4QYL A;  3PUR A;  2MT5 A;  5BT5 A;  2GRC A;  1CHC A;  4YYD A;  5FFV A;  2ECG A;  2LQ6 A;  5A5S A;  3D7C A;  4UIY A;  4FLP A;  2YEK A;  4CUQ A;  1E6I A;  2YQD A;  3HCT A;  1MM2 A;  5L97 A;  1WFK A;  2M85 A;  3LQI A;  5LJ2 A;  3U5N A;  4QZS A;  3P1F A;  5LKZ A;  3T6R A;  2KIZ A;  1FBV A;  3HMF A;  4GPJ A;  2MNY A;  2YSM A;  5CUE A;  5KTU A;  4B86 C;  5CQ6 A;  5IGL A;  5B78 A;  4GNG A;  5FG6 A;  4Z6I A;  5HQ6 A;  4YAB A;  1FP0 A;  4QSQ A;  5KHM A;  3N9L A;  4LLB A;  5EYA F;  2RSD A;  4OUF A;  5HRV A;  4LKA A;  4BJX A;  5A5N A;  2NAA A;  3LJW A;  5FDZ A;  5F1L A;  5EPS A;  4MSX A;  5EU1 A;  2R10 A;  3KQI A;  2DKW A;  3UVX A;  4GND A;  4UIT A;  1X4J A;  5D1M B;  3Q2F A;  4QYD A;  4OGI A;  5KTW A;  5TAB A;  5I86 A;  4IR4 A;  4WIV A;  2MD7 B;  2KWO A;  3LXJ A;  3P1D A;  4Y03 A;  4MVT A;  5D3L A;  2YUC A;  4A9I A;  2I8N A;  4UP0 A;  1JSP B;  4J0R A;  3KV5 A;  5CUA A;  3UW9 A;  5FFW A;  2KR4 A;  3I3J A;  5EVA A;  4Z6H A;  3GV4 A;  4Q0O A;  5I29 A;  3MUL A;  3QZV A;  2JRJ A;  4YY4 A;  5ETD A;  5ENH A;  4O76 A;  3MB3 A;  5E9Y A;  4CFK A;  4QEV A;  1HYJ A;  4A9N A;  2XB1 A;  5FH7 A;  2VP7 A;  4YAT A;  3JVK A;  4GNE A;  4NR4 A;  4RVR A;  5CY9 A;  5G05 B;  5DW1 A;  2RFJ A;  4QC3 A;  4AKN A;  3LRQ A;  5HRX A;  2DX8 A;  2K17 A;  2DAT A;  4PCI A;  3ZVZ B;  5ENI A;  2C2V S;  4MEQ A;  2VPG A;  5KTX A;  4MR4 A;  5I3L A;  3M62 A;  5FER A;  2L43 A;  5D3S A;  2YDW A;  5CS8 A;  3HME A;  5IGM A;  2KGG A;  1X4U A;  2BAY A;  4N4H A;  5CGP A;  5I1Q A;  2KWN A;  3EB6 A;  4QR5 A;  4I7B A;  5FEY A;  4YH3 A;  5D25 A;  4UP5 A;  4ALG A;  2KWK A;  4R2Y A;  2VPB A;  1WEV A;  2VPE A;  2H60 A;  2KU3 A;  4IR3 A;  5ENJ A;  1IYM A;  2R0Y A;  5HM0 A;  2MA5 A;  4N4F A;  2VJE B;  4FK5 A;  5F25 A;  3IU5 A;  5E9V A;  4ZUX U;  4ZDT A;  5EP7 A;  1HYI A;  4NYW A;  4QEW A;  4F52 B;  2DVS A;  3L1X A;  2PNX A;  5IGK A;  1E4U A;  5H1T A;  2K16 A;  3AQA A;  5L98 A;  2XEU A;  4TZ8 A;  4CL9 A;  4CUS A;  5HEL A;  5TDW A;  3EB5 A;  4LJN A;  4PCE A;  2ECW A;  5FB1 A;  4PPE A;  4BBQ A;  4HXR A;  4TS8 A;  4NN2 A;  5G04 B;  2KYU A;  1MM3 A;  5HRW A;  5AD3 A;  4FO9 A;  4BW2 A;  4LZR A;  4A9J A;  4NQM A;  4QST A;  5A5O A;  1G25 A;  4V3K C;  5DX4 A;  1WEE A;  5I89 A;  1K2F A;  4TU6 A;  4YH4 A;  2M3H A;  3NG2 A;  1Z6U A;  2DVR A;  2YSJ A;  4J1P A;  5I40 A;  3G0L A;  4QC1 A;  4O77 A;  3P1C A;  4I7C A;  2L5E A;  4QSS A;  2MUM A;  5DYX A;  4ALH A;  2H0D A;  3FKM X;  5FBX A;  4CLB A;  5LVR A;  2ECN A;  5B8D A;  5F61 A;  4NQN A;  4QB3 A;  4WZ3 B;  4TKP B;  5D1L B;  5E73 A;  5CUC A;  5ACY A;  1ZS5 A;  1WES A;  2HYE D;  5CUB A;  2QJ0 A;  4F3I A;  5C87 A;  5J0D A;  2LV9 A;  5F5Z A;  2F42 A;  5KU3 A;  4Q0N A;  5A5P A;  4Z1S A;  3QZS A;  5EIS A;  2OSS A;  1VFY