3U5OA

Crystal structure of the complex of trim33 phd-bromo and h3(1-22)k9me3k14ack18ac histone peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
189
Chain Sequence
b'DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 54
structure length 189
sequence length 205
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5oA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5oA01
3SHBA 1HYJA 3P1CA 4A49A 4NRBA 5CZGA 2E6RA 2LV9A 4LJNA 2R0SA 5DFCA 4QR3A 4TT6A 5J0DA 5EPBA 2YSMA 5A5OA 5ACYA 4NN2A 4QSWA 5F1LA 5EI4A 2ECGA 4QF3A 3AADA 3Q2EA 4AUQB 3G0LA 4X3GA 5D26A 4QC3A 3UW9A 4Y03A 5FH7A 5TB6A 5I7YA 4LC2A 5TDWA 4QY4A 4CURA 3RPGC 2JMIA 5TCMA 2I50A 4YYKA 2KR4A 3QZSA 2MT5A 5HJCA 1X0JA 1K2FA 2KWJA 5CUCA 4GNEA 5DYAA 3HCUA 2N9GA 4FLPA 1WGMA 5ETDA 3U5KA 5CQ5A 4HXOA 4Q0NA 3U5OA 4YYDA 5F2PA 4Z6IA 5DKAA 4UIZA 2MJVB 4GNGA 4HXRA 4HXNA 5D3TA 2F42A 2LGLA 3ZNIA 4O7EA 5F36A 4R2YA 5EPSA 5HCLA 4ZQLA 2KWOA 3LQJA 5KH9A 4MEQA 4HXSA 3LRQA 4YATA 1X4JA 3JVJA 2GRCA 4NR6A 5I89A 4F3IA 4Z93A 4QR5A 4C67A 1BORA 2EGPA 2UZGA 4TKPB 4PY6A 5E73A 4UIYA 4Z1QA 4B86C 5G05B 4YBTA 3FL2A 5AIUA 4CFKA 4LYSA 4QC1A 2EODA 2Y1MA 4TU6A 3O33A 4QR4A 4QZSA 1WEWA 4V3KC 4QSQA 4W4UA 2VJEB 2QJ0A 5DYCA 2E3KA 5G4SA 3IU6A 3QZTA 4LADB 4LDFA 2KREA 3PUQA 3MB3A 1WEOA 3NXBA 4A9OA 2EA6A 3Q2FA 4BW2A 5FH6A 2YUCA 3I2DA 4L7XA 4O74A 4NUCA 4NYWA 3C5KA 2D9EA 2CSZA 2HYED 5CQ4A 2VPEA 1JM4B 2FUIA 2R0YA 2ZETC 2LXPC 3GL6A 3LJWA 5EU1A 2KU3A 2DWWA 2KTBB 1N72A 5IBNA 4S3OB 4NUEA 1XWHA 4QEUA 4O7AA 5HFRA 5D3JA 4FJCA 3UVYA 2L43A 5CQ7A 5B78A 5ENJA 2CKLA 4Z1SA 4XUBA 4N4FA 5CUBA 4YYJA 4LRGA 4IR5A 5D3LA 1WEVA 1E6IA 2KGGA 2MUMA 2RFJA 1U6GB 4Q0OA 2YURA 2I8NA 5JI8A 4HXPA 2YW5A 3U5LA 4MSXA 5AMEA 4PTBA 4Z6HA 4QF2A 5DYUA 5EICA 5DY7A 5EV9A 5I3LA 1WEUA 5HQ5A 5LCWB 2VPGA 4PCEA 3P1DA 2Y43A 5B76A 4HBYA 3G0JA 4BBQA 4NR9A 3O34A 4OGJA 5A81A 5B79A 4NYXA 2ECJA 1X4UA 5DFDA 4B7YC 3S92A 5I40A 2Y1NA 4A9HA 4I7DA 2FSAA 1WILA 2M6MA 2PUYA 3SOWA 5AD3A 4RVRA 5EA1A 2ECVA 2D82A 5C87A 2K4DA 1ZBDB 2JMJA 3EB6A 5EWVA 5HLSA 5HRWA 3SOUA 5EQ1A 1JSPB 4OUFA 5CUEA 4MEOA 4QSSA 5E3GA 5F3AA 3C6WA 3LQHA 4TYLA 4LKAA 2IDAA 4YYGA 5ENGA 2YHOA 4E96A 2KE1A 2RNWA 5KTUA 3KV5A 3N9PA 2VP7A 2LN0A 4IR3A 4YADA 3IU5A 2LSPB 5KTXA 5C85A 5CQ3A 5EWCA 2JMDA 4FIPA 3HCSA 3M99A 5E9YA 2ECWA 5ETBA 4J1PA 5IGLA 4TZ8A 1WEEA 2H0DB 5LKXA 4NR4A 4QB3A 5II1A 5E7DA 4CL9A 1LDJB 3SOXA 2C2LA 3P1FA 3P5OA 2G6QA 2QICA 2YREA 4TQNA 3U5PA 4YBSA 5CQAA 5BT5A 2G43A 4IOQA 3ASLA 5EWHA 5CU8A 4HBXA 3ZPV1 4XUAA 2L0BA 5E0RA 2LDRA 4QUUA 3JVKA 4IORA 5FE0A 4MVTA 4GB0A 2CKLB 5FH8A 4QUTA 5E74A 4HXKA 2YYRA 2L5UA 5HRVA 4YY6A 4A9IA 3O35A 5D7XA 5L8TA 4F52B 5KH3A 4LYIA 3PURA 5FE3A 5F25A 5EPRA 5IGMA 5D3RA 2VPBA 5G04B 4YYHA 5IG6A 1Z60A 5LJ0A 5KU3A 1WEQA 3HMHA 5FDZA 3SVFA 4PCIA 1E4UA 2YELA 2ECNA 3N9MA 5EGUA 1WEMA 3JVMA 4O7FA 4ZC9A 5F62A 5EP7A 5I29A 2F6JA 4YC9A 5B77A 5ENBA 4CUPA 4TTEA 4CFLA 2KFTA 2NAAA 5EISA 5H1VA 4TT2A 4UIWA 4DONA 2M85A 2KIZA 3T7LA 5ENFA 2I7KA 3AQAA 3UVWA 2YHNA 3MQMA 2RO1A 5E9VA 5F60A 3SVGA 5LKTA 5I88A 4A4CA 4LZRA 4TU4A 3VK6A 3ZPVE 4HXMA 4NS5A 4WIVA 5B8DA 4BJXA 4TT4A 5I1QA 4UIXA 4NRCA 2PNXA 5A5SA 4S3OC 4ZW1A 4A9NA 5CQ8A 2K17A 4UYEA 5FE4A 4A9FA 3ZYQA 2RS9B 2H0DA 5DKCA 3RTRB 5DBMA 5F61A 4YYMA 5FEYA 1WENA 4UITA 2YDWA 4QSRA 4LK9A 4WA6A 1JM7B 1F62A 5CUGA 5CP5A 2YQLA 4BW4A 4NR8A 4XYAA 2QIZA 4C9ZA 4I7CA 4NYVA 4MR4A 5HEMA 3L1XA 5EK9A 4MR3A 4GNDA 5CUDA 1WUGA 5FG6A 5IGKA 1FP0A 5CS8A 4WHUA 5F5ZA 4NQMA 5DYXA 4OGIA 5FE6A 4NXJA 4BW1A 3HCTA 3MB4A 2H60A 5HRXA 4LYWA 5FG4A 1F68A 2WP1A 4QSTA 4UYFA 3N9NA 1VFYA 5L96A 4A9EA 4A9MA 4O78A 2ECTA 5DKHA 2OUOA 3SVHA 4QSPA 1Z2QA 5IIDA 4QYDA 2K1JA 5TDRA 5BT4A 4IOOA 5D3HA 2VJFA 3HTKC 5EVAA 5F1HA 4O64A 4QSVA 3O7AA 2MA5A 5CRZA 4CA1A 3U5NA 4NR7A 5E3DA 5CPEA 3MHSA 4R8PK 4TZ2A 5C89A 5ENCA 2LRIC 5DKDA 4LZSA 5HM0A 5KTWA 3GV4A 5D1LB 5FE8A 1ZS5A 1MM2A 1WIMA 3RCWA 4QBMA 3UVDA 2LQ6A 5IGNA 5HELA 4N3WA 1MM3A 5D3NA 2RSDA 5A83A 4GNFA 5L97A 4IR6A 2YQDA 3JVLA 5HQ7A 3N9LA 3ONIA 4TS8A 5I80A 4UYDA 5CGPA 5TBNA 4IC3A 4N4GA 2YEKA 2DVQA 5HQ6A 4A0CD 5DX4A 5AD2A 2CT2A 5ENIA 5B75A 3ZYUA 2KWNA 2YU4A 2YEMA 4WZ2A 2MIQA 1X4IA 3N9QA 1JM7A 4WZ0A 1WESA 5CQTA 4ALGA 4J0SA 2DVSA 2K16A 5LVQA 3U5JA 5H9MA 5E9LA 3L1ZB 1WFKA 5JG6A 5CUAA 5E9MA 4WZ3B 3I3JA 2YT5A 5FE1A 3KNVA 5L98A 3LQIA 1CHCA 4QSUA 5C13A 1JOCA 5E9KA 1VYXA 1LDKC 3KQIA 3O37A 3MULA 4YYIA 1V87A 5FBXA 3D7CA 5KHMA 2MA6A 4UP0A 4CCGX 4J0RA 4YBMA 5I7XA 5KH7A 3HMEA 4L58A 4J3IA 5D1MB 5LVRA 4NUDA 5COIA 2OSSA 4UYFB 4LZ2A 2NXBA 5II2A 2DATA 4YH4A 1VD4A 4YK0A 4YYNA 4ALHA 2VNFA 5D3SA 2E7NA 2L80A 2MD7B 5TABA 3UV2A 3T6RA 5C7NA 5D1KB 4HXLA 1RMDA 5H1TA 5CQ6A 2KWKA 3UV4A 4CUTA 1FBVA 3DPLR 2FUUA 2VJFB 2E7OA 4O7BA 2L84A 3U5MA 4AYCA 3LXJA 2YSJA 3PHDA 2MD8C 3GG3A 5J3XA 2RNXA 3L11A 5C8GA 4GPJA 4YY4A 2YYNA 4QNSA 5A5PA 2RI7A 3V43A 2C2VS 1IYMA 4O70A 4CLBA 3ZVYA 4XI1A 4O7CA 3RPGB 4AP4A 3M63A 3P1EA 5CY9A 3DAIA 2LGVA 4FK5A 3NG2A 4O77A 5CFWA 5H85A 2XEUA 3TLPA 4CUSA 4UYHA 4A9LA 5A5QA 1DVPA 4I7BA 3M62A 2F6NA 2LGKA 5HFQA 4MENA 4QEVA 4YABA 4WHWA 5AITA 1HYIA 2M3HA 5A5NA 5EYAF 5EWDA 2VPDA 4X2IA 1Z6UA 3MHHA 2D8SA 5E9IA 1G25A 5FB1A 5D0CA 4UIUA 2RNYA 4MR6A 5A82A 5H1UA 3ZVZB 3K2JA 4O71A 2DVRA 5G0FA 5TRBA 3KV6A 4QYLA 5F63A 5FG5A 1WUMA 2MNZA 4P5OB 4V3LC 4IR4A 4NRAA 4N4HA 4QEWA 4QSXA 1EQFA 1WE9A 4IC2A 2R10A 4UI9B 3O36A 4UIVA 5EWWA 4MEPA 4BHWA 5DLZA 3EB5A 5FB0A 5D3PA 5DINA 3MXFA 3DWYA 5KO4A 5FFWA 5FERA 4ZDTA 5LJ2A 1T1HA 3ZTGA 5HENA 5A7CA 5C11A 3DQVR 2YW8A 5A85A 4PPEA 5FE5A 4LR6A 4AYCB 3HMFA 5FFVA 5A5RA 4HBVA 4NQNA 4PS5A 5ENEA 3FKMX 5L8UA 2L75A 5CRMA 2MNYA 5FE2A 4PKLA 4KV1A 4AVXA 2DKWA 2HDPA 4MR5A 4XY8A 1N87A 5LUUA 2G4AA 5D24A 2LGGA 4N4IA 4O76A 5JWMA 4UP5A 4YAXA 2OO1A 4Q6FA 2OXQC 4AKNA 3UV5A 4A9JA 4A9KA 4FO9A 5L99A 5LKUA 4HBWA 3IHPA 5EM3A 4XY9A 5ENHA 5CTLA 2DX8A 3MUKA 3QZVA 4YH3A 4C66A 5I83A 2G45A 2L5EA 5DFBA 4CUUA 5DW2A 2KGIA 5FE9A 4NR5A 4CUQA 4KCXA 3S91A 5LKZA 3UVXA 4LLBA 2BAYA 4A4BA 4KV4A 4BW3A 5FE7A 2WP2A 1WEPA 5C4QA 2CSYA 2M1RA 2VJEA 5FFYA 5LJ1A 3O70A 5DLXA 2ECIA 2JRJA 2LXHC 4R7EA 4ZUXU 2YQMA 5D25A 5I86A 2XB1A 3N9OA 2L85A 5K29A 2DVVA 5DW1A 2E6SA 4UYGA 2R0VA 5G4RA 5BT3A 2AN6A 2KYUA 4O72A 4O75A 5AMFA
