3U5OA

Crystal structure of the complex of trim33 phd-bromo and h3(1-22)k9me3k14ack18ac histone peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
189
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 54
structure length 189
sequence length 205
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5oA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5oA01
3N9OA 5CFWA 2Y1MA 2VP7A 5I3LA 4OUFA 5KTWA 2YQDA 4QB3A 5KTUA 2KGIA 3L1XA 2MD8C 5H1UA 4XY8A 3JVKA 4AKNA 5FFYA 5JI8A 2KU3A 4CCGX 4LZSA 5FE3A 4S3OC 4XYAA 2LQ6A 4IR6A 3G0JA 5ENHA 3IU6A 4HXOA 5AIUA 5E3GA 2QICA 5EI4A 3ZYUA 5DYUA 4MVTA 2MA5A 2FSAA 4GPJA 4NUCA 1WEEA 3P1FA 2KTBB 2YREA 4AYCA 5LVQA 2E7NA 4N4HA 3LJWA 3MHSA 5ENCA 2MNYA 5LVRA 4WIVA 1DVPA 3KV5A 5AMFA 4J0RA 2AN6A 1K2FA 5B8DA 5F62A 5I89A 4CUSA 4O64A 3MHHA 5HQ5A 2EA6A 4YAXA 2WP2A 1LDJB 2VPGA 5KTXA 5HLSA 2FUIA 5ETBA 5IBNA 2KYUA 4UIYA 3ZPV1 5CQ5A 4TKPB 2RFJA 3UVWA 4MR3A 1WIMA 5F2PA 2RNXA 5DKAA 5EU1A 4WZ2A 4A9NA 4YK0A 1FBVA 4WZ3B 1VD4A 4PS5A 4MEPA 4A9KA 5C4QA 1T1HA 3SOUA 4AUQB 5DLZA 2RI7A 4IR3A 4QSPA 2DATA 4X2IA 4HXKA 5EICA 5F5ZA 3SVHA 5CTLA 5EM3A 4A9IA 2H0DA 3MXFA 2F6NA 1WEMA 4L7XA 4LR6A 4GNEA 2QIZA 5DYXA 2DVRA 5FG6A 5KU3A 5ENIA 2L80A 2ECJA 4LZRA 4UIUA 4FK5A 3ZNIA 1Z2QA 2YURA 3N9LA 5I29A 3N9MA 3MB3A 4MR4A 1IYMA 4PTBA 4YYNA 3PURA 1JOCA 5FEYA 4LYWA 5B77A 5HRXA 4TU6A 4NYXA 5L8TA 2MD7B 2YQMA 3AADA 4MR5A 5DFDA 4FLPA 5CUCA 3MULA 5D3SA 3Q2EA 3JVJA 2LXPC 3U5OA 4FJCA 3O37A 4LKAA 5F60A 4CL9A 3NG2A 3LXJA 4UIZA 3C6WA 1E6IA 3QZTA 4O7AA 2DVQA 3IHPA 5A83A 5FE5A 4FIPA 5I83A 4CUUA 5C89A 2D9EA 4RVRA 5CQ3A 2Y43A 5I86A 1JM7B 5I40A 5F63A 4ALGA 4NUEA 5FB1A 4O7EA 4IC3A 2CT2A 5G04B 5CQ8A 4UIVA 4UITA 5EPRA 2IDAA 4UYFA 3NXBA 5EP7A 4A9FA 3UVXA 5HRWA 3MB4A 2DX8A 5KH9A 4YYIA 2RNYA 5CUBA 5A85A 4IR5A 3U5JA 3ZYQA 5D3PA 5A5OA 2ECTA 5E3DA 2KREA 5COIA 4GNDA 3I3JA 5DYAA 4ZDTA 3K2JA 5TCMA 5A5QA 5D25A 1JSPB 4BW4A 4E96A 5FE6A 2YU4A 2L5EA 4QC3A 4NYVA 4TT6A 4YY4A 5D1LB 5C8GA 4L58A 4HBYA 5I1QA 4FO9A 2G6QA 4A9MA 1RMDA 2RO1A 2VJFB 4J1PA 3KQIA 4NRAA 3UVDA 5I88A 3FL2A 5H9MA 3HMFA 4TQNA 4KV1A 4N4IA 2L5UA 2K4DA 2M1RA 5EGUA 5LKTA 3GG3A 4YYKA 5H85A 2VJEB 3IU5A 4QSRA 3ASLA 5EPBA 5EWWA 2KWOA 2JMDA 4QR3A 4TT4A 4Z1QA 4TU4A 2JRJA 2CSZA 3LQIA 4HXRA 1WESA 4W4UA 5FG4A 4BW2A 5KH3A 5B78A 5DKCA 5A5NA 4X3GA 4PPEA 4QSUA 4HBXA 5ENJA 1X4IA 2L84A 4LDFA 4XY9A 4ZW1A 4YYDA 5A5SA 5ACYA 1F68A 1X4UA 2BAYA 2LDRA 3QZSA 4O74A 5CUGA 3EB6A 2R0SA 2OUOA 4UIXA 4QNSA 5CRMA 5AD2A 3LRQA 5ENBA 5C85A 2PNXA 2L85A 4NXJA 2G45A 4B86C 4HXMA 5KH7A 5BT4A 2QJ0A 2ECVA 5F3AA 2YDWA 5DLXA 2NXBA 4UP5A 5D3LA 3O33A 4O75A 3MQMA 5JWMA 4GB0A 2OO1A 3QZVA 3Q2FA 4MEOA 5TDRA 1WE9A 2CKLA 5CGPA 2RNWA 3D7CA 5LKZA 5C11A 3M62A 5HQ7A 5IG6A 2WP1A 1WILA 4QSWA 5FE9A 1ZBDB 4IOOA 2KFTA 5FE0A 3T7LA 2M3HA 1JM4B 5EQ1A 5DY7A 4ZC9A 5LCWB 2R0VA 4QBMA 4QY4A 4LC2A 5DKDA 1N87A 2LXHC 1FP0A 3HCUA 2K17A 5DINA 3U5PA 5HFQA 4OGIA 2LRIC 5KO4A 5EWDA 4TYLA 4UYFB 4XI1A 3DPLR 4IC2A 3RPGB 3GV4A 1Z6UA 4QR5A 5K29A 2E7OA 4UYEA 4QUUA 4Y03A 2I8NA 5DW2A 4CUQA 1WEWA 3HCSA 4HXNA 4XUAA 2F6JA 2YYNA 5DFBA 4Q6FA 2KR4A 2LGGA 5D3TA 5TRBA 2YHNA 5FFWA 3DQVR 3DAIA 5CPEA 4R8PK 5TB6A 3O36A 2DVSA 3VK6A 4A4BA 3L1ZB 2YUCA 5B79A 2DKWA 5ENGA 3JVLA 5L8UA 1LDKC 4R2YA 5HFRA 3RPGC 5D3NA 4A9HA 5E9VA 4WZ0A 4NR7A 5FBXA 2EGPA 5I7XA 5TABA 4QUTA 4BW1A 3U5MA 4C67A 3ONIA 4MENA 1X4JA 4A49A 4UYDA 4YY6A 4BBQA 4YYJA 4NR9A 5HEMA 5B76A 2YW8A 2RS9B 4LLBA 2RSDA 2NAAA 3KNVA 2ECIA 5C13A 1WEOA 2E6RA 3P5OA 4PCEA 4PY6A 5E7DA 4A9EA 4QYLA 4QR4A 1BORA 3UW9A 4O78A 2YYRA 3U5KA 2VNFA 4KCXA 4AVXA 2L43A 3SVGA 5CUAA 2XB1A 4AYCB 3S91A 4A0CD 5ENFA 4CUTA 3KV6A 3O7AA 3ZPVE 5E0RA 3V43A 4CFLA 4QEUA 5AMEA 4XUBA 2MNZA 4J3IA 5H1VA 5C87A 5B75A 2YSMA 4NR8A 1WENA 4UYGA 4R7EA 5CP5A 2DWWA 5D7XA 4F3IA 5AD3A 1ZS5A 3RCWA 3PHDA 4YABA 3UV5A 3N9NA 5AITA 5D3HA 5HELA 3EB5A 3PUQA 3G0LA 3HMEA 4DONA 1WUMA 1WGMA 2R0YA 2D8SA 5EA1A 1HYJA 3JVMA 5FDZA 2LV9A 3M63A 2OXQC 4WA6A 4NUDA 4UP0A 4LZ2A 5BT3A 3LQJA 4QSXA 4HXSA 5EVAA 3SOXA 2E3KA 5G4RA 5A81A 2KWNA 5CQTA 1WEUA 2H0DB 4O7CA 3N9QA 4YBMA 4GNFA 5E9MA 5CU8A 5C7NA 4O70A 3HCTA 4QC1A 5A7CA 4QSTA 4QSQA 1VFYA 5E9KA 2C2LA 5A5RA 4O72A 4QSVA 4Z93A 4P5OB 2LGVA 1JM7A 5EWHA 5LUUA 4YATA 5EWVA 4NYWA 1MM2A 2MT5A 2MUMA 3ZVYA 5F25A 4NQNA 5L96A 4ZUXU 5CS8A 5E73A 5E9LA 5D3JA 2KGGA 1MM3A 4LYSA 4BHWA 3M99A 5G4SA 4Z6IA 5LKUA 5TBNA 2LSPB 3O35A 4BJXA 5IGLA 2VPEA 5IGKA 4YH3A 4N4GA 4MSXA 5TDWA 4N3WA 5HQ6A 2KE1A 2M6MA 5IIDA 1WFKA 4YYMA 1WEQA 2CSYA 5FFVA 5LJ2A 4LRGA 4WHWA 3RTRB 5D0CA 5A5PA 1X0JA 4YYGA 2EODA 1WEPA 4QZSA 2XEUA 2D82A 4OGJA 4YBTA 2VPDA 2R10A 5DKHA 4ALHA 2GRCA 2H60A 5DBMA 2VJFA 1E4UA 4YC9A 5A82A 5EWCA 4HXLA 4BW3A 2PUYA 4HXPA 2I50A 3SHBA 1U6GB 5FERA 5EISA 4QYDA 4HBVA 2VJEA 2YELA 5I80A 5F1HA 3SVFA 3AQAA 4NRBA 1CHCA 4Q0NA 3P1DA 3UVYA 2FUUA 2N9GA 2L75A 5D1KB 1VYXA 4O77A 4QSSA 5HRVA 5F1LA 4NR6A 5DYCA 2ECWA 4I7BA 1N72A 5HM0A 2YT5A 4O7BA 3MUKA 4CLBA 4C66A 5J0DA 5EPSA 5JG6A 5E9YA 2KWJA 5CZGA 5CQAA 5EK9A 4LJNA 2ECNA 5FH8A 4I7CA 4I7DA 2DVVA 3SOWA 2YHOA 5LJ0A 5J3XA 3O70A 4QF3A 3O34A 5FH7A 5IGNA 3U5LA 2F42A 5FH6A 3N9PA 4F52B 2HDPA 1Z60A 4IORA 4UIWA 2MIQA 4QEWA 2LN0A 4NR5A 5E74A 4YBSA 3ZTGA 5D24A 3S92A 4LK9A 4NN2A 3TLPA 1F62A 1EQFA 4TS8A 3U5NA 4A9OA 4CA1A 5EV9A 5II2A 4O71A 2C2VS 4QF2A 1G25A 5IGMA 5FE4A 5I7YA 5CRZA 2YEKA 3C5KA 4TT2A 3P1CA 3LQHA 4IR4A 5II1A 1HYIA 5L97A 3I2DA 3UV2A 2KIZA 2Y1NA 5CQ6A 2ZETC 2G4AA 5LJ1A 3ZVZB 1XWHA 4LADB 4TZ8A 2K1JA 4O76A 4J0SA 4A9LA 4NQMA 2JMIA 5G0FA 5HJCA 1V87A 5H1TA 5FG5A 2YEMA 5FB0A 3HTKC 4N4FA 2YQLA 1WUGA 5D1MB 4UYHA 4CUPA 2CKLB 2K16A 2HYED 2YW5A 5HENA 4TZ2A 4TTEA 4WHUA 3UV4A 5DW1A 5CQ4A 2OSSA 5CQ7A 5BT5A 4GNGA 5KHMA 4YH4A 5G05B 3T6RA 4AP4A 4UI9B 2I7KA 2JMJA 3GL6A 3P1EA 2MJVB 5CY9A 1WEVA 2MA6A 2LGKA 4LYIA 5FE1A 5CUDA 4PKLA 5FE7A 4NR4A 4Z1SA 5FE2A 2VPBA 4Q0OA 5ETDA 4QEVA 5DX4A 5DFCA 5EYAF 5F36A 3HMHA 4B7YC 5HCLA 2ECGA 4S3OB 4ZQLA 4HBWA 4YADA 2KWKA 4MEQA 2L0BA 5F61A 2YSJA 2M85A 2LGLA 3FKMX 4IOQA 4O7FA 5D3RA 2E6SA 4NS5A 5ENEA 2G43A 4MR6A 5D26A 4V3KC 4NRCA 4YYHA 5L99A 5LKXA 4Z6HA 4KV4A 5E9IA 4CFKA 2UZGA 4A9JA 3L11A 4V3LC 4CURA 4A4CA 3DWYA 4PCIA 5L98A 4C9ZA 5CUEA 5FE8A