A;  4HXK A;  5FH6 A;  1WEQ A;  3HCU A;  5CQA A;  5A83 A;  5HJC A;  3RCW A;  2LGV A;  5DKD A;  3ZVY A;  4FJC A;  5HQ5 A;  5FE4 A;  4HXL A;  5A5Q A;  2RNX A;  3C6W A;  1ZBD B;  2DWW A;  3RPG B;  2L80 A;  4NXJ A;  5D7X A;  5EIC A;  4Z93 A;  5ENF A;  4YYH A;  3KV6 A;  1DVP A;  5FG4 A;  1RMD A;  2YYR A;  4QR4 A;  5E3D A;  4WA6 A;  4AP4 A;  5I83 A;  4PS5 A;  5TB6 A;  5KH3 A;  4A9H A;  5HFQ A;  1WEM A;  3U5O A;  4LK9 A;  1X0J A;  4NR9 A;  4UYF A;  5FFY A;  5D3N A;  4O70 A;  4QNS A;  2D82 A;  4TT4 A;  5EQ1 A;  5F60 A;  2E7N A;  5TDR A;  4QSU A;  2L5U A;  3UV2 A;  3IHP A;  4LAD B;  5COI A;  4AVX A;  5L8U A;  2M1R A;  5AMF A;  4P5O B;  4KV4 A;  5B75 A;  5AIU A;  5ENC A;  4O7A A;  4YBS A;  4Z1Q A;  4A9L A;  4A4B A;  4GNF A;  5DYC A;  5L8T A;  5AD2 A;  4ZC9 A;  3ZTG A;  4A0C D;  4PY6 A;  4A9M A;  5HFR A;  1U6G B;  5I88 A;  1WEW A;  5KH9 A;  4C67 A;  5EPB A;  1JM7 A;  3M63 A;  2M6M A;  5TBN A;  2YRE A;  5DBM A;  2K1J A;  3U5M A;  2KE1 A;  4LC2 A;  4N4G A;  4CCG X;  2OO1 A;  4IOQ A;  4MEP A;  5LKX A;  5LVQ A;  5CRZ A;  5FB0 A;  3UV4 A;  2ZET C;  2LXP C;  2ECV A;  5E9I A;  5F1H A;  4HBW A;  4ZQL A;  4YBM A;  2ECI A;  4A49 A;  4J0S A;  3ZPV 1;  2CSY A;  4YAD A;  5C4Q A;  3O70 A;  4NUC A;  5DYU A;  5II2 A;  5F2P A;  2ECT A; 
#chains in the Genus database with same CATH topology
 3N9Q A;  2EGP A;  4OGJ A;  5EA1 A;  4C9Z A;  1EQF A;  2QIC A;  4WZ2 A;  5JI8 A;  4YC9 A;  4UIW A;  3V43 A;  4MEN A;  5EGU A;  1T1H A;  4NR5 A;  5C11 A;  4YYN A;  2JMD A;  3MHH A;  3N9N A;  4QF3 A;  4A9K A;  5D3J A;  2CON A;  4O7E A;  2L84 A;  4XUB A;  2FUU A;  3T7L A;  4L7X A;  5DY7 A;  2G6Q A;  5DKH A;  4LYS A;  5A5R A;  4LR6 A;  3O7A A;  5G4R A;  1WEO A;  2C2L A;  4WHW A;  2IDA A;  2YUR A;  5DLX A;  1WUG A;  4LYI A;  1WEP A;  5C85 A;  1F62 A;  4LYW A;  1LDJ B;  2VJF A;  2E3K A;  5D3P A;  5D3R A;  5EWC A;  2D8S A;  4HXO A;  1VD4 A;  2FFW A;  2YHO A;  4UYE A;  3SVF A;  5F36 A;  4BHW A;  3DQV R;  4UYH A;  5E9L A;  2EXU A;  5ENE A;  4TYL A;  3PLW A;  3MUK A;  3P1E A;  4WHU A;  3HCS A;  3SVG A;  3IU6 A;  4NRC A;  4QSV A;  3O36 A;  4YYK A;  3I2D A;  5TRB A;  5L96 A;  4B7Y C;  3D1D A;  5A82 A;  3MXF A;  4TQN A;  5DFC A;  3U5J A;  5FE8 A;  3G0J A;  2MJV B;  4QUT A;  3MHS A;  4BW1 A;  3VKG A;  4Q6F A;  5JWM A;  2Y1M A;  1WIL A;  5CQT A;  3UVY A;  3UVD A;  4NUD A;  2FSA A;  4MR6 A;  4R8P K;  5DFB A;  4AUQ B;  4NRB A;  3KDE C;  4NYX A;  5F63 A;  5FE6 A;  2D9E A;  5CP5 A;  5C89 A;  5C13 A;  2F6J A;  2WP1 A;  3DWY A;  4TTE A;  5E0R A;  3SOW A;  5K3Q A;  4TZ2 A;  1WEU A;  5ENG A;  3ZPV E;  5DIN A;  5LKU A;  4AKH A;  4S3O B;  4A9E A;  5EWH A;  1XWH A;  3E2D A;  4CFL A;  5EM3 A;  4DON A;  5DW2 A;  2FD4 A;  5JG6 A;  2CT2 A;  3ONI A;  5D0C A;  