3U5OA

Crystal structure of the complex of trim33 phd-bromo and h3(1-22)k9me3k14ack18ac histone peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
189
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 54
structure length 189
sequence length 205
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5oA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5oA01
4A9FA 3GV4A 4FK5A 3C6WA 3N9LA 5D3JA 4ZDTA 5DBMA 4QYLA 4OGJA 4QB3A 2NXBA 4WHUA 2UZGA 4QF2A 4C67A 5EICA 5EWCA 4WZ2A 2D82A 4NYXA 5TB6A 4MR4A 5C13A 5D3HA 2YW8A 1X4IA 5H9MA 5ETBA 4LK9A 2FSAA 4BJXA 3UVYA 3EB5A 4A49A 3T6RA 4NN2A 5CY9A 4O70A 4QSPA 2KGIA 2LGLA 4IORA 5F60A 5II2A 3U5MA 1JM4B 5JI8A 2FUIA 2RS9B 4ALGA 4PY6A 4YADA 5IIDA 1N87A 3P1EA 2CSZA 2VPEA 1WUMA 5CQ8A 5C89A 3U5PA 4TQNA 3O70A 2EA6A 3SVHA 5DKCA 2CT2A 5A5PA 5L97A 3MB3A 4O7EA 3P1FA 4N4FA 4QSXA 5J3XA 5I86A 5B75A 3U5JA 4WA6A 1WIMA 4V3KC 4YBMA 2E7NA 5KU3A 1WEPA 2LXPC 3AQAA 4FJCA 4LYSA 5FE5A 4HBVA 5TCMA 2CSYA 3HTKC 4L58A 4N4HA 5FE6A 2MD7B 5D0CA 5HELA 2YYRA 5E3GA 5D1MB 5CUEA 2G4AA 2YEKA 4Y03A 2H0DA 5KH9A 5FDZA 4TZ2A 3SVGA 4IOOA 5CUAA 2QICA 5CUDA 3Q2EA 5K29A 4AKNA 2G6QA 5FG4A 3O34A 5H1TA 2ECVA 5AD3A 2RSDA 2KFTA 5E9LA 5A7CA 2DATA 4LDFA 4I7CA 4ZUXU 5B76A 2EODA 5C87A 2N9GA 4XUBA 3HMHA 4YYHA 2MJVB 4NUEA 4YYMA 2LDRA 4XI1A 4CUTA 4LZSA 4BW3A 5DYUA 1BORA 4UIXA 5HJCA 4UIUA 4QSUA 2ECJA 4NXJA 2VJEB 3NG2A 4IC2A 2KR4A 1VD4A 4TU4A 5D25A 5FH6A 1WEVA 4A9NA 2C2LA 2OO1A 2EGPA 4YABA 4Q6FA 4UP0A 5EWVA 5HFQA 4UIYA 4Q0NA 2Y43A 5LUUA 2YQLA 4O72A 1F68A 4F3IA 4AP4A 5KO4A 5KTXA 5EK9A 5DINA 4TT2A 5DKHA 4QSSA 3KQIA 4N4IA 3GG3A 3LQIA 3I3JA 4MEPA 4YYJA 4MEQA 5FFYA 5FERA 4HBWA 4NQMA 4PKLA 4UITA 3DAIA 2E6RA 2M85A 3D7CA 3O37A 5HEMA 5FH7A 3MHSA 1X4JA 1Z60A 4FO9A 4UYEA 2VPGA 4UYFB 4N3WA 5EWDA 5FG5A 5D3RA 4QC3A 4B7YC 1EQFA 1F62A 4TTEA 3LXJA 4TZ8A 3LQHA 5EWWA 3UW9A 2OXQC 2KE1A 2LXHC 3I2DA 4NQNA 5D7XA 5LVQA 2L0BA 5LKTA 5DKAA 4LADB 4UYGA 4J0RA 5HCLA 4O7CA 4HXSA 4UI9B 5HQ7A 4NS5A 2WP2A 1X4UA 4HBYA 4LJNA 5FE2A 4NRCA 5I7XA 4J0SA 2PNXA 4E96A 4LKAA 4R7EA 4YYKA 5KH3A 5FB1A 2CKLA 1WILA 4YK0A 5C11A 4NR4A 3KV6A 1WESA 2E6SA 4NRBA 4UP5A 4YY4A 3MQMA 5CQAA 5G0FA 2KYUA 4NUDA 4IR4A 5CUGA 2FUUA 4NRAA 3RCWA 5C85A 2DKWA 5JG6A 3SVFA 4HXNA 2H0DB 2VJEA 2JMIA 3JVLA 3P1CA 2DVQA 5DYCA 3UV4A 3FL2A 5L8UA 5DY7A 3QZVA 3QZTA 5IG6A 3JVMA 5E3DA 5F25A 2DX8A 2F6JA 5HQ6A 2M3HA 4BHWA 3RTRB 4AUQB 5ENHA 4IC3A 4F52B 1LDKC 3ZYQA 2OSSA 4LLBA 2KWKA 5HRVA 5CQ5A 5D3NA 2VJFA 5EA1A 5F61A 4A9MA 4GB0A 1FBVA 4L7XA 2DVSA 4A4BA 5DKDA 4YYNA 3AADA 2DVVA 5H1VA 5CFWA 5C8GA 2G43A 2JMJA 5KHMA 4GNFA 4MENA 4QSRA 4O7BA 1HYJA 4O77A 5CP5A 3L1XA 5CQTA 5FFVA 