chains in the Genus database with same CATH superfamily
3N9OA 5CFWA 2Y1MA 2VP7A 5I3LA 4OUFA 5KTWA 2YQDA 4QB3A 5KTUA 2KGIA 3L1XA 2MD8C 5H1UA 4XY8A 3JVKA 4AKNA 5FFYA 5JI8A 2KU3A 4CCGX 4LZSA 5FE3A 4S3OC 4XYAA 2LQ6A 4IR6A 3G0JA 5ENHA 3IU6A 4HXOA 3DDTA 5AIUA 5E3GA 2QICA 5EI4A 3ZYUA 5DYUA 4MVTA 2MA5A 2FSAA 4GPJA 4NUCA 1WEEA 3P1FA 2KTBB 2YREA 4AYCA 5LVQA 2E7NA 4N4HA 3LJWA 3MHSA 2EGMA 5ENCA 2MNYA 5LVRA 4WIVA 1DVPA 3KV5A 5AMFA 4J0RA 2AN6A 1K2FA 5B8DA 5F62A 5I89A 4CUSA 4O64A 3MHHA 5HQ5A 2EA6A 4YAXA 2WP2A 1LDJB 2VPGA 5KTXA 5HLSA 2FUIA 5ETBA 5IBNA 2KYUA 4UIYA 3ZPV1 5CQ5A 4TKPB 2RFJA 3UVWA 4MR3A 2KKXA 1WIMA 5F2PA 2RNXA 5DKAA 5EU1A 3H7HA 4WZ2A 4A9NA 4YK0A 1FBVA 4WZ3B 1VD4A 4PS5A 2CRRA 4MEPA 4A9KA 5C4QA 1T1HA 3FJUB 3SOUA 5DLZA 2RI7A 4IR3A 4QSPA 2DATA 4AUQB 4X2IA 4HXKA 5EICA 5F5ZA 3SVHA 5CTLA 5EM3A 4A9IA 2H0DA 3MXFA 2F6NA 1WEMA 4L7XA 4LR6A 4GNEA 2QIZA 5DYXA 2DVRA 5FG6A 3PLWA 5KU3A 2XOZA 5ENIA 2L80A 2ECJA 4LZRA 4UIUA 4FK5A 3ZNIA 1Z2QA 3FEHA 2YURA 3DWDA 5I29A 3N9LA 3N9MA 3MB3A 4MR4A 1IYMA 4PTBA 4YYNA 3PURA 1JOCA 5FEYA 4LYWA 5B77A 5HRXA 4TU6A 4NYXA 5L8TA 2MD7B 2YQMA 3AADA 4MR5A 5DFDA 4FLPA 5CUCA 3MULA 5D3SA 3Q2EA 3JVJA 2LXPC 3U5OA 4FJCA 3O37A 4LKAA 5F60A 4CL9A 3NG2A 3LXJA 4UIZA 3VKHA 1E6IA 3QZTA 3C6WA 4O7AA 2DVQA 3IHPA 5A83A 5FE5A 4FIPA 5I83A 4CUUA 2LAUA 5C89A 2D9EA 4RVRA 5CQ3A 2Y43A 5I86A 1JM7B 5I40A 5F63A 4ALGA 4NUEA 5FB1A 3M7KA 4O7EA 4IC3A 2CT2A 5G04B 5CQ8A 4UIVA 4UITA 5EPRA 2IDAA 4UYFA 3NXBA 5EP7A 4A9FA 3UVXA 5HRWA 3MB4A 2DX8A 5KH9A 4YYIA 2RNYA 5CUBA 5A85A 4IR5A 3U5JA 3ZYQA 5D3PA 5A5OA 2ECTA 5E3DA 2KREA 5COIA 4GNDA 3I3JA 5DYAA 4ZDTA 3K2JA 5TCMA 5A5QA 5D25A 1JSPB 4BW4A 4E96A 2OWAA 5FE6A 2YU4A 2L5EA 4QC3A 4NYVA 4TT6A 4YY4A 5D1LB 5C8GA 4L58A 4HBYA 5I1QA 4FO9A 2G6QA 4A9MA 1RMDA 2RO1A 2VJFB 4J1PA 3KQIA 4NRAA 3UVDA 5I88A 3FL2A 5H9MA 3HMFA 4TQNA 4KV1A 4AKIA 4N4IA 2L5UA 2K4DA 2M1RA 2MKEA 5EGUA 5LKTA 3GG3A 4YYKA 4O62A 5H85A 2VJEB 3IU5A 4QSRA 3ASLA 5EPBA 5EWWA 2DJAA 2KWOA 2JMDA 4QR3A 4TT4A 4Z1QA 4TU4A 2JRJA 2CSZA 3LQIA 4HXRA 4V3KC 2XOYA 1WESA 4W4UA 5FG4A 4BW2A 5KH3A 5B78A 5DKCA 5A5NA 4X3GA 4PPEA 4QSUA 4HBXA 5ENJA 1X4IA 4OGCA 2L84A 4LDFA 4XY9A 4ZW1A 4YYDA 5A5SA 5ACYA 1ZKRA 1F68A 1X4UA 2BAYA 2LDRA 3QZSA 4O74A 2RR4A 5CUGA 4AKHA 2R0SA 2OUOA 4UIXA 4QNSA 5CRMA 5AD2A 2M13A 5ENBA 5C85A 2PNXA 2L85A 2EJNA 4NXJA 3VKGA 4HXMA 2G45A 4B86C 5KH7A 5BT4A 2QJ0A 2ECVA 5F3AA 2YDWA 2YVRA 5DLXA 2NXBA 4UP5A 5D3LA 3O33A 4O75A 3MQMA 5JWMA 4GB0A 2OO1A 3QZVA 3Q2FA 4MEOA 3FAOA 5TDRA 1WE9A 2CKLA 5CGPA 3O47A 2RNWA 3D7CA 5LKZA 5C11A 3M62A 5HQ7A 5IG6A 2D8UA 2WP1A 1WILA 4QSWA 5FE9A 1ZBDB 5K3QA 4IOOA 2FD4A 2KFTA 5FE0A 4F1PA 3T7LA 2M3HA 2XP0A 1JM4B 5EQ1A 2CRWA 5DY7A 4ZC9A 5LCWB 2R0VA 4QBMA 4AKGA 4QY4A 4LC2A 5DKDA 1N87A 2LXHC 1FP0A 3EB6A 3HCUA 2K17A 5DINA 3U5PA 5HFQA 4OGIA 2LRIC 5KO4A 5EWDA 4TYLA 4UYFB 4XI1A 3DPLR 4IC2A 3RPGB 3GV4A 1Z6UA 4QR5A 5K29A 2E7OA 2JUNA 4UYEA 4QUUA 4Y03A 2I8NA 5DW2A 4CUQA 1WEWA 3HCSA 4HXNA 4XUAA 2F6JA 2YYNA 5DFBA 4Q6FA 2KR4A 2LGGA 2P57A 3MDBC 5D3TA 5TRBA 3T9KA 2YHNA 3D1BA 5FFWA 3DQVR 3DAIA 5CPEA 4R8PK 5TB6A 3O36A 2E61A 2DVSA 3VK6A 4A4BA 3L1ZB 2JM3A 2YUCA 5B79A 2DKWA 5ENGA 3JVLA 5L8UA 1LDKC 4R2YA 5HFRA 3RPGC 5D3NA 4A9HA 5E9VA 4WZ0A 4NR7A 3LDYA 5FBXA 2EGPA 5I7XA 5TABA 4QUTA 4BW1A 3U5MA 4C67A 3ONIA 4MENA 1X4JA 4A49A 4UYDA 4YY6A 4BBQA 4YYJA 3ERRA 4NR9A 5HEMA 5B76A 4AI6A 2YW8A 2RS9B 4LLBA 2RSDA 2NAAA 3KNVA 2ECIA 5C13A 1WEOA 2E6RA 3P5OA 4PCEA 2KKYA 4PY6A 5E7DA 4A9EA 4QYLA 4QR4A 1BORA 1PUOA 3UW9A 4O78A 2YYRA 3U5KA 2VNFA 4KCXA 4AVXA 1DCQA 2L43A 3SVGA 5CUAA 2XB1A 4AYCB 3S91A 4A0CD 5ENFA 4CUTA 3KV6A 3O7AA 3ZPVE 5E0RA 3V43A 4CFLA 4QEUA 5AMEA 4XUBA 2MNZA 4J3IA 5H1VA 5C87A 5B75A 2YSMA 4NR8A 1WENA 4UYGA 2XOCA 4R7EA 5CP5A 2DWWA 5D7XA 4F3IA 5AD3A 5SVIA 1ZS5A 3RCWA 3PHDA 4YABA 3UV5A 3N9NA 5AITA 5D3HA 5HELA 3EB5A 3PUQA 3LVQE 3G0LA 3HMEA 4DONA 1WUMA 1WGMA 2R0YA 2D8SA 5EA1A 1HYJA 3JVMA 5FDZA 2LV9A 3D1DA 3M63A 2OXQC 4WA6A 4NUDA 4UP0A 4LZ2A 5BT3A 3LQJA 4QSXA 4HXSA 5EVAA 3SOXA 2E3KA 5G4RA 5A81A 2KWNA 5CQTA 1WEUA 2H0DB 4O7CA 3N9QA 4YBMA 4GNFA 5E9MA 5CU8A 5C7NA 4O70A 3HCTA 4QC1A 5A7CA 4QSTA 4QSQA 1VFYA 5E9KA 2C2LA 5A5RA 4O72A 4QSVA 4Z93A 4P5OB 2LGVA 1JM7A 5EWHA 5LUUA 4YATA 5EWVA 4NYWA 1MM2A 2MT5A 2MUMA 3FANA 3ZVYA 3Q1DA 5F25A 4NQNA 5L96A 2CONA 5CS8A 5E73A 4ZUXU 5E9LA 5D3JA 2KGGA 1MM3A 4LYSA 4BHWA 3M99A 5G4SA 4Z6IA 5LKUA 5TBNA 2LSPB 3O35A 4BJXA 5IGLA 2VPEA 5IGKA 4YH3A 4N4GA 4MSXA 5TDWA 4N3WA 5HQ6A 2KE1A 3KDEC 2M6MA 5IIDA 1WFKA 4YYMA 1WEQA 2CSYA 5FFVA 5LJ2A 4LRGA 4WHWA 3RTRB 5D0CA 5A5PA 1X0JA 4H9DA 4YYGA 2EODA 1WEPA 4QZSA 2XEUA 2D82A 4OGJA 4YBTA 2VPDA 2R10A 5DKHA 4ALHA 2GRCA 2H60A 5DBMA 2VJFA 1E4UA 4YC9A 5A82A 5EWCA 4HXLA 4BW3A 2PUYA 4HXPA 2I50A 3SHBA 1U6GB 5FERA 5EISA 4QYDA 4HBVA 2VJEA 2YELA 5I80A 5F1HA 3SVFA 3AQAA 4NRBA 1CHCA 4Q0NA 3P1DA 3UVYA 2FUUA 2N9GA 2L75A 5D1KB 1VYXA 4O77A 4QSSA 5HRVA 2DSMA 5F1LA 4NR6A 5DYCA 2ECWA 4I7BA 1N72A 5HM0A 2YT5A 4O7BA 3MUKA 4CLBA 4C66A 5J0DA 5EPSA 5JG6A 5E9YA 2KWJA 5CZGA 5CQAA 5EK9A 4LJNA 2ECNA 5FH8A 4I7CA 4I7DA 2DVVA 2CSVA 3SOWA 2YHOA 3E2DA 5SVIB 5LJ0A 5J3XA 3O70A 4QF3A 3O34A 5FH7A 5IGNA 3U5LA 2F42A 