4YYG A;  5B76 A;  5FE1 A;  5KH7 A;  4PTB A;  4HBV A;  4UIU A;  1LDK C;  3O37 A;  4O74 A;  4UIV A;  4C66 A;  2CKL A;  2H0D B;  2Y43 A;  5I7Y A;  4R7E A;  5FE7 A;  5CRM A;  1X4I A;  2E6S A;  4O7B A;  4ZW1 A;  5LJ0 A;  3JVL A;  4X3G A;  5I80 A;  3U5K A;  3QZT A;  2CKL B;  3U5P A;  2PUY A;  2EA6 A;  5HLS A;  5EWV A;  5H85 A;  4Z0O A;  4E96 A;  3LQH A;  5F62 A;  3O33 A;  5CTL A;  2YW8 A;  3FJU B;  3SOU A;  5E9K A;  4A9F A;  5D3T A;  4IOO A;  5K29 A;  5DYA A;  2JUN A;  5DKC A;  4NUE A;  3VK6 A;  4CUR A;  5FE2 A;  5HCL A;  4LZS A;  2KGI A;  3TLP A;  5CQ4 A;  5EK9 A;  3LVR E;  2LRI C;  2G45 A;  2HDP A;  4GB0 A;  5LKT A;  2L0B A;  4N3W A;  3PHD A;  3N9M A;  2KTB B;  5D3H A;  4IC2 A;  5A7C A;  5B79 A;  4UYF B;  5IGN A;  2JMI A;  4MR5 A;  2R0S A;  5IBN A;  4CUT A;  4YAX A;  5A85 A;  4HXM A;  5AIT A;  5DLZ A;  2LGG A;  2YT5 A;  2E7O A;  4UYG A;  5CZG A;  5FG5 A;  5J3X A;  5II1 A;  2MNZ A;  5EWW A;  4TT2 A;  2I50 A;  3N9P A;  4LZ2 A;  1WUM A;  3Q1D A;  5G4S A;  2KFT A;  2YHN A;  5CPE A;  5EWD A;  2DSM A;  3S92 A;  2MD8 C;  5H1V A;  5HEM A;  5ENB A;  4YYJ A;  4HBX A;  4I7D A;  4YK0 A;  5EPR A;  2LN0 A;  4IR6 A;  5A81 A;  3GG3 A;  1ZKR A;  4HXN A;  2LSP B;  5CUG A;  5D26 A;  3JVJ A;  4XY9 A;  4CUP A;  2LGK A;  1JM7 B;  3ZYQ A;  4Z0R A;  5H1U A;  4OGE A;  5CFW A;  5IG6 A;  2CSV A;  4O7C A;  5BT4 A;  2L7P A;  3ZNI A;  3D1B A;  4QSP A;  4NS5 A;  4N4I A;  3ZYU A;  4A9O A;  2K4D A;  2YYN A;  3T9K A;  4J3I A;  4UYD A;  5CU8 A;  5AME A;  4QSW A;  5F3A A;  2LGL A;  5CUD A;  3UV5 A;  4O64 A;  4UI9 B;  3DWD A;  2YW5 A;  2RNW A;  2P57 A;  2F6N A;  3NXB A;  2DVQ A;  3L1Z B;  2MIQ A;  4HXS A;  3M99 A;  4A4C A;  4IC3 A;  2VPD A;  3HMH A;  2CRR A;  4S3O C;  5HEN A;  4QY4 A;  3RTR B;  1Z60 A;  4HBY A;  1JOC A;  3M7K A;  3KNV A;  2YQL A;  4QBM A;  4XYA A;  5CQ7 A;  2DVV A;  4QSX A;  4X2I A;  2YEM A;  2KRE A;  3GL6 A;  2I7K A;  3FL2 A;  2NXB A;  4AYC A;  5E9M A;  4L58 A;  5CQ3 A;  1F68 A;  3MQM A;  2WP2 A;  4LDF A;  5EI4 A;  3FAO A;  3SOX A;  2AN6 A;  3O35 A;  4MR3 A;  5E3G A;  2JMJ A;  1N72 A;  4AYC B;  5C7N A;  3N9O A;  2CSZ A;  2KWJ A;  2VNF A;  5DKA A;  2N9G A;  5LCW B;  5BT3 A;  5SVI A;  4IOR A;  3DPL R;  5H9M A;  3U5L A;  4UIZ A;  4WZ0 A;  3AAD A;  4XY8 A;  4NR7 A;  3RPG C;  2VJF B;  4IR5 A;  4KV1 A;  1BOR A;  5IID A;  4V3L C;  2QIZ A;  1N87 A;  5FE5 A;  2MKE A;  4BW4 A;  1WIM A;  2G4A A;  5SVX A;  5FE9 A;  3PUQ A;  1DCQ A;  1WGM A;  5FH8 A;  2EOD A;  4XUA A;  2L85 A;  2YU4 A;  2VJE A;  4NR6 A;  1VYX A;  4CA1 A;  2RNY A;  4NRA A;  2ECJ A;  5CQ5 A;  5DFD A;  2Y1N A;  5D1K B;  5E74 A;  5C8G A;  5E7D A;  2RS9 B;  1Z2Q A;  1WE9 A;  4O78 A;  2L75 A;  4KCX A;  4YBT A;  5ETB A;  5KO4 A;  5EV9 A;  2FUI A;  2RI7 A;  4LRG