chains in the Genus database with same CATH superfamily
3SHBA 1HYJA 3P1CA 3MDBC 4A49A 4NRBA 5CZGA 3D1BA 2E6RA 2LV9A 2R0SA 5DFCA 4QR3A 4TT6A 5J0DA 3E2DA 5EPBA 2YSMA 4LJNA 5A5OA 5ACYA 4NN2A 4QSWA 5F1LA 5EI4A 4OGEA 2ECGA 2P57A 4QF3A 3AADA 3Q2EA 4AUQB 3G0LA 4X3GA 5D26A 4QC3A 3UW9A 4Y03A 5FH7A 5TB6A 2YVRA 5I7YA 4LC2A 5TDWA 4QY4A 4CURA 3RPGC 2JMIA 5TCMA 2CRWA 4YYKA 2I50A 3QZSA 2KR4A 2MT5A 5HJCA 1X0JA 1K2FA 2KWJA 5CUCA 4GNEA 5DYAA 3HCUA 2N9GA 4FLPA 1WGMA 5ETDA 2OWAA 2XP0A 3U5KA 5CQ5A 4HXOA 4Q0NA 3U5OA 3FANA 4YYDA 4AKGA 5F2PA 4Z6IA 5DKAA 4UIZA 2MJVB 4GNGA 4HXRA 4HXNA 5D3TA 2F42A 2LGLA 4AKHA 4O7EA 3ZNIA 5F36A 4R2YA 5EPSA 5HCLA 4ZQLA 2KWOA 3LQJA 5KH9A 4MEQA 4HXSA 3LRQA 4YATA 1X4JA 3JVJA 2GRCA 4NR6A 5I89A 4F3IA 4Z93A 4QR5A 4C67A 1BORA 2EGPA 2IQJA 2UZGA 4TKPB 4PY6A 5E73A 4UIYA 4Z1QA 4B86C 5SVXA 5G05B 4YBTA 3FL2A 3FJUB 5AIUA 4CFKA 4LYSA 4QC1A 2EODA 2Y1MA 4TU6A 3O33A 4QR4A 4QZSA 1WEWA 4V3KC 4QSQA 4W4UA 2VJEB 2QJ0A 5DYCA 2E3KA 5G4SA 3IU6A 4H9DA 3QZTA 4LADB 4LDFA 2KREA 3PUQA 1PUOA 3MB3A 1WEOA 3NXBA 4A9OA 2EA6A 3Q2FA 4BW2A 5FH6A 2YUCA 3I2DA 2EJNA 4O74A 4L7XA 4NUCA 4NYWA 3C5KA 2D9EA 2CSZA 2HYED 3DWDA 5CQ4A 3M7KA 2VPEA 1JM4B 2FUIA 2R0YA 2ZETC 2LXPC 3GL6A 3LJWA 5EU1A 2KU3A 2DWWA 2KTBB 1N72A 5IBNA 4S3OB 4NUEA 1XWHA 4QEUA 4O7AA 5HFRA 5D3JA 4FJCA 3UVYA 2L43A 5CQ7A 5B78A 3KDEC 5ENJA 2CKLA 4Z1SA 3T9KA 4XUBA 4N4FA 5CUBA 4YYJA 4LRGA 4IR5A 2XOCA 5D3LA 1WEVA 1E6IA 2KGGA 2MUMA 2RFJA 1U6GB 4Q0OA 2YURA 2I8NA 5JI8A 4HXPA 2YW5A 3U5LA 2CSVA 4MSXA 5AMEA 4PTBA 4Z6HA 4QF2A 5DYUA 5EICA 5DY7A 5EV9A 5I3LA 1WEUA 5HQ5A 3D1DA 5LCWB 2VPGA 4PCEA 3P1DA 2Y43A 5B76A 4HBYA 3G0JA 4BBQA 3FEHA 4NR9A 3O34A 4OGJA 5A81A 5B79A 4NYXA 2ECJA 1X4UA 4CCGX 5DFDA 4B7YC 3S92A 5I40A 2L7PA 4A9HA 2Y1NA 4I7DA 2FSAA 1WILA 2M6MA 2PUYA 3SOWA 5AD3A 4RVRA 5EA1A 2ECVA 2D82A 3LJUX 5C87A 2K4DA 1ZBDB 2JMJA 3EB6A 3LVRE 5EWVA 5HLSA 5HRWA 3SOUA 5EQ1A 1JSPB 4OUFA 5CUEA 4MEOA 4QSSA 5E3GA 5F3AA 3C6WA 3LQHA 2KKXA 4TYLA 4LKAA 2IDAA 4YYGA 5ENGA 2YHOA 4E96A 2KE1A 2RNWA 5KTUA 3KV5A 3N9PA 2VP7A 2LN0A 4IR3A 4YADA 3IU5A 2LSPB 5KTXA 5C85A 5CQ3A 5EWCA 2JMDA 4FIPA 3HCSA 3M99A 5E9YA 2ECWA 5ETBA 2FD4A 4J1PA 5IGLA 4TZ8A 1WEEA 2H0DB 5LKXA 2XOYA 4NR4A 4QB3A 5II1A 5E7DA 4CL9A 1LDJB 3SOXA 2C2LA 3P1FA 3P5OA 2G6QA 2MKEA 2QICA 2YREA 4TQNA 3U5PA 3VKGA 4YBSA 5CQAA 5BT5A 2G43A 4IOQA 3ASLA 5EWHA 5CU8A 4HBXA 3ZPV1 4XUAA 2L0BA 5E0RA 2LDRA 4QUUA 3JVKA 4IORA 5FE0A 4OGCA 4MVTA 4GB0A 2CKLB 5FH8A 4QUTA 5E74A 4HXKA 2YYRA 2L5UA 5HRVA 4YY6A 4A9IA 3O35A 5D7XA 5L8TA 3Q1DA 4F52B 5KH3A 4LYIA 3PURA 5FE3A 5F25A 5EPRA 5IGMA 5D3RA 2VPBA 5G04B 4YYHA 5IG6A 1Z60A 5LJ0A 5KU3A 1WEQA 3HMHA 5FDZA 3SVFA 4PCIA 1E4UA 2YELA 2KKYA 2ECNA 3N9MA 5EGUA 1WEMA 3JVMA 4O7FA 2E61A 4ZC9A 5F62A 5EP7A 5I29A 2F6JA 4YC9A 5B77A 5ENBA 4CUPA 4TTEA 4CFLA 2KFTA 2NAAA 5EISA 5H1VA 2CONA 4TT2A 4F1PA 4UIWA 4DONA 2M85A 2KIZA 2LAUA 5ENFA 3T7LA 2I7KA 3AQAA 3UVWA 2M13A 2YHNA 3MQMA 2RO1A 5E9VA 5F60A 3SVGA 5LKTA 5I88A 4A4CA 4LZRA 4TU4A 3VK6A 3ZPVE 4HXMA 4NS5A 4WIVA 5B8DA 4BJXA 4TT4A 5I1QA 4UIXA 4NRCA 2PNXA 5A5SA 4S3OC 4ZW1A 4A9NA 5CQ8A 1MBMA 4UYEA 2K17A 5FE4A 4A9FA 3ZYQA 2RS9B 2CRRA 5DKCA 2H0DA 5DBMA 3RTRB 5F61A 4YYMA 5FEYA 1WENA 4UITA 2YDWA 4QSRA 4LK9A 4WA6A 1JM7B 1F62A 5CUGA 5CP5A 2YQLA 4BW4A 4NR8A 4XYAA 2QIZA 4C9ZA 4I7CA 4NYVA 4MR4A 5HEMA 5SVIB 3L1XA 5EK9A 4MR3A 4GNDA 5CUDA 1WUGA 5FG6A 5IGKA 1FP0A 5CS8A 4WHUA 5F5ZA 4NQMA 5DYXA 4OGIA 5FE6A 4NXJA 4BW1A 3HCTA 3MB4A 2H60A 5HRXA 4LYWA 5FG4A 1F68A 2WP1A 4QSTA 4UYFA 3N9NA 1VFYA 5L96A 4A9EA 4A9MA 4O78A 2ECTA 5DKHA 3LVQE 2OUOA 3SVHA 4QSPA 2RR4A 1Z2QA 5IIDA 4QYDA 2K1JA 5TDRA 5BT4A 4IOOA 5D3HA 2VJFA 3HTKC 5EVAA 5F1HA 4O64A 4QSVA 3O7AA 2MA5A 4Z0RA 5CRZA 4CA1A 3U5NA 4NR7A 5E3DA 5CPEA 3MHSA 4O62A 4R8PK 4TZ2A 5C89A 5ENCA 2EGMA 2LRIC 5DKDA 4LZSA 5HM0A 5KTWA 3GV4A 5D1LB 5FE8A 1ZS5A 1MM2A 1WIMA 3RCWA 4QBMA 3UVDA 2LQ6A 5IGNA 5HELA 4N3WA 1MM3A 5D3NA 2RSDA 5A83A 4GNFA 5L97A 4IR6A 2YQDA 2JM3A 3JVLA 5HQ7A 3N9LA 5SVYA 3ONIA 4TS8A 5I80A 4UYDA 2B0OE 5CGPA 5TBNA 2D8UA 4IC3A 4N4GA 2YEKA 2DVQA 5HQ6A 4A0CD 5DX4A 5AD2A 2CT2A 5ENIA 5B75A 3ZYUA 2KWNA 2YU4A 2YEMA 4WZ2A 2MIQA 1X4IA 3N9QA 1JM7A 4WZ0A 1WESA 5CQTA 4ALGA 4J0SA 2DVSA 2K16A 5SVIA 5LVQA 3U5JA 5H9MA 5E9LA 3L1ZB 3FAOA 3DDTA 1WFKA 5JG6A 5CUAA 5E9MA 4WZ3B 3I3JA 2YT5A 5FE1A 2EXUA 3PLWA 3KNVA 5L98A 3LQIA 1CHCA 4QSUA 5C13A 2FFWA 1JOCA 5E9KA 2DSMA 1VYXA 1LDKC 3KQIA 3O37A 3MULA 4YYIA 1V87A 5FBXA 3D7CA 5KHMA 2MA6A 4UP0A 5K3QA 4J0RA 4YBMA 5I7XA 5KH7A 3HMEA 4L58A 4J3IA 5D1MB 2JUNA 5LVRA 4NUDA 5COIA 2OSSA 4UYFB 4LZ2A 2NXBA 5II2A 2DATA 4YH4A 1VD4A 4YK0A 4YYNA 4ALHA 2VNFA 5D3SA 2E7NA 2L80A 2MD7B 5TABA 3UV2A 3T6RA 5C7NA 3JUEA 5D1KB 4HXLA 1RMDA 5H1TA 5CQ6A 2KWKA 3UV4A 4CUTA 1FBVA 3DPLR 2FUUA 3SUBA 2VJFB 2E7OA 4O7BA 2L84A 3U5MA 2XOZA 3LXJA 2YSJA 3PHDA 4AYCA 2MD8C 3GG3A 5J3XA 2RNXA 3L11A 5C8GA 4GPJA 4YY4A 2YYNA 4QNSA 5A5PA 2RI7A 3V43A 2C2VS 1IYMA 4O70A 4CLBA 3ZVYA 4XI1A 4O7CA 3RPGB 4QQ4A 3M63A 4AP4A 3P1EA 5CY9A 3DAIA 2LGVA 4FK5A 3NG2A 4O77A 5CFWA 5H85A 2XEUA 3TLPA 4CUSA 3FM8C 4UYHA 4A9LA 5A5QA 1DVPA 4I7BA 3M62A 2F6NA 2LGKA 5HFQA 4MENA 4QEVA 3LDYA 4YABA 4WHWA 