3U5OA

Crystal structure of the complex of trim33 phd-bromo and h3(1-22)k9me3k14ack18ac histone peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
189
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 54
structure length 189
sequence length 205
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5oA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5oA01
3O35A 4NUDA 5CUBA 5E3DA 4NRCA 2KWKA 5AD2A 4NR9A 2C2VS 3HCTA 4OGIA 5F60A 4GNDA 2H60A 2YW5A 3U5JA 2QICA 4C67A 5IGMA 2LGKA 2YHNA 2RS9B 5LVQA 2OXQC 3JVMA 2LXHC 5ENIA 1MM3A 1RMDA 5TRBA 5A82A 4BW1A 3P1FA 5K29A 2KYUA 4QUTA 2EGPA 5FFWA 3RTRB 4UITA 1WEWA 2ECGA 1WEPA 4UIZA 4R8PK 5CQ8A 5FH6A 4LC2A 5KTXA 1Z6UA 4ZDTA 1LDKC 5A81A 5I40A 5CUAA 5F2PA 3P1EA 2LGVA 2NAAA 4AUQB 2M85A 4O78A 4Q0OA 4A9MA 5LJ0A 1WEOA 4QF3A 3FKMX 5L8TA 2FUIA 4BJXA 4TU6A 3QZTA 5CQ4A 4GNGA 4WZ2A 3MB4A 5L96A 4RVRA 2WP1A 4CUUA 2R0YA 3HMHA 3G0LA 4YYJA 4QUUA 4A9EA 1DVPA 5F25A 5E9VA 2K16A 2M3HA 1WUGA 2L84A 2K1JA 2L80A 3M62A 4QNSA 4N4HA 5CS8A 2DVQA 5E3GA 5FE4A 5I29A 4PPEA 4LZRA 5ENJA 5E0RA 4NS5A 3N9MA 2YELA 4O64A 4CFKA 4A9OA 3Q2FA 2RI7A 4L58A 1JM7A 1HYJA 4O77A 4TZ2A 2M1RA 5FE0A 5AD3A 4TT4A 4UYEA 1F62A 4QSRA 5HQ5A 4HXKA 4NYXA 2VJFB 4YBTA 2PNXA 4IOQA 4A49A 4QSSA 4ZUXU 2DVSA 2LGLA 4YABA 4QEWA 2LXPC 4TKPB 2E6SA 5A5SA 5HCLA 1ZS5A 2H0DB 4UI9B 5F63A 4A9IA 4QSTA 2VP7A 5F61A 2IDAA 5EA1A 4QY4A 2KE1A 5DW2A 5C89A 5FDZA 3SVFA 2K17A 5IGLA 5HQ7A 2D82A 4HBYA 2MJVB 3N9OA 5H1TA 4BW3A 4GPJA 4A9LA 3DQVR 5HRWA 2OSSA 5L98A 3HCUA 1Z60A 5EV9A 1VD4A 5H1UA 4LYIA 5G0FA 5F1HA 4Y03A 3IU5A 5E73A 3SVGA 4YH3A 5FE2A 4MR3A 1FP0A 2KWNA 4C66A 4NR4A 5EPBA 4HXMA 5A5NA 4O7CA 4QYDA 4A4BA 4UIYA 2DWWA 4BHWA 2I50A 2HDPA 5DYXA 5D24A 1N72A 5A5OA 3O33A 5A5RA 2E7OA 2R0VA 5HFQA 3S92A 5IIDA 3IHPA 4UYFB 5D3TA 1Z2QA 3AADA 4QYLA 4KCXA 3QZVA 4TZ8A 2ZETC 4LLBA 5D3RA 4LKAA 3UV4A 5CZGA 3RCWA 4P5OB 4UP0A 3TLPA 3N9LA 4UIVA 4FIPA 5DINA 5EQ1A 5D3SA 2VNFA 4R7EA 5TABA 3MUKA 4HXLA 4F52B 1V87A 2YQMA 3N9QA 5KTUA 5I3LA 3L1ZB 3DPLR 5EWVA 5JG6A 4J0RA 5AMFA 2CKLA 5A85A 3SOWA 4TT2A 2MIQA 4IC3A 5CY9A 2L5UA 4O75A 5DYCA 4HBWA 5DKHA 3RPGB 2LN0A 5CQ3A 5KO4A 2YEKA 2N9GA 5A7CA 5HRXA 2L0BA 5J0DA 4PKLA 4KV1A 5B78A 5ETDA 5FH8A 4TS8A 1WE9A 2YREA 3GL6A 5II1A 3U5LA 2D8SA 4QR5A 2DATA 1WFKA 4CUSA 2WP2A 2YURA 3DWYA 3LQHA 5D3JA 5D25A 5DKCA 4YATA 5TB6A 2YEMA 5LKTA 3MHSA 3UW9A 4YY6A 4O7BA 4Z93A 2YU4A 4BW2A 4YBMA 5CUCA 3ZTGA 5CQ6A 2VJEA 1X4JA 4Z1SA 5BT4A 3M63A 3NG2A 2MNYA 5TDWA 4O7EA 4LR6A 1EQFA 4HXRA 4QC3A 5C7NA 4GNFA 2L5EA 5D1KB 1U6GB 5D3LA 3AQAA 3HMFA 4HXSA 5J3XA 1JOCA 4CURA 5EWCA 5I7YA 4QR4A 3U5OA 4N3WA 4B7YC 5TBNA 2E6RA 5LVRA 2LRIC 4YH4A 4YADA 2OO1A 2MUMA 2CT2A 2MD7B 2Y1MA 2YHOA 3EB5A 1XWHA 3U5MA 4IC2A 5DFDA 3MHHA 4W4UA 3G0JA 5COIA 5TCMA 5C85A 3UVDA 4ZQLA 5I83A 4N4IA 1WEUA 1WILA 2D9EA 3IU6A 4NQMA 2EA6A 5CTLA 5BT5A 5B77A 2YW8A 5DKAA 5CUGA 5DLZA 1T1HA 4GB0A 5EYAF 3P1DA 5CUEA 2HYED 3JVLA 3LJWA 4HBVA 4NRBA 5H85A 4LK9A 3L1XA 4C9ZA 5B79A 4TQNA 4LADB 4YYDA 5EU1A 5HENA 3VK6A 4AYCA 4UIWA 5FE7A 5H1VA 2XB1A 4A9HA 5I88A 4QBMA 4WHUA 4R2YA 4CLBA 2KTBB 5DYAA 1MM2A 3ZYQA 1WGMA 2GRCA 5FE3A 4MSXA 2RNYA 5HLSA 2RNXA 5F36A 5D7XA 4Z1QA 4MEOA 4BW4A 5CQAA 5TDRA 5KHMA 2XEUA 4J3IA 2R10A 3UVYA 4ALGA 2VPGA 5EWWA 5HQ6A 1WUMA 3PUQA 1E6IA 4B86C 2E7NA 4O71A 2DVRA 4WZ0A 4IR6A 5C13A 2KWOA 3LXJA 5ENFA 4AP4A 5CRMA 5FE8A 3KNVA 3RPGC 1K2FA 1X0JA 4X2IA 4NR8A 5D1MB 2Y1NA 2YYNA 4A9JA 1WEQA 5EM3A 2YUCA 2KWJA 5A83A 2R0SA 4A9KA 5ENHA 4ZW1A 2UZGA 2I8NA 4J1PA 5B8DA 2L43A 4YYGA 4IR3A 4XI1A 5DFCA 5C8GA 2ECWA 3N9PA 5EPSA 4PY6A 1JM7B 3SHBA 2ECIA 4L7XA 3ZYUA 5FBXA 2JRJA 3KV6A 4MEQA 1IYMA 5D3NA 3ZPVE 3QZSA 2OUOA 5G4SA 5LJ2A 2YT5A 2LSPB 5LKZA 3HCSA 2MD8C 4QEUA 5HJCA 4A0CD 4PCIA 2DX8A 4YYIA 2RNWA 3DAIA 2YSMA 3C6WA 3EB6A 3NXBA 3U5KA 3C5KA 4LZ2A 4MEPA 5EI4A 2BAYA 3O34A 2FSAA 4NRAA 1E4UA 5AITA 3JVJA 5JI8A 2LDRA 2G43A 5E9IA 3L11A 3PHDA 5EGUA 5IG6A 4MVTA 5D3PA 5DFBA 4LYSA 2LGGA 5HEMA 5EWHA 2G4AA 2PUYA 5FEYA 2E3KA 4IORA 4I7BA 5ENBA 2G6QA 1JM4B 2CSZA 4OUFA 4PS5A 5EK9A 5KH3A 5LUUA 1G25A 4WIVA 2KIZA 5KU3A 2F6JA 3LQJA 5D26A 5DY7A 3ASLA 5EVAA 3PURA 2YYRA 4YY4A 4V3LC 4NR7A 5G4RA 5FE9A 1WENA 5EICA 5A5PA 5FE5A 2ECVA 4S3OB 4UIUA 4O70A 3HMEA 4QSUA 2YSJA 1LDJB 5FE6A 3LRQA 5IBNA 5B76A 3LQIA 4Q0NA 5CPEA 4XUBA 4FJCA 2F42A 5JWMA 4HXPA 3D7CA 3U5NA 2CSYA 4I7CA 4QC1A 2VPBA 2K4DA 4TU4A 3UV5A 2VJFA 1WESA 5KH9A 3ZPV1 2JMIA 1X4IA 4CFLA 5G05B 4NYWA 5FB0A 4O7AA 4YYMA 5I1QA 5ENEA 2H0DA 3O70A 3K2JA 5FFYA 3N9NA 3MXFA 4UYDA 4NXJA 4CL9A 5FH7A 3V43A 4A9FA 4NR5A 2YQDA 4AVXA 4QZSA 3O7AA 2FUUA 4LRGA 5LKUA 4XUAA 4QSVA 5F62A 4HXNA 5CQTA 4I7DA 2YDWA 5IGKA 2CKLB 2RO1A 2ECTA 5LJ1A 5KH7A 4FLPA 3ZNIA 5EPRA 4MR6A 1FBVA 2MNZA 3I3JA 5AIUA 4QSXA 3UV2A 2EODA 4KV4A 5FERA 2VPDA 5HFRA 2KFTA 4LZSA 2DVVA 1VYXA 4UYHA 3KQIA 4HBXA 4YAXA 3Q2EA 4OGJA 5E9MA 3O37A 4ZC9A 1WIMA 4Q6FA 4MR5A 3JVKA 2VPEA 3M99A 4O7FA 3ZVZB 4Z6HA 3P5OA 2KGGA 5ENGA 3FL2A 2I7KA 4O72A 4UYGA 5C11A 3T7LA 5FG5A 5CU8A 3GV4A 3ONIA 5F3AA 4QSPA 1CHCA 3MB3A 5L99A 4UYFA 1WEVA 4FO9A 4LDFA 5F5ZA 5E74A 2YQLA 4XYAA 4XY9A 1JSPB 5DKDA 2NXBA 2VJEB 4NUEA 3SOXA 4CA1A 5FE1A 5I7XA 2LQ6A 4E96A 4F3IA 5KTWA 5ENCA 5FFVA 2JMJA 4QF2A 1HYIA 4LYWA 4BBQA 4NN2A 4N4FA 4MR4A 3U5PA 4IOOA 5HELA 5B75A 4TYLA 5C4QA 3HTKC 5LCWB 5E9LA 4CUQA 4J0SA 2L75A 5D1LB 5E9KA 5C87A 3KV5A 2QJ0A 5G04B 3ZVYA 4YYKA 2MA5A 3T6RA 2KR4A 4GNEA 4NQNA 4PCEA 4CUTA 5E9YA 5EWDA 4S3OC 3S91A 4QSWA 3P1CA 4MENA 4QR3A 4ALHA 5A5QA 2QIZA 4YBSA 4UP5A 5I89A 4PTBA 4A4CA 2L85A 2KU3A 5DW1A 2MT5A 5FG4A 2RSDA 5DLXA 1X4UA 3GG3A 5CQ5A 5DYUA 5CFWA 4IR4A 3UVXA 4YYNA 4WHWA 2ECNA 4TT6A 2MA6A 4X3GA 5HM0A 5E7DA 5DX4A 4YK0A 2RFJA 4XY8A 2AN6A 4AYCB 5FG6A 4NYVA 5DBMA 2LV9A 4TTEA 5HRVA 5H9MA 3SOUA 5CQ7A 4A9NA 5II2A 4CUPA 4YC9A 5CGPA 4LJNA 4HXOA 4YYHA 4UIXA 3SVHA 5IGNA 5CUDA 4V3KC 1BORA 4Z6IA 4O76A 1N87A 5F1LA 4WZ3B 4DONA 4AKNA 1VFYA 4NUCA 4QB3A 1ZBDB 2KREA 5L97A 4FK5A 2C2LA 3MQMA 2JMDA 5CRZA 4N4GA 5I86A 1WEMA 3MULA 5D0CA 5AMEA 5D3HA 4O74A 5ETBA 1F68A 2DKWA 5FB1A 1WEEA 2KGIA 4WA6A 5ACYA 3O36A 2F6NA 4IR5A 5BT3A 2ECJA 2G45A 5I80A 4NR6A 4QSQA 5LKXA 4CCGX 2Y43A 3I2DA 5EP7A 4QEVA 5EISA 2M6MA 5L8UA 5CP5A 3UVWA