A;  4YY6 A;  3O34 A;  4QEU A;  1JM4 B;  4UIX A;  3ASL A;  5TCM A;  4QF2 A;  3LQJ A;  4O7F A;  5FE3 A;  3FEH A;  5G0F A;  2E6R A;  2MA6 A;  5I7X A;  3C5K A;  2G43 A;  3SHB A;  3Q2E A;  4QUU A;  2UZG A;  4CUU A;  4O71 A;  4MEO A;  4YYM A;  5LJ1 A;  1WEN A;  3P5O A;  4YYI A;  2OUO A;  1V87 A;  5L99 A;  3MB4 A;  5HQ7 A;  2OXQ C;  4NYV A;  5FE0 A;  3DAI A;  4BW3 A;  4QSR A;  2LXH C;  2RO1 A;  4XI1 A;  4O75 A;  4O72 A;  3JVM A;  4AKI A;  4QR3 A;  5CQ8 A;  5D24 A;  3UVW A;  2LDR A;  5LUU A;  3HTK C;  3SVH A;  2YQM A;  4W4U A;  3S91 A;  3K2J A;  4NR8 A;  3L11 A;  4HXP A;  2R0V A;  4PKL A;  4FIP A;  5B77 A;  1PUO A;  4TT6 A;  4TU4 A;  2YEL A;  4QYL A;  3O47 A;  3PUR A;  2MT5 A;  5BT5 A;  5SVY A;  2GRC A;  1CHC A;  4YYD A;  5FFV A;  2ECG A;  2LQ6 A;  5A5S A;  3D7C A;  4UIY A;  4FLP A;  2YEK A;  4CUQ A;  1E6I A;  2YQD A;  3HCT A;  1MM2 A;  5L97 A;  1WFK A;  2M85 A;  3LQI A;  5LJ2 A;  3U5N A;  4QZS A;  3P1F A;  5LKZ A;  3T6R A;  2KIZ A;  1FBV A;  3HMF A;  4GPJ A;  2MNY A;  2YSM A;  5CUE A;  4AI6 A;  5KTU A;  4B86 C;  5CQ6 A;  5IGL A;  5B78 A;  4GNG A;  5FG6 A;  4Z6I A;  5HQ6 A;  4YAB A;  1FP0 A;  4QSQ A;  5KHM A;  3N9L A;  4LLB A;  5EYA F;  2RSD A;  4OUF A;  5HRV A;  4LKA A;  4BJX A;  5A5N A;  2NAA A;  3LJW A;  5FDZ A;  5F1L A;  5EPS A;  3VKH A;  4MSX A;  5EU1 A;  2R10 A;  3KQI A;  1MBM A;  2DKW A;  3UVX A;  4GND A;  4UIT A;  1X4J A;  5D1M B;  3Q2F A;  2EGM A;  4H9D A;  4QYD A;  4OGI A;  3SUB A;  5KTW A;  5TAB A;  5I86 A;  4IR4 A;  4WIV A;  2MD7 B;  2KWO A;  3FM8 C;  3LXJ A;  3P1D A;  4Y03 A;  4MVT A;  5D3L A;  2YUC A;  4A9I A;  2I8N A;  2B0O E;  4UP0 A;  1JSP B;  4J0R A;  4AKG A;  3KV5 A;  5CUA A;  3UW9 A;  5FFW A;  2KR4 A;  3I3J A;  2E61 A;  5EVA A;  4Z6H A;  2LAU A;  3GV4 A;  4Q0O A;  5I29 A;  3MUL A;  3QZV A;  2JRJ A;  4YY4 A;  5ETD A;  5ENH A;  4O76 A;  3MB3 A;  5E9Y A;  4CFK A;  2CRW A;  4QEV A;  1HYJ A;  4QQ4 A;  4A9N A;  2XP0 A;  2XB1 A;  5FH7 A;  2KKX A;  2VP7 A;  4YAT A;  3JVK A;  4GNE A;  4NR4 A;  4RVR A;  3ERR A;  5CY9 A;  5G05 B;  5DW1 A;  2RFJ A;  4QC3 A;  4AKN A;  3LRQ A;  5HRX A;  2DX8 A;  4OGC A;  2K17 A;  2DAT A;  4PCI A;  2XOY A;  2XOZ A;  3ZVZ B;  5ENI A;  2C2V S;  4MEQ A;  2VPG A;  5KTX A;  4MR4 A;  5I3L A;  3M62 A;  5FER A;  2L43 A;  5D3S A;  5SVI B;  2YDW A;  5CS8 A;  3HME A;  5IGM A;  2KGG A;  1X4U A;  2BAY A;  4N4H A;  5CGP A;  5I1Q A;  2KWN A;  3EB6 A;  4QR5 A;  4I7B A;  5FEY A;  4YH3 A;  5D25 A;  4UP5 A;  4ALG A;  2KWK A;  4R2Y A;  2VPB A;  4F1P A;  1WEV A;  2VPE A;  2H60 A;  2KU3 A;  4IR3 A;  5ENJ A;  1IYM A;  2R0Y A;  5HM0 A;  2EJN A;  4N4F A;  2MA5 A;  2VJE B;  4FK5 A;  5F25 A;  3IU5 A;  5E9V A;  4ZUX U;  4ZDT A;  2D8U A;  5EP7 A;  2IQJ A;  1HYI A;  4NYW A;  4QEW A;  