5AITA 1HYIA 2M3HA 5A5NA 5EYAF 5EWDA 2VPDA 3H7HA 4X2IA 1Z6UA 3MHHA 2D8SA 5E9IA 2DJAA 1G25A 5FB1A 5D0CA 4UIUA 2RNYA 4MR6A 5A82A 5H1UA 3ZVZB 3ERRA 3K2JA 4O71A 2DVRA 5G0FA 5TRBA 3KV6A 4QYLA 5F63A 5FG5A 1WUMA 2MNZA 3O47A 4P5OB 4V3LC 4IR4A 4NRAA 4N4HA 4QEWA 4QSXA 1EQFA 1WE9A 4IC2A 2R10A 4UI9B 3O36A 4UIVA 5EWWA 4MEPA 4BHWA 5DLZA 3EB5A 5FB0A 5D3PA 5DINA 3MXFA 3DWYA 5KO4A 5FFWA 5FERA 4ZDTA 5LJ2A 1T1HA 3ZTGA 5HENA 5A7CA 5C11A 3DQVR 2YW8A 5A85A 4PPEA 5FE5A 4LR6A 4AYCB 3HMFA 5FFVA 5A5RA 4HBVA 4NQNA 4PS5A 5ENEA 3FKMX 5L8UA 2L75A 5CRMA 2MNYA 5FE2A 4PKLA 4KV1A 4AVXA 2DKWA 2HDPA 4MR5A 4XY8A 1N87A 5LUUA 2G4AA 5D24A 2LGGA 4N4IA 4O76A 5JWMA 4UP5A 4Z0OA 3VKHA 4YAXA 2OO1A 1DCQA 4Q6FA 2OXQC 4AKNA 3UV5A 4A9JA 4A9KA 4FO9A 5L99A 5LKUA 4HBWA 3IHPA 5EM3A 4XY9A 5ENHA 5CTLA 2DX8A 3MUKA 3QZVA 4YH3A 4C66A 5I83A 2G45A 2L5EA 5DFBA 4CUUA 5DW2A 2KGIA 5FE9A 4NR5A 4CUQA 4KCXA 3S91A 5LKZA 4AI6A 3UVXA 4LLBA 2BAYA 4A4BA 4KV4A 4BW3A 5FE7A 2WP2A 1WEPA 5C4QA 4AKIA 2CSYA 2M1RA 2VJEA 5FFYA 5LJ1A 3O70A 1ZKRA 5DLXA 2ECIA 2JRJA 2LXHC 4R7EA 4ZUXU 2YQMA 5D25A 5I86A 2XB1A 3N9OA 2L85A 5K29A 2DVVA 5DW1A 2E6SA 4UYGA 2R0VA 5G4RA 5BT3A 2AN6A 2KYUA 4O72A 4O75A 5AMFA
chains in the Genus database with same CATH topology
3SHBA 1HYJA 3P1CA 4A49A 4NRBA 5CZGA 2E6RA 2LV9A 4LJNA 2R0SA 5DFCA 4QR3A 4TT6A 5J0DA 5EPBA 2YSMA 5A5OA 5ACYA 4NN2A 4QSWA 5F1LA 5EI4A 2ECGA 4QF3A 3AADA 3Q2EA 4AUQB 3G0LA 4X3GA 5D26A 4QC3A 3UW9A 4Y03A 5FH7A 5TB6A 5I7YA 4LC2A 5TDWA 4QY4A 4CURA 3RPGC 2JMIA 5TCMA 2I50A 4YYKA 2KR4A 3QZSA 2MT5A 5HJCA 1X0JA 1K2FA 2KWJA 5CUCA 4GNEA 5DYAA 3HCUA 2N9GA 4FLPA 1WGMA 5ETDA 3U5KA 5CQ5A 4HXOA 4Q0NA 3U5OA 4YYDA 5F2PA 4Z6IA 5DKAA 4UIZA 2MJVB 4GNGA 4HXRA 4HXNA 5D3TA 2F42A 2LGLA 3ZNIA 4O7EA 5F36A 4R2YA 5EPSA 5HCLA 4ZQLA 2KWOA 3LQJA 5KH9A 4MEQA 4HXSA 3LRQA 4YATA 1X4JA 3JVJA 2GRCA 4NR6A 5I89A 4F3IA 4Z93A 4QR5A 4C67A 1BORA 2EGPA 2UZGA 4TKPB 4PY6A 5E73A 4UIYA 4Z1QA 4B86C 5G05B 4YBTA 3FL2A 5AIUA 4CFKA 4LYSA 4QC1A 2EODA 2Y1MA 4TU6A 3O33A 4QR4A 4QZSA 1WEWA 4V3KC 4QSQA 4W4UA 2VJEB 2QJ0A 5DYCA 2E3KA 5G4SA 3IU6A 3QZTA 4LADB 4LDFA 2KREA 3PUQA 3MB3A 1WEOA 3NXBA 4A9OA 2EA6A 3Q2FA 4BW2A 5FH6A 2YUCA 3I2DA 4L7XA 4O74A 4NUCA 4NYWA 3C5KA 2D9EA 2CSZA 2HYED 5CQ4A 2VPEA 1JM4B 2FUIA 2R0YA 2ZETC 2LXPC 3GL6A 3LJWA 5EU1A 2KU3A 2DWWA 2KTBB 1N72A 5IBNA 4S3OB 4NUEA 1XWHA 4QEUA 4O7AA 5HFRA 5D3JA 4FJCA 3UVYA 2L43A 5CQ7A 5B78A 5ENJA 2CKLA 4Z1SA 4XUBA 4N4FA 5CUBA 4YYJA 4LRGA 4IR5A 5D3LA 1WEVA 1E6IA 2KGGA 2MUMA 2RFJA 1U6GB 4Q0OA 2YURA 2I8NA 5JI8A 4HXPA 2YW5A 3U5LA 4MSXA 5AMEA 4PTBA 4Z6HA 4QF2A 5DYUA 5EICA 5DY7A 5EV9A 5I3LA 1WEUA 5HQ5A 5LCWB 2VPGA 4PCEA 3P1DA 2Y43A 5B76A 4HBYA 3G0JA 4BBQA 4NR9A 3O34A 4OGJA 5A81A 5B79A 4NYXA 2ECJA 1X4UA 5DFDA 4B7YC 3S92A 5I40A 2Y1NA 4A9HA 4I7DA 2FSAA 1WILA 2M6MA 2PUYA 3SOWA 5AD3A 4RVRA 5EA1A 2ECVA 2D82A 5C87A 2K4DA 1ZBDB 2JMJA 3EB6A 5EWVA 5HLSA 5HRWA 3SOUA 5EQ1A 1JSPB 4OUFA 5CUEA 4MEOA 4QSSA 5E3GA 5F3AA 3C6WA 3LQHA 4TYLA 4LKAA 2IDAA 4YYGA 5ENGA 2YHOA 4E96A 2KE1A 2RNWA 5KTUA 3KV5A 3N9PA 2VP7A 2LN0A 4IR3A 4YADA 3IU5A 2LSPB 5KTXA 5C85A 5CQ3A 5EWCA 2JMDA 4FIPA 3HCSA 3M99A 5E9YA 2ECWA 5ETBA 4J1PA 5IGLA 4TZ8A 1WEEA 2H0DB 5LKXA 4NR4A 4QB3A 5II1A 5E7DA 4CL9A 1LDJB 3SOXA 2C2LA 3P1FA 3P5OA 2G6QA 2QICA 2YREA 4TQNA 3U5PA 4YBSA 5CQAA 5BT5A 2G43A 4IOQA 3ASLA 5EWHA 5CU8A 4HBXA 3ZPV1 4XUAA 2L0BA 5E0RA 2LDRA 4QUUA 3JVKA 4IORA 5FE0A 4MVTA 4GB0A 2CKLB 5FH8A 4QUTA 5E74A 4HXKA 2YYRA 2L5UA 5HRVA 4YY6A 4A9IA 3O35A 5D7XA 5L8TA 4F52B 5KH3A 4LYIA 3PURA 5FE3A 5F25A 5EPRA 5IGMA 5D3RA 2VPBA 5G04B 4YYHA 5IG6A 1Z60A 5LJ0A 5KU3A 1WEQA 3HMHA 5FDZA 3SVFA 4PCIA 1E4UA 2YELA 2ECNA 3N9MA 5EGUA 1WEMA 3JVMA 4O7FA 4ZC9A 5F62A 5EP7A 5I29A 2F6JA 4YC9A 5B77A 5ENBA 4CUPA 4TTEA 4CFLA 2KFTA 2NAAA 5EISA 5H1VA 4TT2A 4UIWA 4DONA 2M85A 2KIZA 3T7LA 5ENFA 2I7KA 3AQAA 3UVWA 2YHNA 3MQMA 2RO1A 5E9VA 5F60A 3SVGA 5LKTA 5I88A 4A4CA 4LZRA 4TU4A 3VK6A 3ZPVE 4HXMA 4NS5A 4WIVA 5B8DA 4BJXA 4TT4A 5I1QA 4UIXA 4NRCA 2PNXA 5A5SA 4S3OC 4ZW1A 4A9NA 5CQ8A 2K17A 4UYEA 5FE4A 4A9FA 3ZYQA 2RS9B 2H0DA 5DKCA 3RTRB 5DBMA 5F61A 4YYMA 5FEYA 1WENA 4UITA 2YDWA 4QSRA 4LK9A 4WA6A 1JM7B 1F62A 5CUGA 5CP5A 2YQLA 4BW4A 4NR8A 4XYAA 2QIZA 4C9ZA 4I7CA 4NYVA 4MR4A 5HEMA 3L1XA 5EK9A 4MR3A 4GNDA 5CUDA 1WUGA 5FG6A 5IGKA 1FP0A 5CS8A 4WHUA 5F5ZA 4NQMA 5DYXA 4OGIA 5FE6A 4NXJA 4BW1A 3HCTA 3MB4A 2H60A 5HRXA 4LYWA 5FG4A 1F68A 2WP1A 4QSTA 4UYFA 3N9NA 1VFYA 5L96A 4A9EA 4A9MA 4O78A 2ECTA 5DKHA 2OUOA 3SVHA 4QSPA 1Z2QA 5IIDA 4QYDA 2K1JA 5TDRA 5BT4A 4IOOA 5D3HA 2VJFA 3HTKC 5EVAA 5F1HA 4O64A 4QSVA 3O7AA 2MA5A 5CRZA 4CA1A 3U5NA 4NR7A 5E3DA 5CPEA 3MHSA 4R8PK 4TZ2A 5C89A 5ENCA 2LRIC 5DKDA 4LZSA 5HM0A 5KTWA 3GV4A 5D1LB 5FE8A 1ZS5A 1MM2A 1WIMA 3RCWA 4QBMA 3UVDA 2LQ6A 5IGNA 5HELA 4N3WA 1MM3A 5D3NA 2RSDA 5A83A 4GNFA 5L97A 4IR6A 2YQDA 3JVLA 5HQ7A 3N9LA 3ONIA 4TS8A 5I80A 4UYDA 5CGPA 5TBNA 4IC3A 4N4GA 2YEKA 2DVQA 5HQ6A 4A0CD 5DX4A 5AD2A 2CT2A 5ENIA 5B75A 3ZYUA 2KWNA 2YU4A 2YEMA 4WZ2A 2MIQA 1X4IA 3N9QA 1JM7A 4WZ0A 1WESA 5CQTA 4ALGA 4J0SA 2DVSA 2K16A 5LVQA 3U5JA 5H9MA 5E9LA 3L1ZB 1WFKA 5JG6A 5CUAA 5E9MA 4WZ3B 3I3JA 2YT5A 5FE1A 3KNVA 5L98A 3LQIA 1CHCA 4QSUA 5C13A 1JOCA 5E9KA 1VYXA 1LDKC 3KQIA 3O37A 3MULA 4YYIA 1V87A 5FBXA 3D7CA 5KHMA 2MA6A 4UP0A 4CCGX 4J0RA 4YBMA 5I7XA 5KH7A 3HMEA 4L58A 4J3IA 5D1MB 5LVRA 4NUDA 5COIA 2OSSA 4UYFB 4LZ2A 2NXBA 5II2A 2DATA 4YH4A 1VD4A 4YK0A 4YYNA 4ALHA 2VNFA 5D3SA 2E7NA 2L80A 2MD7B 5TABA 3UV2A 3T6RA 5C7NA 5D1KB 4HXLA 1RMDA 5H1TA 5CQ6A 2KWKA 3UV4A 4CUTA 1FBVA 3DPLR 2FUUA 2VJFB 2E7OA 4O7BA 2L84A 3U5MA 4AYCA 3LXJA 2YSJA 3PHDA 2MD8C 3GG3A 5J3XA 2RNXA 3L11A 5C8GA 4GPJA 4YY4A 2YYNA 4QNSA 5A5PA 2RI7A 