5FH6A 3N9PA 4F52B 2HDPA 2L7PA 1Z60A 4IORA 4UIWA 2MIQA 4QEWA 2LN0A 4NR5A 5E74A 4YBSA 3ZTGA 5D24A 3S92A 4LK9A 4NN2A 3TLPA 1F62A 1EQFA 4TS8A 3U5NA 4Z0OA 4A9OA 4CA1A 5EV9A 5II2A 4O71A 2C2VS 4QF2A 1G25A 2B0OE 5IGMA 5FE4A 5I7YA 5CRZA 2YEKA 3C5KA 4TT2A 3P1CA 3LQHA 4IR4A 5II1A 1HYIA 5L97A 3I2DA 4QQ4A 3UV2A 2KIZA 2Y1NA 5CQ6A 2ZETC 4OGEA 2G4AA 5LJ1A 3ZVZB 1XWHA 4LADB 4TZ8A 2K1JA 4O76A 5SVYA 4J0SA 4A9LA 4NQMA 2JMIA 5G0FA 5HJCA 1V87A 5H1TA 5FG5A 2YEMA 5FB0A 3HTKC 4N4FA 2YQLA 1WUGA 5D1MB 4UYHA 4CUPA 2CKLB 2K16A 2HYED 2YW5A 3SUBA 5HENA 4TZ2A 4TTEA 4Z0RA 4WHUA 3UV4A 5DW1A 3FM8C 5CQ4A 2OSSA 5CQ7A 5BT5A 4GNGA 5KHMA 4YH4A 2EXUA 5G05B 3T6RA 4AP4A 4UI9B 2I7KA 2JMJA 3GL6A 3P1EA 2MJVB 5CY9A 1WEVA 2MA6A 2LGKA 5SVXA 4LYIA 5FE1A 5CUDA 4PKLA 5FE7A 4NR4A 4Z1SA 5FE2A 2VPBA 4Q0OA 5ETDA 4QEVA 5DX4A 5DFCA 5EYAF 5F36A 3HMHA 4B7YC 5HCLA 2ECGA 4S3OB 3LVRE 4ZQLA 4HBWA 4YADA 2KWKA 4MEQA 2L0BA 5F61A 2YSJA 2M85A 2LGLA 3FKMX 4IOQA 4O7FA 5D3RA 2E6SA 4NS5A 2FFWA 5ENEA 1MBMA 4MR6A 5D26A 2G43A 4NRCA 4YYHA 5L99A 5LKXA 4Z6HA 4KV4A 3JUEA 5E9IA 4CFKA 2IQJA 4A9JA 2UZGA 3L11A 3LJUX 4V3LC 4CURA 4A4CA 3DWYA 4PCIA 5L98A 4C9ZA 5CUEA 3LRQA 5FE8A
chains in the Genus database with same CATH topology
3N9OA 5CFWA 2Y1MA 2VP7A 5I3LA 4OUFA 5KTWA 2YQDA 4QB3A 5KTUA 2KGIA 3L1XA 2MD8C 5H1UA 4XY8A 3JVKA 4AKNA 5FFYA 5JI8A 2KU3A 4CCGX 4LZSA 5FE3A 4S3OC 4XYAA 2LQ6A 4IR6A 3G0JA 5ENHA 3IU6A 4HXOA 5AIUA 5E3GA 2QICA 5EI4A 3ZYUA 5DYUA 4MVTA 2MA5A 2FSAA 4GPJA 4NUCA 1WEEA 3P1FA 2KTBB 2YREA 4AYCA 5LVQA 2E7NA 4N4HA 3LJWA 3MHSA 5ENCA 2MNYA 5LVRA 4WIVA 1DVPA 3KV5A 5AMFA 4J0RA 2AN6A 1K2FA 5B8DA 5F62A 5I89A 4CUSA 4O64A 3MHHA 5HQ5A 2EA6A 4YAXA 2WP2A 1LDJB 2VPGA 5KTXA 5HLSA 2FUIA 5ETBA 5IBNA 2KYUA 4UIYA 3ZPV1 5CQ5A 4TKPB 2RFJA 3UVWA 4MR3A 1WIMA 5F2PA 2RNXA 5DKAA 5EU1A 4WZ2A 4A9NA 4YK0A 1FBVA 4WZ3B 1VD4A 4PS5A 4MEPA 4A9KA 5C4QA 1T1HA 3SOUA 4AUQB 5DLZA 2RI7A 4IR3A 4QSPA 2DATA 4X2IA 4HXKA 5EICA 5F5ZA 3SVHA 5CTLA 5EM3A 4A9IA 2H0DA 3MXFA 2F6NA 1WEMA 4L7XA 4LR6A 4GNEA 2QIZA 5DYXA 2DVRA 5FG6A 5KU3A 5ENIA 2L80A 2ECJA 4LZRA 4UIUA 4FK5A 3ZNIA 1Z2QA 2YURA 3N9LA 5I29A 3N9MA 3MB3A 4MR4A 1IYMA 4PTBA 4YYNA 3PURA 1JOCA 5FEYA 4LYWA 5B77A 5HRXA 4TU6A 4NYXA 5L8TA 2MD7B 2YQMA 3AADA 4MR5A 5DFDA 4FLPA 5CUCA 3MULA 5D3SA 3Q2EA 3JVJA 2LXPC 3U5OA 4FJCA 3O37A 4LKAA 5F60A 4CL9A 3NG2A 3LXJA 4UIZA 3C6WA 1E6IA 3QZTA 4O7AA 2DVQA 3IHPA 5A83A 5FE5A 4FIPA 5I83A 4CUUA 5C89A 2D9EA 4RVRA 5CQ3A 2Y43A 5I86A 1JM7B 5I40A 5F63A 4ALGA 4NUEA 5FB1A 4O7EA 4IC3A 2CT2A 5G04B 5CQ8A 4UIVA 4UITA 5EPRA 2IDAA 4UYFA 3NXBA 5EP7A 4A9FA 3UVXA 5HRWA 3MB4A 2DX8A 5KH9A 4YYIA 2RNYA 5CUBA 5A85A 4IR5A 3U5JA 3ZYQA 5D3PA 5A5OA 2ECTA 5E3DA 2KREA 5COIA 4GNDA 3I3JA 5DYAA 4ZDTA 3K2JA 5TCMA 5A5QA 5D25A 1JSPB 4BW4A 4E96A 5FE6A 2YU4A 2L5EA 4QC3A 4NYVA 4TT6A 4YY4A 5D1LB 5C8GA 4L58A 4HBYA 5I1QA 4FO9A 2G6QA 4A9MA 1RMDA 2RO1A 2VJFB 4J1PA 3KQIA 4NRAA 3UVDA 5I88A 3FL2A 5H9MA 3HMFA 4TQNA 4KV1A 4N4IA 2L5UA 2K4DA 2M1RA 5EGUA 5LKTA 3GG3A 4YYKA 5H85A 2VJEB 3IU5A 4QSRA 3ASLA 5EPBA 5EWWA 2KWOA 2JMDA 4QR3A 4TT4A 4Z1QA 4TU4A 2JRJA 2CSZA 3LQIA 4HXRA 1WESA 4W4UA 5FG4A 4BW2A 5KH3A 5B78A 5DKCA 5A5NA 4X3GA 4PPEA 4QSUA 4HBXA 5ENJA 1X4IA 2L84A 4LDFA 4XY9A 4ZW1A 4YYDA 5A5SA 5ACYA 1F68A 1X4UA 2BAYA 2LDRA 3QZSA 4O74A 5CUGA 3EB6A 2R0SA 2OUOA 4UIXA 4QNSA 5CRMA 5AD2A 3LRQA 5ENBA 5C85A 2PNXA 2L85A 4NXJA 2G45A 4B86C 4HXMA 5KH7A 5BT4A 2QJ0A 2ECVA 5F3AA 2YDWA 5DLXA 2NXBA 4UP5A 5D3LA 3O33A 4O75A 3MQMA 5JWMA 4GB0A 2OO1A 3QZVA 3Q2FA 4MEOA 5TDRA 1WE9A 2CKLA 5CGPA 2RNWA 3D7CA 5LKZA 5C11A 3M62A 5HQ7A 5IG6A 2WP1A 1WILA 4QSWA 5FE9A 1ZBDB 4IOOA 2KFTA 5FE0A 3T7LA 2M3HA 1JM4B 5EQ1A 5DY7A 4ZC9A 5LCWB 2R0VA 4QBMA 4QY4A 4LC2A 5DKDA 1N87A 2LXHC 1FP0A 3HCUA 2K17A 5DINA 3U5PA 5HFQA 4OGIA 2LRIC 5KO4A 5EWDA 4TYLA 4UYFB 4XI1A 3DPLR 4IC2A 3RPGB 3GV4A 1Z6UA 4QR5A 5K29A 2E7OA 4UYEA 4QUUA 4Y03A 2I8NA 5DW2A 4CUQA 1WEWA 3HCSA 4HXNA 4XUAA 2F6JA 2YYNA 5DFBA 4Q6FA 2KR4A 2LGGA 5D3TA 5TRBA 2YHNA 5FFWA 3DQVR 3DAIA 5CPEA 4R8PK 5TB6A 3O36A 2DVSA 3VK6A 4A4BA 3L1ZB 2YUCA 5B79A 2DKWA 5ENGA 3JVLA 5L8UA 1LDKC 4R2YA 5HFRA 3RPGC 5D3NA 4A9HA 5E9VA 4WZ0A 4NR7A 5FBXA 2EGPA 5I7XA 5TABA 4QUTA 4BW1A 3U5MA 4C67A 3ONIA 4MENA 1X4JA 4A49A 4UYDA 4YY6A 4BBQA 4YYJA 4NR9A 5HEMA 5B76A 2YW8A 2RS9B 4LLBA 2RSDA 2NAAA 3KNVA 2ECIA 5C13A 1WEOA 2E6RA 3P5OA 4PCEA 4PY6A 5E7DA 4A9EA 4QYLA 4QR4A 1BORA 3UW9A 4O78A 2YYRA 3U5KA 2VNFA 4KCXA 4AVXA 2L43A 3SVGA 5CUAA 2XB1A 4AYCB 3S91A 4A0CD 5ENFA 4CUTA 3KV6A 3O7AA 3ZPVE 5E0RA 3V43A 4CFLA 4QEUA 5AMEA 4XUBA 2MNZA 4J3IA 5H1VA 5C87A 5B75A 2YSMA 4NR8A 1WENA 4UYGA 4R7EA 5CP5A 2DWWA 5D7XA 4F3IA 5AD3A 1ZS5A 3RCWA 3PHDA 4YABA 3UV5A 3N9NA 5AITA 5D3HA 5HELA 3EB5A 3PUQA 3G0LA 3HMEA 4DONA 1WUMA 1WGMA 2R0YA 2D8SA 5EA1A 1HYJA 3JVMA 5FDZA 2LV9A 3M63A 2OXQC 4WA6A 4NUDA 4UP0A 4LZ2A 5BT3A 3LQJA 4QSXA 4HXSA 5EVAA 3SOXA 2E3KA 5G4RA 5A81A 2KWNA 5CQTA 1WEUA 2H0DB 4O7CA 3N9QA 4YBMA 4GNFA 5E9MA 5CU8A 5C7NA 4O70A 3HCTA 4QC1A 5A7CA 4QSTA 4QSQA 1VFYA 5E9KA 2C2LA 5A5RA 4O72A 4QSVA 4Z93A 4P5OB 2LGVA 1JM7A 5EWHA 5LUUA 4YATA 5EWVA 4NYWA 1MM2A 2MT5A 2MUMA 3ZVYA 5F25A 4NQNA 5L96A 4ZUXU 5CS8A 5E73A 5E9LA 5D3JA 2KGGA 1MM3A 4LYSA 4BHWA 3M99A 5G4SA 4Z6IA 5LKUA 5TBNA 2LSPB 3O35A 4BJXA 5IGLA 2VPEA 5IGKA 4YH3A 4N4GA 4MSXA 5TDWA 4N3WA 5HQ6A 2KE1A 2M6MA 5IIDA 1WFKA 4YYMA 1WEQA 2CSYA 5FFVA 5LJ2A 4LRGA 4WHWA 3RTRB 5D0CA 5A5PA 1X0JA 4YYGA 2EODA 1WEPA 4QZSA 2XEUA 2D82A 4OGJA 4YBTA 2VPDA 2R10A 5DKHA 4ALHA 2GRCA 2H60A 5DBMA 2VJFA 1E4UA 4YC9A 5A82A 5EWCA 4HXLA 4BW3A 2PUYA 4HXPA 2I50A 3SHBA 1U6GB 5FERA 5EISA 4QYDA 4HBVA 2VJEA 2YELA 5I80A 5F1HA 3SVFA 3AQAA 4NRBA 1CHCA 4Q0NA 3P1DA 3UVYA 2FUUA 