4F52 B;  2DVS A;  3L1X A;  2PNX A;  5IGK A;  1E4U A;  5H1T A;  2K16 A;  3AQA A;  5L98 A;  3LVQ E;  2XEU A;  4TZ8 A;  4CL9 A;  4CUS A;  5HEL A;  5TDW A;  3EB5 A;  4LJN A;  4PCE A;  2ECW A;  3DDT A;  5FB1 A;  4PPE A;  4BBQ A;  4HXR A;  4TS8 A;  4NN2 A;  5G04 B;  2KYU A;  1MM3 A;  5HRW A;  3FAN A;  5AD3 A;  3MDB C;  4FO9 A;  4BW2 A;  4LZR A;  4A9J A;  4NQM A;  4QST A;  5A5O A;  1G25 A;  4V3K C;  5DX4 A;  1WEE A;  5I89 A;  1K2F A;  4TU6 A;  4YH4 A;  2M3H A;  3NG2 A;  1Z6U A;  2DVR A;  2YSJ A;  4J1P A;  5I40 A;  3G0L A;  4QC1 A;  4O77 A;  3P1C A;  2KKY A;  4I7C A;  2L5E A;  4QSS A;  2MUM A;  5DYX A;  4ALH A;  2H0D A;  3FKM X;  5FBX A;  4CLB A;  5LVR A;  2ECN A;  5B8D A;  5F61 A;  4NQN A;  4QB3 A;  4WZ3 B;  4TKP B;  3JUE A;  5E73 A;  5CUC A;  5ACY A;  1ZS5 A;  1WES A;  2HYE D;  5D1L B;  5CUB A;  2QJ0 A;  4F3I A;  2JM3 A;  5C87 A;  5J0D A;  2LV9 A;  5F5Z A;  2F42 A;  5KU3 A;  4Q0N A;  5A5P A;  4Z1S A;  3QZS A;  5EIS A;  2OSS A;  1VFY A;  4HXK A;  5FH6 A;  1WEQ A;  3HCU A;  5CQA A;  5A83 A;  5HJC A;  3RCW A;  2LGV A;  5DKD A;  2DJA A;  3ZVY A;  2YVR A;  4FJC A;  5HQ5 A;  5FE4 A;  4HXL A;  5A5Q A;  2RNX A;  2RR4 A;  1ZBD B;  3C6W A;  2DWW A;  3RPG B;  2L80 A;  4NXJ A;  5D7X A;  5EIC A;  4Z93 A;  5ENF A;  4YYH A;  3KV6 A;  1DVP A;  5FG4 A;  1RMD A;  2YYR A;  4QR4 A;  5E3D A;  3LJU X;  4WA6 A;  5I83 A;  4PS5 A;  5TB6 A;  5KH3 A;  4A9H A;  5HFQ A;  1WEM A;  3U5O A;  4LK9 A;  1X0J A;  4NR9 A;  4UYF A;  5FFY A;  5D3N A;  4O70 A;  4QNS A;  2D82 A;  4O62 A;  4TT4 A;  5EQ1 A;  5F60 A;  2OWA A;  2E7N A;  5TDR A;  4QSU A;  2L5U A;  3UV2 A;  3IHP A;  3H7H A;  4LAD B;  5COI A;  4AVX A;  5L8U A;  2M1R A;  5AMF A;  4P5O B;  4KV4 A;  5B75 A;  5AIU A;  5ENC A;  4O7A A;  4YBS A;  4Z1Q A;  4A9L A;  4A4B A;  4GNF A;  5DYC A;  5L8T A;  5AD2 A;  2M13 A;  4ZC9 A;  3ZTG A;  4A0C D;  4PY6 A;  4A9M A;  5HFR A;  1U6G B;  5I88 A;  1WEW A;  5KH9 A;  4C67 A;  5EPB A;  1JM7 A;  3M63 A;  2M6M A;  2XOC A;  5TBN A;  2YRE A;  5DBM A;  2K1J A;  3U5M A;  2KE1 A;  4LC2 A;  4N4G A;  4CCG X;  2OO1 A;  4IOQ A;  4MEP A;  5LKX A;  5LVQ A;  5CRZ A;  5FB0 A;  3UV4 A;  2ZET C;  2LXP C;  2ECV A;  5E9I A;  5F1H A;  4HBW A;  4ZQL A;  4YBM A;  2ECI A;  4AP4 A;  4A49 A;  4J0S A;  3ZPV 1;  2CSY A;  4YAD A;  5C4Q A;  3O70 A;  4NUC A;  5DYU A;  5II2 A;  3LDY A;  5F2P A;  2ECT A; 
#chains in the Genus database with same CATH homology