3V43A 2C2VS 1IYMA 4O70A 4CLBA 3ZVYA 4XI1A 4O7CA 3RPGB 4AP4A 3M63A 3P1EA 5CY9A 3DAIA 2LGVA 4FK5A 3NG2A 4O77A 5CFWA 5H85A 2XEUA 3TLPA 4CUSA 4UYHA 4A9LA 5A5QA 1DVPA 4I7BA 3M62A 2F6NA 2LGKA 5HFQA 4MENA 4QEVA 4YABA 4WHWA 5AITA 1HYIA 2M3HA 5A5NA 5EYAF 5EWDA 2VPDA 4X2IA 1Z6UA 3MHHA 2D8SA 5E9IA 1G25A 5FB1A 5D0CA 4UIUA 2RNYA 4MR6A 5A82A 5H1UA 3ZVZB 3K2JA 4O71A 2DVRA 5G0FA 5TRBA 3KV6A 4QYLA 5F63A 5FG5A 1WUMA 2MNZA 4P5OB 4V3LC 4IR4A 4NRAA 4N4HA 4QEWA 4QSXA 1EQFA 1WE9A 4IC2A 2R10A 4UI9B 3O36A 4UIVA 5EWWA 4MEPA 4BHWA 5DLZA 3EB5A 5FB0A 5D3PA 5DINA 3MXFA 3DWYA 5KO4A 5FFWA 5FERA 4ZDTA 5LJ2A 1T1HA 3ZTGA 5HENA 5A7CA 5C11A 3DQVR 2YW8A 5A85A 4PPEA 5FE5A 4LR6A 4AYCB 3HMFA 5FFVA 5A5RA 4HBVA 4NQNA 4PS5A 5ENEA 3FKMX 5L8UA 2L75A 5CRMA 2MNYA 5FE2A 4PKLA 4KV1A 4AVXA 2DKWA 2HDPA 4MR5A 4XY8A 1N87A 5LUUA 2G4AA 5D24A 2LGGA 4N4IA 4O76A 5JWMA 4UP5A 4YAXA 2OO1A 4Q6FA 2OXQC 4AKNA 3UV5A 4A9JA 4A9KA 4FO9A 5L99A 5LKUA 4HBWA 3IHPA 5EM3A 4XY9A 5ENHA 5CTLA 2DX8A 3MUKA 3QZVA 4YH3A 4C66A 5I83A 2G45A 2L5EA 5DFBA 4CUUA 5DW2A 2KGIA 5FE9A 4NR5A 4CUQA 4KCXA 3S91A 5LKZA 3UVXA 4LLBA 2BAYA 4A4BA 4KV4A 4BW3A 5FE7A 2WP2A 1WEPA 5C4QA 2CSYA 2M1RA 2VJEA 5FFYA 5LJ1A 3O70A 5DLXA 2ECIA 2JRJA 2LXHC 4R7EA 4ZUXU 2YQMA 5D25A 5I86A 2XB1A 3N9OA 2L85A 5K29A 2DVVA 5DW1A 2E6SA 4UYGA 2R0VA 5G4RA 5BT3A 2AN6A 2KYUA 4O72A 4O75A 5AMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHB A;  1HYJ A;  3P1C A;  4A49 A;  4NRB A;  5CZG A;  2E6R A;  2LV9 A;  4LJN A;  2R0S A;  5DFC A;  4QR3 A;  4TT6 A;  5J0D A;  5EPB A;  2YSM A;  5A5O A;  5ACY A;  4NN2 A;  4QSW A;  5F1L A;  5EI4 A;  2ECG A;  4QF3 A;  3AAD A;  3Q2E A;  4AUQ B;  3G0L A;  4X3G A;  5D26 A;  4QC3 A;  3UW9 A;  4Y03 A;  5FH7 A;  5TB6 A;  5I7Y A;  4LC2 A;  5TDW A;  4QY4 A;  4CUR A;  3RPG C;  2JMI A;  5TCM A;  2I50 A;  4YYK A;  2KR4 A;  3QZS A;  2MT5 A;  5HJC A;  1X0J A;  1K2F A;  2KWJ A;  5CUC A;  4GNE A;  5DYA A;  3HCU A;  2N9G A;  4FLP A;  1WGM A;  5ETD A;  3U5K A;  5CQ5 A;  4HXO A;  4Q0N A;  3U5O A;  4YYD A;  5F2P A;  4Z6I A;  5DKA A;  4UIZ A;  2MJV B;  4GNG A;  4HXR A;  4HXN A;  5D3T A;  2F42 A;  2LGL A;  3ZNI A;  4O7E A;  5F36 A;  4R2Y A;  5EPS A;  5HCL A;  4ZQL A;  2KWO A;  3LQJ A;  5KH9 A;  4MEQ A;  4HXS A;  3LRQ A;  4YAT A;  1X4J A;  3JVJ A;  2GRC A;  4NR6 A;  5I89 A;  4F3I A;  4Z93 A;  4QR5 A;  4C67 A;  1BOR A;  2EGP A;  2UZG A;  4TKP B;  4PY6 A;  5E73 A;  4UIY A;  4Z1Q A;  4B86 C;  5G05 B;  4YBT A;  3FL2 A;  5AIU A;  4CFK A;  4LYS A;  4QC1 A;  2EOD A;  2Y1M A;  4TU6 A;  3O33 A;  4QR4 A;  4QZS A;  1WEW A;  4V3K C;  4QSQ A;  4W4U A;  2VJE B;  2QJ0 A;  5DYC A;  2E3K A;  5G4S A;  3IU6 A;  3QZT A;  4LAD B;  4LDF A;  2KRE A;  3PUQ A;  3MB3 A;  1WEO A;  3NXB A;  4A9O A;  2EA6 A;  3Q2F A;  4BW2 A;  5FH6 A;  2YUC A;  3I2D A;  4L7X A;  4O74 A;  4NUC A;  4NYW A;  3C5K A;  2D9E A;  2CSZ A;  2HYE D;  5CQ4 A;  2VPE A;  1JM4 B;  2FUI A;  2R0Y A;  2ZET C;  2LXP C;  3GL6 A;  3LJW A;  5EU1 A;  2KU3 A;  2DWW A;  2KTB B;  1N72 A;  5IBN A;  4S3O B;  4NUE A;  1XWH A;  4QEU A;  4O7A A;  5HFR A;  5D3J A;  4FJC A;  3UVY A;  2L43 A;  5CQ7 A;  5B78 A;  5ENJ A;  2CKL A;  4Z1S A;  4XUB A;  4N4F A;  5CUB A;  4YYJ A;  4LRG A;  4IR5 A;  5D3L A;  1WEV A;  1E6I A;  2KGG A;  2MUM A;  2RFJ A;  1U6G B;  4Q0O A;  2YUR A;  2I8N A;  5JI8 A;  4HXP A;  2YW5 A;  3U5L A;  4MSX A;  5AME A;  4PTB A;  4Z6H A;  4QF2 A;  5DYU A;  5EIC A;  5DY7 A;  5EV9 A;  5I3L A;  1WEU A;  5HQ5 A;  5LCW B;  2VPG A;  4PCE A;  3P1D A;  2Y43 A;  5B76 A;  4HBY A;  3G0J A;  4BBQ A;  4NR9 A;  3O34 A;  4OGJ A;  5A81 A;  5B79 A;  4NYX A;  2ECJ A;  1X4U A;  5DFD A;  4B7Y C;  3S92 A;  5I40 A;  2Y1N A;  4A9H A;  4I7D A;  2FSA A;  1WIL A;  2M6M A;  2PUY A;  3SOW A;  5AD3 A;  4RVR A;  5EA1 A;  2ECV A;  2D82 A;  5C87 A;  2K4D A;  1ZBD B;  2JMJ A;  3EB6 A;  5EWV A;  5HLS A;  5HRW A;  3SOU A;  5EQ1 A;  1JSP B;  4OUF A;  5CUE A;  4MEO A;  4QSS A;  5E3G A;  5F3A A;  3C6W A;  3LQH A;  4TYL A;  4LKA A;  2IDA A;  4YYG A;  5ENG A;  2YHO A;  4E96 A;  2KE1 A;  2RNW A;  5KTU A;  3KV5 A;  3N9P A;  2VP7 A;  2LN0 A;  4IR3 A;  4YAD A;  3IU5 A;  2LSP B;  5KTX A;  5C85 A;  5CQ3 A;  5EWC A;  2JMD A;  4FIP A;  3HCS A;  3M99 A;  5E9Y A;  2ECW A;  5ETB A;  4J1P A;  5IGL A;  4TZ8 A;  1WEE A;  2H0D B;  5LKX A;  4NR4 A;  4QB3 A;  5II1 A;  5E7D A;  4CL9 A;  1LDJ B;  3SOX A;  2C2L A;  3P1F A;  3P5O A;  2G6Q A;  2QIC A;  2YRE A;  4TQN A;  3U5P A;  4YBS A;  5CQA A;  5BT5 A;  2G43 A;  4IOQ A;  3ASL A;  5EWH A;  5CU8 A;  4HBX A;  3ZPV 1;  4XUA A;  2L0B A;  5E0R A;  2LDR A;  4QUU A;  3JVK A;  4IOR A;  5FE0 A;  4MVT A;  4GB0 A;  2CKL B;  5FH8 A;  4QUT A;  5E74 A;  4HXK A;  2YYR A;  2L5U A;  5HRV A;  4YY6 A;  4A9I A;  3O35 A;  5D7X A;  5L8T A;  4F52 B;  5KH3 A;  4LYI A;  3PUR A;  5FE3 A;  5F25 A;  5EPR A;  5IGM A;  5D3R A;  2VPB A;  5G04 B;  4YYH A;  5IG6 A;  1Z60 A;  5LJ0 A;  5KU3 A;  1WEQ A;  3HMH A;  5FDZ A;  3SVF A;  4PCI A;  1E4U A;  2YEL A;  2ECN A;  3N9M A;  5EGU A;  1WEM A;  3JVM A;  4O7F A;  4ZC9 A;  5F62 A;  5EP7 A;  5I29 A;  2F6J A;  4YC9 A;  5B77 A;  5ENB A;  4CUP A;  4TTE A;  4CFL A;  2KFT A;  2NAA A;  5EIS A;  5H1V A;  4TT2 A;  4UIW A;  4DON A;  2M85 A;  2KIZ A;  3T7L A;  5ENF A;  2I7K A;  3AQA A;  3UVW A;  2YHN A;  3MQM A;  2RO1 A;  5E9V A;  5F60 A;  3SVG A;  5LKT A;  5I88 A;  4A4C A;  4LZR A;  4TU4 A;  3VK6 A;  3ZPV E;  4HXM A;  4NS5 A;  4WIV A;  5B8D A;  4BJX A;  4TT4 A;  5I1Q A;  4UIX A;  4NRC A;  2PNX A;  5A5S A;  4S3O C;  4ZW1 A;  4A9N A;  5CQ8 A;  2K17 A;  4UYE A;  5FE4 A;  4A9F A;  3ZYQ A;  2RS9 B;  2H0D A;  5DKC A;  3RTR B;  5DBM A;  5F61 