2N9GA 2L75A 5D1KB 1VYXA 4O77A 4QSSA 5HRVA 5F1LA 4NR6A 5DYCA 2ECWA 4I7BA 1N72A 5HM0A 2YT5A 4O7BA 3MUKA 4CLBA 4C66A 5J0DA 5EPSA 5JG6A 5E9YA 2KWJA 5CZGA 5CQAA 5EK9A 4LJNA 2ECNA 5FH8A 4I7CA 4I7DA 2DVVA 3SOWA 2YHOA 5LJ0A 5J3XA 3O70A 4QF3A 3O34A 5FH7A 5IGNA 3U5LA 2F42A 5FH6A 3N9PA 4F52B 2HDPA 1Z60A 4IORA 4UIWA 2MIQA 4QEWA 2LN0A 4NR5A 5E74A 4YBSA 3ZTGA 5D24A 3S92A 4LK9A 4NN2A 3TLPA 1F62A 1EQFA 4TS8A 3U5NA 4A9OA 4CA1A 5EV9A 5II2A 4O71A 2C2VS 4QF2A 1G25A 5IGMA 5FE4A 5I7YA 5CRZA 2YEKA 3C5KA 4TT2A 3P1CA 3LQHA 4IR4A 5II1A 1HYIA 5L97A 3I2DA 3UV2A 2KIZA 2Y1NA 5CQ6A 2ZETC 2G4AA 5LJ1A 3ZVZB 1XWHA 4LADB 4TZ8A 2K1JA 4O76A 4J0SA 4A9LA 4NQMA 2JMIA 5G0FA 5HJCA 1V87A 5H1TA 5FG5A 2YEMA 5FB0A 3HTKC 4N4FA 2YQLA 1WUGA 5D1MB 4UYHA 4CUPA 2CKLB 2K16A 2HYED 2YW5A 5HENA 4TZ2A 4TTEA 4WHUA 3UV4A 5DW1A 5CQ4A 2OSSA 5CQ7A 5BT5A 4GNGA 5KHMA 4YH4A 5G05B 3T6RA 4AP4A 4UI9B 2I7KA 2JMJA 3GL6A 3P1EA 2MJVB 5CY9A 1WEVA 2MA6A 2LGKA 4LYIA 5FE1A 5CUDA 4PKLA 5FE7A 4NR4A 4Z1SA 5FE2A 2VPBA 4Q0OA 5ETDA 4QEVA 5DX4A 5DFCA 5EYAF 5F36A 3HMHA 4B7YC 5HCLA 2ECGA 4S3OB 4ZQLA 4HBWA 4YADA 2KWKA 4MEQA 2L0BA 5F61A 2YSJA 2M85A 2LGLA 3FKMX 4IOQA 4O7FA 5D3RA 2E6SA 4NS5A 5ENEA 2G43A 4MR6A 5D26A 4V3KC 4NRCA 4YYHA 5L99A 5LKXA 4Z6HA 4KV4A 5E9IA 4CFKA 2UZGA 4A9JA 3L11A 4V3LC 4CURA 4A4CA 3DWYA 4PCIA 5L98A 4C9ZA 5CUEA 5FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9O A;  5CFW A;  2Y1M A;  2VP7 A;  5I3L A;  4OUF A;  5KTW A;  2YQD A;  4QB3 A;  5KTU A;  2KGI A;  3L1X A;  2MD8 C;  5H1U A;  4XY8 A;  3JVK A;  4AKN A;  5FFY A;  5JI8 A;  2KU3 A;  4CCG X;  4LZS A;  5FE3 A;  4S3O C;  4XYA A;  2LQ6 A;  4IR6 A;  3G0J A;  5ENH A;  3IU6 A;  4HXO A;  5AIU A;  5E3G A;  2QIC A;  5EI4 A;  3ZYU A;  5DYU A;  4MVT A;  2MA5 A;  2FSA A;  4GPJ A;  4NUC A;  1WEE A;  3P1F A;  2KTB B;  2YRE A;  4AYC A;  5LVQ A;  2E7N A;  4N4H A;  3LJW A;  3MHS A;  5ENC A;  2MNY A;  5LVR A;  4WIV A;  1DVP A;  3KV5 A;  5AMF A;  4J0R A;  2AN6 A;  1K2F A;  5B8D A;  5F62 A;  5I89 A;  4CUS A;  4O64 A;  3MHH A;  5HQ5 A;  2EA6 A;  4YAX A;  2WP2 A;  1LDJ B;  2VPG A;  5KTX A;  5HLS A;  2FUI A;  5ETB A;  5IBN A;  2KYU A;  4UIY A;  3ZPV 1;  5CQ5 A;  4TKP B;  2RFJ A;  3UVW A;  4MR3 A;  1WIM A;  5F2P A;  2RNX A;  5DKA A;  5EU1 A;  4WZ2 A;  4A9N A;  4YK0 A;  1FBV A;  4WZ3 B;  1VD4 A;  4PS5 A;  4MEP A;  4A9K A;  5C4Q A;  1T1H A;  3SOU A;  4AUQ B;  5DLZ A;  2RI7 A;  4IR3 A;  4QSP A;  2DAT A;  4X2I A;  4HXK A;  5EIC A;  5F5Z A;  3SVH A;  5CTL A;  5EM3 A;  4A9I A;  2H0D A;  3MXF A;  2F6N A;  1WEM A;  4L7X A;  4LR6 A;  4GNE A;  2QIZ A;  5DYX A;  2DVR A;  5FG6 A;  5KU3 A;  5ENI A;  2L80 A;  2ECJ A;  4LZR A;  4UIU A;  4FK5 A;  3ZNI A;  1Z2Q A;  2YUR A;  3N9L A;  5I29 A;  3N9M A;  3MB3 A;  4MR4 A;  1IYM A;  4PTB A;  4YYN A;  3PUR A;  1JOC A;  5FEY A;  4LYW A;  5B77 A;  5HRX A;  4TU6 A;  4NYX A;  5L8T A;  2MD7 B;  2YQM A;  3AAD A;  4MR5 A;  5DFD A;  4FLP A;  5CUC A;  3MUL A;  5D3S A;  3Q2E A;  3JVJ A;  2LXP C;  3U5O A;  4FJC A;  3O37 A;  4LKA A;  5F60 A;  4CL9 A;  3NG2 A;  3LXJ A;  4UIZ A;  3C6W A;  1E6I A;  3QZT A;  4O7A A;  2DVQ A;  3IHP A;  5A83 A;  5FE5 A;  4FIP A;  5I83 A;  4CUU A;  5C89 A;  2D9E A;  4RVR A;  5CQ3 A;  2Y43 A;  5I86 A;  1JM7 B;  5I40 A;  5F63 A;  4ALG A;  4NUE A;  5FB1 A;  4O7E A;  4IC3 A;  2CT2 A;  5G04 B;  5CQ8 A;  4UIV A;  4UIT A;  5EPR A;  2IDA A;  4UYF A;  3NXB A;  5EP7 A;  4A9F A;  3UVX A;  5HRW A;  3MB4 A;  2DX8 A;  5KH9 A;  4YYI A;  2RNY A;  5CUB A;  5A85 A;  4IR5 A;  3U5J A;  3ZYQ A;  5D3P A;  5A5O A;  2ECT A;  5E3D A;  2KRE A;  5COI A;  4GND A;  3I3J A;  5DYA A;  4ZDT A;  3K2J A;  5TCM A;  5A5Q A;  5D25 A;  1JSP B;  4BW4 A;  4E96 A;  5FE6 A;  2YU4 A;  2L5E A;  4QC3 A;  4NYV A;  4TT6 A;  4YY4 A;  5D1L B;  5C8G A;  4L58 A;  4HBY A;  5I1Q A;  4FO9 A;  2G6Q A;  4A9M A;  1RMD A;  2RO1 A;  2VJF B;  4J1P A;  3KQI A;  4NRA A;  3UVD A;  5I88 A;  3FL2 A;  5H9M A;  3HMF A;  4TQN A;  4KV1 A;  4N4I A;  2L5U A;  2K4D A;  2M1R A;  5EGU A;  5LKT A;  3GG3 A;  4YYK A;  5H85 A;  2VJE B;  3IU5 A;  4QSR A;  3ASL A;  5EPB A;  5EWW A;  2KWO A;  2JMD A;  4QR3 A;  4TT4 A;  4Z1Q A;  4TU4 A;  2JRJ A;  2CSZ A;  3LQI A;  4HXR A;  1WES A;  4W4U A;  5FG4 A;  4BW2 A;  5KH3 A;  5B78 A;  5DKC A;  5A5N A;  4X3G A;  4PPE A;  4QSU A;  4HBX A;  5ENJ A;  1X4I A;  2L84 A;  4LDF A;  4XY9 A;  4ZW1 A;  4YYD A;  5A5S A;  5ACY A;  1F68 A;  1X4U A;  2BAY A;  2LDR A;  3QZS A;  4O74 A;  5CUG A;  3EB6 A;  2R0S A;  2OUO A;  4UIX A;  4QNS A;  5CRM A;  5AD2 A;  3LRQ A;  5ENB A;  5C85 A;  2PNX A;  2L85 A;  4NXJ A;  2G45 A;  4B86 C;  4HXM A;  5KH7 A;  5BT4 A;  2QJ0 A;  2ECV A;  5F3A A;  2YDW A;  5DLX A;  2NXB A;  4UP5 A;  5D3L A;  3O33 A;  4O75 A;  3MQM A;  5JWM A;  4GB0 A;  2OO1 A;  3QZV A;  3Q2F A;  4MEO A;  5TDR A;  1WE9 A;  2CKL A;  5CGP A;  2RNW A;  3D7C A;  5LKZ A;  5C11 A;  3M62 A;  5HQ7 A;  5IG6 A;  2WP1 A;  1WIL A;  4QSW A;  5FE9 A;  1ZBD B;  4IOO A;  2KFT A;  5FE0 A;  3T7L A;  2M3H A;  1JM4 B;  5EQ1 A;  5DY7 A;  4ZC9 A;  5LCW B;  2R0V A;  4QBM A;  4QY4 A;  4LC2 A;  5DKD A;  1N87 A;  2LXH C;  1FP0 A;  3HCU A;  2K17 A;  5DIN A;  3U5P A;  5HFQ A;  4OGI A;  2LRI C;  5KO4 A;  5EWD A;  4TYL A;  4UYF B;  4XI1 A;  3DPL R;  4IC2 A;  3RPG B;  3GV4 A;  1Z6U A;  4QR5 A;  5K29 A;  2E7O A;  4UYE A;  4QUU A;  4Y03 A;  2I8N A;  5DW2 A;  4CUQ A;  1WEW A;  3HCS A;  4HXN A;  4XUA A;  2F6J A;  2YYN A;  5DFB A;  4Q6F A;  2KR4 A;  2LGG A;  5D3T A;  5TRB A;  2YHN A;  5FFW A;  3DQV R;  3DAI A;  5CPE A;  4R8P K;  5TB6 A;  3O36 A;  2DVS A;  3VK6 A;  4A4B A;  3L1Z B;  2YUC A;  5B79 A;  2DKW A;  5ENG A;  3JVL