 3N9Q A;  2EGP A;  4OGJ A;  5EA1 A;  4C9Z A;  1EQF A;  2QIC A;  4WZ2 A;  5JI8 A;  4YC9 A;  4UIW A;  3V43 A;  4MEN A;  5EGU A;  1T1H A;  4NR5 A;  5C11 A;  4YYN A;  2JMD A;  3MHH A;  3N9N A;  4QF3 A;  4A9K A;  5D3J A;  4O7E A;  2L84 A;  4XUB A;  2FUU A;  3T7L A;  4L7X A;  5DY7 A;  2G6Q A;  5DKH A;  4LYS A;  5A5R A;  4LR6 A;  3O7A A;  5G4R A;  1WEO A;  2C2L A;  4WHW A;  2IDA A;  2YUR A;  5DLX A;  1WUG A;  4LYI A;  1WEP A;  5C85 A;  1F62 A;  4LYW A;  1LDJ B;  2VJF A;  2E3K A;  5D3P A;  5D3R A;  5EWC A;  2D8S A;  4HXO A;  1VD4 A;  2YHO A;  4UYE A;  3SVF A;  5F36 A;  4BHW A;  3DQV R;  4UYH A;  5E9L A;  5ENE A;  4TYL A;  3MUK A;  3P1E A;  4WHU A;  3HCS A;  3SVG A;  3IU6 A;  4NRC A;  4QSV A;  3O36 A;  4YYK A;  3I2D A;  5TRB A;  5L96 A;  4B7Y C;  5A82 A;  3MXF A;  4TQN A;  5DFC A;  3U5J A;  5FE8 A;  3G0J A;  2MJV B;  4QUT A;  3MHS A;  4BW1 A;  4Q6F A;  5JWM A;  2Y1M A;  1WIL A;  5CQT A;  3UVY A;  3UVD A;  4NUD A;  2FSA A;  4MR6 A;  4R8P K;  5DFB A;  4AUQ B;  4NRB A;  4NYX A;  5F63 A;  5FE6 A;  2D9E A;  5CP5 A;  5C89 A;  5C13 A;  2F6J A;  2WP1 A;  3DWY A;  4TTE A;  5E0R A;  3SOW A;  4TZ2 A;  1WEU A;  5ENG A;  3ZPV E;  5DIN A;  5LKU A;  4S3O B;  4A9E A;  5EWH A;  1XWH A;  4CFL A;  5EM3 A;  4DON A;  5DW2 A;  5JG6 A;  2CT2 A;  3ONI A;  5D0C A;  4YYG A;  5B76 A;  5FE1 A;  5KH7 A;  4PTB A;  4HBV A;  4UIU A;  1LDK C;  3O37 A;  4O74 A;  4UIV A;  4C66 A;  2CKL A;  2H0D B;  2Y43 A;  5I7Y A;  4R7E A;  5FE7 A;  5CRM A;  1X4I A;  2E6S A;  4O7B A;  4ZW1 A;  5LJ0 A;  3JVL A;  4X3G A;  5I80 A;  3U5K A;  3QZT A;  2CKL B;  3U5P A;  2PUY A;  2EA6 A;  5HLS A;  5EWV A;  5H85 A;  4E96 A;  3LQH A;  5F62 A;  3O33 A;  5CTL A;  2YW8 A;  3SOU A;  5E9K A;  4A9F A;  5D3T A;  4IOO A;  5K29 A;  5DYA A;  5DKC A;  4NUE A;  3VK6 A;  4CUR A;  5FE2 A;  5HCL A;  4LZS A;  2KGI A;  3TLP A;  5CQ4 A;  5EK9 A;  2LRI C;  2G45 A;  2HDP A;  4GB0 A;  5LKT A;  2L0B A;  4N3W A;  3PHD A;  3N9M A;  2KTB B;  5D3H A;  4IC2 A;  5A7C A;  5B79 A;  4UYF B;  5IGN A;  2JMI A;  4MR5 A;  2R0S A;  5IBN A;  4CUT A;  4YAX A;  5A85 A;  4HXM A;  5AIT A;  5DLZ A;  2LGG A;  2YT5 A;  2E7O A;  4UYG A;  5CZG A;  5FG5 A;  5J3X A;  5II1 A;  2MNZ A;  5EWW A;  4TT2 A;  2I50 A;  3N9P A;  4LZ2 A;  1WUM A;  5G4S A;  2KFT A;  2YHN A;  5CPE A;  5EWD A;  3S92 A;  2MD8 C;  5H1V A;  5HEM A;  5ENB A;  4YYJ A;  4HBX A;  4I7D A;  4YK0 A;  5EPR A;  2LN0 A;  4IR6 A;  5A81 A;  3GG3 A;  4HXN A;  5CUG A;  2LSP B;  2LGK A;  5D26 A;  3JVJ A;  4XY9 A;  4CUP A;  1JM7 B;  3ZYQ A;  5H1U A;  5CFW A;  5IG6 A;  4O7C A;  5BT4 A;  3ZNI A;  4QSP A;  4NS5 A;  4N4I A;  3ZYU A;  4A9O A;  2K4D A;  2YYN A;  4J3I A;  4UYD A;  5CU8 A;  5AME A;  4QSW A;  5F3A A;  2LGL A;  5CUD A;  3UV5 A;  4O64 A;  4UI9 B;  2YW5 A;  2RNW A;  2F6N A;  3NXB A;  2DVQ A;  3L1Z B;  2MIQ A;  4HXS A;  3M99 A;  4A4C A;  4IC3 A;  2VPD A;  3HMH A;  4S3O C;  5HEN A;  4QY4 A;  3RTR B;  1Z60 A;  4HBY A;  1JOC A;  3KNV A;  2YQL A;  4QBM A;  4XYA A;  5CQ7 A;  2DVV A;  4QSX A;  4X2I A;  2YEM A;  2KRE A;  3GL6 A;  2I7K A;  3FL2 A;  2NXB A;  4AYC