A;  4YYM A;  5FEY A;  1WEN A;  4UIT A;  2YDW A;  4QSR A;  4LK9 A;  4WA6 A;  1JM7 B;  1F62 A;  5CUG A;  5CP5 A;  2YQL A;  4BW4 A;  4NR8 A;  4XYA A;  2QIZ A;  4C9Z A;  4I7C A;  4NYV A;  4MR4 A;  5HEM A;  3L1X A;  5EK9 A;  4MR3 A;  4GND A;  5CUD A;  1WUG A;  5FG6 A;  5IGK A;  1FP0 A;  5CS8 A;  4WHU A;  5F5Z A;  4NQM A;  5DYX A;  4OGI A;  5FE6 A;  4NXJ A;  4BW1 A;  3HCT A;  3MB4 A;  2H60 A;  5HRX A;  4LYW A;  5FG4 A;  1F68 A;  2WP1 A;  4QST A;  4UYF A;  3N9N A;  1VFY A;  5L96 A;  4A9E A;  4A9M A;  4O78 A;  2ECT A;  5DKH A;  2OUO A;  3SVH A;  4QSP A;  1Z2Q A;  5IID A;  4QYD A;  2K1J A;  5TDR A;  5BT4 A;  4IOO A;  5D3H A;  2VJF A;  3HTK C;  5EVA A;  5F1H A;  4O64 A;  4QSV A;  3O7A A;  2MA5 A;  5CRZ A;  4CA1 A;  3U5N A;  4NR7 A;  5E3D A;  5CPE A;  3MHS A;  4R8P K;  4TZ2 A;  5C89 A;  5ENC A;  2LRI C;  5DKD A;  4LZS A;  5HM0 A;  5KTW A;  3GV4 A;  5D1L B;  5FE8 A;  1ZS5 A;  1MM2 A;  1WIM A;  3RCW A;  4QBM A;  3UVD A;  2LQ6 A;  5IGN A;  5HEL A;  4N3W A;  1MM3 A;  5D3N A;  2RSD A;  5A83 A;  4GNF A;  5L97 A;  4IR6 A;  2YQD A;  3JVL A;  5HQ7 A;  3N9L A;  3ONI A;  4TS8 A;  5I80 A;  4UYD A;  5CGP A;  5TBN A;  4IC3 A;  4N4G A;  2YEK A;  2DVQ A;  5HQ6 A;  4A0C D;  5DX4 A;  5AD2 A;  2CT2 A;  5ENI A;  5B75 A;  3ZYU A;  2KWN A;  2YU4 A;  2YEM A;  4WZ2 A;  2MIQ A;  1X4I A;  3N9Q A;  1JM7 A;  4WZ0 A;  1WES A;  5CQT A;  4ALG A;  4J0S A;  2DVS A;  2K16 A;  5LVQ A;  3U5J A;  5H9M A;  5E9L A;  3L1Z B;  1WFK A;  5JG6 A;  5CUA A;  5E9M A;  4WZ3 B;  3I3J A;  2YT5 A;  5FE1 A;  3KNV A;  5L98 A;  3LQI A;  1CHC A;  4QSU A;  5C13 A;  1JOC A;  5E9K A;  1VYX A;  1LDK C;  3KQI A;  3O37 A;  3MUL A;  4YYI A;  1V87 A;  5FBX A;  3D7C A;  5KHM A;  2MA6 A;  4UP0 A;  4CCG X;  4J0R A;  4YBM A;  5I7X A;  5KH7 A;  3HME A;  4L58 A;  4J3I A;  5D1M B;  5LVR A;  4NUD A;  5COI A;  2OSS A;  4UYF B;  4LZ2 A;  2NXB A;  5II2 A;  2DAT A;  4YH4 A;  1VD4 A;  4YK0 A;  4YYN A;  4ALH A;  2VNF A;  5D3S A;  2E7N A;  2L80 A;  2MD7 B;  5TAB A;  3UV2 A;  3T6R A;  5C7N A;  5D1K B;  4HXL A;  1RMD A;  5H1T A;  5CQ6 A;  2KWK A;  3UV4 A;  4CUT A;  1FBV A;  3DPL R;  2FUU A;  2VJF B;  2E7O A;  4O7B A;  2L84 A;  3U5M A;  4AYC A;  3LXJ A;  2YSJ A;  3PHD A;  2MD8 C;  3GG3 A;  5J3X A;  2RNX A;  3L11 A;  5C8G A;  4GPJ A;  4YY4 A;  2YYN A;  4QNS A;  5A5P A;  2RI7 A;  3V43 A;  2C2V S;  1IYM A;  4O70 A;  4CLB A;  3ZVY A;  4XI1 A;  4O7C A;  3RPG B;  4AP4 A;  3M63 A;  3P1E A;  5CY9 A;  3DAI A;  2LGV A;  4FK5 A;  3NG2 A;  4O77 A;  5CFW A;  5H85 A;  2XEU A;  3TLP A;  4CUS A;  4UYH A;  4A9L A;  5A5Q A;  1DVP A;  4I7B A;  3M62 A;  2F6N A;  2LGK A;  5HFQ A;  4MEN A;  4QEV A;  4YAB A;  4WHW A;  5AIT A;  1HYI A;  2M3H A;  5A5N A;  5EYA F;  5EWD A;  2VPD A;  4X2I A;  1Z6U A;  3MHH A;  2D8S A;  5E9I A;  1G25 A;  5FB1 A;  5D0C A;  4UIU A;  2RNY A;  4MR6 A;  5A82 A;  5H1U A;  3ZVZ B;  3K2J A;  4O71 A;  2DVR A;  5G0F A;  5TRB A;  3KV6 A;  4QYL A;  5F63 A;  5FG5 A;  1WUM A;  2MNZ A;  4P5O B;  4V3L C;  4IR4 A;  4NRA A;  4N4H A;  4QEW A;  4QSX A;  1EQF A;  1WE9 A;  4IC2 A;  2R10 A;  4UI9 B;  3O36 A;  4UIV A;  5EWW A;  4MEP A;  4BHW A;  5DLZ A;  3EB5 A;  5FB0 A;  5D3P A;  5DIN A;  3MXF A;  3DWY A;  5KO4 A;  5FFW A;  5FER A;  4ZDT A;  5LJ2 A;  1T1H A;  3ZTG A;  5HEN A;  5A7C A;  5C11 A;  3DQV R;  2YW8 A;  5A85 A;  4PPE A;  5FE5 A;  4LR6 A;  4AYC B;  3HMF A;  5FFV A;  5A5R A;  4HBV A;  4NQN A;  4PS5 A;  5ENE A;  3FKM X;  5L8U A;  2L75 A;  5CRM A;  2MNY A;  5FE2 A;  4PKL A;  4KV1 A;  4AVX A;  2DKW A;  2HDP A;  4MR5 A;  4XY8 A;  1N87 A;  5LUU A;  2G4A A;  5D24 A;  2LGG A;  4N4I A;  4O76 A;  5JWM A;  4UP5 A;  4YAX A;  2OO1 A;  4Q6F A;  2OXQ C;  4AKN A;  3UV5 A;  4A9J A;  4A9K A;  4FO9 A;  5L99 A;  5LKU A;  4HBW A;  3IHP A;  5EM3 A;  4XY9 A;  5ENH A;  5CTL A;  2DX8 A;  3MUK A;  3QZV A;  4YH3 A;  4C66 A;  5I83 A;  2G45 A;  2L5E A;  5DFB A;  4CUU A;  5DW2 A;  2KGI A;  5FE9 A;  4NR5 A;  4CUQ A;  4KCX A;  3S91 A;  5LKZ A;  3UVX A;  4LLB A;  2BAY A;  4A4B A;  4KV4 A;  4BW3 A;  5FE7 A;  2WP2 A;  1WEP A;  5C4Q A;  2CSY A;  2M1R A;  2VJE A;  5FFY A;  5LJ1 A;  3O70 A;  5DLX A;  2ECI A;  2JRJ A;  2LXH C;  4R7E A;  4ZUX U;  2YQM A;  5D25 A;  5I86 A;  2XB1 A;  3N9O A;  2L85 A;  5K29 A;  2DVV A;  5DW1 A;  2E6S A;  4UYG A;  2R0V A;  5G4R A;  5BT3 A;  2AN6 A;  2KYU A;  4O72 A;  4O75 A;  5AMF A; 
#chains in the Genus database with same CATH topology
 3SHB A;  1HYJ A;  3P1C A;  3MDB C;  4A49 A;  4NRB A;  5CZG A;  3D1B A;  2E6R A;  2LV9 A;  2R0S A;  5DFC A;  4QR3 A;  4TT6 A;  5J0D A;  3E2D A;  5EPB A;  2YSM A;  4LJN A;  5A5O A;  5ACY A;  4NN2 A;  4QSW A;  5F1L A;  5EI4 A;  4OGE A;  2ECG A;  2P57 A;  4QF3 A;  3AAD A;  3Q2E A;  4AUQ B;  3G0L A;  4X3G A;  5D26 A;  4QC3 A;  3UW9 A;  4Y03 A;  5FH7 A;  5TB6 A;  2YVR A;  5I7Y A;  4LC2 A;  5TDW A;  4QY4 A;  4CUR A;  3RPG C;  2JMI A;  5TCM A;  2CRW A;  4YYK A;  2I50 A;  3QZS A;  2KR4 A;  2MT5 A;  5HJC A;  1X0J A;  1K2F A;  2KWJ A;  5CUC A;  4GNE A;  5DYA A;  3HCU A;  2N9G A;  4FLP A;  1WGM A;  5ETD A;  2OWA A;  2XP0 A;  3U5K A;  5CQ5 A;  4HXO A;  4Q0N A;  3U5O A;  3FAN A;  4YYD A;  4AKG A;  5F2P A;  4Z6I A;  5DKA A;  4UIZ A;  2MJV B;  4GNG A;  4HXR A;  4HXN A;  5D3T A;  2F42 A;  2LGL A;  4AKH A;  4O7E A;  3ZNI A;  5F36 A;  4R2Y A;  5EPS A;  5HCL A;  4ZQL A;  2KWO A;  3LQJ A;  5KH9 A;  4MEQ A;  4HXS A;  3LRQ A;  4YAT A;  1X4J A;  3JVJ A;  2GRC A;  4NR6 A;  5I89 A;  4F3I A;  4Z93 A;  4QR5 A;  4C67 A;  1BOR A;  2EGP A;  2IQJ A;  2UZG A;  4TKP B;  4PY6 A;  5E73 A;  4UIY A;  4Z1Q A;  4B86 C;  5SVX A;  5G05 B;  4YBT A;  3FL2 