A;  5L8U A;  1LDK C;  4R2Y A;  5HFR A;  3RPG C;  5D3N A;  4A9H A;  5E9V A;  4WZ0 A;  4NR7 A;  5FBX A;  2EGP A;  5I7X A;  5TAB A;  4QUT A;  4BW1 A;  3U5M A;  4C67 A;  3ONI A;  4MEN A;  1X4J A;  4A49 A;  4UYD A;  4YY6 A;  4BBQ A;  4YYJ A;  4NR9 A;  5HEM A;  5B76 A;  2YW8 A;  2RS9 B;  4LLB A;  2RSD A;  2NAA A;  3KNV A;  2ECI A;  5C13 A;  1WEO A;  2E6R A;  3P5O A;  4PCE A;  4PY6 A;  5E7D A;  4A9E A;  4QYL A;  4QR4 A;  1BOR A;  3UW9 A;  4O78 A;  2YYR A;  3U5K A;  2VNF A;  4KCX A;  4AVX A;  2L43 A;  3SVG A;  5CUA A;  2XB1 A;  4AYC B;  3S91 A;  4A0C D;  5ENF A;  4CUT A;  3KV6 A;  3O7A A;  3ZPV E;  5E0R A;  3V43 A;  4CFL A;  4QEU A;  5AME A;  4XUB A;  2MNZ A;  4J3I A;  5H1V A;  5C87 A;  5B75 A;  2YSM A;  4NR8 A;  1WEN A;  4UYG A;  4R7E A;  5CP5 A;  2DWW A;  5D7X A;  4F3I A;  5AD3 A;  1ZS5 A;  3RCW A;  3PHD A;  4YAB A;  3UV5 A;  3N9N A;  5AIT A;  5D3H A;  5HEL A;  3EB5 A;  3PUQ A;  3G0L A;  3HME A;  4DON A;  1WUM A;  1WGM A;  2R0Y A;  2D8S A;  5EA1 A;  1HYJ A;  3JVM A;  5FDZ A;  2LV9 A;  3M63 A;  2OXQ C;  4WA6 A;  4NUD A;  4UP0 A;  4LZ2 A;  5BT3 A;  3LQJ A;  4QSX A;  4HXS A;  5EVA A;  3SOX A;  2E3K A;  5G4R A;  5A81 A;  2KWN A;  5CQT A;  1WEU A;  2H0D B;  4O7C A;  3N9Q A;  4YBM A;  4GNF A;  5E9M A;  5CU8 A;  5C7N A;  4O70 A;  3HCT A;  4QC1 A;  5A7C A;  4QST A;  4QSQ A;  1VFY A;  5E9K A;  2C2L A;  5A5R A;  4O72 A;  4QSV A;  4Z93 A;  4P5O B;  2LGV A;  1JM7 A;  5EWH A;  5LUU A;  4YAT A;  5EWV A;  4NYW A;  1MM2 A;  2MT5 A;  2MUM A;  3ZVY A;  5F25 A;  4NQN A;  5L96 A;  4ZUX U;  5CS8 A;  5E73 A;  5E9L A;  5D3J A;  2KGG A;  1MM3 A;  4LYS A;  4BHW A;  3M99 A;  5G4S A;  4Z6I A;  5LKU A;  5TBN A;  2LSP B;  3O35 A;  4BJX A;  5IGL A;  2VPE A;  5IGK A;  4YH3 A;  4N4G A;  4MSX A;  5TDW A;  4N3W A;  5HQ6 A;  2KE1 A;  2M6M A;  5IID A;  1WFK A;  4YYM A;  1WEQ A;  2CSY A;  5FFV A;  5LJ2 A;  4LRG A;  4WHW A;  3RTR B;  5D0C A;  5A5P A;  1X0J A;  4YYG A;  2EOD A;  1WEP A;  4QZS A;  2XEU A;  2D82 A;  4OGJ A;  4YBT A;  2VPD A;  2R10 A;  5DKH A;  4ALH A;  2GRC A;  2H60 A;  5DBM A;  2VJF A;  1E4U A;  4YC9 A;  5A82 A;  5EWC A;  4HXL A;  4BW3 A;  2PUY A;  4HXP A;  2I50 A;  3SHB A;  1U6G B;  5FER A;  5EIS A;  4QYD A;  4HBV A;  2VJE A;  2YEL A;  5I80 A;  5F1H A;  3SVF A;  3AQA A;  4NRB A;  1CHC A;  4Q0N A;  3P1D A;  3UVY A;  2FUU A;  2N9G A;  2L75 A;  5D1K B;  1VYX A;  4O77 A;  4QSS A;  5HRV A;  5F1L A;  4NR6 A;  5DYC A;  2ECW A;  4I7B A;  1N72 A;  5HM0 A;  2YT5 A;  4O7B A;  3MUK A;  4CLB A;  4C66 A;  5J0D A;  5EPS A;  5JG6 A;  5E9Y A;  2KWJ A;  5CZG A;  5CQA A;  5EK9 A;  4LJN A;  2ECN A;  5FH8 A;  4I7C A;  4I7D A;  2DVV A;  3SOW A;  2YHO A;  5LJ0 A;  5J3X A;  3O70 A;  4QF3 A;  3O34 A;  5FH7 A;  5IGN A;  3U5L A;  2F42 A;  5FH6 A;  3N9P A;  4F52 B;  2HDP A;  1Z60 A;  4IOR A;  4UIW A;  2MIQ A;  4QEW A;  2LN0 A;  4NR5 A;  5E74 A;  4YBS A;  3ZTG A;  5D24 A;  3S92 A;  4LK9 A;  4NN2 A;  3TLP A;  1F62 A;  1EQF A;  4TS8 A;  3U5N A;  4A9O A;  4CA1 A;  5EV9 A;  5II2 A;  4O71 A;  2C2V S;  4QF2 A;  1G25 A;  5IGM A;  5FE4 A;  5I7Y A;  5CRZ A;  2YEK A;  3C5K A;  4TT2 A;  3P1C A;  3LQH A;  4IR4 A;  5II1 A;  1HYI A;  5L97 A;  3I2D A;  3UV2 A;  2KIZ A;  2Y1N A;  5CQ6 A;  2ZET C;  2G4A A;  5LJ1 A;  3ZVZ B;  1XWH A;  4LAD B;  4TZ8 A;  2K1J A;  4O76 A;  4J0S A;  4A9L A;  4NQM A;  2JMI A;  5G0F A;  5HJC A;  1V87 A;  5H1T A;  5FG5 A;  2YEM A;  5FB0 A;  3HTK C;  4N4F A;  2YQL A;  1WUG A;  5D1M B;  4UYH A;  4CUP A;  2CKL B;  2K16 A;  2HYE D;  2YW5 A;  5HEN A;  4TZ2 A;  4TTE A;  4WHU A;  3UV4 A;  5DW1 A;  5CQ4 A;  2OSS A;  5CQ7 A;  5BT5 A;  4GNG A;  5KHM A;  4YH4 A;  5G05 B;  3T6R A;  4AP4 A;  4UI9 B;  2I7K A;  2JMJ A;  3GL6 A;  3P1E A;  2MJV B;  5CY9 A;  1WEV A;  2MA6 A;  2LGK A;  4LYI A;  5FE1 A;  5CUD A;  4PKL A;  5FE7 A;  4NR4 A;  4Z1S A;  5FE2 A;  2VPB A;  4Q0O A;  5ETD A;  4QEV A;  5DX4 A;  5DFC A;  5EYA F;  5F36 A;  3HMH A;  4B7Y C;  5HCL A;  2ECG A;  4S3O B;  4ZQL A;  4HBW A;  4YAD A;  2KWK A;  4MEQ A;  2L0B A;  5F61 A;  2YSJ A;  2M85 A;  2LGL A;  3FKM X;  4IOQ A;  4O7F A;  5D3R A;  2E6S A;  4NS5 A;  5ENE A;  2G43 A;  4MR6 A;  5D26 A;  4V3K C;  4NRC A;  4YYH A;  5L99 A;  5LKX A;  4Z6H A;  4KV4 A;  5E9I A;  4CFK A;  2UZG A;  4A9J A;  3L11 A;  4V3L C;  4CUR A;  4A4C A;  3DWY A;  4PCI A;  5L98 A;  4C9Z A;  5CUE A;  5FE8 A; 
#chains in the Genus database with same CATH topology
 3N9O A;  5CFW A;  2Y1M A;  2VP7 A;  5I3L A;  4OUF A;  5KTW A;  2YQD A;  4QB3 A;  5KTU A;  2KGI A;  3L1X A;  2MD8 C;  5H1U A;  4XY8 A;  3JVK A;  4AKN A;  5FFY A;  5JI8 A;  2KU3 A;  4CCG X;  4LZS A;  5FE3 A;  4S3O C;  4XYA A;  2LQ6 A;  4IR6 A;  3G0J A;  5ENH A;  3IU6 A;  4HXO A;  3DDT A;  5AIU A;  5E3G A;  2QIC A;  5EI4 A;  3ZYU A;  5DYU A;  4MVT A;  2MA5 A;  2FSA A;  4GPJ A;  4NUC A;  1WEE A;  3P1F A;  2KTB B;  2YRE A;  4AYC A;  5LVQ A;  2E7N A;  4N4H A;  3LJW A;  3MHS A;  2EGM A;  5ENC A;  2MNY A;  5LVR A;  4WIV A;  1DVP A;  3KV5 A;  5AMF A;  4J0R A;  2AN6 A;  1K2F A;  5B8D A;  5F62 A;  5I89 A;  4CUS A;  4O64 A;  3MHH A;  5HQ5 A;  2EA6 A;  4YAX A;  2WP2 A;  1LDJ B;  2VPG A;  5KTX A;  5HLS A;  2FUI A;  5ETB A;  5IBN A;  2KYU A;  4UIY A;  3ZPV 1;  5CQ5 A;  4TKP B;  2RFJ A;  3UVW A;  4MR3 A;  2KKX A;  1WIM A;  5F2P A;  2RNX A;  5DKA A;  5EU1 A;  3H7H A;  4WZ2 A;  4A9N A;  4YK0 A;  1FBV A;  4WZ3 B;  1VD4 A;  4PS5 A;  2CRR A;  4MEP A;  4A9K A;  5C4Q A;  1T1H A;  3FJU B;  3SOU A;  5DLZ A;  2RI7 A;  4IR3 A;  4QSP A;  2DAT A;  4AUQ B;  4X2I A;  4HXK A;  5EIC A;  5F5Z A;  3SVH A;  5CTL A;  5EM3 A;  4A9I A;  2H0D A;  3MXF A;  