2M6MA 2VPBA 1WEEA 4WZ0A 5FE0A 5CQ7A 2L5UA 5L98A 4QSVA 4UIVA 5A5QA 5IGNA 4S3OC 2K4DA 2F42A 3DWYA 5CPEA 4O75A 4A9HA 5FE3A 4I7DA 4A9OA 4QR5A 2KWOA 5EVAA 2LQ6A 2MA6A 3MHHA 4QEUA 2RNWA 3Q2FA 4BBQA 5AMEA 2KWNA 4IR3A 4QY4A 2D9EA 4HXPA 2RNXA 4GPJA 4TT4A 4XUAA 2LGKA 2LGVA 4ZQLA 5D1LB 5IBNA 4NR9A 2ECWA 5H85A 4X2IA 2XEUA 5FE1A 5DW2A 5E9VA 5FE8A 4N4GA 5DLZA 4PCIA 1K2FA 1N72A 4A9EA 4OUFA 1WEOA 4WHWA 5EGUA 2DWWA 5EPRA 1U6GB 4NR8A 3JVKA 4HXLA 4HXOA 4RVRA 5JWMA 2QJ0A 2R0YA 2VPDA 2RO1A 2HYED 3M99A 5ENIA 2YW5A 1VYXA 4CCGX 4LZRA 3V43A 5IGKA 1FP0A 5TABA 4CUQA 5HRWA 2JMDA 2BAYA 3ZVZB 3MB4A 2M1RA 2MNZA 3S91A 5TDWA 5C4QA 5HRXA 5D3SA 5HENA 2L5EA 2YSJA 5A85A 4QZSA 4A9KA 4NR7A 3DQVR 3PUQA 4I7BA 5I3LA 3O33A 5G4RA 3P1DA 3KNVA 4UIZA 5KH7A 4NR6A 5ACYA 4O71A 4LZ2A 5TRBA 2CKLB 4CUUA 3ZNIA 4CA1A 3SOUA 3FKMX 4TU6A 2LSPB 4AYCB 5G05B 2RFJA 5DFBA 3UV2A 4TYLA 5D24A 4LYIA 4XYAA 1ZS5A 4BW4A 4YH4A 3ZPV1 4MR6A 2YYNA 5E73A 2R0SA 2OUOA 4DONA 2MD8C 4MSXA 2K17A 2MNYA 1V87A 4GNDA 5AITA 4LRGA 1Z2QA 4O7AA 2YQDA 5DFCA 5II1A 3M63A 1ZBDB 3ZYUA 5BT4A 4HXRA 5LVRA 2ZETC 4UYFA 5HLSA 3IU5A 2WP1A 5E9KA 1X0JA 4QUUA 5CQ3A 5F2PA 4QSWA 5L8TA 2KGGA 4MR5A 1HYIA 4A9LA 5CRZA 5A81A 5EU1A 5FBXA 3UVXA 2L84A 4QSQA 5EP7A 2KREA 5DLXA 4O7FA 5I40A 4BW1A 5LJ0A 4HXMA 4O74A 5C7NA 2MT5A 5CS8A 4WZ3B 5F5ZA 5FEYA 5E9IA 4QEVA 5E9YA 2KWJA 3U5NA 4KCXA 5I7YA 2C2VS 4J1PA 1XWHA 2QIZA 2L85A 2LRIC 2KIZA 5E7DA 5KTUA 3RPGC 5F63A 4PS5A 3LQJA 3O7AA 5FFWA 2YURA 4AVXA 5J0DA 3IU6A 1JOCA 3QZSA 4YYGA 5I83A 2I7KA 4A9IA 4QNSA 5E0RA 4PCEA 3JVJA 4UYHA 4HBXA 4QBMA 4GNGA 3G0JA 3GL6A 5A5RA 5CGPA 5F1HA 2VJFB 3U5LA 3MULA 4B86C 2RI7A 5CQ6A 3O35A 5H1UA 3N9MA 4C9ZA 5EV9A 5A82A 4Z1QA 5E9MA 4HXKA 2IDAA 4PPEA 1RMDA 5B77A 2DVRA 3T7LA 1MM3A 3N9QA 4CURA 2R0VA 4V3LC 5B78A 1WUGA 1MM2A 5F3AA 5COIA 3NXBA 1WEQA 5KTWA 5FB0A 5HM0A 3UV5A 5EPBA 5I29A 5A83A 2LV9A 2L75A 1WFKA 4X3GA 4A4CA 5DFDA 5I80A 1T1HA 1E4UA 1WEUA 5EI4A 4KV4A 4IR5A 4QUTA 5A5OA 5FE7A 5FH8A 4Z6IA 2ECNA 2YQMA 5AD2A 4PTBA 4QSTA 5CUBA 5BT5A 2L43A 2YSMA 4WIVA 4NR5A 2PUYA 2YUCA 2GRCA 5ETDA 2KTBB 5CTLA 3HCSA 5DX4A 5FE4A 4NYVA 2F6NA 2ECIA 2RNYA 4YH3A 5L96A 2G45A 2YU4A 3L11A 5B79A 2I50A 2ECGA 2MUMA 3SOXA 4YYDA 2YELA 2AN6A 4QR3A 1CHCA 5TDRA 4KV1A 4YYIA 5A5SA 2LGGA 3HCTA 5BT3A 5B8DA 2LN0A 3EB6A 4CL9A 3N9PA 4Z6HA 4Z1SA 5AMFA 3HMEA 5EWHA 3IHPA 5D3TA 2VNFA 4YBTA 5D3PA 3O36A 4CFLA 4IOQA 4YAXA 5EPSA 3S92A 1WEWA 3L1ZB 4TKPB 4O76A 2KU3A 5I89A 5G4SA 3N9NA 1VFYA 4IR6A 4A9JA 4LC2A 4ZC9A 3ZPVE 5DYAA 5EYAF 5A5NA 5L99A 2E7OA 4OGIA 3VK6A 1JM7A 5ENBA 3C5KA 4YATA 4XY9A 2YREA 4ZW1A 4YBSA 5LKXA 3MUKA 5ENJA 1G25A 3ASLA 5LJ1A 4P5OB 1Z6UA 2YDWA 5LKZA 