A;  3FJU B;  5AIU A;  4CFK A;  4LYS A;  4QC1 A;  2EOD A;  2Y1M A;  4TU6 A;  3O33 A;  4QR4 A;  4QZS A;  1WEW A;  4V3K C;  4QSQ A;  4W4U A;  2VJE B;  2QJ0 A;  5DYC A;  2E3K A;  5G4S A;  3IU6 A;  4H9D A;  3QZT A;  4LAD B;  4LDF A;  2KRE A;  3PUQ A;  1PUO A;  3MB3 A;  1WEO A;  3NXB A;  4A9O A;  2EA6 A;  3Q2F A;  4BW2 A;  5FH6 A;  2YUC A;  3I2D A;  2EJN A;  4O74 A;  4L7X A;  4NUC A;  4NYW A;  3C5K A;  2D9E A;  2CSZ A;  2HYE D;  3DWD A;  5CQ4 A;  3M7K A;  2VPE A;  1JM4 B;  2FUI A;  2R0Y A;  2ZET C;  2LXP C;  3GL6 A;  3LJW A;  5EU1 A;  2KU3 A;  2DWW A;  2KTB B;  1N72 A;  5IBN A;  4S3O B;  4NUE A;  1XWH A;  4QEU A;  4O7A A;  5HFR A;  5D3J A;  4FJC A;  3UVY A;  2L43 A;  5CQ7 A;  5B78 A;  3KDE C;  5ENJ A;  2CKL A;  4Z1S A;  3T9K A;  4XUB A;  4N4F A;  5CUB A;  4YYJ A;  4LRG A;  4IR5 A;  2XOC A;  5D3L A;  1WEV A;  1E6I A;  2KGG A;  2MUM A;  2RFJ A;  1U6G B;  4Q0O A;  2YUR A;  2I8N A;  5JI8 A;  4HXP A;  2YW5 A;  3U5L A;  2CSV A;  4MSX A;  5AME A;  4PTB A;  4Z6H A;  4QF2 A;  5DYU A;  5EIC A;  5DY7 A;  5EV9 A;  5I3L A;  1WEU A;  5HQ5 A;  3D1D A;  5LCW B;  2VPG A;  4PCE A;  3P1D A;  2Y43 A;  5B76 A;  4HBY A;  3G0J A;  4BBQ A;  3FEH A;  4NR9 A;  3O34 A;  4OGJ A;  5A81 A;  5B79 A;  4NYX A;  2ECJ A;  1X4U A;  4CCG X;  5DFD A;  4B7Y C;  3S92 A;  5I40 A;  2L7P A;  4A9H A;  2Y1N A;  4I7D A;  2FSA A;  1WIL A;  2M6M A;  2PUY A;  3SOW A;  5AD3 A;  4RVR A;  5EA1 A;  2ECV A;  2D82 A;  3LJU X;  5C87 A;  2K4D A;  1ZBD B;  2JMJ A;  3EB6 A;  3LVR E;  5EWV A;  5HLS A;  5HRW A;  3SOU A;  5EQ1 A;  1JSP B;  4OUF A;  5CUE A;  4MEO A;  4QSS A;  5E3G A;  5F3A A;  3C6W A;  3LQH A;  2KKX A;  4TYL A;  4LKA A;  2IDA A;  4YYG A;  5ENG A;  2YHO A;  4E96 A;  2KE1 A;  2RNW A;  5KTU A;  3KV5 A;  3N9P A;  2VP7 A;  2LN0 A;  4IR3 A;  4YAD A;  3IU5 A;  2LSP B;  5KTX A;  5C85 A;  5CQ3 A;  5EWC A;  2JMD A;  4FIP A;  3HCS A;  3M99 A;  5E9Y A;  2ECW A;  5ETB A;  2FD4 A;  4J1P A;  5IGL A;  4TZ8 A;  1WEE A;  2H0D B;  5LKX A;  2XOY A;  4NR4 A;  4QB3 A;  5II1 A;  5E7D A;  4CL9 A;  1LDJ B;  3SOX A;  2C2L A;  3P1F A;  3P5O A;  2G6Q A;  2MKE A;  2QIC A;  2YRE A;  4TQN A;  3U5P A;  3VKG A;  4YBS A;  5CQA A;  5BT5 A;  2G43 A;  4IOQ A;  3ASL A;  5EWH A;  5CU8 A;  4HBX A;  3ZPV 1;  4XUA A;  2L0B A;  5E0R A;  2LDR A;  4QUU A;  3JVK A;  4IOR A;  5FE0 A;  4OGC A;  4MVT A;  4GB0 A;  2CKL B;  5FH8 A;  4QUT A;  5E74 A;  4HXK A;  2YYR A;  2L5U A;  5HRV A;  4YY6 A;  4A9I A;  3O35 A;  5D7X A;  5L8T A;  3Q1D A;  4F52 B;  5KH3 A;  4LYI A;  3PUR A;  5FE3 A;  5F25 A;  5EPR A;  5IGM A;  5D3R A;  2VPB A;  5G04 B;  4YYH A;  5IG6 A;  1Z60 A;  5LJ0 A;  5KU3 A;  1WEQ A;  3HMH A;  5FDZ A;  3SVF A;  4PCI A;  1E4U A;  2YEL A;  2KKY A;  2ECN A;  3N9M A;  5EGU A;  1WEM A;  3JVM A;  4O7F A;  2E61 A;  4ZC9 A;  5F62 A;  5EP7 A;  5I29 A;  2F6J A;  4YC9 A;  5B77 A;  5ENB A;  4CUP A;  4TTE A;  4CFL A;  2KFT A;  2NAA A;  5EIS A;  5H1V A;  2CON A;  4TT2 A;  4F1P A;  4UIW A;  4DON A;  2M85 A;  2KIZ A;  2LAU A;  5ENF A;  3T7L A;  2I7K A;  3AQA A;  3UVW A;  2M13 A;  2YHN A;  3MQM A;  2RO1 A;  5E9V A;  5F60 A;  3SVG A;  5LKT A;  5I88 A;  4A4C A;  4LZR A;  4TU4 A;  3VK6 A;  3ZPV E;  4HXM A;  4NS5 A;  4WIV A;  5B8D A;  4BJX A;  4TT4 A;  5I1Q A;  4UIX A;  4NRC A;  2PNX A;  5A5S A;  4S3O C;  4ZW1 A;  4A9N A;  5CQ8 A;  1MBM A;  4UYE A;  2K17 A;  5FE4 A;  4A9F A;  3ZYQ A;  2RS9 B;  2CRR A;  5DKC A;  2H0D A;  5DBM A;  3RTR B;  5F61 A;  4YYM A;  5FEY A;  1WEN A;  4UIT A;  2YDW A;  4QSR A;  4LK9 A;  4WA6 A;  1JM7 B;  1F62 A;  5CUG A;  5CP5 A;  2YQL A;  4BW4 A;  4NR8 A;  4XYA A;  2QIZ A;  4C9Z A;  4I7C A;  4NYV A;  4MR4 A;  5HEM A;  5SVI B;  3L1X A;  5EK9 A;  4MR3 A;  4GND A;  5CUD A;  1WUG A;  5FG6 A;  5IGK A;  1FP0 A;  5CS8 A;  4WHU A;  5F5Z A;  4NQM A;  5DYX A;  4OGI A;  5FE6 A;  4NXJ A;  4BW1 A;  3HCT A;  3MB4 A;  2H60 A;  5HRX A;  4LYW A;  5FG4 A;  1F68 A;  2WP1 A;  4QST A;  4UYF A;  3N9N A;  1VFY A;  5L96 A;  4A9E A;  4A9M A;  4O78 A;  2ECT A;  5DKH A;  3LVQ E;  2OUO A;  3SVH A;  4QSP A;  2RR4 A;  1Z2Q A;  5IID A;  4QYD A;  2K1J A;  5TDR A;  5BT4 A;  4IOO A;  5D3H A;  2VJF A;  3HTK C;  5EVA A;  5F1H A;  4O64 A;  4QSV A;  3O7A A;  2MA5 A;  4Z0R A;  5CRZ A;  4CA1 A;  3U5N A;  4NR7 A;  5E3D A;  5CPE A;  3MHS A;  4O62 A;  4R8P K;  4TZ2 A;  5C89 A;  5ENC A;  2EGM A;  2LRI C;  5DKD A;  4LZS A;  5HM0 A;  5KTW A;  3GV4 A;  5D1L B;  5FE8 A;  1ZS5 A;  1MM2 A;  1WIM A;  3RCW A;  4QBM A;  3UVD A;  2LQ6 A;  5IGN A;  5HEL A;  4N3W A;  1MM3 A;  5D3N A;  2RSD A;  5A83 A;  4GNF A;  5L97 A;  4IR6 A;  2YQD A;  2JM3 A;  3JVL A;  5HQ7 A;  3N9L A;  5SVY A;  3ONI A;  4TS8 A;  5I80 A;  4UYD A;  2B0O E;  5CGP A;  5TBN A;  2D8U A;  4IC3 A;  4N4G A;  2YEK A;  2DVQ A;  5HQ6 A;  4A0C D;  5DX4 A;  5AD2 A;  2CT2 A;  5ENI A;  5B75 A;  3ZYU A;  2KWN A;  2YU4 A;  2YEM A;  4WZ2 A;  2MIQ A;  1X4I A;  3N9Q A;  1JM7 A;  4WZ0 A;  1WES A;  5CQT A;  4ALG A;  4J0S A;  2DVS A;  2K16 A;  5SVI A;  5LVQ A;  3U5J A;  5H9M A;  5E9L A;  3L1Z B;  3FAO A;  3DDT A;  1WFK A;  5JG6 A;  5CUA A;  5E9M A;  4WZ3 B;  3I3J A;  2YT5 A;  5FE1 A;  2EXU A;  3PLW A;  3KNV A;  5L98 A;  3LQI A;  1CHC A;  4QSU A;  5C13 A;  2FFW A;  1JOC A;  5E9K A;  2DSM A;  1VYX A;  1LDK C;  3KQI A;  3O37 A;  3MUL A;  4YYI A;  1V87 A;  5FBX A;  3D7C A;  5KHM A;  2MA6 A;  4UP0 A;  5K3Q A;  4J0R A;  4YBM A;  5I7X A;  5KH7 A;  3HME A;  4L58 A;  4J3I A;  5D1M B;  2JUN A;  5LVR A;  4NUD A;  5COI A;  2OSS A;  4UYF B;  4LZ2 A;  2NXB A;  5II2 A;  2DAT A;  4YH4 A;  1VD4 A;  4YK0 A;  4YYN A;  4ALH A;  2VNF A;  5D3S A;  2E7N A;  2L80 