chains in the Genus database with same CATH superfamily
3O35A 4NUDA 5CUBA 5E3DA 4NRCA 2KWKA 5AD2A 4NR9A 2C2VS 3HCTA 4OGIA 5F60A 4GNDA 2H60A 2YW5A 3U5JA 2QICA 4C67A 5IGMA 1DCQA 2LGKA 2YHNA 2OWAA 2RS9B 5LVQA 2OXQC 3JVMA 2LXHC 5ENIA 1MM3A 1RMDA 5TRBA 5A82A 4BW1A 3P1FA 5K29A 2KYUA 4QUTA 2EGPA 5FFWA 3RTRB 4UITA 1WEWA 2ECGA 1WEPA 4UIZA 4R8PK 5CQ8A 5FH6A 4LC2A 2EXUA 5KTXA 1Z6UA 4ZDTA 1LDKC 5A81A 5I40A 5CUAA 5F2PA 3P1EA 2LGVA 2NAAA 4AUQB 2M85A 3D1BA 4O78A 4Q0OA 4A9MA 5LJ0A 1WEOA 4QF3A 2XOYA 3FKMX 5L8TA 2FUIA 4BJXA 4TU6A 3QZTA 5CQ4A 4GNGA 4WZ2A 3MB4A 5L96A 4RVRA 3FJUB 2WP1A 4CUUA 2R0YA 3HMHA 3G0LA 4YYJA 4QUUA 4A9EA 1DVPA 5F25A 5E9VA 2K16A 2M3HA 1WUGA 2L84A 2K1JA 2L80A 3M62A 4AI6A 4QNSA 4N4HA 5CS8A 2DVQA 5E3GA 5FE4A 5I29A 4PPEA 4LZRA 5ENJA 5E0RA 4NS5A 3N9MA 2YELA 4O64A 4CFKA 4A9OA 3Q2FA 2RI7A 4L58A 1JM7A 1HYJA 5SVXA 4O77A 4TZ2A 2M1RA 5FE0A 5AD3A 4TT4A 4UYEA 1F62A 4QSRA 5HQ5A 4HXKA 4NYXA 3JUEA 2VJFB 4YBTA 2PNXA 4IOQA 4A49A 4QSSA 4ZUXU 2DVSA 3LRQA 2LGLA 4YABA 4QEWA 2LXPC 4TKPB 2E6SA 5A5SA 5HCLA 1ZS5A 2H0DB 4UI9B 5F63A 4A9IA 4QSTA 2VP7A 5F61A 2IDAA 5EA1A 4QY4A 3O47A 2CRRA 2KE1A 5DW2A 5C89A 4F1PA 4AKGA 5FDZA 3SVFA 2K17A 3FEHA 5IGLA 5HQ7A 2D82A 4HBYA 2MJVB 3N9OA 5H1TA 4BW3A 4GPJA 4A9LA 4Z0OA 3DQVR 5HRWA 2OSSA 5L98A 3HCUA 1Z60A 5EV9A 1VD4A 5H1UA 4LYIA 5G0FA 5F1HA 4Y03A 3ERRA 3IU5A 5E73A 3SVGA 4YH3A 5FE2A 4MR3A 1FP0A 2JM3A 2KWNA 3FANA 5SVYA 4C66A 4NR4A 5EPBA 4HXMA 5A5NA 2L7PA 4H9DA 4O7CA 4QYDA 4A4BA 4UIYA 2DWWA 4BHWA 2I50A 2HDPA 1ZKRA 5D24A 1N72A 5DYXA 5A5OA 3O33A 5A5RA 2E7OA 4Z0RA 2R0VA 5HFQA 3S92A 5IIDA 3IHPA 4UYFB 5D3TA 1Z2QA 3AADA 4QYLA 4KCXA 3FAOA 3QZVA 4TZ8A 2ZETC 4LLBA 5D3RA 4LKAA 3UV4A 5CZGA 3RCWA 1MBMA 4P5OB 4UP0A 3TLPA 3N9LA 4UIVA 2M13A 4FIPA 5DINA 5EQ1A 5D3SA 2VNFA 4R7EA 5TABA 3MUKA 4HXLA 4F52B 1V87A 2YQMA 3N9QA 5KTUA 3VKHA 5I3LA 3L1ZB 3DPLR 5EWVA 5JG6A 4J0RA 5AMFA 2CKLA 5A85A 3SOWA 4TT2A 2MIQA 3D1DA 4IC3A 5CY9A 2L5UA 4O75A 5DYCA 4O62A 4HBWA 5DKHA 3VKGA 3RPGB 2XOCA 2LN0A 5CQ3A 3E2DA 5KO4A 2YEKA 2N9GA 5A7CA 5HRXA 2L0BA 2RR4A 5J0DA 4PKLA 4KV1A 5B78A 5ETDA 5FH8A 4TS8A 1WE9A 2YREA 3GL6A 5II1A 3U5LA 2D8SA 4QR5A 2DATA 1WFKA 4CUSA 2WP2A 2YURA 3DWYA 3LQHA 5D3JA 5D25A 5DKCA 4YATA 5TB6A 2YEMA 5LKTA 3MHSA 3UW9A 4YY6A 3PLWA 4O7BA 4Z93A 2YU4A 4BW2A 4YBMA 5CUCA 3ZTGA 5CQ6A 2VJEA 1X4JA 4Z1SA 5BT4A 3M63A 3NG2A 2MNYA 5TDWA 4O7EA 4LR6A 1EQFA 4HXRA 4QC3A 5C7NA 4GNFA 2L5EA 5D1KB 1U6GB 2LAUA 5D3LA 3AQAA 3HMFA 4HXSA 5J3XA 1JOCA 4CURA 5EWCA 2XP0A 5I7YA 5SVIB 4QR4A 3U5OA 4N3WA 4B7YC 5TBNA 2E6RA 5LVRA 2LRIC 4YH4A 4YADA 2OO1A 2MUMA 2CT2A 2MD7B 2Y1MA 2YHOA 2YVRA 3EB5A 1XWHA 3U5MA 3FM8C 4IC2A 5DFDA 3MHHA 4W4UA 3G0JA 5COIA 5TCMA 2EGMA 5C85A 3UVDA 4ZQLA 5I83A 4N4IA 1WEUA 1WILA 2D9EA 3IU6A 4NQMA 2EA6A 5CTLA 5BT5A 5B77A 2YW8A 5DKAA 5CUGA 5DLZA 1T1HA 4GB0A 5EYAF 3MDBC 3P1DA 5CUEA 2HYED 3JVLA 3LJWA 4HBVA 4NRBA 5H85A 2FD4A 4LK9A 3L1XA 4C9ZA 5B79A 3KDEC 4TQNA 2D8UA 4LADB 4YYDA 5EU1A 5HENA 3VK6A 4AYCA 4UIWA 5FE7A 5H1VA 2XB1A 4A9HA 5I88A 4QBMA 4WHUA 4R2YA 4CLBA 2KTBB 5DYAA 1MM2A 3ZYQA 1WGMA 2GRCA 5FE3A 4MSXA 2RNYA 5HLSA 2RNXA 5F36A 5D7XA 4Z1QA 4MEOA 5K3QA 4BW4A 5CQAA 4AKHA 5TDRA 5KHMA 2XEUA 3Q1DA 4J3IA 2R10A 3UVYA 4ALGA 2VPGA 5EWWA 5HQ6A 1WUMA 3PUQA 1E6IA 4B86C 2E7NA 4O71A 2DVRA 4WZ0A 4IR6A 5C13A 2KKXA 3LXJA 5ENFA 2KWOA 4AP4A 5CRMA 5FE8A 3KNVA 3RPGC 1K2FA 1X0JA 4X2IA 4NR8A 5D1MB 2Y1NA 2YYNA 4A9JA 1WEQA 5EM3A 2YUCA 2KWJA 5A83A 2R0SA 3LVQE 4A9KA 5ENHA 4ZW1A 2UZGA 2I8NA 4J1PA 5B8DA 2L43A 4YYGA 4IR3A 4XI1A 5DFCA 5C8GA 2ECWA 3N9PA 5EPSA 4PY6A 1JM7B 3SHBA 2ECIA 4L7XA 3ZYUA 5FBXA 2JRJA 3KV6A 4MEQA 1IYMA 5D3NA 3ZPVE 3QZSA 2OUOA 5G4SA 5LJ2A 2YT5A 2EJNA 2LSPB 5LKZA 3HCSA 2MD8C 4QEUA 5HJCA 4A0CD 4PCIA 5B76A 2CSVA 2DX8A 4YYIA 3LDYA 2RNWA 3DAIA 2YSMA 3C6WA 3H7HA 3EB6A 3NXBA 3U5KA 3C5KA 4LZ2A 4MEPA 5EI4A 2BAYA 3O34A 2FSAA 4NRAA 1E4UA 5AITA 3JVJA 2E61A 5JI8A 2LDRA 2G43A 5E9IA 3L11A 3PHDA 2CRWA 5EGUA 5IG6A 4MVTA 5D3PA 5DFBA 2P57A 4LYSA 2LGGA 5HEMA 5EWHA 2G4AA 2PUYA 5FEYA 2E3KA 4IORA 4I7BA 5ENBA 2G6QA 1JM4B 2CSZA 4OUFA 4PS5A 5EK9A 5KH3A 5LUUA 1G25A 4WIVA 2KIZA 5KU3A 2F6JA 3LQJA 5D26A 5DY7A 3ASLA 5EVAA 3PURA 2YYRA 4YY4A 4V3LC 4NR7A 5G4RA 5FE9A 1WENA 5EICA 5A5PA 5FE5A 2ECVA 4S3OB 4UIUA 4O70A 3HMEA 4QSUA 2JUNA 1LDJB 5FE6A 2YSJA 5IBNA 2B0OE 3LQIA 3DDTA 4Q0NA 5CPEA 4XUBA 4FJCA 2F42A 3SUBA 5JWMA 4HXPA 3D7CA 3U5NA 2CSYA 4I7CA 4QC1A 2VPBA 2K4DA 4TU4A 3UV5A 2VJFA 1WESA 5KH9A 3ZPV1 2JMIA 1X4IA 4CFLA 5G05B 4NYWA 5FB0A 4O7AA 4YYMA 5I1QA 5ENEA 2H0DA 3O70A 3K2JA 5FFYA 3N9NA 3MXFA 4UYDA 4NXJA 4CL9A 5FH7A 3V43A 4A9FA 4NR5A 2XOZA 2YQDA 4AVXA 4QZSA 3O7AA 2FUUA 4LRGA 5LKUA 4XUAA 4QSVA 5F62A 4HXNA 5CQTA 4I7DA 2YDWA 5IGKA 2CKLB 2RO1A 2ECTA 5LJ1A 5KH7A 4FLPA 3ZNIA 5EPRA 4MR6A 3LJUX 1FBVA 2MNZA 3I3JA 5AIUA 4QSXA 3UV2A 2EODA 4KV4A 5FERA 2VPDA 5HFRA 2KFTA 4LZSA 2DVVA 1VYXA 4UYHA 3KQIA 4HBXA 4YAXA 3Q2EA 4OGJA 5E9MA 3O37A 4ZC9A 1WIMA 4Q6FA 4MR5A 3JVKA 2VPEA 3M99A 4O7FA 3ZVZB 4Z6HA 3P5OA 2KGGA 2IQJA 5ENGA 3FL2A 2I7KA 4O72A 4UYGA 5C11A 3T7LA 5FG5A 5CU8A 4AKIA 3GV4A 3ONIA 5F3AA 4QSPA 1CHCA 3MB3A 5L99A 4UYFA 1WEVA 4FO9A 4LDFA 5F5ZA 5E74A 2FFWA 2YQLA 4XYAA 4XY9A 