4R8PK 5TBNA 3HMFA 4Q0OA 5G04B 3LJWA 5I1QA 4QYDA 2ECTA 3HCUA 2NAAA 3ZTGA 4QF3A 4C66A 5EM3A 5D3LA 4ALHA 5FG6A 3ZVYA 5D26A 4GNEA 5I88A 1JSPB 2K1JA 5F62A 5ENEA 4J3IA 5LCWB 5CZGA 4CFKA 3M62A 4NYWA 2D8SA 5E74A 2YEMA 5ENFA 4R2YA 3P5OA 4UIWA 4UYDA 5IGLA 4O64A 5ENGA 2JRJA 3UVDA 4NUCA 4MVTA 5DW1A 5EQ1A 2MA5A 2MIQA 4AYCA 3TLPA 3UVWA 2K16A 2XB1A 1WE9A 2I8NA 4XY8A 2E3KA 4MEOA 5HQ5A 2YHNA 4Z93A 3SOWA 4FIPA 3U5OA 2YT5A 1E6IA 5FE9A 5F36A 5IGMA 5EISA 3MXFA 4O78A 2L80A 2Y1NA 3N9OA 3KV5A 4W4UA 5D1KB 4A0CD 4CUSA 4QEWA 2R10A 4TT6A 4YC9A 3U5KA 4S3OB 5CU8A 3RPGB 4MR3A 1IYMA 3DPLR 4QR4A 5CRMA 3LRQA 4LR6A 4TS8A 3G0LA 4FLPA 5F1LA 1DVPA 4QC1A 1LDJB 2YHOA 2HDPA 5HFRA 5LKUA 5CUCA 4CLBA 5ENCA 1JM7B 4YY6A 1WGMA 3K2JA 5AIUA 5CQ4A 5LJ2A 3ONIA 1WENA 4CUPA 2VP7A 2Y1MA 1WEMA 3SHBA 3PURA 4LYWA 4BW2A 2H60A 3PHDA 5DYXA
chains in the Genus database with same CATH superfamily
4A9FA 3GV4A 4FK5A 3C6WA 3N9LA 5D3JA 3FEHA 5DBMA 4ZDTA 4QYLA 4OGJA 4QB3A 2NXBA 4WHUA 3ERRA 2UZGA 4QF2A 4C67A 4O62A 5EICA 5EWCA 4WZ2A 2D82A 4NYXA 5TB6A 4MR4A 5C13A 5D3HA 2YW8A 1X4IA 5H9MA 5ETBA 4LK9A 2FSAA 4BJXA 3UVYA 3EB5A 4A49A 3T6RA 4NN2A 5CY9A 4O70A 4QSPA 2KGIA 2LGLA 4IORA 5F60A 5II2A 3U5MA 1JM4B 5JI8A 2FUIA 2RS9B 4ALGA 4PY6A 4YADA 5IIDA 1N87A 3P1EA 2CSZA 2VPEA 1WUMA 5CQ8A 5C89A 3U5PA 2EXUA 4TQNA 3O70A 2EA6A 3SVHA 5DKCA 2CT2A 5A5PA 5L97A 3MB3A 4O7EA 3P1FA 4N4FA 4QSXA 5J3XA 5I86A 5B75A 3U5JA 4WA6A 1WIMA 4V3KC 4YBMA 2E7NA 5KU3A 1WEPA 2LXPC 3AQAA 4FJCA 4LYSA 5FE5A 4HBVA 5TCMA 2CSYA 3HTKC 4L58A 4N4HA 5FE6A 2MD7B 2XOZA 5D0CA 5HELA 2YYRA 5E3GA 5D1MB 5CUEA 2G4AA 2YEKA 4Y03A 2H0DA 3DDTA 5KH9A 5FDZA 4TZ2A 3SVGA 4IOOA 5CUAA 2QICA 5CUDA 3Q2EA 5K29A 4AKNA 2G6QA 5FG4A 3O34A 5H1TA 2ECVA 5AD3A 2RSDA 2KFTA 5E9LA 5A7CA 2DATA 4LDFA 4I7CA 4ZUXU 5B76A 2EODA 5C87A 2N9GA 4XUBA 3HMHA 4YYHA 2MJVB 4NUEA 4YYMA 2LDRA 4XI1A 4CUTA 4LZSA 4BW3A 5DYUA 1BORA 4UIXA 5HJCA 4UIUA 4QSUA 2ECJA 4NXJA 2VJEB 3NG2A 4IC2A 2KR4A 1VD4A 1ZKRA 4TU4A 5D25A 5FH6A 1WEVA 4A9NA 2C2LA 2OO1A 2EGPA 4YABA 4Q6FA 1DCQA 4UP0A 5EWVA 5HFQA 3LVRE 4UIYA 4Q0NA 2M13A 5LUUA 2Y43A 2YQLA 4O72A 1F68A 4F3IA 4AP4A 5KO4A 5KTXA 5EK9A 5DINA 4TT2A 5DKHA 4QQ4A 4QSSA 3KQIA 2FD4A 4N4IA 3GG3A 3LQIA 3I3JA 4MEPA 4YYJA 4MEQA 5FFYA 5FERA 4HBWA 4NQMA 4PKLA 4UITA 3DAIA 2CSVA 2E6RA 2M85A 3D7CA 3O37A 5HEMA 5FH7A 3MHSA 1X4JA 1Z60A 4FO9A 4UYEA 2VPGA 4UYFB 4N3WA 5EWDA 5FG5A 5D3RA 4QC3A 4B7YC 1EQFA 1F62A 4TTEA 3LXJA 4TZ8A 3LQHA 5EWWA 3UW9A 2OXQC 2KE1A 2LXHC 3I2DA 4NQNA 5D7XA 5LVQA 2L0BA 5LKTA 5DKAA 4LADB 4UYGA 4J0RA 5HCLA 4O7CA 4HXSA 4UI9B 5HQ7A 4NS5A 2WP2A 1X4UA 4HBYA 2KKYA 4LJNA 5FE2A 4NRCA 5I7XA 4J0SA 2PNXA 4E96A 4LKAA 4R7EA 