A;  2MD7 B;  5TAB A;  3UV2 A;  3T6R A;  5C7N A;  3JUE A;  5D1K B;  4HXL A;  1RMD A;  5H1T A;  5CQ6 A;  2KWK A;  3UV4 A;  4CUT A;  1FBV A;  3DPL R;  2FUU A;  3SUB A;  2VJF B;  2E7O A;  4O7B A;  2L84 A;  3U5M A;  2XOZ A;  3LXJ A;  2YSJ A;  3PHD A;  4AYC A;  2MD8 C;  3GG3 A;  5J3X A;  2RNX A;  3L11 A;  5C8G A;  4GPJ A;  4YY4 A;  2YYN A;  4QNS A;  5A5P A;  2RI7 A;  3V43 A;  2C2V S;  1IYM A;  4O70 A;  4CLB A;  3ZVY A;  4XI1 A;  4O7C A;  3RPG B;  4QQ4 A;  3M63 A;  4AP4 A;  3P1E A;  5CY9 A;  3DAI A;  2LGV A;  4FK5 A;  3NG2 A;  4O77 A;  5CFW A;  5H85 A;  2XEU A;  3TLP A;  4CUS A;  3FM8 C;  4UYH A;  4A9L A;  5A5Q A;  1DVP A;  4I7B A;  3M62 A;  2F6N A;  2LGK A;  5HFQ A;  4MEN A;  4QEV A;  3LDY A;  4YAB A;  4WHW A;  5AIT A;  1HYI A;  2M3H A;  5A5N A;  5EYA F;  5EWD A;  2VPD A;  3H7H A;  4X2I A;  1Z6U A;  3MHH A;  2D8S A;  5E9I A;  2DJA A;  1G25 A;  5FB1 A;  5D0C A;  4UIU A;  2RNY A;  4MR6 A;  5A82 A;  5H1U A;  3ZVZ B;  3ERR A;  3K2J A;  4O71 A;  2DVR A;  5G0F A;  5TRB A;  3KV6 A;  4QYL A;  5F63 A;  5FG5 A;  1WUM A;  2MNZ A;  3O47 A;  4P5O B;  4V3L C;  4IR4 A;  4NRA A;  4N4H A;  4QEW A;  4QSX A;  1EQF A;  1WE9 A;  4IC2 A;  2R10 A;  4UI9 B;  3O36 A;  4UIV A;  5EWW A;  4MEP A;  4BHW A;  5DLZ A;  3EB5 A;  5FB0 A;  5D3P A;  5DIN A;  3MXF A;  3DWY A;  5KO4 A;  5FFW A;  5FER A;  4ZDT A;  5LJ2 A;  1T1H A;  3ZTG A;  5HEN A;  5A7C A;  5C11 A;  3DQV R;  2YW8 A;  5A85 A;  4PPE A;  5FE5 A;  4LR6 A;  4AYC B;  3HMF A;  5FFV A;  5A5R A;  4HBV A;  4NQN A;  4PS5 A;  5ENE A;  3FKM X;  5L8U A;  2L75 A;  5CRM A;  2MNY A;  5FE2 A;  4PKL A;  4KV1 A;  4AVX A;  2DKW A;  2HDP A;  4MR5 A;  4XY8 A;  1N87 A;  5LUU A;  2G4A A;  5D24 A;  2LGG A;  4N4I A;  4O76 A;  5JWM A;  4UP5 A;  4Z0O A;  3VKH A;  4YAX A;  2OO1 A;  1DCQ A;  4Q6F A;  2OXQ C;  4AKN A;  3UV5 A;  4A9J A;  4A9K A;  4FO9 A;  5L99 A;  5LKU A;  4HBW A;  3IHP A;  5EM3 A;  4XY9 A;  5ENH A;  5CTL A;  2DX8 A;  3MUK A;  3QZV A;  4YH3 A;  4C66 A;  5I83 A;  2G45 A;  2L5E A;  5DFB A;  4CUU A;  5DW2 A;  2KGI A;  5FE9 A;  4NR5 A;  4CUQ A;  4KCX A;  3S91 A;  5LKZ A;  4AI6 A;  3UVX A;  4LLB A;  2BAY A;  4A4B A;  4KV4 A;  4BW3 A;  5FE7 A;  2WP2 A;  1WEP A;  5C4Q A;  4AKI A;  2CSY A;  2M1R A;  2VJE A;  5FFY A;  5LJ1 A;  3O70 A;  1ZKR A;  5DLX A;  2ECI A;  2JRJ A;  2LXH C;  4R7E A;  4ZUX U;  2YQM A;  5D25 A;  5I86 A;  2XB1 A;  3N9O A;  2L85 A;  5K29 A;  2DVV A;  5DW1 A;  2E6S A;  4UYG A;  2R0V A;  5G4R A;  5BT3 A;  2AN6 A;  2KYU A;  4O72 A;  4O75 A;  5AMF A; 
#chains in the Genus database with same CATH homology
 3SHB A;  1HYJ A;  3P1C A;  4A49 A;  4NRB A;  5CZG A;  2E6R A;  2LV9 A;  4LJN A;  2R0S A;  5DFC A;  4QR3 A;  4TT6 A;  5J0D A;  5EPB A;  2YSM A;  5A5O A;  5ACY A;  4NN2 A;  4QSW A;  5F1L A;  5EI4 A;  2ECG A;  4QF3 A;  3AAD A;  3Q2E A;  4AUQ B;  3G0L A;  4X3G A;  5D26 A;  4QC3 A;  3UW9 A;  4Y03 A;  5FH7 A;  5TB6 A;  5I7Y A;  4LC2 A;  5TDW A;  4QY4 A;  4CUR A;  3RPG C;  2JMI A;  5TCM A;  2I50 A;  4YYK A;  2KR4 A;  3QZS A;  2MT5 A;  5HJC A;  1X0J A;  1K2F A;  2KWJ A;  5CUC A;  4GNE A;  5DYA A;  3HCU A;  2N9G A;  4FLP A;  1WGM A;  5ETD A;  3U5K A;  5CQ5 A;  4HXO A;  4Q0N A;  3U5O A;  4YYD A;  5F2P A;  4Z6I A;  5DKA A;  4UIZ A;  2MJV B;  4GNG A;  4HXR A;  4HXN A;  5D3T A;  2F42 A;  2LGL A;  3ZNI A;  4O7E A;  5F36 A;  4R2Y A;  5EPS A;  5HCL A;  4ZQL A;  2KWO A;  3LQJ A;  5KH9 A;  4MEQ A;  4HXS A;  3LRQ A;  4YAT A;  1X4J A;  3JVJ A;  2GRC A;  4NR6 A;  5I89 A;  4F3I A;  4Z93 A;  4QR5 A;  4C67 A;  1BOR A;  2EGP A;  2UZG A;  4TKP B;  4PY6 A;  5E73 A;  4UIY A;  4Z1Q A;  4B86 C;  5G05 B;  4YBT A;  3FL2 A;  5AIU A;  4CFK A;  4LYS A;  4QC1 A;  2EOD A;  2Y1M A;  4TU6 A;  3O33 A;  4QR4 A;  4QZS A;  1WEW A;  4V3K C;  4QSQ A;  4W4U A;  2VJE B;  2QJ0 A;  5DYC A;  2E3K A;  5G4S A;  3IU6 A;  3QZT A;  4LAD B;  4LDF A;  2KRE A;  3PUQ A;  3MB3 A;  1WEO A;  3NXB A;  4A9O A;  2EA6 A;  3Q2F A;  4BW2 A;  5FH6 A;  2YUC A;  3I2D A;  4L7X A;  4O74 A;  4NUC A;  4NYW A;  3C5K A;  2D9E A;  2CSZ A;  2HYE D;  5CQ4 A;  2VPE A;  1JM4 B;  2FUI A;  2R0Y A;  2ZET C;  2LXP C;  3GL6 A;  3LJW A;  5EU1 A;  2KU3 A;  2DWW A;  2KTB B;  1N72 A;  5IBN A;  4S3O B;  4NUE A;  1XWH A;  4QEU A;  4O7A A;  5HFR A;  5D3J A;  4FJC A;  3UVY A;  2L43 A;  5CQ7 A;  5B78 A;  5ENJ A;  2CKL A;  4Z1S A;  4XUB A;  4N4F A;  5CUB A;  4YYJ A;  4LRG A;  4IR5 A;  5D3L A;  1WEV A;  1E6I A;  2KGG A;  2MUM A;  2RFJ A;  1U6G B;  4Q0O A;  2YUR A;  2I8N A;  5JI8 A;  4HXP A;  2YW5 A;  3U5L A;  4MSX A;  5AME A;  4PTB A;  4Z6H A;  4QF2 A;  5DYU A;  5EIC A;  5DY7 A;  5EV9 A;  5I3L A;  1WEU A;  5HQ5 A;  5LCW B;  2VPG A;  4PCE A;  3P1D A;  2Y43 A;  5B76 A;  4HBY A;  3G0J A;  4BBQ A;  4NR9 A;  3O34 A;  4OGJ A;  5A81 A;  5B79 A;  4NYX A;  2ECJ A;  1X4U A;  5DFD A;  4B7Y C;  3S92 A;  5I40 A;  2Y1N A;  4A9H A;  4I7D A;  2FSA A;  1WIL A;  2M6M A;  2PUY A;  3SOW A;  5AD3 A;  4RVR A;  5EA1 A;  2ECV A;  2D82 A;  5C87 A;  2K4D A;  1ZBD B;  2JMJ A;  3EB6 A;  5EWV A;  5HLS A;  5HRW A;  3SOU A;  5EQ1 A;  1JSP B;  4OUF A;  5CUE A;  4MEO A;  4QSS A;  5E3G A;  5F3A A;  3C6W A;  3LQH A;  4TYL A;  4LKA A;  2IDA A;  4YYG A;  5ENG A;  2YHO A;  4E96 A;  2KE1 A;  2RNW A;  5KTU A;  3KV5 A;  3N9P A;  2VP7 A;  2LN0 A;  4IR3 A;  4YAD A;  3IU5 A;  2LSP B;  5KTX A;  5C85 A;  5CQ3 A;  5EWC A;  2JMD A;  4FIP A;  3HCS A;  3M99 A;  5E9Y A;  2ECW A;  5ETB A;  4J1P A;  5IGL A;  4TZ8 A;  1WEE A;  2H0D B;  5LKX A;  4NR4 A;  4QB3 A;  5II1 A;  5E7D A;  4CL9 A;  1LDJ B;  3SOX A;  2C2L A;  3P1F A;  3P5O A;  2G6Q A;  2QIC A;  2YRE A;  4TQN A;  3U5P