1JSPB 5DKDA 2NXBA 2VJEB 4NUEA 3SOXA 4CA1A 5FE1A 5I7XA 2LQ6A 4E96A 4F3IA 5KTWA 5ENCA 5FFVA 2JMJA 4QF2A 1HYIA 4LYWA 4BBQA 4NN2A 4N4FA 2CONA 4MR4A 3U5PA 4IOOA 5HELA 5B75A 4TYLA 5C4QA 3HTKC 5LCWB 5E9LA 4CUQA 4J0SA 2L75A 5D1LB 3T9KA 2DJAA 5E9KA 5C87A 3KV5A 2QJ0A 5G04B 1PUOA 3ZVYA 4YYKA 2MA5A 3T6RA 2KR4A 4GNEA 4NQNA 4PCEA 4CUTA 5E9YA 5EWDA 4OGEA 4S3OC 3S91A 4QSWA 3P1CA 4MENA 4QR3A 4ALHA 5A5QA 2DSMA 2QIZA 4YBSA 4UP5A 5I89A 4PTBA 4A4CA 2L85A 2KU3A 5DW1A 2MT5A 5FG4A 2RSDA 5DLXA 1X4UA 3GG3A 5CQ5A 5DYUA 5CFWA 4IR4A 3UVXA 4YYNA 4WHWA 2ECNA 4TT6A 4QQ4A 2MA6A 4X3GA 5HM0A 5E7DA 5DX4A 4YK0A 2RFJA 4XY8A 2KKYA 3DWDA 2AN6A 4AYCB 5FG6A 4NYVA 5DBMA 2LV9A 4TTEA 5HRVA 5H9MA 3SOUA 5CQ7A 4A9NA 5II2A 4CUPA 4YC9A 5CGPA 4LJNA 4HXOA 4YYHA 4UIXA 3SVHA 5IGNA 5CUDA 4V3KC 1BORA 4Z6IA 4O76A 1N87A 5F1LA 4WZ3B 4DONA 4AKNA 1VFYA 3M7KA 4NUCA 4QB3A 1ZBDB 2KREA 5L97A 2MKEA 2C2LA 4FK5A 3MQMA 2JMDA 5CRZA 4N4GA 5I86A 1WEMA 3MULA 5D0CA 5AMEA 5D3HA 4O74A 5SVIA 5ETBA 1F68A 2DKWA 5FB1A 1WEEA 2KGIA 4OGCA 5ACYA 3O36A 2F6NA 4IR5A 5BT3A 2ECJA 2G45A 5I80A 4WA6A 3LVRE 4NR6A 4QSQA 5LKXA 4CCGX 2Y43A 3I2DA 5EP7A 4QEVA 5EISA 2M6MA 5L8UA 5CP5A 3UVWA
chains in the Genus database with same CATH topology
3O35A 4NUDA 5CUBA 5E3DA 4NRCA 2KWKA 5AD2A 4NR9A 2C2VS 3HCTA 4OGIA 5F60A 4GNDA 2H60A 2YW5A 3U5JA 2QICA 4C67A 5IGMA 2LGKA 2YHNA 2RS9B 5LVQA 2OXQC 3JVMA 2LXHC 5ENIA 1MM3A 1RMDA 5TRBA 5A82A 4BW1A 3P1FA 5K29A 2KYUA 4QUTA 2EGPA 5FFWA 3RTRB 4UITA 1WEWA 2ECGA 1WEPA 4UIZA 4R8PK 5CQ8A 5FH6A 4LC2A 5KTXA 1Z6UA 4ZDTA 1LDKC 5A81A 5I40A 5CUAA 5F2PA 3P1EA 2LGVA 2NAAA 4AUQB 2M85A 4O78A 4Q0OA 4A9MA 5LJ0A 1WEOA 4QF3A 3FKMX 5L8TA 2FUIA 4BJXA 4TU6A 3QZTA 5CQ4A 4GNGA 4WZ2A 3MB4A 5L96A 4RVRA 2WP1A 4CUUA 2R0YA 3HMHA 3G0LA 4YYJA 4QUUA 4A9EA 1DVPA 5F25A 5E9VA 2K16A 2M3HA 1WUGA 2L84A 2K1JA 2L80A 3M62A 4QNSA 4N4HA 5CS8A 2DVQA 5E3GA 5FE4A 5I29A 4PPEA 4LZRA 5ENJA 5E0RA 4NS5A 3N9MA 2YELA 4O64A 4CFKA 4A9OA 3Q2FA 2RI7A 4L58A 1JM7A 1HYJA 4O77A 4TZ2A 2M1RA 5FE0A 5AD3A 4TT4A 4UYEA 1F62A 4QSRA 5HQ5A 4HXKA 4NYXA 2VJFB 4YBTA 2PNXA 4IOQA 4A49A 4QSSA 4ZUXU 2DVSA 2LGLA 4YABA 4QEWA 2LXPC 4TKPB 2E6SA 5A5SA 5HCLA 1ZS5A 2H0DB 4UI9B 5F63A 4A9IA 4QSTA 2VP7A 5F61A 2IDAA 5EA1A 4QY4A 2KE1A 5DW2A 5C89A 5FDZA 3SVFA 2K17A 5IGLA 5HQ7A 2D82A 4HBYA 2MJVB 3N9OA 5H1TA 4BW3A 4GPJA 4A9LA 3DQVR 5HRWA 2OSSA 5L98A 3HCUA 1Z60A 5EV9A 1VD4A 5H1UA 4LYIA 5G0FA 5F1HA 4Y03A 3IU5A 5E73A 3SVGA 4YH3A 5FE2A 4MR3A 1FP0A 2KWNA 4C66A 4NR4A 5EPBA 4HXMA 5A5NA 4O7CA 4QYDA 4A4BA 4UIYA 2DWWA 4BHWA 2I50A 2HDPA 5DYXA 5D24A 1N72A 5A5OA 3O33A 5A5RA 2E7OA 2R0VA 5HFQA 3S92A 5IIDA 3IHPA 4UYFB 5D3TA 1Z2QA 3AADA 4QYLA 4KCXA 3QZVA 4TZ8A 2ZETC 4LLBA 5D3RA 4LKAA 3UV4A 5CZGA 3RCWA 4P5OB 4UP0A 3TLPA 3N9LA 4UIVA 4FIPA 5DINA 5EQ1A 5D3SA 2VNFA 4R7EA 5TABA 3MUKA 4HXLA 4F52B 1V87A 2YQMA 3N9QA 5KTUA 5I3LA 3L1ZB 3DPLR 5EWVA 5JG6A 4J0RA 5AMFA 2CKLA 5A85A 3SOWA 4TT2A 2MIQA 4IC3A 5CY9A 2L5UA 4O75A 5DYCA 4HBWA 5DKHA 3RPGB 2LN0A 5CQ3A 5KO4A 2YEKA 2N9GA 5A7CA 5HRXA 2L0BA 5J0DA 4PKLA 4KV1A 5B78A 5ETDA 5FH8A 4TS8A 1WE9A 2YREA 3GL6A 5II1A 3U5LA 2D8SA 4QR5A 2DATA 1WFKA 4CUSA 2WP2A 2YURA 3DWYA 3LQHA 5D3JA 5D25A 5DKCA 4YATA 5TB6A 2YEMA 5LKTA 3MHSA 3UW9A 4YY6A 4O7BA 4Z93A 2YU4A 4BW2A 4YBMA 5CUCA 3ZTGA 5CQ6A 2VJEA 1X4JA 4Z1SA 5BT4A 3M63A 3NG2A 2MNYA 5TDWA 4O7EA 4LR6A 1EQFA 4HXRA 4QC3A 5C7NA 4GNFA 2L5EA 5D1KB 1U6GB 5D3LA 3AQAA 3HMFA 4HXSA 5J3XA 1JOCA 4CURA 5EWCA 5I7YA 4QR4A 3U5OA 4N3WA 4B7YC 5TBNA 2E6RA 5LVRA 2LRIC 4YH4A 4YADA 2OO1A 2MUMA 2CT2A 2MD7B 2Y1MA 2YHOA 3EB5A 1XWHA 3U5MA 4IC2A 5DFDA 3MHHA 4W4UA 3G0JA 5COIA 5TCMA 5C85A 3UVDA 4ZQLA 5I83A 4N4IA 1WEUA 1WILA 2D9EA 3IU6A 4NQMA 2EA6A 5CTLA 5BT5A 5B77A 2YW8A 5DKAA 5CUGA 5DLZA 1T1HA 4GB0A 5EYAF 3P1DA 5CUEA 2HYED 3JVLA 3LJWA 4HBVA 4NRBA 5H85A 4LK9A 3L1XA 4C9ZA 5B79A 4TQNA 4LADB 4YYDA 5EU1A 5HENA 3VK6A 4AYCA 4UIWA 5FE7A 5H1VA 2XB1A 4A9HA 5I88A 4QBMA 4WHUA 4R2YA 4CLBA 2KTBB 5DYAA 1MM2A 3ZYQA 1WGMA 2GRCA 5FE3A 4MSXA 2RNYA 5HLSA 2RNXA 5F36A 5D7XA 4Z1QA 4MEOA 4BW4A 5CQAA 5TDRA 5KHMA 2XEUA 4J3IA 2R10A 3UVYA 4ALGA 2VPGA 5EWWA 5HQ6A 1WUMA 3PUQA 1E6IA 4B86C 2E7NA 4O71A 2DVRA 4WZ0A 4IR6A 5C13A 2KWOA 3LXJA 5ENFA 4AP4A 5CRMA 5FE8A 3KNVA 3RPGC 1K2FA 1X0JA 4X2IA 4NR8A 5D1MB 2Y1NA 2YYNA 4A9JA 1WEQA 5EM3A 2YUCA 2KWJA 5A83A 2R0SA 4A9KA 5ENHA 4ZW1A 2UZGA 2I8NA 4J1PA 5B8DA 2L43A 4YYGA 4IR3A 4XI1A 5DFCA 5C8GA 2ECWA 3N9PA 5EPSA 4PY6A 1JM7B 3SHBA 2ECIA 4L7XA 3ZYUA 5FBXA 2JRJA 3KV6A 4MEQA 1IYMA 5D3NA 3ZPVE 3QZSA 2OUOA 5G4SA 5LJ2A 2YT5A 2LSPB 5LKZA 3HCSA 2MD8C 4QEUA 5HJCA 4A0CD 4PCIA 2DX8A 4YYIA 2RNWA 3DAIA 2YSMA 3C6WA 3EB6A 3NXBA 3U5KA 3C5KA 4LZ2A 4MEPA 5EI4A 2BAYA 3O34A 2FSAA 4NRAA 1E4UA 5AITA 3JVJA 5JI8A 2LDRA 2G43A 5E9IA 3L11A 3PHDA 5EGUA 5IG6A 4MVTA 5D3PA 5DFBA 4LYSA 2LGGA 5HEMA 5EWHA 2G4AA 2PUYA 5FEYA 2E3KA 4IORA 4I7BA 5ENBA 2G6QA 1JM4B 2CSZA 4OUFA 4PS5A 5EK9A 5KH3A 5LUUA 1G25A 4WIVA 2KIZA 5KU3A 2F6JA 3LQJA 5D26A 5DY7A 3ASLA 5EVAA 3PURA 2YYRA 4YY4A 4V3LC 4NR7A 5G4RA 5FE9A 1WENA 5EICA 5A5PA 5FE5A 2ECVA 4S3OB 4UIUA 4O70A 3HMEA 4QSUA 2YSJA 1LDJB 5FE6A 3LRQA 5IBNA 5B76A 3LQIA 4Q0NA 5CPEA 4XUBA 4FJCA 2F42A 5JWMA 4HXPA 3D7CA 3U5NA 2CSYA 4I7CA 4QC1A 2VPBA 2K4DA 4TU4A 3UV5A 2VJFA 1WESA 5KH9A 3ZPV1 2JMIA 1X4IA 4CFLA 5G05B 4NYWA 5FB0A 4O7AA 4YYMA 5I1QA 5ENEA 2H0DA 3O70A 3K2JA 5FFYA 3N9NA 3MXFA 4UYDA 4NXJA 4CL9A 5FH7A 3V43A 4A9FA 4NR5A 2YQDA 4AVXA 4QZSA 3O7AA 2FUUA 4LRGA 5LKUA 4XUAA 4QSVA 5F62A 4HXNA 5CQTA 4I7DA 2YDWA 5IGKA 2CKLB 2RO1A 2ECTA 5LJ1A 5KH7A 4FLPA 3ZNIA 5EPRA 4MR6A 1FBVA 2MNZA 3I3JA 5AIUA 4QSXA 3UV2A 2EODA 4KV4A 5FERA 2VPDA 5HFRA 2KFTA 4LZSA 2DVVA 1VYXA 4UYHA 3KQIA 4HBXA 4YAXA 