4YYKA 5KH3A 5FB1A 2CKLA 1WILA 4YK0A 5C11A 4NR4A 3KV6A 1WESA 2E6SA 4NRBA 4UP5A 4AKGA 4YY4A 3MQMA 5CQAA 5G0FA 2KYUA 4NUDA 4IR4A 5CUGA 2FUUA 4NRAA 3RCWA 5C85A 2DKWA 5JG6A 3SVFA 4HXNA 2H0DB 2VJEA 2JMIA 3JVLA 3P1CA 2DVQA 5DYCA 3UV4A 2YVRA 4AI6A 3FL2A 5L8UA 2CRRA 5DY7A 3QZVA 3QZTA 5IG6A 3JVMA 5E3DA 5F25A 2DX8A 3LJUX 2F6JA 5HQ6A 2M3HA 4BHWA 3RTRB 4AUQB 5ENHA 4IC3A 4F52B 1LDKC 3ZYQA 2OSSA 4LLBA 2KWKA 5HRVA 5CQ5A 5D3NA 2VJFA 5EA1A 5F61A 4A9MA 4GB0A 1FBVA 4L7XA 3Q1DA 2DVSA 4A4BA 5DKDA 4YYNA 3AADA 2DVVA 5H1VA 5CFWA 5C8GA 2G43A 2JMJA 5KHMA 4GNFA 4MENA 4QSRA 4O7BA 1HYJA 4O77A 5CP5A 3L1XA 5CQTA 5FFVA 2M6MA 2VPBA 1WEEA 4WZ0A 5FE0A 5CQ7A 2L5UA 5L98A 4QSVA 4UIVA 5A5QA 5IGNA 4S3OC 2K4DA 2F42A 3DWYA 5CPEA 4O75A 4A9HA 5FE3A 4I7DA 4A9OA 4QR5A 2KWOA 5EVAA 2LQ6A 2MA6A 3MHHA 3PLWA 2RR4A 4QEUA 5SVIA 2RNWA 2OWAA 3Q2FA 4BBQA 5AMEA 2KWNA 4IR3A 4QY4A 2D9EA 4HXPA 2RNXA 4GPJA 4TT4A 4XUAA 2LGKA 2LGVA 4ZQLA 5D1LB 5IBNA 4NR9A 3VKGA 2ECWA 5H85A 4X2IA 2XEUA 5FE1A 5DW2A 5E9VA 5FE8A 4N4GA 2DSMA 4AKHA 5DLZA 4PCIA 1K2FA 1N72A 4A9EA 4OUFA 1WEOA 4WHWA 5EGUA 2DWWA 5EPRA 1U6GB 4NR8A 3JVKA 4HXLA 4HXOA 4RVRA 5JWMA 2QJ0A 2R0YA 2VPDA 2RO1A 2HYED 3M99A 5ENIA 2YW5A 1VYXA 4CCGX 4LZRA 2DJAA 3V43A 5IGKA 1FP0A 5TABA 4CUQA 5HRWA 2JMDA 3VKHA 2BAYA 3MB4A 4H9DA 2M1RA 2MNZA 3S91A 3MDBC 5TDWA 3ZVZB 5C4QA 5HRXA 5D3SA 5HENA 2L5EA 2YSJA 5A85A 4QZSA 4A9KA 4NR7A 3DQVR 3PUQA 4I7BA 4Z0OA 5I3LA 2XOYA 3O33A 5G4RA 3P1DA 3KNVA 4UIZA 5KH7A 4NR6A 5ACYA 3FM8C 2EGMA 4O71A 4LZ2A 5TRBA 2CKLB 4CUUA 3ZNIA 4CA1A 3SOUA 2XOCA 3FKMX 5SVIB 4TU6A 3O47A 2LSPB 4AYCB 5G05B 2RFJA 5DFBA 3UV2A 4TYLA 5D24A 4LYIA 4XYAA 1ZS5A 4BW4A 4YH4A 3ZPV1 2XP0A 4MR6A 2YYNA 5E73A 2R0SA 2OUOA 4F1PA 3H7HA 4DONA 3LDYA 2MD8C 4MSXA 2K17A 2MNYA 1V87A 4GNDA 5AITA 4LRGA 1Z2QA 4O7AA 2YQDA 5DFCA 5II1A 3M63A 1ZBDB 3ZYUA 5BT4A 4HXRA 5LVRA 2ZETC 4UYFA 5HLSA 3IU5A 2WP1A 3FANA 5E9KA 2L7PA 1X0JA 4QUUA 5CQ3A 5F2PA 4QSWA 5L8TA 2KGGA 4MR5A 1MBMA 2EJNA 1HYIA 4A9LA 5CRZA 5A81A 5EU1A 5FBXA 3DWDA 3UVXA 2L84A 2JUNA 4QSQA 5EP7A 2KREA 5DLXA 4O7FA 5I40A 4BW1A 5LJ0A 4HXMA 4O74A 5C7NA 2MT5A 5CS8A 4WZ3B 5F5ZA 5FEYA 5E9IA 4QEVA 5E9YA 2KWJA 3U5NA 4KCXA 5I7YA 2C2VS 4J1PA 1XWHA 2QIZA 2L85A 2LRIC 2KIZA 2P57A 5E7DA 5KTUA 3RPGC 5F63A 4PS5A 3LQJA 3O7AA 5FFWA 2YURA 4AVXA 5J0DA 3IU6A 1JOCA 3QZSA 4YYGA 5I83A 2I7KA 4A9IA 4QNSA 5E0RA 4PCEA 3JVJA 2E61A 4UYHA 4HBXA 4QBMA 4GNGA 3G0JA 3GL6A 5A5RA 5CGPA 5F1HA 2VJFB 3U5LA 3MULA 4B86C 2RI7A 5CQ6A 3O35A 5H1UA 3N9MA 4C9ZA 5EV9A 5A82A 4Z1QA 5E9MA 4HXKA 2IDAA 4PPEA 1RMDA 2B0OE 5B77A 2DVRA 3T7LA 1MM3A 3N9QA 4CURA 2R0VA 4V3LC 5B78A 1WUGA 1MM2A 5F3AA 5COIA 3NXBA 2IQJA 1WEQA 