A;  4YBS A;  5CQA A;  5BT5 A;  2G43 A;  4IOQ A;  3ASL A;  5EWH A;  5CU8 A;  4HBX A;  3ZPV 1;  4XUA A;  2L0B A;  5E0R A;  2LDR A;  4QUU A;  3JVK A;  4IOR A;  5FE0 A;  4MVT A;  4GB0 A;  2CKL B;  5FH8 A;  4QUT A;  5E74 A;  4HXK A;  2YYR A;  2L5U A;  5HRV A;  4YY6 A;  4A9I A;  3O35 A;  5D7X A;  5L8T A;  4F52 B;  5KH3 A;  4LYI A;  3PUR A;  5FE3 A;  5F25 A;  5EPR A;  5IGM A;  5D3R A;  2VPB A;  5G04 B;  4YYH A;  5IG6 A;  1Z60 A;  5LJ0 A;  5KU3 A;  1WEQ A;  3HMH A;  5FDZ A;  3SVF A;  4PCI A;  1E4U A;  2YEL A;  2ECN A;  3N9M A;  5EGU A;  1WEM A;  3JVM A;  4O7F A;  4ZC9 A;  5F62 A;  5EP7 A;  5I29 A;  2F6J A;  4YC9 A;  5B77 A;  5ENB A;  4CUP A;  4TTE A;  4CFL A;  2KFT A;  2NAA A;  5EIS A;  5H1V A;  4TT2 A;  4UIW A;  4DON A;  2M85 A;  2KIZ A;  3T7L A;  5ENF A;  2I7K A;  3AQA A;  3UVW A;  2YHN A;  3MQM A;  2RO1 A;  5E9V A;  5F60 A;  3SVG A;  5LKT A;  5I88 A;  4A4C A;  4LZR A;  4TU4 A;  3VK6 A;  3ZPV E;  4HXM A;  4NS5 A;  4WIV A;  5B8D A;  4BJX A;  4TT4 A;  5I1Q A;  4UIX A;  4NRC A;  2PNX A;  5A5S A;  4S3O C;  4ZW1 A;  4A9N A;  5CQ8 A;  2K17 A;  4UYE A;  5FE4 A;  4A9F A;  3ZYQ A;  2RS9 B;  2H0D A;  5DKC A;  3RTR B;  5DBM A;  5F61 A;  4YYM A;  5FEY A;  1WEN A;  4UIT A;  2YDW A;  4QSR A;  4LK9 A;  4WA6 A;  1JM7 B;  1F62 A;  5CUG A;  5CP5 A;  2YQL A;  4BW4 A;  4NR8 A;  4XYA A;  2QIZ A;  4C9Z A;  4I7C A;  4NYV A;  4MR4 A;  5HEM A;  3L1X A;  5EK9 A;  4MR3 A;  4GND A;  5CUD A;  1WUG A;  5FG6 A;  5IGK A;  1FP0 A;  5CS8 A;  4WHU A;  5F5Z A;  4NQM A;  5DYX A;  4OGI A;  5FE6 A;  4NXJ A;  4BW1 A;  3HCT A;  3MB4 A;  2H60 A;  5HRX A;  4LYW A;  5FG4 A;  1F68 A;  2WP1 A;  4QST A;  4UYF A;  3N9N A;  1VFY A;  5L96 A;  4A9E A;  4A9M A;  4O78 A;  2ECT A;  5DKH A;  2OUO A;  3SVH A;  4QSP A;  1Z2Q A;  5IID A;  4QYD A;  2K1J A;  5TDR A;  5BT4 A;  4IOO A;  5D3H A;  2VJF A;  3HTK C;  5EVA A;  5F1H A;  4O64 A;  4QSV A;  3O7A A;  2MA5 A;  5CRZ A;  4CA1 A;  3U5N A;  4NR7 A;  5E3D A;  5CPE A;  3MHS A;  4R8P K;  4TZ2 A;  5C89 A;  5ENC A;  2LRI C;  5DKD A;  4LZS A;  5HM0 A;  5KTW A;  3GV4 A;  5D1L B;  5FE8 A;  1ZS5 A;  1MM2 A;  1WIM A;  3RCW A;  4QBM A;  3UVD A;  2LQ6 A;  5IGN A;  5HEL A;  4N3W A;  1MM3 A;  5D3N A;  2RSD A;  5A83 A;  4GNF A;  5L97 A;  4IR6 A;  2YQD A;  3JVL A;  5HQ7 A;  3N9L A;  3ONI A;  4TS8 A;  5I80 A;  4UYD A;  5CGP A;  5TBN A;  4IC3 A;  4N4G A;  2YEK A;  2DVQ A;  5HQ6 A;  4A0C D;  5DX4 A;  5AD2 A;  2CT2 A;  5ENI A;  5B75 A;  3ZYU A;  2KWN A;  2YU4 A;  2YEM A;  4WZ2 A;  2MIQ A;  1X4I A;  3N9Q A;  1JM7 A;  4WZ0 A;  1WES A;  5CQT A;  4ALG A;  4J0S A;  2DVS A;  2K16 A;  5LVQ A;  3U5J A;  5H9M A;  5E9L A;  3L1Z B;  1WFK A;  5JG6 A;  5CUA A;  5E9M A;  4WZ3 B;  3I3J A;  2YT5 A;  5FE1 A;  3KNV A;  5L98 A;  3LQI A;  1CHC A;  4QSU A;  5C13 A;  1JOC A;  5E9K A;  1VYX A;  1LDK C;  3KQI A;  3O37 A;  3MUL A;  4YYI A;  1V87 A;  5FBX A;  3D7C A;  5KHM A;  2MA6 A;  4UP0 A;  4CCG X;  4J0R A;  4YBM A;  5I7X A;  5KH7 A;  3HME A;  4L58 A;  4J3I A;  5D1M B;  5LVR A;  4NUD A;  5COI A;  2OSS A;  4UYF B;  4LZ2 A;  2NXB A;  5II2 A;  2DAT A;  4YH4 A;  1VD4 A;  4YK0 A;  4YYN A;  4ALH A;  2VNF A;  5D3S A;  2E7N A;  2L80 A;  2MD7 B;  5TAB A;  3UV2 A;  3T6R A;  5C7N A;  5D1K B;  4HXL A;  1RMD A;  5H1T A;  5CQ6 A;  2KWK A;  3UV4 A;  4CUT A;  1FBV A;  3DPL R;  2FUU A;  2VJF B;  2E7O A;  4O7B A;  2L84 A;  3U5M A;  4AYC A;  3LXJ A;  2YSJ A;  3PHD A;  2MD8 C;  3GG3 A;  5J3X A;  2RNX A;  3L11 A;  5C8G A;  4GPJ A;  4YY4 A;  2YYN A;  4QNS A;  5A5P A;  2RI7 A;  3V43 A;  2C2V S;  1IYM A;  4O70 A;  4CLB A;  3ZVY A;  4XI1 A;  4O7C A;  3RPG B;  4AP4 A;  3M63 A;  3P1E A;  5CY9 A;  3DAI A;  2LGV A;  4FK5 A;  3NG2 A;  4O77 A;  5CFW A;  5H85 A;  2XEU A;  3TLP A;  4CUS A;  4UYH A;  4A9L A;  5A5Q A;  1DVP A;  4I7B A;  3M62 A;  2F6N A;  2LGK A;  5HFQ A;  4MEN A;  4QEV A;  4YAB A;  4WHW A;  5AIT A;  1HYI A;  2M3H A;  5A5N A;  5EYA F;  5EWD A;  2VPD A;  4X2I A;  1Z6U A;  3MHH A;  2D8S A;  5E9I A;  1G25 A;  5FB1 A;  5D0C A;  4UIU A;  2RNY A;  4MR6 A;  5A82 A;  5H1U A;  3ZVZ B;  3K2J A;  4O71 A;  2DVR A;  5G0F A;  5TRB A;  3KV6 A;  4QYL A;  5F63 A;  5FG5 A;  1WUM A;  2MNZ A;  4P5O B;  4V3L C;  4IR4 A;  4NRA A;  4N4H A;  4QEW A;  4QSX A;  1EQF A;  1WE9 A;  4IC2 A;  2R10 A;  4UI9 B;  3O36 A;  4UIV A;  5EWW A;  4MEP A;  4BHW A;  5DLZ A;  3EB5 A;  5FB0 A;  5D3P A;  5DIN A;  3MXF A;  3DWY A;  5KO4 A;  5FFW A;  5FER A;  4ZDT A;  5LJ2 A;  1T1H A;  3ZTG A;  5HEN A;  5A7C A;  5C11 A;  3DQV R;  2YW8 A;  5A85 A;  4PPE A;  5FE5 A;  4LR6 A;  4AYC B;  3HMF A;  5FFV A;  5A5R A;  4HBV A;  4NQN A;  4PS5 A;  5ENE A;  3FKM X;  5L8U A;  2L75 A;  5CRM A;  2MNY A;  5FE2 A;  4PKL A;  4KV1 A;  4AVX A;  2DKW A;  2HDP A;  4MR5 A;  4XY8 A;  1N87 A;  5LUU A;  2G4A A;  5D24 A;  2LGG A;  4N4I A;  4O76 A;  5JWM A;  4UP5 A;  4YAX A;  2OO1 A;  4Q6F A;  2OXQ C;  4AKN A;  3UV5 A;  4A9J A;  4A9K A;  4FO9 A;  5L99 A;  5LKU A;  4HBW A;  3IHP A;  5EM3 A;  4XY9 A;  5ENH A;  5CTL A;  2DX8 A;  3MUK A;  3QZV A;  4YH3 A;  4C66 A;  5I83 A;  2G45 A;  2L5E A;  5DFB A;  4CUU A;  5DW2 A;  2KGI A;  5FE9 A;  4NR5 A;  4CUQ A;  4KCX A;  3S91 A;  5LKZ A;  3UVX A;  4LLB A;  2BAY A;  4A4B A;  4KV4 A;  4BW3 A;  5FE7 A;  2WP2 A;  1WEP A;  5C4Q A;  2CSY A;  2M1R A;  2VJE A;  5FFY A;  5LJ1 A;  3O70 A;  5DLX A;  2ECI A;  2JRJ A;  2LXH C;  4R7E A;  4ZUX U;  2YQM A;  5D25 A;  5I86 A;  2XB1 A;  3N9O A;  2L85 A;  5K29 A;  2DVV A;  5DW1 A;  2E6S A;  4UYG A;  2R0V A;  5G4R A;  5BT3 A;  2AN6 A;  2KYU A;  4O72 A;  4O75 A;  5AMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...