3Q2EA 4OGJA 5E9MA 3O37A 4ZC9A 1WIMA 4Q6FA 4MR5A 3JVKA 2VPEA 3M99A 4O7FA 3ZVZB 4Z6HA 3P5OA 2KGGA 5ENGA 3FL2A 2I7KA 4O72A 4UYGA 5C11A 3T7LA 5FG5A 5CU8A 3GV4A 3ONIA 5F3AA 4QSPA 1CHCA 3MB3A 5L99A 4UYFA 1WEVA 4FO9A 4LDFA 5F5ZA 5E74A 2YQLA 4XYAA 4XY9A 1JSPB 5DKDA 2NXBA 2VJEB 4NUEA 3SOXA 4CA1A 5FE1A 5I7XA 2LQ6A 4E96A 4F3IA 5KTWA 5ENCA 5FFVA 2JMJA 4QF2A 1HYIA 4LYWA 4BBQA 4NN2A 4N4FA 4MR4A 3U5PA 4IOOA 5HELA 5B75A 4TYLA 5C4QA 3HTKC 5LCWB 5E9LA 4CUQA 4J0SA 2L75A 5D1LB 5E9KA 5C87A 3KV5A 2QJ0A 5G04B 3ZVYA 4YYKA 2MA5A 3T6RA 2KR4A 4GNEA 4NQNA 4PCEA 4CUTA 5E9YA 5EWDA 4S3OC 3S91A 4QSWA 3P1CA 4MENA 4QR3A 4ALHA 5A5QA 2QIZA 4YBSA 4UP5A 5I89A 4PTBA 4A4CA 2L85A 2KU3A 5DW1A 2MT5A 5FG4A 2RSDA 5DLXA 1X4UA 3GG3A 5CQ5A 5DYUA 5CFWA 4IR4A 3UVXA 4YYNA 4WHWA 2ECNA 4TT6A 2MA6A 4X3GA 5HM0A 5E7DA 5DX4A 4YK0A 2RFJA 4XY8A 2AN6A 4AYCB 5FG6A 4NYVA 5DBMA 2LV9A 4TTEA 5HRVA 5H9MA 3SOUA 5CQ7A 4A9NA 5II2A 4CUPA 4YC9A 5CGPA 4LJNA 4HXOA 4YYHA 4UIXA 3SVHA 5IGNA 5CUDA 4V3KC 1BORA 4Z6IA 4O76A 1N87A 5F1LA 4WZ3B 4DONA 4AKNA 1VFYA 4NUCA 4QB3A 1ZBDB 2KREA 5L97A 4FK5A 2C2LA 3MQMA 2JMDA 5CRZA 4N4GA 5I86A 1WEMA 3MULA 5D0CA 5AMEA 5D3HA 4O74A 5ETBA 1F68A 2DKWA 5FB1A 1WEEA 2KGIA 4WA6A 5ACYA 3O36A 2F6NA 4IR5A 5BT3A 2ECJA 2G45A 5I80A 4NR6A 4QSQA 5LKXA 4CCGX 2Y43A 3I2DA 5EP7A 4QEVA 5EISA 2M6MA 5L8UA 5CP5A 3UVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O35 A;  4NUD A;  5CUB A;  5E3D A;  4NRC A;  2KWK A;  5AD2 A;  4NR9 A;  2C2V S;  3HCT A;  4OGI A;  5F60 A;  4GND A;  2H60 A;  2YW5 A;  3U5J A;  2QIC A;  4C67 A;  5IGM A;  2LGK A;  2YHN A;  2RS9 B;  5LVQ A;  2OXQ C;  3JVM A;  2LXH C;  5ENI A;  1MM3 A;  1RMD A;  5TRB A;  5A82 A;  4BW1 A;  3P1F A;  5K29 A;  2KYU A;  4QUT A;  2EGP A;  5FFW A;  3RTR B;  4UIT A;  1WEW A;  2ECG A;  1WEP A;  4UIZ A;  4R8P K;  5CQ8 A;  5FH6 A;  4LC2 A;  5KTX A;  1Z6U A;  4ZDT A;  1LDK C;  5A81 A;  5I40 A;  5CUA A;  5F2P A;  3P1E A;  2LGV A;  2NAA A;  4AUQ B;  2M85 A;  4O78 A;  4Q0O A;  4A9M A;  5LJ0 A;  1WEO A;  4QF3 A;  3FKM X;  5L8T A;  2FUI A;  4BJX A;  4TU6 A;  3QZT A;  5CQ4 A;  4GNG A;  4WZ2 A;  3MB4 A;  5L96 A;  4RVR A;  2WP1 A;  4CUU A;  2R0Y A;  3HMH A;  3G0L A;  4YYJ A;  4QUU A;  4A9E A;  1DVP A;  5F25 A;  5E9V A;  2K16 A;  2M3H A;  1WUG A;  2L84 A;  2K1J A;  2L80 A;  3M62 A;  4QNS A;  4N4H A;  5CS8 A;  2DVQ A;  5E3G A;  5FE4 A;  5I29 A;  4PPE A;  4LZR A;  5ENJ A;  5E0R A;  4NS5 A;  3N9M A;  2YEL A;  4O64 A;  4CFK A;  4A9O A;  3Q2F A;  2RI7 A;  4L58 A;  1JM7 A;  1HYJ A;  4O77 A;  4TZ2 A;  2M1R A;  5FE0 A;  5AD3 A;  4TT4 A;  4UYE A;  1F62 A;  4QSR A;  5HQ5 A;  4HXK A;  4NYX A;  2VJF B;  4YBT A;  2PNX A;  4IOQ A;  4A49 A;  4QSS A;  4ZUX U;  2DVS A;  2LGL A;  4YAB A;  4QEW A;  2LXP C;  4TKP B;  2E6S A;  5A5S A;  5HCL A;  1ZS5 A;  2H0D B;  4UI9 B;  5F63 A;  4A9I A;  4QST A;  2VP7 A;  5F61 A;  2IDA A;  5EA1 A;  4QY4 A;  2KE1 A;  5DW2 A;  5C89 A;  5FDZ A;  3SVF A;  2K17 A;  5IGL A;  5HQ7 A;  2D82 A;  4HBY A;  2MJV B;  3N9O A;  5H1T A;  4BW3 A;  4GPJ A;  4A9L A;  3DQV R;  5HRW A;  2OSS A;  5L98 A;  3HCU A;  1Z60 A;  5EV9 A;  1VD4 A;  5H1U A;  4LYI A;  5G0F A;  5F1H A;  4Y03 A;  3IU5 A;  5E73 A;  3SVG A;  4YH3 A;  5FE2 A;  4MR3 A;  1FP0 A;  2KWN A;  4C66 A;  4NR4 A;  5EPB A;  4HXM A;  5A5N A;  4O7C A;  4QYD A;  4A4B A;  4UIY A;  2DWW A;  4BHW A;  2I50 A;  2HDP A;  5DYX A;  5D24 A;  1N72 A;  5A5O A;  3O33 A;  5A5R A;  2E7O A;  2R0V A;  5HFQ A;  3S92 A;  5IID A;  3IHP A;  4UYF B;  5D3T A;  1Z2Q A;  3AAD A;  4QYL A;  4KCX A;  3QZV A;  4TZ8 A;  2ZET C;  4LLB A;  5D3R A;  4LKA A;  3UV4 A;  5CZG A;  3RCW A;  4P5O B;  4UP0 A;  3TLP A;  3N9L A;  4UIV A;  4FIP A;  5DIN A;  5EQ1 A;  5D3S A;  2VNF A;  4R7E A;  5TAB A;  3MUK A;  4HXL A;  4F52 B;  1V87 A;  2YQM A;  3N9Q A;  5KTU A;  5I3L A;  3L1Z B;  3DPL R;  5EWV A;  5JG6 A;  4J0R A;  5AMF A;  2CKL A;  5A85 A;  3SOW A;  4TT2 A;  2MIQ A;  4IC3 A;  5CY9 A;  2L5U A;  4O75 A;  5DYC A;  4HBW A;  5DKH A;  3RPG B;  2LN0 A;  5CQ3 A;  5KO4 A;  2YEK A;  2N9G A;  5A7C A;  5HRX A;  2L0B A;  5J0D A;  4PKL A;  4KV1 A;  5B78 A;  5ETD A;  5FH8 A;  4TS8 A;  1WE9 A;  2YRE A;  3GL6 A;  5II1 A;  3U5L A;  2D8S A;  4QR5 A;  2DAT A;  1WFK A;  4CUS A;  2WP2 A;  2YUR A;  3DWY A;  3LQH A;  5D3J A;  5D25 A;  5DKC A;  4YAT A;  5TB6 A;  2YEM A;  5LKT A;  3MHS A;  3UW9 A;  4YY6 A;  4O7B A;  4Z93 A;  2YU4 A;  4BW2 A;  4YBM A;  5CUC A;  3ZTG A;  5CQ6 A;  2VJE A;  1X4J A;  4Z1S A;  5BT4 A;  3M63 A;  3NG2 A;  2MNY A;  5TDW A;  4O7E A;  4LR6 A;  1EQF A;  4HXR A;  4QC3 A;  5C7N A;  4GNF A;  2L5E A;  5D1K B;  1U6G B;  5D3L A;  3AQA A;  3HMF A;  4HXS A;  5J3X A;  1JOC A;  4CUR A;  5EWC A;  5I7Y A;  4QR4 A;  3U5O A;  4N3W A;  4B7Y C;  5TBN A;  2E6R A;  5LVR A;  2LRI C;  4YH4 A;  4YAD A;  2OO1 A;  2MUM A;  2CT2 A;  2MD7 B;  2Y1M A;  2YHO A;  3EB5 A;  1XWH A;  3U5M A;  4IC2 A;  5DFD A;  3MHH A;  4W4U A;  3G0J A;  5COI A;  5TCM A;  5C85 A;  3UVD A;  4ZQL A;  5I83 A;  4N4I A;  1WEU A;  1WIL A;  2D9E A;  3IU6 A;  4NQM A;  2EA6 A;  5CTL A;  5BT5 A;  5B77 A;  2YW8 A;  5DKA A;  5CUG A;  5DLZ A;  1T1H A;  4GB0 A;  5EYA F;  3P1D A;  5CUE A;  2HYE D;  3JVL A;  3LJW A;  4HBV A;  4NRB A;  5H85 A;  4LK9 A;  3L1X A;  4C9Z A;  5B79 A;  4TQN A;  4LAD B;  4YYD A;  5EU1 A;  5HEN A;  3VK6 A;  4AYC A;  4UIW A;  5FE7 A;  5H1V A;  2XB1 A;  4A9H A;  5I88 A;  4QBM A;  4WHU A;  4R2Y A;  4CLB A;  2KTB B;  5DYA A;  1MM2 A;  3ZYQ A;  1WGM A;  2GRC A;  5FE3 A;  4MSX A;  2RNY A;  5HLS A;  2RNX A;  5F36 A;  5D7X A;  4Z1Q A;  4MEO A;  4BW4 A;  5CQA A;  5TDR A;  5KHM A;  2XEU A;  4J3I A;  2R10 A;  