5KTWA 5FB0A 5HM0A 3UV5A 5EPBA 5I29A 5A83A 2LV9A 2L75A 1WFKA 4X3GA 4A4CA 5DFDA 5I80A 1T1HA 3KDEC 1E4UA 1WEUA 3LVQE 4KV4A 5EI4A 4IR5A 4QUTA 5A5OA 5FE7A 5FH8A 4Z6IA 2ECNA 4Z0RA 2YQMA 5AD2A 4PTBA 4QSTA 5CUBA 5BT5A 2L43A 2YSMA 4WIVA 4NR5A 2PUYA 3D1BA 2YUCA 2GRCA 5ETDA 2CONA 2KTBB 5CTLA 3HCSA 5DX4A 5FE4A 4NYVA 2F6NA 2ECIA 2RNYA 4YH3A 5L96A 2G45A 2YU4A 3L11A 5B79A 2I50A 2ECGA 2MUMA 5SVXA 3SOXA 4YYDA 2YELA 2AN6A 4QR3A 3D1DA 1CHCA 4KV1A 4YYIA 5A5SA 2LGGA 3HCTA 5BT3A 5TDRA 5B8DA 2LN0A 3EB6A 4CL9A 3N9PA 4Z6HA 4Z1SA 5AMFA 3HMEA 5EWHA 3IHPA 5D3TA 2VNFA 4YBTA 5D3PA 3O36A 4CFLA 4IOQA 4YAXA 5EPSA 3S92A 1WEWA 1PUOA 3L1ZB 4O76A 4TKPB 2KU3A 5I89A 5G4SA 3JUEA 3N9NA 1VFYA 4IR6A 4AKIA 4A9JA 4LC2A 4ZC9A 3ZPVE 5DYAA 5EYAF 5A5NA 5L99A 2E7OA 4OGIA 3VK6A 1JM7A 5ENBA 3C5KA 4YATA 4XY9A 2YREA 5K3QA 4ZW1A 4YBSA 5LKXA 3MUKA 5ENJA 1G25A 3ASLA 5LJ1A 4P5OB 1Z6UA 2YDWA 5LKZA 4R8PK 5TBNA 3HMFA 4Q0OA 5G04B 3E2DA 3LJWA 5I1QA 5SVYA 4QYDA 2ECTA 3HCUA 2MKEA 2NAAA 3ZTGA 4QF3A 4C66A 5EM3A 5D3LA 4ALHA 5FG6A 3ZVYA 5D26A 4GNEA 5I88A 1JSPB 2K1JA 5F62A 5ENEA 4J3IA 5LCWB 5CZGA 4CFKA 3M62A 4NYWA 2D8SA 5E74A 2YEMA 5ENFA 4R2YA 3P5OA 4UIWA 4UYDA 5IGLA 4O64A 5ENGA 2JRJA 3UVDA 4NUCA 3FJUB 4MVTA 5DW1A 5EQ1A 2MA5A 2MIQA 4AYCA 3TLPA 3UVWA 2K16A 2XB1A 1WE9A 2I8NA 4XY8A 3SUBA 4OGCA 2E3KA 4MEOA 5HQ5A 2YHNA 3FAOA 4Z93A 2KKXA 3SOWA 4FIPA 3U5OA 2YT5A 3T9KA 1E6IA 3M7KA 5FE9A 5F36A 5IGMA 5EISA 3MXFA 4O78A 2L80A 2Y1NA 3N9OA 3KV5A 4W4UA 5D1KB 4A0CD 2LAUA 4CUSA 4QEWA 4OGEA 2R10A 4TT6A 4YC9A 3U5KA 4S3OB 5CU8A 3RPGB 4MR3A 2FFWA 1IYMA 3DPLR 4QR4A 5CRMA 3LRQA 4LR6A 4TS8A 3G0LA 4FLPA 5F1LA 1DVPA 4QC1A 1LDJB 2CRWA 2YHOA 2HDPA 5HFRA 2JM3A 5LKUA 5CUCA 4CLBA 5ENCA 1JM7B 4YY6A 1WGMA 3K2JA 5AIUA 5CQ4A 5LJ2A 3ONIA 2D8UA 1WENA 4CUPA 2VP7A 2Y1MA 1WEMA 3SHBA 3PURA 4LYWA 4BW2A 2H60A 3PHDA 5DYXA
chains in the Genus database with same CATH topology
4A9FA 3GV4A 4FK5A 3C6WA 3N9LA 5D3JA 4ZDTA 5DBMA 4QYLA 4OGJA 4QB3A 2NXBA 4WHUA 2UZGA 4QF2A 4C67A 5EICA 5EWCA 4WZ2A 2D82A 4NYXA 5TB6A 4MR4A 5C13A 5D3HA 2YW8A 1X4IA 5H9MA 5ETBA 4LK9A 2FSAA 4BJXA 3UVYA 3EB5A 4A49A 3T6RA 4NN2A 5CY9A 4O70A 4QSPA 2KGIA 2LGLA 4IORA 5F60A 5II2A 3U5MA 1JM4B 5JI8A 2FUIA 2RS9B 4ALGA 4PY6A 4YADA 5IIDA 1N87A 3P1EA 2CSZA 2VPEA 1WUMA 5CQ8A 5C89A 3U5PA 4TQNA 3O70A 2EA6A 3SVHA 5DKCA 2CT2A 5A5PA 5L97A 3MB3A 4O7EA 3P1FA 4N4FA 4QSXA 5J3XA 5I86A 5B75A 3U5JA 4WA6A 1WIMA 4V3KC 4YBMA 2E7NA 5KU3A 1WEPA 2LXPC 3AQAA 4FJCA 4LYSA 5FE5A 4HBVA 5TCMA 2CSYA 3HTKC 4L58A 4N4HA 5FE6A 2MD7B 5D0CA 5HELA 2YYRA 5E3GA 5D1MB 5CUEA 2G4AA 2YEKA 4Y03A 2H0DA 5KH9A 5FDZA 4TZ2A 3SVGA 4IOOA 5CUAA 2QICA 5CUDA 3Q2EA 5K29A 4AKNA 