A;  5E9M A;  4L58 A;  5CQ3 A;  1F68 A;  3MQM A;  2WP2 A;  4LDF A;  5EI4 A;  3SOX A;  2AN6 A;  3O35 A;  4MR3 A;  5E3G A;  2JMJ A;  1N72 A;  4AYC B;  5C7N A;  3N9O A;  2CSZ A;  2KWJ A;  2VNF A;  5DKA A;  2N9G A;  5LCW B;  5BT3 A;  4IOR A;  3DPL R;  5H9M A;  3U5L A;  4UIZ A;  4WZ0 A;  3AAD A;  4XY8 A;  4NR7 A;  3RPG C;  2VJF B;  4IR5 A;  4KV1 A;  1BOR A;  5IID A;  4V3L C;  2QIZ A;  1N87 A;  5FE5 A;  4BW4 A;  1WIM A;  2G4A A;  5FE9 A;  3PUQ A;  2EOD A;  1WGM A;  5FH8 A;  4XUA A;  2L85 A;  2YU4 A;  2VJE A;  4NR6 A;  1VYX A;  4CA1 A;  2RNY A;  4NRA A;  2ECJ A;  5CQ5 A;  5DFD A;  2Y1N A;  5D1K B;  5E74 A;  5C8G A;  5E7D A;  2RS9 B;  1Z2Q A;  1WE9 A;  4O78 A;  2L75 A;  4KCX A;  4YBT A;  5ETB A;  5KO4 A;  5EV9 A;  2FUI A;  2RI7 A;  4LRG A;  4YY6 A;  3O34 A;  4QEU A;  1JM4 B;  4UIX A;  3ASL A;  5TCM A;  4QF2 A;  3LQJ A;  4O7F A;  5FE3 A;  5G0F A;  2E6R A;  2MA6 A;  5I7X A;  3C5K A;  2G43 A;  3SHB A;  3Q2E A;  4QUU A;  2UZG A;  4CUU A;  4O71 A;  4MEO A;  4YYM A;  5LJ1 A;  1WEN A;  3P5O A;  4YYI A;  2OUO A;  1V87 A;  5L99 A;  3MB4 A;  5HQ7 A;  2OXQ C;  4NYV A;  5FE0 A;  3DAI A;  4BW3 A;  4QSR A;  2LXH C;  2RO1 A;  4XI1 A;  4O75 A;  4O72 A;  3JVM A;  4QR3 A;  5CQ8 A;  5D24 A;  3UVW A;  2LDR A;  5LUU A;  3HTK C;  3SVH A;  2YQM A;  4W4U A;  3S91 A;  3K2J A;  4NR8 A;  3L11 A;  4HXP A;  2R0V A;  4PKL A;  4FIP A;  5B77 A;  4TT6 A;  4TU4 A;  2YEL A;  4QYL A;  3PUR A;  2MT5 A;  5BT5 A;  2GRC A;  1CHC A;  4YYD A;  5FFV A;  2ECG A;  2LQ6 A;  5A5S A;  3D7C A;  4UIY A;  4FLP A;  2YEK A;  4CUQ A;  1E6I A;  2YQD A;  3HCT A;  1MM2 A;  5L97 A;  1WFK A;  2M85 A;  3LQI A;  5LJ2 A;  3U5N A;  4QZS A;  3P1F A;  5LKZ A;  3T6R A;  2KIZ A;  1FBV A;  3HMF A;  4GPJ A;  2MNY A;  2YSM A;  5CUE A;  5KTU A;  4B86 C;  5CQ6 A;  5IGL A;  5B78 A;  4GNG A;  5FG6 A;  4Z6I A;  5HQ6 A;  4YAB A;  1FP0 A;  4QSQ A;  5KHM A;  3N9L A;  4LLB A;  5EYA F;  2RSD A;  4OUF A;  5HRV A;  4LKA A;  4BJX A;  5A5N A;  2NAA A;  3LJW A;  5FDZ A;  5F1L A;  5EPS A;  4MSX A;  5EU1 A;  2R10 A;  3KQI A;  2DKW A;  3UVX A;  4GND A;  4UIT A;  1X4J A;  5D1M B;  3Q2F A;  4QYD A;  4OGI A;  5KTW A;  5TAB A;  5I86 A;  4IR4 A;  4WIV A;  2MD7 B;  2KWO A;  3LXJ A;  3P1D A;  4Y03 A;  4MVT A;  5D3L A;  2YUC A;  4A9I A;  2I8N A;  4UP0 A;  1JSP B;  4J0R A;  3KV5 A;  5CUA A;  3UW9 A;  5FFW A;  2KR4 A;  3I3J A;  5EVA A;  4Z6H A;  3GV4 A;  4Q0O A;  5I29 A;  3MUL A;  3QZV A;  2JRJ A;  4YY4 A;  5ETD A;  5ENH A;  4O76 A;  3MB3 A;  5E9Y A;  4CFK A;  4QEV A;  1HYJ A;  4A9N A;  2XB1 A;  5FH7 A;  2VP7 A;  4YAT A;  3JVK A;  4GNE A;  4NR4 A;  4RVR A;  5CY9 A;  5G05 B;  5DW1 A;  2RFJ A;  4QC3 A;  4AKN A;  3LRQ A;  5HRX A;  2DX8 A;  2K17 A;  2DAT A;  4PCI A;  3ZVZ B;  5ENI A;  2C2V S;  