3UVY A;  4ALG A;  2VPG A;  5EWW A;  5HQ6 A;  1WUM A;  3PUQ A;  1E6I A;  4B86 C;  2E7N A;  4O71 A;  2DVR A;  4WZ0 A;  4IR6 A;  5C13 A;  2KWO A;  3LXJ A;  5ENF A;  4AP4 A;  5CRM A;  5FE8 A;  3KNV A;  3RPG C;  1K2F A;  1X0J A;  4X2I A;  4NR8 A;  5D1M B;  2Y1N A;  2YYN A;  4A9J A;  1WEQ A;  5EM3 A;  2YUC A;  2KWJ A;  5A83 A;  2R0S A;  4A9K A;  5ENH A;  4ZW1 A;  2UZG A;  2I8N A;  4J1P A;  5B8D A;  2L43 A;  4YYG A;  4IR3 A;  4XI1 A;  5DFC A;  5C8G A;  2ECW A;  3N9P A;  5EPS A;  4PY6 A;  1JM7 B;  3SHB A;  2ECI A;  4L7X A;  3ZYU A;  5FBX A;  2JRJ A;  3KV6 A;  4MEQ A;  1IYM A;  5D3N A;  3ZPV E;  3QZS A;  2OUO A;  5G4S A;  5LJ2 A;  2YT5 A;  2LSP B;  5LKZ A;  3HCS A;  2MD8 C;  4QEU A;  5HJC A;  4A0C D;  4PCI A;  2DX8 A;  4YYI A;  2RNW A;  3DAI A;  2YSM A;  3C6W A;  3EB6 A;  3NXB A;  3U5K A;  3C5K A;  4LZ2 A;  4MEP A;  5EI4 A;  2BAY A;  3O34 A;  2FSA A;  4NRA A;  1E4U A;  5AIT A;  3JVJ A;  5JI8 A;  2LDR A;  2G43 A;  5E9I A;  3L11 A;  3PHD A;  5EGU A;  5IG6 A;  4MVT A;  5D3P A;  5DFB A;  4LYS A;  2LGG A;  5HEM A;  5EWH A;  2G4A A;  2PUY A;  5FEY A;  2E3K A;  4IOR A;  4I7B A;  5ENB A;  2G6Q A;  1JM4 B;  2CSZ A;  4OUF A;  4PS5 A;  5EK9 A;  5KH3 A;  5LUU A;  1G25 A;  4WIV A;  2KIZ A;  5KU3 A;  2F6J A;  3LQJ A;  5D26 A;  5DY7 A;  3ASL A;  5EVA A;  3PUR A;  2YYR A;  4YY4 A;  4V3L C;  4NR7 A;  5G4R A;  5FE9 A;  1WEN A;  5EIC A;  5A5P A;  5FE5 A;  2ECV A;  4S3O B;  4UIU A;  4O70 A;  3HME A;  4QSU A;  2YSJ A;  1LDJ B;  5FE6 A;  3LRQ A;  5IBN A;  5B76 A;  3LQI A;  4Q0N A;  5CPE A;  4XUB A;  4FJC A;  2F42 A;  5JWM A;  4HXP A;  3D7C A;  3U5N A;  2CSY A;  4I7C A;  4QC1 A;  2VPB A;  2K4D A;  4TU4 A;  3UV5 A;  2VJF A;  1WES A;  5KH9 A;  3ZPV 1;  2JMI A;  1X4I A;  4CFL A;  5G05 B;  4NYW A;  5FB0 A;  4O7A A;  4YYM A;  5I1Q A;  5ENE A;  2H0D A;  3O70 A;  3K2J A;  5FFY A;  3N9N A;  3MXF A;  4UYD A;  4NXJ A;  4CL9 A;  5FH7 A;  3V43 A;  4A9F A;  4NR5 A;  2YQD A;  4AVX A;  4QZS A;  3O7A A;  2FUU A;  4LRG A;  5LKU A;  4XUA A;  4QSV A;  5F62 A;  4HXN A;  5CQT A;  4I7D A;  2YDW A;  5IGK A;  2CKL B;  2RO1 A;  2ECT A;  5LJ1 A;  5KH7 A;  4FLP A;  3ZNI A;  5EPR A;  4MR6 A;  1FBV A;  2MNZ A;  3I3J A;  5AIU A;  4QSX A;  3UV2 A;  2EOD A;  4KV4 A;  5FER A;  2VPD A;  5HFR A;  2KFT A;  4LZS A;  2DVV A;  1VYX A;  4UYH A;  3KQI A;  4HBX A;  4YAX A;  3Q2E A;  4OGJ A;  5E9M A;  3O37 A;  4ZC9 A;  1WIM A;  4Q6F A;  4MR5 A;  3JVK A;  2VPE A;  3M99 A;  4O7F A;  3ZVZ B;  4Z6H A;  3P5O A;  2KGG A;  5ENG A;  3FL2 A;  2I7K A;  4O72 A;  4UYG A;  5C11 A;  3T7L A;  5FG5 A;  5CU8 A;  3GV4 A;  3ONI A;  5F3A A;  4QSP A;  1CHC A;  3MB3 A;  5L99 A;  4UYF A;  1WEV A;  4FO9 A;  4LDF A;  5F5Z A;  5E74 A;  2YQL A;  4XYA A;  4XY9 A;  1JSP B;  5DKD A;  2NXB A;  2VJE B;  4NUE A;  3SOX A;  4CA1 A;  5FE1 A;  5I7X A;  2LQ6 A;  4E96 A;  4F3I A;  5KTW A;  5ENC A;  5FFV A;  2JMJ A;  4QF2 A;  1HYI A;  4LYW A;  4BBQ A;  4NN2 A;  4N4F A;  4MR4 A;  3U5P A;  4IOO A;  5HEL A;  5B75 A;  4TYL A;  5C4Q A;  3HTK C;  5LCW B;  5E9L A;  4CUQ A;  4J0S A;  2L75 A;  5D1L B;  5E9K A;  5C87 A;  3KV5 A;  2QJ0 A;  5G04 B;  3ZVY A;  4YYK A;  2MA5 A;  3T6R A;  2KR4 A;  4GNE A;  4NQN A;  4PCE A;  4CUT A;  5E9Y A;  5EWD A;  4S3O C;  3S91 A;  4QSW A;  3P1C A;  4MEN A;  4QR3 A;  4ALH A;  5A5Q A;  2QIZ A;  4YBS A;  4UP5 A;  5I89 A;  4PTB A;  4A4C A;  2L85 A;  2KU3 A;  5DW1 A;  2MT5 A;  5FG4 A;  2RSD A;  5DLX A;  1X4U A;  3GG3 A;  5CQ5 A;  5DYU A;  5CFW A;  4IR4 A;  3UVX A;  4YYN A;  4WHW A;  2ECN A;  4TT6 A;  2MA6 A;  4X3G A;  5HM0 A;  5E7D A;  5DX4 A;  4YK0 A;  2RFJ A;  4XY8 A;  2AN6 A;  4AYC B;  5FG6 A;  4NYV A;  5DBM A;  2LV9 A;  4TTE A;  5HRV A;  5H9M A;  3SOU A;  5CQ7 A;  4A9N A;  5II2 A;  4CUP A;  4YC9 A;  5CGP A;  4LJN A;  4HXO A;  4YYH A;  4UIX A;  3SVH A;  5IGN A;  5CUD A;  4V3K C;  1BOR A;  4Z6I A;  4O76 A;  1N87 A;  5F1L A;  4WZ3 B;  4DON A;  4AKN A;  1VFY A;  4NUC A;  4QB3 A;  1ZBD B;  2KRE A;  5L97 A;  4FK5 A;  2C2L A;  3MQM A;  2JMD A;  5CRZ A;  4N4G A;  5I86 A;  1WEM A;  3MUL A;  5D0C A;  5AME A;  5D3H A;  4O74 A;  5ETB A;  1F68 A;  2DKW A;  5FB1 A;  1WEE A;  2KGI A;  4WA6 A;  5ACY A;  3O36 A;  2F6N A;  4IR5 A;  5BT3 A;  2ECJ A;  2G45 A;  5I80 A;  4NR6 A;  4QSQ A;  5LKX A;  4CCG X;  2Y43 A;  3I2D A;  5EP7 A;  4QEV A;  5EIS A;  2M6M A;  5L8U A;  5CP5 A;  3UVW A; 
#chains in the Genus database with same CATH topology
 3O35 A;  4NUD A;  5CUB A;  5E3D A;  4NRC A;  2KWK A;  5AD2 A;  4NR9 A;  2C2V S;  3HCT A;  4OGI A;  5F60 A;  4GND A;  2H60 A;  2YW5 A;  3U5J A;  2QIC A;  4C67 A;  5IGM A;  1DCQ A;  2LGK A;  2YHN A;  2OWA A;  2RS9 B;  5LVQ A;  2OXQ C;  3JVM A;  2LXH C;  5ENI A;  1MM3 A;  1RMD A;  5TRB A;  5A82 A;  4BW1 A;  3P1F A;  5K29 A;  2KYU A;  4QUT A;  2EGP A;  5FFW A;  3RTR B;  4UIT A;  1WEW A;  2ECG A;  1WEP A;  4UIZ A;  4R8P K;  5CQ8 A;  5FH6 A;  4LC2 A;  2EXU A;  5KTX A;  1Z6U A;  4ZDT A;  1LDK C;  5A81 A;  5I40 A;  5CUA A;  5F2P A;  3P1E A;  2LGV A;  2NAA A;  4AUQ B;  2M85 A;  3D1B A;  4O78 A;  4Q0O A;  4A9M A;  5LJ0 A;  1WEO A;  4QF3 A;  2XOY A;  3FKM X;  5L8T A;  2FUI A;  4BJX A;  4TU6 A;  3QZT A;  5CQ4 A;  4GNG A;  4WZ2 A;  3MB4 A;  5L96 A;  4RVR A;  3FJU B;  2WP1 A;  4CUU A;  2R0Y A;  3HMH A;  3G0L A;  4YYJ A;  4QUU A;  4A9E A;  1DVP A;  5F25 A;  5E9V A;  2K16 A;  2M3H A;  1WUG A;  2L84 A;  2K1J A;  2L80 A;  3M62 A;  4AI6 A;  4QNS A;  4N4H A;  5CS8 A;  2DVQ A;  5E3G A;  5FE4 A;  5I29 A;  4PPE A;  4LZR A;  5ENJ A;  5E0R A;  4NS5 A;  3N9M A;  2YEL A;  4O64 A;  4CFK A;  4A9O A;  3Q2F A;  2RI7 A;  4L58 A;  1JM7 A;  1HYJ A;  