2G6QA 5FG4A 3O34A 5H1TA 2ECVA 5AD3A 2RSDA 2KFTA 5E9LA 5A7CA 2DATA 4LDFA 4I7CA 4ZUXU 5B76A 2EODA 5C87A 2N9GA 4XUBA 3HMHA 4YYHA 2MJVB 4NUEA 4YYMA 2LDRA 4XI1A 4CUTA 4LZSA 4BW3A 5DYUA 1BORA 4UIXA 5HJCA 4UIUA 4QSUA 2ECJA 4NXJA 2VJEB 3NG2A 4IC2A 2KR4A 1VD4A 4TU4A 5D25A 5FH6A 1WEVA 4A9NA 2C2LA 2OO1A 2EGPA 4YABA 4Q6FA 4UP0A 5EWVA 5HFQA 4UIYA 4Q0NA 2Y43A 5LUUA 2YQLA 4O72A 1F68A 4F3IA 4AP4A 5KO4A 5KTXA 5EK9A 5DINA 4TT2A 5DKHA 4QSSA 3KQIA 4N4IA 3GG3A 3LQIA 3I3JA 4MEPA 4YYJA 4MEQA 5FFYA 5FERA 4HBWA 4NQMA 4PKLA 4UITA 3DAIA 2E6RA 2M85A 3D7CA 3O37A 5HEMA 5FH7A 3MHSA 1X4JA 1Z60A 4FO9A 4UYEA 2VPGA 4UYFB 4N3WA 5EWDA 5FG5A 5D3RA 4QC3A 4B7YC 1EQFA 1F62A 4TTEA 3LXJA 4TZ8A 3LQHA 5EWWA 3UW9A 2OXQC 2KE1A 2LXHC 3I2DA 4NQNA 5D7XA 5LVQA 2L0BA 5LKTA 5DKAA 4LADB 4UYGA 4J0RA 5HCLA 4O7CA 4HXSA 4UI9B 5HQ7A 4NS5A 2WP2A 1X4UA 4HBYA 4LJNA 5FE2A 4NRCA 5I7XA 4J0SA 2PNXA 4E96A 4LKAA 4R7EA 4YYKA 5KH3A 5FB1A 2CKLA 1WILA 4YK0A 5C11A 4NR4A 3KV6A 1WESA 2E6SA 4NRBA 4UP5A 4YY4A 3MQMA 5CQAA 5G0FA 2KYUA 4NUDA 4IR4A 5CUGA 2FUUA 4NRAA 3RCWA 5C85A 2DKWA 5JG6A 3SVFA 4HXNA 2H0DB 2VJEA 2JMIA 3JVLA 3P1CA 2DVQA 5DYCA 3UV4A 3FL2A 5L8UA 5DY7A 3QZVA 3QZTA 5IG6A 3JVMA 5E3DA 5F25A 2DX8A 2F6JA 5HQ6A 2M3HA 4BHWA 3RTRB 4AUQB 5ENHA 4IC3A 4F52B 1LDKC 3ZYQA 2OSSA 4LLBA 2KWKA 5HRVA 5CQ5A 5D3NA 2VJFA 5EA1A 5F61A 4A9MA 4GB0A 1FBVA 4L7XA 2DVSA 4A4BA 5DKDA 4YYNA 3AADA 2DVVA 5H1VA 5CFWA 5C8GA 2G43A 2JMJA 5KHMA 4GNFA 4MENA 4QSRA 4O7BA 1HYJA 4O77A 5CP5A 3L1XA 5CQTA 5FFVA 2M6MA 2VPBA 1WEEA 4WZ0A 5FE0A 5CQ7A 2L5UA 5L98A 4QSVA 4UIVA 5A5QA 5IGNA 4S3OC 2K4DA 2F42A 3DWYA 5CPEA 4O75A 4A9HA 5FE3A 4I7DA 4A9OA 4QR5A 2KWOA 5EVAA 2LQ6A 2MA6A 3MHHA 4QEUA 2RNWA 3Q2FA 4BBQA 5AMEA 2KWNA 4IR3A 4QY4A 2D9EA 4HXPA 2RNXA 4GPJA 4TT4A 4XUAA 2LGKA 2LGVA 4ZQLA 5D1LB 5IBNA 4NR9A 2ECWA 5H85A 4X2IA 2XEUA 5FE1A 5DW2A 5E9VA 5FE8A 4N4GA 5DLZA 4PCIA 1K2FA 1N72A 4A9EA 4OUFA 1WEOA 4WHWA 5EGUA 2DWWA 5EPRA 1U6GB 4NR8A 3JVKA 4HXLA 4HXOA 4RVRA 5JWMA 2QJ0A 2R0YA 2VPDA 2RO1A 2HYED 3M99A 5ENIA 2YW5A 1VYXA 4CCGX 4LZRA 3V43A 5IGKA 1FP0A 5TABA 4CUQA 5HRWA 2JMDA 2BAYA 3ZVZB 3MB4A 2M1RA 2MNZA 3S91A 5TDWA 5C4QA 5HRXA 5D3SA 5HENA 2L5EA 2YSJA 5A85A 4QZSA 4A9KA 4NR7A 3DQVR 3PUQA 4I7BA 5I3LA 3O33A 5G4RA 3P1DA 3KNVA 4UIZA 5KH7A 4NR6A 5ACYA 4O71A 4LZ2A 5TRBA 2CKLB 4CUUA 3ZNIA 4CA1A 3SOUA 3FKMX 4TU6A 2LSPB 4AYCB 5G05B 2RFJA 5DFBA 3UV2A 4TYLA 5D24A 4LYIA 4XYAA 1ZS5A 4BW4A 4YH4A 3ZPV1 4MR6A 2YYNA 5E73A 2R0SA 2OUOA 4DONA 2MD8C 4MSXA 2K17A 2MNYA 1V87A 4GNDA 5AITA 4LRGA 1Z2QA 4O7AA 2YQDA 5DFCA 5II1A 3M63A 1ZBDB 3ZYUA 5BT4A 4HXRA 5LVRA 2ZETC 4UYFA 5HLSA 3IU5A 2WP1A 5E9KA 1X0JA 4QUUA 5CQ3A 5F2PA 