2F6N A;  1WEM A;  4L7X A;  4LR6 A;  4GNE A;  2QIZ A;  5DYX A;  2DVR A;  5FG6 A;  3PLW A;  5KU3 A;  2XOZ A;  5ENI A;  2L80 A;  2ECJ A;  4LZR A;  4UIU A;  4FK5 A;  3ZNI A;  1Z2Q A;  3FEH A;  2YUR A;  3DWD A;  5I29 A;  3N9L A;  3N9M A;  3MB3 A;  4MR4 A;  1IYM A;  4PTB A;  4YYN A;  3PUR A;  1JOC A;  5FEY A;  4LYW A;  5B77 A;  5HRX A;  4TU6 A;  4NYX A;  5L8T A;  2MD7 B;  2YQM A;  3AAD A;  4MR5 A;  5DFD A;  4FLP A;  5CUC A;  3MUL A;  5D3S A;  3Q2E A;  3JVJ A;  2LXP C;  3U5O A;  4FJC A;  3O37 A;  4LKA A;  5F60 A;  4CL9 A;  3NG2 A;  3LXJ A;  4UIZ A;  3VKH A;  1E6I A;  3QZT A;  3C6W A;  4O7A A;  2DVQ A;  3IHP A;  5A83 A;  5FE5 A;  4FIP A;  5I83 A;  4CUU A;  2LAU A;  5C89 A;  2D9E A;  4RVR A;  5CQ3 A;  2Y43 A;  5I86 A;  1JM7 B;  5I40 A;  5F63 A;  4ALG A;  4NUE A;  5FB1 A;  3M7K A;  4O7E A;  4IC3 A;  2CT2 A;  5G04 B;  5CQ8 A;  4UIV A;  4UIT A;  5EPR A;  2IDA A;  4UYF A;  3NXB A;  5EP7 A;  4A9F A;  3UVX A;  5HRW A;  3MB4 A;  2DX8 A;  5KH9 A;  4YYI A;  2RNY A;  5CUB A;  5A85 A;  4IR5 A;  3U5J A;  3ZYQ A;  5D3P A;  5A5O A;  2ECT A;  5E3D A;  2KRE A;  5COI A;  4GND A;  3I3J A;  5DYA A;  4ZDT A;  3K2J A;  5TCM A;  5A5Q A;  5D25 A;  1JSP B;  4BW4 A;  4E96 A;  2OWA A;  5FE6 A;  2YU4 A;  2L5E A;  4QC3 A;  4NYV A;  4TT6 A;  4YY4 A;  5D1L B;  5C8G A;  4L58 A;  4HBY A;  5I1Q A;  4FO9 A;  2G6Q A;  4A9M A;  1RMD A;  2RO1 A;  2VJF B;  4J1P A;  3KQI A;  4NRA A;  3UVD A;  5I88 A;  3FL2 A;  5H9M A;  3HMF A;  4TQN A;  4KV1 A;  4AKI A;  4N4I A;  2L5U A;  2K4D A;  2M1R A;  2MKE A;  5EGU A;  5LKT A;  3GG3 A;  4YYK A;  4O62 A;  5H85 A;  2VJE B;  3IU5 A;  4QSR A;  3ASL A;  5EPB A;  5EWW A;  2DJA A;  2KWO A;  2JMD A;  4QR3 A;  4TT4 A;  4Z1Q A;  4TU4 A;  2JRJ A;  2CSZ A;  3LQI A;  4HXR A;  4V3K C;  2XOY A;  1WES A;  4W4U A;  5FG4 A;  4BW2 A;  5KH3 A;  5B78 A;  5DKC A;  5A5N A;  4X3G A;  4PPE A;  4QSU A;  4HBX A;  5ENJ A;  1X4I A;  4OGC A;  2L84 A;  4LDF A;  4XY9 A;  4ZW1 A;  4YYD A;  5A5S A;  5ACY A;  1ZKR A;  1F68 A;  1X4U A;  2BAY A;  2LDR A;  3QZS A;  4O74 A;  2RR4 A;  5CUG A;  4AKH A;  2R0S A;  2OUO A;  4UIX A;  4QNS A;  5CRM A;  5AD2 A;  2M13 A;  5ENB A;  5C85 A;  2PNX A;  2L85 A;  2EJN A;  4NXJ A;  3VKG A;  4HXM A;  2G45 A;  4B86 C;  5KH7 A;  5BT4 A;  2QJ0 A;  2ECV A;  5F3A A;  2YDW A;  2YVR A;  5DLX A;  2NXB A;  4UP5 A;  5D3L A;  3O33 A;  4O75 A;  3MQM A;  5JWM A;  4GB0 A;  2OO1 A;  3QZV A;  3Q2F A;  4MEO A;  3FAO A;  5TDR A;  1WE9 A;  2CKL A;  5CGP A;  3O47 A;  2RNW A;  3D7C A;  5LKZ A;  5C11 A;  3M62 A;  5HQ7 A;  5IG6 A;  2D8U A;  2WP1 A;  1WIL A;  4QSW A;  5FE9 A;  1ZBD B;  5K3Q A;  4IOO A;  2FD4 A;  2KFT A;  5FE0 A;  4F1P A;  3T7L A;  2M3H A;  2XP0 A;  1JM4 B;  5EQ1 A;  2CRW A;  5DY7 A;  4ZC9 A;  5LCW B;  2R0V A;  4QBM A;  4AKG A;  4QY4 A;  4LC2 A;  5DKD A;  1N87 A;  2LXH C;  1FP0 A;  3EB6 A;  3HCU A;  2K17 A;  5DIN A;  3U5P A;  5HFQ A;  4OGI A;  2LRI C;  5KO4 A;  5EWD A;  4TYL A;  4UYF B;  4XI1 A;  3DPL R;  4IC2 A;  3RPG B;  3GV4 A;  1Z6U A;  4QR5 A;  5K29 A;  2E7O A;  2JUN A;  4UYE A;  4QUU A;  4Y03 A;  2I8N A;  5DW2 A;  4CUQ A;  1WEW A;  3HCS A;  4HXN A;  4XUA A;  2F6J A;  2YYN A;  5DFB A;  4Q6F A;  2KR4 A;  2LGG A;  2P57 A;  3MDB C;  5D3T A;  5TRB A;  3T9K A;  2YHN A;  3D1B A;  5FFW A;  3DQV R;  3DAI A;  5CPE A;  4R8P K;  5TB6 A;  3O36 A;  2E61 A;  2DVS A;  3VK6 A;  4A4B A;  3L1Z B;  2JM3 A;  2YUC A;  5B79 A;  2DKW A;  5ENG A;  3JVL A;  5L8U A;  1LDK C;  4R2Y A;  5HFR A;  3RPG C;  5D3N A;  4A9H A;  5E9V A;  4WZ0 A;  4NR7 A;  3LDY A;  5FBX A;  2EGP A;  5I7X A;  5TAB A;  4QUT A;  4BW1 A;  3U5M A;  4C67 A;  3ONI A;  4MEN A;  1X4J A;  4A49 A;  4UYD A;  4YY6 A;  4BBQ A;  4YYJ A;  3ERR A;  4NR9 A;  5HEM A;  5B76 A;  4AI6 A;  2YW8 A;  2RS9 B;  4LLB A;  2RSD A;  2NAA A;  3KNV A;  2ECI A;  5C13 A;  1WEO A;  2E6R A;  3P5O A;  4PCE A;  2KKY A;  4PY6 A;  5E7D A;  4A9E A;  4QYL A;  4QR4 A;  1BOR A;  1PUO A;  3UW9 A;  4O78 A;  2YYR A;  3U5K A;  2VNF A;  4KCX A;  4AVX A;  1DCQ A;  2L43 A;  3SVG A;  5CUA A;  2XB1 A;  4AYC B;  3S91 A;  4A0C D;  5ENF A;  4CUT A;  3KV6 A;  3O7A A;  3ZPV E;  5E0R A;  3V43 A;  4CFL A;  4QEU A;  5AME A;  4XUB A;  2MNZ A;  4J3I A;  5H1V A;  5C87 A;  5B75 A;  2YSM A;  4NR8 A;  1WEN A;  4UYG A;  2XOC A;  4R7E A;  5CP5 A;  2DWW A;  5D7X A;  4F3I A;  5AD3 A;  5SVI A;  1ZS5 A;  3RCW A;  3PHD A;  4YAB A;  3UV5 A;  3N9N A;  5AIT A;  5D3H A;  5HEL A;  3EB5 A;  3PUQ A;  3LVQ E;  3G0L A;  3HME A;  4DON A;  1WUM A;  1WGM A;  2R0Y A;  2D8S A;  5EA1 A;  1HYJ A;  3JVM A;  5FDZ A;  2LV9 A;  3D1D A;  3M63 A;  2OXQ C;  4WA6 A;  4NUD A;  4UP0 A;  4LZ2 A;  5BT3 A;  3LQJ A;  4QSX A;  4HXS A;  5EVA A;  3SOX A;  2E3K A;  5G4R A;  5A81 A;  2KWN A;  5CQT A;  1WEU A;  2H0D B;  4O7C A;  3N9Q A;  4YBM A;  4GNF A;  5E9M A;  5CU8 A;  5C7N A;  4O70 A;  3HCT A;  4QC1 A;  5A7C A;  4QST A;  4QSQ A;  1VFY A;  5E9K A;  2C2L A;  5A5R A;  4O72 A;  4QSV A;  4Z93 A;  4P5O B;  2LGV A;  1JM7 A;  5EWH A;  5LUU A;  4YAT A;  5EWV A;  4NYW A;  1MM2 A;  2MT5 A;  2MUM A;  3FAN A;  3ZVY A;  3Q1D A;  5F25 A;  4NQN A;  5L96 A;  2CON A;  5CS8 A;  5E73 A;  4ZUX U;  5E9L A;  5D3J A;  2KGG A;  1MM3 A;  4LYS A;  4BHW A;  3M99 A;  5G4S A;  4Z6I A;  5LKU A;  5TBN A;  2LSP B;  3O35 A;  4BJX A;  5IGL A;  2VPE A;  5IGK A;  4YH3 A;  4N4G A;  4MSX A;  5TDW A;  4N3W A;  5HQ6 A;  2KE1 A;  3KDE C;  2M6M A;  5IID A;  1WFK A;  4YYM A;  1WEQ A;  2CSY A;  5FFV A;  5LJ2 A;  4LRG A;  4WHW A;  3RTR B;  5D0C A;  5A5P A;  1X0J A;  4H9D A;  4YYG A;  2EOD A;  1WEP A;  4QZS A;  2XEU A;  2D82 A;  4OGJ A;  4YBT A;  2VPD A;  