5SVX A;  4O77 A;  4TZ2 A;  2M1R A;  5FE0 A;  5AD3 A;  4TT4 A;  4UYE A;  1F62 A;  4QSR A;  5HQ5 A;  4HXK A;  4NYX A;  3JUE A;  2VJF B;  4YBT A;  2PNX A;  4IOQ A;  4A49 A;  4QSS A;  4ZUX U;  2DVS A;  3LRQ A;  2LGL A;  4YAB A;  4QEW A;  2LXP C;  4TKP B;  2E6S A;  5A5S A;  5HCL A;  1ZS5 A;  2H0D B;  4UI9 B;  5F63 A;  4A9I A;  4QST A;  2VP7 A;  5F61 A;  2IDA A;  5EA1 A;  4QY4 A;  3O47 A;  2CRR A;  2KE1 A;  5DW2 A;  5C89 A;  4F1P A;  4AKG A;  5FDZ A;  3SVF A;  2K17 A;  3FEH A;  5IGL A;  5HQ7 A;  2D82 A;  4HBY A;  2MJV B;  3N9O A;  5H1T A;  4BW3 A;  4GPJ A;  4A9L A;  4Z0O A;  3DQV R;  5HRW A;  2OSS A;  5L98 A;  3HCU A;  1Z60 A;  5EV9 A;  1VD4 A;  5H1U A;  4LYI A;  5G0F A;  5F1H A;  4Y03 A;  3ERR A;  3IU5 A;  5E73 A;  3SVG A;  4YH3 A;  5FE2 A;  4MR3 A;  1FP0 A;  2JM3 A;  2KWN A;  3FAN A;  5SVY A;  4C66 A;  4NR4 A;  5EPB A;  4HXM A;  5A5N A;  2L7P A;  4H9D A;  4O7C A;  4QYD A;  4A4B A;  4UIY A;  2DWW A;  4BHW A;  2I50 A;  2HDP A;  1ZKR A;  5D24 A;  1N72 A;  5DYX A;  5A5O A;  3O33 A;  5A5R A;  2E7O A;  4Z0R A;  2R0V A;  5HFQ A;  3S92 A;  5IID A;  3IHP A;  4UYF B;  5D3T A;  1Z2Q A;  3AAD A;  4QYL A;  4KCX A;  3FAO A;  3QZV A;  4TZ8 A;  2ZET C;  4LLB A;  5D3R A;  4LKA A;  3UV4 A;  5CZG A;  3RCW A;  1MBM A;  4P5O B;  4UP0 A;  3TLP A;  3N9L A;  4UIV A;  2M13 A;  4FIP A;  5DIN A;  5EQ1 A;  5D3S A;  2VNF A;  4R7E A;  5TAB A;  3MUK A;  4HXL A;  4F52 B;  1V87 A;  2YQM A;  3N9Q A;  5KTU A;  3VKH A;  5I3L A;  3L1Z B;  3DPL R;  5EWV A;  5JG6 A;  4J0R A;  5AMF A;  2CKL A;  5A85 A;  3SOW A;  4TT2 A;  2MIQ A;  3D1D A;  4IC3 A;  5CY9 A;  2L5U A;  4O75 A;  5DYC A;  4O62 A;  4HBW A;  5DKH A;  3VKG A;  3RPG B;  2XOC A;  2LN0 A;  5CQ3 A;  3E2D A;  5KO4 A;  2YEK A;  2N9G A;  5A7C A;  5HRX A;  2L0B A;  2RR4 A;  5J0D A;  4PKL A;  4KV1 A;  5B78 A;  5ETD A;  5FH8 A;  4TS8 A;  1WE9 A;  2YRE A;  3GL6 A;  5II1 A;  3U5L A;  2D8S A;  4QR5 A;  2DAT A;  1WFK A;  4CUS A;  2WP2 A;  2YUR A;  3DWY A;  3LQH A;  5D3J A;  5D25 A;  5DKC A;  4YAT A;  5TB6 A;  2YEM A;  5LKT A;  3MHS A;  3UW9 A;  4YY6 A;  3PLW A;  4O7B A;  4Z93 A;  2YU4 A;  4BW2 A;  4YBM A;  5CUC A;  3ZTG A;  5CQ6 A;  2VJE A;  1X4J A;  4Z1S A;  5BT4 A;  3M63 A;  3NG2 A;  2MNY A;  5TDW A;  4O7E A;  4LR6 A;  1EQF A;  4HXR A;  4QC3 A;  5C7N A;  4GNF A;  2L5E A;  5D1K B;  1U6G B;  2LAU A;  5D3L A;  3AQA A;  3HMF A;  4HXS A;  5J3X A;  1JOC A;  4CUR A;  5EWC A;  2XP0 A;  5I7Y A;  5SVI B;  4QR4 A;  3U5O A;  4N3W A;  4B7Y C;  5TBN A;  2E6R A;  5LVR A;  2LRI C;  4YH4 A;  4YAD A;  2OO1 A;  2MUM A;  2CT2 A;  2MD7 B;  2Y1M A;  2YHO A;  2YVR A;  3EB5 A;  1XWH A;  3U5M A;  3FM8 C;  4IC2 A;  5DFD A;  3MHH A;  4W4U A;  3G0J A;  5COI A;  5TCM A;  2EGM A;  5C85 A;  3UVD A;  4ZQL A;  5I83 A;  4N4I A;  1WEU A;  1WIL A;  2D9E A;  3IU6 A;  4NQM A;  2EA6 A;  5CTL A;  5BT5 A;  5B77 A;  2YW8 A;  5DKA A;  5CUG A;  5DLZ A;  1T1H A;  4GB0 A;  5EYA F;  3MDB C;  3P1D A;  5CUE A;  2HYE D;  3JVL A;  3LJW A;  4HBV A;  4NRB A;  5H85 A;  2FD4 A;  4LK9 A;  3L1X A;  4C9Z A;  5B79 A;  3KDE C;  4TQN A;  2D8U A;  4LAD B;  4YYD A;  5EU1 A;  5HEN A;  3VK6 A;  4AYC A;  4UIW A;  5FE7 A;  5H1V A;  2XB1 A;  4A9H A;  5I88 A;  4QBM A;  4WHU A;  4R2Y A;  4CLB A;  2KTB B;  5DYA A;  1MM2 A;  3ZYQ A;  1WGM A;  2GRC A;  5FE3 A;  4MSX A;  2RNY A;  5HLS A;  2RNX A;  5F36 A;  5D7X A;  4Z1Q A;  4MEO A;  5K3Q A;  4BW4 A;  5CQA A;  4AKH A;  5TDR A;  5KHM A;  2XEU A;  3Q1D A;  4J3I A;  2R10 A;  3UVY A;  4ALG A;  2VPG A;  5EWW A;  5HQ6 A;  1WUM A;  3PUQ A;  1E6I A;  4B86 C;  2E7N A;  4O71 A;  2DVR A;  4WZ0 A;  4IR6 A;  5C13 A;  2KKX A;  3LXJ A;  5ENF A;  2KWO A;  4AP4 A;  5CRM A;  5FE8 A;  3KNV A;  3RPG C;  1K2F A;  1X0J A;  4X2I A;  4NR8 A;  5D1M B;  2Y1N A;  2YYN A;  4A9J A;  1WEQ A;  5EM3 A;  2YUC A;  2KWJ A;  5A83 A;  2R0S A;  3LVQ E;  4A9K A;  5ENH A;  4ZW1 A;  2UZG A;  2I8N A;  4J1P A;  5B8D A;  2L43 A;  4YYG A;  4IR3 A;  4XI1 A;  5DFC A;  5C8G A;  2ECW A;  3N9P A;  5EPS A;  4PY6 A;  1JM7 B;  3SHB A;  2ECI A;  4L7X A;  3ZYU A;  5FBX A;  2JRJ A;  3KV6 A;  4MEQ A;  1IYM A;  5D3N A;  3ZPV E;  3QZS A;  2OUO A;  5G4S A;  5LJ2 A;  2YT5 A;  2EJN A;  2LSP B;  5LKZ A;  3HCS A;  2MD8 C;  4QEU A;  5HJC A;  4A0C D;  4PCI A;  5B76 A;  2CSV A;  2DX8 A;  4YYI A;  3LDY A;  2RNW A;  3DAI A;  2YSM A;  3C6W A;  3H7H A;  3EB6 A;  3NXB A;  3U5K A;  3C5K A;  4LZ2 A;  4MEP A;  5EI4 A;  2BAY A;  3O34 A;  2FSA A;  4NRA A;  1E4U A;  5AIT A;  3JVJ A;  2E61 A;  5JI8 A;  2LDR A;  2G43 A;  5E9I A;  3L11 A;  3PHD A;  2CRW A;  5EGU A;  5IG6 A;  4MVT A;  5D3P A;  5DFB A;  2P57 A;  4LYS A;  2LGG A;  5HEM A;  5EWH A;  2G4A A;  2PUY A;  5FEY A;  2E3K A;  4IOR A;  4I7B A;  5ENB A;  2G6Q A;  1JM4 B;  2CSZ A;  4OUF A;  4PS5 A;  5EK9 A;  5KH3 A;  5LUU A;  1G25 A;  4WIV A;  2KIZ A;  5KU3 A;  2F6J A;  3LQJ A;  5D26 A;  5DY7 A;  3ASL A;  5EVA A;  3PUR A;  2YYR A;  4YY4 A;  4V3L C;  4NR7 A;  5G4R A;  5FE9 A;  1WEN A;  5EIC A;  5A5P A;  5FE5 A;  2ECV A;  4S3O B;  4UIU A;  4O70 A;  3HME A;  4QSU A;  2JUN A;  1LDJ B;  5FE6 A;  2YSJ A;  5IBN A;  2B0O E;  3LQI A;  3DDT A;  4Q0N A;  5CPE A;  4XUB A;  4FJC A;  2F42 A;  3SUB A;  5JWM A;  4HXP A;  3D7C A;  3U5N A;  2CSY A;  4I7C A;  4QC1 A;  2VPB A;  2K4D A;  4TU4 A;  3UV5 A;  2VJF A;  1WES A;  5KH9 A;  3ZPV 1;  2JMI A;  1X4I A;  4CFL A;  5G05 B;  4NYW A;  5FB0 A;  4O7A A;  4YYM A;  5I1Q A;  5ENE A;  2H0D A;  3O70 A;  3K2J A;  5FFY A;  3N9N A;  3MXF A;  4UYD A;  4NXJ A;  4CL9 A;  5FH7 A;  3V43 A;  4A9F A;  4NR5 A;  2XOZ A;  2YQD A;  4AVX A;  4QZS A;  3O7A A;  2FUU A;  4LRG A;  