4QSWA 5L8TA 2KGGA 4MR5A 1HYIA 4A9LA 5CRZA 5A81A 5EU1A 5FBXA 3UVXA 2L84A 4QSQA 5EP7A 2KREA 5DLXA 4O7FA 5I40A 4BW1A 5LJ0A 4HXMA 4O74A 5C7NA 2MT5A 5CS8A 4WZ3B 5F5ZA 5FEYA 5E9IA 4QEVA 5E9YA 2KWJA 3U5NA 4KCXA 5I7YA 2C2VS 4J1PA 1XWHA 2QIZA 2L85A 2LRIC 2KIZA 5E7DA 5KTUA 3RPGC 5F63A 4PS5A 3LQJA 3O7AA 5FFWA 2YURA 4AVXA 5J0DA 3IU6A 1JOCA 3QZSA 4YYGA 5I83A 2I7KA 4A9IA 4QNSA 5E0RA 4PCEA 3JVJA 4UYHA 4HBXA 4QBMA 4GNGA 3G0JA 3GL6A 5A5RA 5CGPA 5F1HA 2VJFB 3U5LA 3MULA 4B86C 2RI7A 5CQ6A 3O35A 5H1UA 3N9MA 4C9ZA 5EV9A 5A82A 4Z1QA 5E9MA 4HXKA 2IDAA 4PPEA 1RMDA 5B77A 2DVRA 3T7LA 1MM3A 3N9QA 4CURA 2R0VA 4V3LC 5B78A 1WUGA 1MM2A 5F3AA 5COIA 3NXBA 1WEQA 5KTWA 5FB0A 5HM0A 3UV5A 5EPBA 5I29A 5A83A 2LV9A 2L75A 1WFKA 4X3GA 4A4CA 5DFDA 5I80A 1T1HA 1E4UA 1WEUA 5EI4A 4KV4A 4IR5A 4QUTA 5A5OA 5FE7A 5FH8A 4Z6IA 2ECNA 2YQMA 5AD2A 4PTBA 4QSTA 5CUBA 5BT5A 2L43A 2YSMA 4WIVA 4NR5A 2PUYA 2YUCA 2GRCA 5ETDA 2KTBB 5CTLA 3HCSA 5DX4A 5FE4A 4NYVA 2F6NA 2ECIA 2RNYA 4YH3A 5L96A 2G45A 2YU4A 3L11A 5B79A 2I50A 2ECGA 2MUMA 3SOXA 4YYDA 2YELA 2AN6A 4QR3A 1CHCA 5TDRA 4KV1A 4YYIA 5A5SA 2LGGA 3HCTA 5BT3A 5B8DA 2LN0A 3EB6A 4CL9A 3N9PA 4Z6HA 4Z1SA 5AMFA 3HMEA 5EWHA 3IHPA 5D3TA 2VNFA 4YBTA 5D3PA 3O36A 4CFLA 4IOQA 4YAXA 5EPSA 3S92A 1WEWA 3L1ZB 4TKPB 4O76A 2KU3A 5I89A 5G4SA 3N9NA 1VFYA 4IR6A 4A9JA 4LC2A 4ZC9A 3ZPVE 5DYAA 5EYAF 5A5NA 5L99A 2E7OA 4OGIA 3VK6A 1JM7A 5ENBA 3C5KA 4YATA 4XY9A 2YREA 4ZW1A 4YBSA 5LKXA 3MUKA 5ENJA 1G25A 3ASLA 5LJ1A 4P5OB 1Z6UA 2YDWA 5LKZA 4R8PK 5TBNA 3HMFA 4Q0OA 5G04B 3LJWA 5I1QA 4QYDA 2ECTA 3HCUA 2NAAA 3ZTGA 4QF3A 4C66A 5EM3A 5D3LA 4ALHA 5FG6A 3ZVYA 5D26A 4GNEA 5I88A 1JSPB 2K1JA 5F62A 5ENEA 4J3IA 5LCWB 5CZGA 4CFKA 3M62A 4NYWA 2D8SA 5E74A 2YEMA 5ENFA 4R2YA 3P5OA 4UIWA 4UYDA 5IGLA 4O64A 5ENGA 2JRJA 3UVDA 4NUCA 4MVTA 5DW1A 5EQ1A 2MA5A 2MIQA 4AYCA 3TLPA 3UVWA 2K16A 2XB1A 1WE9A 2I8NA 4XY8A 2E3KA 4MEOA 5HQ5A 2YHNA 4Z93A 3SOWA 4FIPA 3U5OA 2YT5A 1E6IA 5FE9A 5F36A 5IGMA 5EISA 3MXFA 4O78A 2L80A 2Y1NA 3N9OA 3KV5A 4W4UA 5D1KB 4A0CD 4CUSA 4QEWA 2R10A 4TT6A 4YC9A 3U5KA 4S3OB 5CU8A 3RPGB 4MR3A 1IYMA 3DPLR 4QR4A 5CRMA 3LRQA 4LR6A 4TS8A 3G0LA 4FLPA 5F1LA 1DVPA 4QC1A 1LDJB 2YHOA 2HDPA 5HFRA 5LKUA 5CUCA 4CLBA 5ENCA 1JM7B 4YY6A 1WGMA 3K2JA 5AIUA 5CQ4A 5LJ2A 3ONIA 1WENA 4CUPA 2VP7A 2Y1MA 1WEMA 3SHBA 3PURA 4LYWA 4BW2A 2H60A 3PHDA 5DYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9F A;  3GV4 A;  4FK5 A;  3C6W A;  3N9L A;  5D3J A;  4ZDT A;  5DBM A;  4QYL A;  4OGJ A;  4QB3 A;  2NXB A;  4WHU A;  2UZG A;  4QF2 A;  4C67 A;  5EIC A;  5EWC A;  4WZ2 A;  2D82 A;  4NYX A;  5TB6 A;  4MR4 A;  5C13 A;  5D3H A;  2YW8 A;  1X4I A;  5H9M A;  