2R10 A;  5DKH A;  4ALH A;  2GRC A;  2H60 A;  5DBM A;  2VJF A;  1E4U A;  4YC9 A;  5A82 A;  5EWC A;  4HXL A;  4BW3 A;  2PUY A;  4HXP A;  2I50 A;  3SHB A;  1U6G B;  5FER A;  5EIS A;  4QYD A;  4HBV A;  2VJE A;  2YEL A;  5I80 A;  5F1H A;  3SVF A;  3AQA A;  4NRB A;  1CHC A;  4Q0N A;  3P1D A;  3UVY A;  2FUU A;  2N9G A;  2L75 A;  5D1K B;  1VYX A;  4O77 A;  4QSS A;  5HRV A;  2DSM A;  5F1L A;  4NR6 A;  5DYC A;  2ECW A;  4I7B A;  1N72 A;  5HM0 A;  2YT5 A;  4O7B A;  3MUK A;  4CLB A;  4C66 A;  5J0D A;  5EPS A;  5JG6 A;  5E9Y A;  2KWJ A;  5CZG A;  5CQA A;  5EK9 A;  4LJN A;  2ECN A;  5FH8 A;  4I7C A;  4I7D A;  2DVV A;  2CSV A;  3SOW A;  2YHO A;  3E2D A;  5SVI B;  5LJ0 A;  5J3X A;  3O70 A;  4QF3 A;  3O34 A;  5FH7 A;  5IGN A;  3U5L A;  2F42 A;  5FH6 A;  3N9P A;  4F52 B;  2HDP A;  2L7P A;  1Z60 A;  4IOR A;  4UIW A;  2MIQ A;  4QEW A;  2LN0 A;  4NR5 A;  5E74 A;  4YBS A;  3ZTG A;  5D24 A;  3S92 A;  4LK9 A;  4NN2 A;  3TLP A;  1F62 A;  1EQF A;  4TS8 A;  3U5N A;  4Z0O A;  4A9O A;  4CA1 A;  5EV9 A;  5II2 A;  4O71 A;  2C2V S;  4QF2 A;  1G25 A;  2B0O E;  5IGM A;  5FE4 A;  5I7Y A;  5CRZ A;  2YEK A;  3C5K A;  4TT2 A;  3P1C A;  3LQH A;  4IR4 A;  5II1 A;  1HYI A;  5L97 A;  3I2D A;  4QQ4 A;  3UV2 A;  2KIZ A;  2Y1N A;  5CQ6 A;  2ZET C;  4OGE A;  2G4A A;  5LJ1 A;  3ZVZ B;  1XWH A;  4LAD B;  4TZ8 A;  2K1J A;  4O76 A;  5SVY A;  4J0S A;  4A9L A;  4NQM A;  2JMI A;  5G0F A;  5HJC A;  1V87 A;  5H1T A;  5FG5 A;  2YEM A;  5FB0 A;  3HTK C;  4N4F A;  2YQL A;  1WUG A;  5D1M B;  4UYH A;  4CUP A;  2CKL B;  2K16 A;  2HYE D;  2YW5 A;  3SUB A;  5HEN A;  4TZ2 A;  4TTE A;  4Z0R A;  4WHU A;  3UV4 A;  5DW1 A;  3FM8 C;  5CQ4 A;  2OSS A;  5CQ7 A;  5BT5 A;  4GNG A;  5KHM A;  4YH4 A;  2EXU A;  5G05 B;  3T6R A;  4AP4 A;  4UI9 B;  2I7K A;  2JMJ A;  3GL6 A;  3P1E A;  2MJV B;  5CY9 A;  1WEV A;  2MA6 A;  2LGK A;  5SVX A;  4LYI A;  5FE1 A;  5CUD A;  4PKL A;  5FE7 A;  4NR4 A;  4Z1S A;  5FE2 A;  2VPB A;  4Q0O A;  5ETD A;  4QEV A;  5DX4 A;  5DFC A;  5EYA F;  5F36 A;  3HMH A;  4B7Y C;  5HCL A;  2ECG A;  4S3O B;  3LVR E;  4ZQL A;  4HBW A;  4YAD A;  2KWK A;  4MEQ A;  2L0B A;  5F61 A;  2YSJ A;  2M85 A;  2LGL A;  3FKM X;  4IOQ A;  4O7F A;  5D3R A;  2E6S A;  4NS5 A;  2FFW A;  5ENE A;  1MBM A;  4MR6 A;  5D26 A;  2G43 A;  4NRC A;  4YYH A;  5L99 A;  5LKX A;  4Z6H A;  4KV4 A;  3JUE A;  5E9I A;  4CFK A;  2IQJ A;  4A9J A;  2UZG A;  3L11 A;  3LJU X;  4V3L C;  4CUR A;  4A4C A;  3DWY A;  4PCI A;  5L98 A;  4C9Z A;  5CUE A;  3LRQ A;  5FE8 A; 
#chains in the Genus database with same CATH homology
 3N9O A;  5CFW A;  2Y1M A;  2VP7 A;  5I3L A;  4OUF A;  5KTW A;  2YQD A;  4QB3 A;  5KTU A;  2KGI A;  3L1X A;  2MD8 C;  5H1U A;  4XY8 A;  3JVK A;  4AKN A;  5FFY A;  5JI8 A;  2KU3 A;  4CCG X;  4LZS A;  5FE3 A;  4S3O C;  4XYA A;  2LQ6 A;  4IR6 A;  3G0J A;  5ENH A;  3IU6 A;  4HXO A;  5AIU A;  5E3G A;  2QIC A;  5EI4 A;  3ZYU A;  5DYU A;  4MVT A;  2MA5 A;  2FSA A;  4GPJ A;  4NUC A;  1WEE A;  3P1F A;  2KTB B;  2YRE A;  4AYC A;  5LVQ A;  2E7N A;  4N4H A;  3LJW A;  3MHS A;  5ENC A;  2MNY A;  5LVR A;  4WIV A;  1DVP A;  3KV5 A;  5AMF A;  4J0R A;  2AN6 A;  1K2F A;  5B8D A;  5F62 A;  5I89 A;  4CUS A;  4O64 A;  3MHH A;  5HQ5 A;  2EA6 A;  4YAX A;  2WP2 A;  1LDJ B;  2VPG A;  5KTX A;  5HLS A;  2FUI A;  5ETB A;  5IBN A;  2KYU A;  4UIY A;  3ZPV 1;  5CQ5 A;  4TKP B;  2RFJ A;  3UVW A;  4MR3 A;  1WIM A;  5F2P A;  2RNX A;  5DKA A;  5EU1 A;  4WZ2 A;  4A9N A;  4YK0 A;  1FBV A;  4WZ3 B;  1VD4 A;  4PS5 A;  4MEP A;  4A9K A;  5C4Q A;  1T1H A;  3SOU A;  4AUQ B;  5DLZ A;  2RI7 A;  4IR3 A;  4QSP A;  2DAT A;  4X2I A;  4HXK A;  5EIC A;  5F5Z A;  3SVH A;  5CTL A;  5EM3 A;  4A9I A;  2H0D A;  3MXF A;  2F6N A;  1WEM A;  4L7X A;  4LR6 A;  4GNE A;  2QIZ A;  5DYX A;  2DVR A;  5FG6 A;  5KU3 A;  5ENI A;  2L80 A;  2ECJ A;  4LZR A;  4UIU A;  4FK5 A;  3ZNI A;  1Z2Q A;  2YUR A;  3N9L A;  5I29 A;  3N9M A;  3MB3 A;  4MR4 A;  1IYM A;  4PTB A;  4YYN A;  3PUR A;  1JOC A;  5FEY A;  4LYW A;  5B77 A;  5HRX A;  4TU6 A;  4NYX A;  5L8T A;  2MD7 B;  2YQM A;  3AAD A;  4MR5 A;  5DFD A;  4FLP A;  5CUC A;  3MUL A;  5D3S A;  3Q2E A;  3JVJ A;  2LXP C;  3U5O A;  4FJC A;  3O37 A;  4LKA A;  5F60 A;  4CL9 A;  3NG2 A;  3LXJ A;  4UIZ A;  3C6W A;  1E6I A;  3QZT A;  4O7A A;  2DVQ A;  3IHP A;  5A83 A;  5FE5 A;  4FIP A;  5I83 A;  4CUU A;  5C89 A;  2D9E A;  4RVR A;  5CQ3 A;  2Y43 A;  5I86 A;  1JM7 B;  5I40 A;  5F63 A;  4ALG A;  4NUE A;  5FB1 A;  4O7E A;  4IC3 A;  2CT2 A;  5G04 B;  5CQ8 A;  4UIV A;  4UIT A;  5EPR A;  2IDA A;  4UYF A;  3NXB A;  5EP7 A;  4A9F A;  3UVX A;  5HRW A;  3MB4 A;  2DX8 A;  5KH9 A;  4YYI A;  2RNY A;  5CUB A;  5A85 A;  4IR5 A;  3U5J A;  3ZYQ A;  5D3P A;  5A5O A;  2ECT A;  5E3D A;  2KRE A;  5COI A;  4GND A;  3I3J A;  5DYA A;  4ZDT A;  3K2J A;  5TCM A;  5A5Q A;  5D25 A;  1JSP B;  4BW4 A;  4E96 A;  5FE6 A;  2YU4 A;  2L5E A;  4QC3 A;  4NYV A;  4TT6 A;  4YY4 A;  5D1L B;  5C8G A;  4L58 A;  4HBY A;  5I1Q A;  4FO9 A;  2G6Q A;  4A9M A;  1RMD A;  2RO1 A;  2VJF B;  4J1P A;  3KQI A;  4NRA A;  3UVD A;  5I88 A;  3FL2 A;  5H9M A;  3HMF A;  4TQN A;  4KV1 A;  4N4I A;  2L5U A;  2K4D A;  2M1R A;  5EGU A;  5LKT A;  3GG3 A;  4YYK A;  5H85 A;  2VJE B;  3IU5 A;  4QSR A;  3ASL A;  5EPB A;  5EWW A;  2KWO A;  2JMD A;  4QR3 A;  4TT4 A;  4Z1Q A;  4TU4 A;  2JRJ A;  2CSZ A;  3LQI A;  4HXR A;  1WES A;  4W4U A;  5FG4 A;  4BW2 A;  5KH3 A;  5B78 A;  5DKC A;  5A5N A;  4X3G A;  4PPE A;  4QSU A;  4HBX A;  5ENJ A;  1X4I A;  2L84 A;  4LDF A;  4XY9 A;  4ZW1 A;  4YYD A;  5A5S A;  5ACY A;  1F68 A;  1X4U A;  2BAY A;  2LDR