5LKU A;  4XUA A;  4QSV A;  5F62 A;  4HXN A;  5CQT A;  4I7D A;  2YDW A;  5IGK A;  2CKL B;  2RO1 A;  2ECT A;  5LJ1 A;  5KH7 A;  4FLP A;  3ZNI A;  5EPR A;  4MR6 A;  3LJU X;  1FBV A;  2MNZ A;  3I3J A;  5AIU A;  4QSX A;  3UV2 A;  2EOD A;  4KV4 A;  5FER A;  2VPD A;  5HFR A;  2KFT A;  4LZS A;  2DVV A;  1VYX A;  4UYH A;  3KQI A;  4HBX A;  4YAX A;  3Q2E A;  4OGJ A;  5E9M A;  3O37 A;  4ZC9 A;  1WIM A;  4Q6F A;  4MR5 A;  3JVK A;  2VPE A;  3M99 A;  4O7F A;  3ZVZ B;  4Z6H A;  3P5O A;  2KGG A;  2IQJ A;  5ENG A;  3FL2 A;  2I7K A;  4O72 A;  4UYG A;  5C11 A;  3T7L A;  5FG5 A;  5CU8 A;  4AKI A;  3GV4 A;  3ONI A;  5F3A A;  4QSP A;  1CHC A;  3MB3 A;  5L99 A;  4UYF A;  1WEV A;  4FO9 A;  4LDF A;  5F5Z A;  5E74 A;  2FFW A;  2YQL A;  4XYA A;  4XY9 A;  1JSP B;  5DKD A;  2NXB A;  2VJE B;  4NUE A;  3SOX A;  4CA1 A;  5FE1 A;  5I7X A;  2LQ6 A;  4E96 A;  4F3I A;  5KTW A;  5ENC A;  5FFV A;  2JMJ A;  4QF2 A;  1HYI A;  4LYW A;  4BBQ A;  4NN2 A;  4N4F A;  2CON A;  4MR4 A;  3U5P A;  4IOO A;  5HEL A;  5B75 A;  4TYL A;  5C4Q A;  3HTK C;  5LCW B;  5E9L A;  4CUQ A;  4J0S A;  2L75 A;  5D1L B;  3T9K A;  2DJA A;  5E9K A;  5C87 A;  3KV5 A;  2QJ0 A;  5G04 B;  1PUO A;  3ZVY A;  4YYK A;  2MA5 A;  3T6R A;  2KR4 A;  4GNE A;  4NQN A;  4PCE A;  4CUT A;  5E9Y A;  5EWD A;  4OGE A;  4S3O C;  3S91 A;  4QSW A;  3P1C A;  4MEN A;  4QR3 A;  4ALH A;  5A5Q A;  2DSM A;  2QIZ A;  4YBS A;  4UP5 A;  5I89 A;  4PTB A;  4A4C A;  2L85 A;  2KU3 A;  5DW1 A;  2MT5 A;  5FG4 A;  2RSD A;  5DLX A;  1X4U A;  3GG3 A;  5CQ5 A;  5DYU A;  5CFW A;  4IR4 A;  3UVX A;  4YYN A;  4WHW A;  2ECN A;  4TT6 A;  4QQ4 A;  2MA6 A;  4X3G A;  5HM0 A;  5E7D A;  5DX4 A;  4YK0 A;  2RFJ A;  4XY8 A;  2KKY A;  3DWD A;  2AN6 A;  4AYC B;  5FG6 A;  4NYV A;  5DBM A;  2LV9 A;  4TTE A;  5HRV A;  5H9M A;  3SOU A;  5CQ7 A;  4A9N A;  5II2 A;  4CUP A;  4YC9 A;  5CGP A;  4LJN A;  4HXO A;  4YYH A;  4UIX A;  3SVH A;  5IGN A;  5CUD A;  4V3K C;  1BOR A;  4Z6I A;  4O76 A;  1N87 A;  5F1L A;  4WZ3 B;  4DON A;  4AKN A;  1VFY A;  3M7K A;  4NUC A;  4QB3 A;  1ZBD B;  2KRE A;  5L97 A;  2MKE A;  2C2L A;  4FK5 A;  3MQM A;  2JMD A;  5CRZ A;  4N4G A;  5I86 A;  1WEM A;  3MUL A;  5D0C A;  5AME A;  5D3H A;  4O74 A;  5SVI A;  5ETB A;  1F68 A;  2DKW A;  5FB1 A;  1WEE A;  2KGI A;  4OGC A;  5ACY A;  3O36 A;  2F6N A;  4IR5 A;  5BT3 A;  2ECJ A;  2G45 A;  5I80 A;  4WA6 A;  3LVR E;  4NR6 A;  4QSQ A;  5LKX A;  4CCG X;  2Y43 A;  3I2D A;  5EP7 A;  4QEV A;  5EIS A;  2M6M A;  5L8U A;  5CP5 A;  3UVW A; 
#chains in the Genus database with same CATH homology
 3O35 A;  4NUD A;  5CUB A;  5E3D A;  4NRC A;  2KWK A;  5AD2 A;  4NR9 A;  2C2V S;  3HCT A;  4OGI A;  5F60 A;  4GND A;  2H60 A;  2YW5 A;  3U5J A;  2QIC A;  4C67 A;  5IGM A;  2LGK A;  2YHN A;  2RS9 B;  5LVQ A;  2OXQ C;  3JVM A;  2LXH C;  5ENI A;  1MM3 A;  1RMD A;  5TRB A;  5A82 A;  4BW1 A;  3P1F A;  5K29 A;  2KYU A;  4QUT A;  2EGP A;  5FFW A;  3RTR B;  4UIT A;  1WEW A;  2ECG A;  1WEP A;  4UIZ A;  4R8P K;  5CQ8 A;  5FH6 A;  4LC2 A;  5KTX A;  1Z6U A;  4ZDT A;  1LDK C;  5A81 A;  5I40 A;  5CUA A;  5F2P A;  3P1E A;  2LGV A;  2NAA A;  4AUQ B;  2M85 A;  4O78 A;  4Q0O A;  4A9M A;  5LJ0 A;  1WEO A;  4QF3 A;  3FKM X;  5L8T A;  2FUI A;  4BJX A;  4TU6 A;  3QZT A;  5CQ4 A;  4GNG A;  4WZ2 A;  3MB4 A;  5L96 A;  4RVR A;  2WP1 A;  4CUU A;  2R0Y A;  3HMH A;  3G0L A;  4YYJ A;  4QUU A;  4A9E A;  1DVP A;  5F25 A;  5E9V A;  2K16 A;  2M3H A;  1WUG A;  2L84 A;  2K1J A;  2L80 A;  3M62 A;  4QNS A;  4N4H A;  5CS8 A;  2DVQ A;  5E3G A;  5FE4 A;  5I29 A;  4PPE A;  4LZR A;  5ENJ A;  5E0R A;  4NS5 A;  3N9M A;  2YEL A;  4O64 A;  4CFK A;  4A9O A;  3Q2F A;  2RI7 A;  4L58 A;  1JM7 A;  1HYJ A;  4O77 A;  4TZ2 A;  2M1R A;  5FE0 A;  5AD3 A;  4TT4 A;  4UYE A;  1F62 A;  4QSR A;  5HQ5 A;  4HXK A;  4NYX A;  2VJF B;  4YBT A;  2PNX A;  4IOQ A;  4A49 A;  4QSS A;  4ZUX U;  2DVS A;  2LGL A;  4YAB A;  4QEW A;  2LXP C;  4TKP B;  2E6S A;  5A5S A;  5HCL A;  1ZS5 A;  2H0D B;  4UI9 B;  5F63 A;  4A9I A;  4QST A;  2VP7 A;  5F61 A;  2IDA A;  5EA1 A;  4QY4 A;  2KE1 A;  5DW2 A;  5C89 A;  5FDZ A;  3SVF A;  2K17 A;  5IGL A;  5HQ7 A;  2D82 A;  4HBY A;  2MJV B;  3N9O A;  5H1T A;  4BW3 A;  4GPJ A;  4A9L A;  3DQV R;  5HRW A;  2OSS A;  5L98 A;  3HCU A;  1Z60 A;  5EV9 A;  1VD4 A;  5H1U A;  4LYI A;  5G0F A;  5F1H A;  4Y03 A;  3IU5 A;  5E73 A;  3SVG A;  4YH3 A;  5FE2 A;  4MR3 A;  1FP0 A;  2KWN A;  4C66 A;  4NR4 A;  5EPB A;  4HXM A;  5A5N A;  4O7C A;  4QYD A;  4A4B A;  4UIY A;  2DWW A;  4BHW A;  2I50 A;  2HDP A;  5DYX A;  5D24 A;  1N72 A;  5A5O A;  3O33 A;  5A5R A;  2E7O A;  2R0V A;  5HFQ A;  3S92 A;  5IID A;  3IHP A;  4UYF B;  5D3T A;  1Z2Q A;  3AAD A;  4QYL A;  4KCX A;  3QZV A;  4TZ8 A;  2ZET C;  4LLB A;  5D3R A;  4LKA A;  3UV4 A;  5CZG A;  3RCW A;  4P5O B;  4UP0 A;  3TLP A;  3N9L A;  4UIV A;  4FIP A;  5DIN A;  5EQ1 A;  5D3S A;  2VNF A;  4R7E A;  5TAB A;  3MUK A;  4HXL A;  4F52 B;  1V87 A;  2YQM A;  3N9Q A;  5KTU A;  5I3L A;  3L1Z B;  3DPL R;  5EWV A;  5JG6 A;  4J0R A;  5AMF A;  2CKL A;  5A85 A;  3SOW A;  4TT2 A;  2MIQ A;  4IC3 A;  5CY9 A;  2L5U A;  4O75 A;  5DYC A;  4HBW A;  5DKH A;  3RPG B;  2LN0 A;  5CQ3 A;  5KO4 A;  2YEK A;  2N9G A;  5A7C A;  5HRX A;  2L0B A;  5J0D A;  4PKL A;  4KV1 A;  5B78 A;  5ETD A;  5FH8 A;  4TS8 A;  1WE9 A;  2YRE A;  3GL6 A;  5II1 A;  3U5L A;  2D8S A;  4QR5 A;  2DAT A;  1WFK A;  4CUS A;  2WP2 A;  2YUR A;  3DWY A;  3LQH A;  5D3J A;  5D25 A;  5DKC A;  4YAT A;  5TB6 A;  2YEM A;  5LKT A;  3MHS A;  3UW9 A;  4YY6 A;  4O7B A;  4Z93 A;  2YU4 A;  4BW2 A;  4YBM A;  5CUC A;  3ZTG