4MEQ A;  2VPG A;  5KTX A;  4MR4 A;  5I3L A;  3M62 A;  5FER A;  2L43 A;  5D3S A;  2YDW A;  5CS8 A;  3HME A;  5IGM A;  2KGG A;  1X4U A;  2BAY A;  4N4H A;  5CGP A;  5I1Q A;  2KWN A;  3EB6 A;  4QR5 A;  4I7B A;  5FEY A;  4YH3 A;  5D25 A;  4UP5 A;  4ALG A;  2KWK A;  4R2Y A;  2VPB A;  1WEV A;  2VPE A;  2H60 A;  2KU3 A;  4IR3 A;  5ENJ A;  1IYM A;  2R0Y A;  5HM0 A;  2MA5 A;  4N4F A;  2VJE B;  4FK5 A;  5F25 A;  3IU5 A;  5E9V A;  4ZUX U;  4ZDT A;  5EP7 A;  1HYI A;  4NYW A;  4QEW A;  4F52 B;  2DVS A;  3L1X A;  2PNX A;  5IGK A;  1E4U A;  5H1T A;  2K16 A;  3AQA A;  5L98 A;  2XEU A;  4TZ8 A;  4CL9 A;  4CUS A;  5HEL A;  5TDW A;  3EB5 A;  4LJN A;  4PCE A;  2ECW A;  5FB1 A;  4PPE A;  4BBQ A;  4HXR A;  4TS8 A;  4NN2 A;  5G04 B;  2KYU A;  1MM3 A;  5HRW A;  5AD3 A;  4FO9 A;  4BW2 A;  4LZR A;  4A9J A;  4NQM A;  4QST A;  5A5O A;  1G25 A;  4V3K C;  5DX4 A;  1WEE A;  5I89 A;  1K2F A;  4TU6 A;  4YH4 A;  2M3H A;  3NG2 A;  1Z6U A;  2DVR A;  2YSJ A;  4J1P A;  5I40 A;  3G0L A;  4QC1 A;  4O77 A;  3P1C A;  4I7C A;  2L5E A;  4QSS A;  2MUM A;  5DYX A;  4ALH A;  2H0D A;  3FKM X;  5FBX A;  4CLB A;  5LVR A;  2ECN A;  5B8D A;  5F61 A;  4NQN A;  4QB3 A;  4WZ3 B;  4TKP B;  5D1L B;  5E73 A;  5CUC A;  5ACY A;  1ZS5 A;  1WES A;  2HYE D;  5CUB A;  2QJ0 A;  4F3I A;  5C87 A;  5J0D A;  2LV9 A;  5F5Z A;  2F42 A;  5KU3 A;  4Q0N A;  5A5P A;  4Z1S A;  3QZS A;  5EIS A;  2OSS A;  1VFY A;  4HXK A;  5FH6 A;  1WEQ A;  3HCU A;  5CQA A;  5A83 A;  5HJC A;  3RCW A;  2LGV A;  5DKD A;  3ZVY A;  4FJC A;  5HQ5 A;  5FE4 A;  4HXL A;  5A5Q A;  2RNX A;  3C6W A;  1ZBD B;  2DWW A;  3RPG B;  2L80 A;  4NXJ A;  5D7X A;  5EIC A;  4Z93 A;  5ENF A;  4YYH A;  3KV6 A;  1DVP A;  5FG4 A;  1RMD A;  2YYR A;  4QR4 A;  5E3D A;  4WA6 A;  4AP4 A;  5I83 A;  4PS5 A;  5TB6 A;  5KH3 A;  4A9H A;  5HFQ A;  1WEM A;  3U5O A;  4LK9 A;  1X0J A;  4NR9 A;  4UYF A;  5FFY A;  5D3N A;  4O70 A;  4QNS A;  2D82 A;  4TT4 A;  5EQ1 A;  5F60 A;  2E7N A;  5TDR A;  4QSU A;  2L5U A;  3UV2 A;  3IHP A;  4LAD B;  5COI A;  4AVX A;  5L8U A;  2M1R A;  5AMF A;  4P5O B;  4KV4 A;  5B75 A;  5AIU A;  5ENC A;  4O7A A;  4YBS A;  4Z1Q A;  4A9L A;  4A4B A;  4GNF A;  5DYC A;  5L8T A;  5AD2 A;  4ZC9 A;  3ZTG A;  4A0C D;  4PY6 A;  4A9M A;  5HFR A;  1U6G B;  5I88 A;  1WEW A;  5KH9 A;  4C67 A;  5EPB A;  1JM7 A;  3M63 A;  2M6M A;  5TBN A;  2YRE A;  5DBM A;  2K1J A;  3U5M A;  2KE1 A;  4LC2 A;  4N4G A;  4CCG X;  2OO1 A;  4IOQ A;  4MEP A;  5LKX A;  5LVQ A;  5CRZ A;  5FB0 A;  3UV4 A;  2ZET C;  2LXP C;  2ECV A;  5E9I A;  5F1H A;  4HBW A;  4ZQL A;  4YBM A;  2ECI A;  4A49 A;  4J0S A;  3ZPV 1;  2CSY A;  4YAD A;  5C4Q A;  3O70 A;  4NUC A;  5DYU A;  5II2 A;  5F2P A;  2ECT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...