A;  3QZS A;  4O74 A;  5CUG A;  3EB6 A;  2R0S A;  2OUO A;  4UIX A;  4QNS A;  5CRM A;  5AD2 A;  3LRQ A;  5ENB A;  5C85 A;  2PNX A;  2L85 A;  4NXJ A;  2G45 A;  4B86 C;  4HXM A;  5KH7 A;  5BT4 A;  2QJ0 A;  2ECV A;  5F3A A;  2YDW A;  5DLX A;  2NXB A;  4UP5 A;  5D3L A;  3O33 A;  4O75 A;  3MQM A;  5JWM A;  4GB0 A;  2OO1 A;  3QZV A;  3Q2F A;  4MEO A;  5TDR A;  1WE9 A;  2CKL A;  5CGP A;  2RNW A;  3D7C A;  5LKZ A;  5C11 A;  3M62 A;  5HQ7 A;  5IG6 A;  2WP1 A;  1WIL A;  4QSW A;  5FE9 A;  1ZBD B;  4IOO A;  2KFT A;  5FE0 A;  3T7L A;  2M3H A;  1JM4 B;  5EQ1 A;  5DY7 A;  4ZC9 A;  5LCW B;  2R0V A;  4QBM A;  4QY4 A;  4LC2 A;  5DKD A;  1N87 A;  2LXH C;  1FP0 A;  3HCU A;  2K17 A;  5DIN A;  3U5P A;  5HFQ A;  4OGI A;  2LRI C;  5KO4 A;  5EWD A;  4TYL A;  4UYF B;  4XI1 A;  3DPL R;  4IC2 A;  3RPG B;  3GV4 A;  1Z6U A;  4QR5 A;  5K29 A;  2E7O A;  4UYE A;  4QUU A;  4Y03 A;  2I8N A;  5DW2 A;  4CUQ A;  1WEW A;  3HCS A;  4HXN A;  4XUA A;  2F6J A;  2YYN A;  5DFB A;  4Q6F A;  2KR4 A;  2LGG A;  5D3T A;  5TRB A;  2YHN A;  5FFW A;  3DQV R;  3DAI A;  5CPE A;  4R8P K;  5TB6 A;  3O36 A;  2DVS A;  3VK6 A;  4A4B A;  3L1Z B;  2YUC A;  5B79 A;  2DKW A;  5ENG A;  3JVL A;  5L8U A;  1LDK C;  4R2Y A;  5HFR A;  3RPG C;  5D3N A;  4A9H A;  5E9V A;  4WZ0 A;  4NR7 A;  5FBX A;  2EGP A;  5I7X A;  5TAB A;  4QUT A;  4BW1 A;  3U5M A;  4C67 A;  3ONI A;  4MEN A;  1X4J A;  4A49 A;  4UYD A;  4YY6 A;  4BBQ A;  4YYJ A;  4NR9 A;  5HEM A;  5B76 A;  2YW8 A;  2RS9 B;  4LLB A;  2RSD A;  2NAA A;  3KNV A;  2ECI A;  5C13 A;  1WEO A;  2E6R A;  3P5O A;  4PCE A;  4PY6 A;  5E7D A;  4A9E A;  4QYL A;  4QR4 A;  1BOR A;  3UW9 A;  4O78 A;  2YYR A;  3U5K A;  2VNF A;  4KCX A;  4AVX A;  2L43 A;  3SVG A;  5CUA A;  2XB1 A;  4AYC B;  3S91 A;  4A0C D;  5ENF A;  4CUT A;  3KV6 A;  3O7A A;  3ZPV E;  5E0R A;  3V43 A;  4CFL A;  4QEU A;  5AME A;  4XUB A;  2MNZ A;  4J3I A;  5H1V A;  5C87 A;  5B75 A;  2YSM A;  4NR8 A;  1WEN A;  4UYG A;  4R7E A;  5CP5 A;  2DWW A;  5D7X A;  4F3I A;  5AD3 A;  1ZS5 A;  3RCW A;  3PHD A;  4YAB A;  3UV5 A;  3N9N A;  5AIT A;  5D3H A;  5HEL A;  3EB5 A;  3PUQ A;  3G0L A;  3HME A;  4DON A;  1WUM A;  1WGM A;  2R0Y A;  2D8S A;  5EA1 A;  1HYJ A;  3JVM A;  5FDZ A;  2LV9 A;  3M63 A;  2OXQ C;  4WA6 A;  4NUD A;  4UP0 A;  4LZ2 A;  5BT3 A;  3LQJ A;  4QSX A;  4HXS A;  5EVA A;  3SOX A;  2E3K A;  5G4R A;  5A81 A;  2KWN A;  5CQT A;  1WEU A;  2H0D B;  4O7C A;  3N9Q A;  4YBM A;  4GNF A;  5E9M A;  5CU8 A;  5C7N A;  4O70 A;  3HCT A;  4QC1 A;  5A7C A;  4QST A;  4QSQ A;  1VFY A;  5E9K A;  2C2L A;  5A5R A;  4O72 A;  4QSV A;  4Z93 A;  4P5O B;  2LGV A;  1JM7 A;  5EWH A;  5LUU A;  4YAT A;  5EWV A;  4NYW A;  1MM2 A;  2MT5 A;  2MUM A;  3ZVY A;  5F25 A;  4NQN A;  5L96 A;  4ZUX U;  5CS8 A;  5E73 A;  5E9L A;  5D3J A;  2KGG A;  1MM3 A;  4LYS A;  4BHW A;  3M99 A;  5G4S A;  4Z6I A;  5LKU A;  5TBN A;  2LSP B;  3O35 A;  4BJX A;  5IGL A;  2VPE A;  5IGK A;  4YH3 A;  4N4G A;  4MSX A;  5TDW A;  4N3W A;  5HQ6 A;  2KE1 A;  2M6M A;  5IID A;  1WFK A;  4YYM A;  1WEQ A;  2CSY A;  5FFV A;  5LJ2 A;  4LRG A;  4WHW A;  3RTR B;  5D0C A;  5A5P A;  1X0J A;  4YYG A;  2EOD A;  1WEP A;  4QZS A;  2XEU A;  2D82 A;  4OGJ A;  4YBT A;  2VPD A;  2R10 A;  5DKH A;  4ALH A;  2GRC A;  2H60 A;  5DBM A;  2VJF A;  1E4U A;  4YC9 A;  5A82 A;  5EWC A;  4HXL A;  4BW3 A;  2PUY A;  4HXP A;  2I50 A;  3SHB A;  1U6G B;  5FER A;  5EIS A;  4QYD A;  4HBV A;  2VJE A;  2YEL A;  5I80 A;  5F1H A;  3SVF A;  3AQA A;  4NRB A;  1CHC A;  4Q0N A;  3P1D A;  3UVY A;  2FUU A;  2N9G A;  2L75 A;  5D1K B;  1VYX A;  4O77 A;  4QSS A;  5HRV A;  5F1L A;  4NR6 A;  5DYC A;  2ECW A;  4I7B A;  1N72 A;  5HM0 A;  2YT5 A;  4O7B A;  3MUK A;  4CLB A;  4C66 A;  5J0D A;  5EPS A;  5JG6 A;  5E9Y A;  2KWJ A;  5CZG A;  5CQA A;  5EK9 A;  4LJN A;  2ECN A;  5FH8 A;  4I7C A;  4I7D A;  2DVV A;  3SOW A;  2YHO A;  5LJ0 A;  5J3X A;  3O70 A;  4QF3 A;  3O34 A;  5FH7 A;  5IGN A;  3U5L A;  2F42 A;  5FH6 A;  3N9P A;  4F52 B;  2HDP A;  1Z60 A;  4IOR A;  4UIW A;  2MIQ A;  4QEW A;  2LN0 A;  4NR5 A;  5E74 A;  4YBS A;  3ZTG A;  5D24 A;  3S92 A;  4LK9 A;  4NN2 A;  3TLP A;  1F62 A;  1EQF A;  4TS8 A;  3U5N A;  4A9O A;  4CA1 A;  5EV9 A;  5II2 A;  4O71 A;  2C2V S;  4QF2 A;  1G25 A;  5IGM A;  5FE4 A;  5I7Y A;  5CRZ A;  2YEK A;  3C5K A;  4TT2 A;  3P1C A;  3LQH A;  4IR4 A;  5II1 A;  1HYI A;  5L97 A;  3I2D A;  3UV2 A;  2KIZ A;  2Y1N A;  5CQ6 A;  2ZET C;  2G4A A;  5LJ1 A;  3ZVZ B;  1XWH A;  4LAD B;  4TZ8 A;  2K1J A;  4O76 A;  4J0S A;  4A9L A;  4NQM A;  2JMI A;  5G0F A;  5HJC A;  1V87 A;  5H1T A;  5FG5 A;  2YEM A;  5FB0 A;  3HTK C;  4N4F A;  2YQL A;  1WUG A;  5D1M B;  4UYH A;  4CUP A;  2CKL B;  2K16 A;  2HYE D;  2YW5 A;  5HEN A;  4TZ2 A;  4TTE A;  4WHU A;  3UV4 A;  5DW1 A;  5CQ4 A;  2OSS A;  5CQ7 A;  5BT5 A;  4GNG A;  5KHM A;  4YH4 A;  5G05 B;  3T6R A;  4AP4 A;  4UI9 B;  2I7K A;  2JMJ A;  3GL6 A;  3P1E A;  2MJV B;  5CY9 A;  1WEV A;  2MA6 A;  2LGK A;  4LYI A;  5FE1 A;  5CUD A;  4PKL A;  5FE7 A;  4NR4 A;  4Z1S A;  5FE2 A;  2VPB A;  4Q0O A;  5ETD A;  4QEV A;  5DX4 A;  5DFC A;  5EYA F;  5F36 A;  3HMH A;  4B7Y C;  5HCL A;  2ECG A;  4S3O B;  4ZQL A;  4HBW A;  4YAD A;  2KWK A;  4MEQ A;  2L0B A;  5F61 A;  2YSJ A;  2M85 A;  2LGL A;  3FKM X;  4IOQ A;  4O7F A;  5D3R A;  2E6S A;  4NS5 A;  5ENE A;  2G43 A;  4MR6 A;  5D26 A;  4V3K C;  4NRC A;  4YYH A;  5L99 A;  5LKX A;  4Z6H A;  4KV4 A;  5E9I A;  4CFK A;  2UZG A;  4A9J A;  3L11 A;  4V3L C;  4CUR A;  4A4C A;  3DWY A;  4PCI A;  5L98 A;  4C9Z A;  5CUE A;  5FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...