A;  5CQ6 A;  2VJE A;  1X4J A;  4Z1S A;  5BT4 A;  3M63 A;  3NG2 A;  2MNY A;  5TDW A;  4O7E A;  4LR6 A;  1EQF A;  4HXR A;  4QC3 A;  5C7N A;  4GNF A;  2L5E A;  5D1K B;  1U6G B;  5D3L A;  3AQA A;  3HMF A;  4HXS A;  5J3X A;  1JOC A;  4CUR A;  5EWC A;  5I7Y A;  4QR4 A;  3U5O A;  4N3W A;  4B7Y C;  5TBN A;  2E6R A;  5LVR A;  2LRI C;  4YH4 A;  4YAD A;  2OO1 A;  2MUM A;  2CT2 A;  2MD7 B;  2Y1M A;  2YHO A;  3EB5 A;  1XWH A;  3U5M A;  4IC2 A;  5DFD A;  3MHH A;  4W4U A;  3G0J A;  5COI A;  5TCM A;  5C85 A;  3UVD A;  4ZQL A;  5I83 A;  4N4I A;  1WEU A;  1WIL A;  2D9E A;  3IU6 A;  4NQM A;  2EA6 A;  5CTL A;  5BT5 A;  5B77 A;  2YW8 A;  5DKA A;  5CUG A;  5DLZ A;  1T1H A;  4GB0 A;  5EYA F;  3P1D A;  5CUE A;  2HYE D;  3JVL A;  3LJW A;  4HBV A;  4NRB A;  5H85 A;  4LK9 A;  3L1X A;  4C9Z A;  5B79 A;  4TQN A;  4LAD B;  4YYD A;  5EU1 A;  5HEN A;  3VK6 A;  4AYC A;  4UIW A;  5FE7 A;  5H1V A;  2XB1 A;  4A9H A;  5I88 A;  4QBM A;  4WHU A;  4R2Y A;  4CLB A;  2KTB B;  5DYA A;  1MM2 A;  3ZYQ A;  1WGM A;  2GRC A;  5FE3 A;  4MSX A;  2RNY A;  5HLS A;  2RNX A;  5F36 A;  5D7X A;  4Z1Q A;  4MEO A;  4BW4 A;  5CQA A;  5TDR A;  5KHM A;  2XEU A;  4J3I A;  2R10 A;  3UVY A;  4ALG A;  2VPG A;  5EWW A;  5HQ6 A;  1WUM A;  3PUQ A;  1E6I A;  4B86 C;  2E7N A;  4O71 A;  2DVR A;  4WZ0 A;  4IR6 A;  5C13 A;  2KWO A;  3LXJ A;  5ENF A;  4AP4 A;  5CRM A;  5FE8 A;  3KNV A;  3RPG C;  1K2F A;  1X0J A;  4X2I A;  4NR8 A;  5D1M B;  2Y1N A;  2YYN A;  4A9J A;  1WEQ A;  5EM3 A;  2YUC A;  2KWJ A;  5A83 A;  2R0S A;  4A9K A;  5ENH A;  4ZW1 A;  2UZG A;  2I8N A;  4J1P A;  5B8D A;  2L43 A;  4YYG A;  4IR3 A;  4XI1 A;  5DFC A;  5C8G A;  2ECW A;  3N9P A;  5EPS A;  4PY6 A;  1JM7 B;  3SHB A;  2ECI A;  4L7X A;  3ZYU A;  5FBX A;  2JRJ A;  3KV6 A;  4MEQ A;  1IYM A;  5D3N A;  3ZPV E;  3QZS A;  2OUO A;  5G4S A;  5LJ2 A;  2YT5 A;  2LSP B;  5LKZ A;  3HCS A;  2MD8 C;  4QEU A;  5HJC A;  4A0C D;  4PCI A;  2DX8 A;  4YYI A;  2RNW A;  3DAI A;  2YSM A;  3C6W A;  3EB6 A;  3NXB A;  3U5K A;  3C5K A;  4LZ2 A;  4MEP A;  5EI4 A;  2BAY A;  3O34 A;  2FSA A;  4NRA A;  1E4U A;  5AIT A;  3JVJ A;  5JI8 A;  2LDR A;  2G43 A;  5E9I A;  3L11 A;  3PHD A;  5EGU A;  5IG6 A;  4MVT A;  5D3P A;  5DFB A;  4LYS A;  2LGG A;  5HEM A;  5EWH A;  2G4A A;  2PUY A;  5FEY A;  2E3K A;  4IOR A;  4I7B A;  5ENB A;  2G6Q A;  1JM4 B;  2CSZ A;  4OUF A;  4PS5 A;  5EK9 A;  5KH3 A;  5LUU A;  1G25 A;  4WIV A;  2KIZ A;  5KU3 A;  2F6J A;  3LQJ A;  5D26 A;  5DY7 A;  3ASL A;  5EVA A;  3PUR A;  2YYR A;  4YY4 A;  4V3L C;  4NR7 A;  5G4R A;  5FE9 A;  1WEN A;  5EIC A;  5A5P A;  5FE5 A;  2ECV A;  4S3O B;  4UIU A;  4O70 A;  3HME A;  4QSU A;  2YSJ A;  1LDJ B;  5FE6 A;  3LRQ A;  5IBN A;  5B76 A;  3LQI A;  4Q0N A;  5CPE A;  4XUB A;  4FJC A;  2F42 A;  5JWM A;  4HXP A;  3D7C A;  3U5N A;  2CSY A;  4I7C A;  4QC1 A;  2VPB A;  2K4D A;  4TU4 A;  3UV5 A;  2VJF A;  1WES A;  5KH9 A;  3ZPV 1;  2JMI A;  1X4I A;  4CFL A;  5G05 B;  4NYW A;  5FB0 A;  4O7A A;  4YYM A;  5I1Q A;  5ENE A;  2H0D A;  3O70 A;  3K2J A;  5FFY A;  3N9N A;  3MXF A;  4UYD A;  4NXJ A;  4CL9 A;  5FH7 A;  3V43 A;  4A9F A;  4NR5 A;  2YQD A;  4AVX A;  4QZS A;  3O7A A;  2FUU A;  4LRG A;  5LKU A;  4XUA A;  4QSV A;  5F62 A;  4HXN A;  5CQT A;  4I7D A;  2YDW A;  5IGK A;  2CKL B;  2RO1 A;  2ECT A;  5LJ1 A;  5KH7 A;  4FLP A;  3ZNI A;  5EPR A;  4MR6 A;  1FBV A;  2MNZ A;  3I3J A;  5AIU A;  4QSX A;  3UV2 A;  2EOD A;  4KV4 A;  5FER A;  2VPD A;  5HFR A;  2KFT A;  4LZS A;  2DVV A;  1VYX A;  4UYH A;  3KQI A;  4HBX A;  4YAX A;  3Q2E A;  4OGJ A;  5E9M A;  3O37 A;  4ZC9 A;  1WIM A;  4Q6F A;  4MR5 A;  3JVK A;  2VPE A;  3M99 A;  4O7F A;  3ZVZ B;  4Z6H A;  3P5O A;  2KGG A;  5ENG A;  3FL2 A;  2I7K A;  4O72 A;  4UYG A;  5C11 A;  3T7L A;  5FG5 A;  5CU8 A;  3GV4 A;  3ONI A;  5F3A A;  4QSP A;  1CHC A;  3MB3 A;  5L99 A;  4UYF A;  1WEV A;  4FO9 A;  4LDF A;  5F5Z A;  5E74 A;  2YQL A;  4XYA A;  4XY9 A;  1JSP B;  5DKD A;  2NXB A;  2VJE B;  4NUE A;  3SOX A;  4CA1 A;  5FE1 A;  5I7X A;  2LQ6 A;  4E96 A;  4F3I A;  5KTW A;  5ENC A;  5FFV A;  2JMJ A;  4QF2 A;  1HYI A;  4LYW A;  4BBQ A;  4NN2 A;  4N4F A;  4MR4 A;  3U5P A;  4IOO A;  5HEL A;  5B75 A;  4TYL A;  5C4Q A;  3HTK C;  5LCW B;  5E9L A;  4CUQ A;  4J0S A;  2L75 A;  5D1L B;  5E9K A;  5C87 A;  3KV5 A;  2QJ0 A;  5G04 B;  3ZVY A;  4YYK A;  2MA5 A;  3T6R A;  2KR4 A;  4GNE A;  4NQN A;  4PCE A;  4CUT A;  5E9Y A;  5EWD A;  4S3O C;  3S91 A;  4QSW A;  3P1C A;  4MEN A;  4QR3 A;  4ALH A;  5A5Q A;  2QIZ A;  4YBS A;  4UP5 A;  5I89 A;  4PTB A;  4A4C A;  2L85 A;  2KU3 A;  5DW1 A;  2MT5 A;  5FG4 A;  2RSD A;  5DLX A;  1X4U A;  3GG3 A;  5CQ5 A;  5DYU A;  5CFW A;  4IR4 A;  3UVX A;  4YYN A;  4WHW A;  2ECN A;  4TT6 A;  2MA6 A;  4X3G A;  5HM0 A;  5E7D A;  5DX4 A;  4YK0 A;  2RFJ A;  4XY8 A;  2AN6 A;  4AYC B;  5FG6 A;  4NYV A;  5DBM A;  2LV9 A;  4TTE A;  5HRV A;  5H9M A;  3SOU A;  5CQ7 A;  4A9N A;  5II2 A;  4CUP A;  4YC9 A;  5CGP A;  4LJN A;  4HXO A;  4YYH A;  4UIX A;  3SVH A;  5IGN A;  5CUD A;  4V3K C;  1BOR A;  4Z6I A;  4O76 A;  1N87 A;  5F1L A;  4WZ3 B;  4DON A;  4AKN A;  1VFY A;  4NUC A;  4QB3 A;  1ZBD B;  2KRE A;  5L97 A;  4FK5 A;  2C2L A;  3MQM A;  2JMD A;  5CRZ A;  4N4G A;  5I86 A;  1WEM A;  3MUL A;  5D0C A;  5AME A;  5D3H A;  4O74 A;  5ETB A;  1F68 A;  2DKW A;  5FB1 A;  1WEE A;  2KGI A;  4WA6 A;  5ACY A;  3O36 A;  2F6N A;  4IR5 A;  5BT3 A;  2ECJ A;  2G45 A;  5I80 A;  4NR6 A;  4QSQ A;  5LKX A;  4CCG X;  2Y43 A;  3I2D A;  5EP7 A;  4QEV A;  5EIS A;  2M6M A;  5L8U A;  5CP5 A;  3UVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...