5ETB A;  4LK9 A;  2FSA A;  4BJX A;  3UVY A;  3EB5 A;  4A49 A;  3T6R A;  4NN2 A;  5CY9 A;  4O70 A;  4QSP A;  2KGI A;  2LGL A;  4IOR A;  5F60 A;  5II2 A;  3U5M A;  1JM4 B;  5JI8 A;  2FUI A;  2RS9 B;  4ALG A;  4PY6 A;  4YAD A;  5IID A;  1N87 A;  3P1E A;  2CSZ A;  2VPE A;  1WUM A;  5CQ8 A;  5C89 A;  3U5P A;  4TQN A;  3O70 A;  2EA6 A;  3SVH A;  5DKC A;  2CT2 A;  5A5P A;  5L97 A;  3MB3 A;  4O7E A;  3P1F A;  4N4F A;  4QSX A;  5J3X A;  5I86 A;  5B75 A;  3U5J A;  4WA6 A;  1WIM A;  4V3K C;  4YBM A;  2E7N A;  5KU3 A;  1WEP A;  2LXP C;  3AQA A;  4FJC A;  4LYS A;  5FE5 A;  4HBV A;  5TCM A;  2CSY A;  3HTK C;  4L58 A;  4N4H A;  5FE6 A;  2MD7 B;  5D0C A;  5HEL A;  2YYR A;  5E3G A;  5D1M B;  5CUE A;  2G4A A;  2YEK A;  4Y03 A;  2H0D A;  5KH9 A;  5FDZ A;  4TZ2 A;  3SVG A;  4IOO A;  5CUA A;  2QIC A;  5CUD A;  3Q2E A;  5K29 A;  4AKN A;  2G6Q A;  5FG4 A;  3O34 A;  5H1T A;  2ECV A;  5AD3 A;  2RSD A;  2KFT A;  5E9L A;  5A7C A;  2DAT A;  4LDF A;  4I7C A;  4ZUX U;  5B76 A;  2EOD A;  5C87 A;  2N9G A;  4XUB A;  3HMH A;  4YYH A;  2MJV B;  4NUE A;  4YYM A;  2LDR A;  4XI1 A;  4CUT A;  4LZS A;  4BW3 A;  5DYU A;  1BOR A;  4UIX A;  5HJC A;  4UIU A;  4QSU A;  2ECJ A;  4NXJ A;  2VJE B;  3NG2 A;  4IC2 A;  2KR4 A;  1VD4 A;  4TU4 A;  5D25 A;  5FH6 A;  1WEV A;  4A9N A;  2C2L A;  2OO1 A;  2EGP A;  4YAB A;  4Q6F A;  4UP0 A;  5EWV A;  5HFQ A;  4UIY A;  4Q0N A;  2Y43 A;  5LUU A;  2YQL A;  4O72 A;  1F68 A;  4F3I A;  4AP4 A;  5KO4 A;  5KTX A;  5EK9 A;  5DIN A;  4TT2 A;  5DKH A;  4QSS A;  3KQI A;  4N4I A;  3GG3 A;  3LQI A;  3I3J A;  4MEP A;  4YYJ A;  4MEQ A;  5FFY A;  5FER A;  4HBW A;  4NQM A;  4PKL A;  4UIT A;  3DAI A;  2E6R A;  2M85 A;  3D7C A;  3O37 A;  5HEM A;  5FH7 A;  3MHS A;  1X4J A;  1Z60 A;  4FO9 A;  4UYE A;  2VPG A;  4UYF B;  4N3W A;  5EWD A;  5FG5 A;  5D3R A;  4QC3 A;  4B7Y C;  1EQF A;  1F62 A;  4TTE A;  3LXJ A;  4TZ8 A;  3LQH A;  5EWW A;  3UW9 A;  2OXQ C;  2KE1 A;  2LXH C;  3I2D A;  4NQN A;  5D7X A;  5LVQ A;  2L0B A;  5LKT A;  5DKA A;  4LAD B;  4UYG A;  4J0R A;  5HCL A;  4O7C A;  4HXS A;  4UI9 B;  5HQ7 A;  4NS5 A;  2WP2 A;  1X4U A;  4HBY A;  4LJN A;  5FE2 A;  4NRC A;  5I7X A;  4J0S A;  2PNX A;  4E96 A;  4LKA A;  4R7E A;  4YYK A;  5KH3 A;  5FB1 A;  2CKL A;  1WIL A;  4YK0 A;  5C11 A;  4NR4 A;  3KV6 A;  1WES A;  2E6S A;  4NRB A;  4UP5 A;  4YY4 A;  3MQM A;  5CQA A;  5G0F A;  2KYU A;  4NUD A;  4IR4 A;  5CUG A;  2FUU A;  4NRA A;  3RCW A;  5C85 A;  2DKW A;  5JG6 A;  3SVF A;  4HXN A;  2H0D B;  2VJE A;  2JMI A;  3JVL A;  3P1C A;  2DVQ A;  5DYC A;  3UV4 A;  3FL2 A;  5L8U A;  5DY7 A;  3QZV A;  3QZT A;  5IG6 A;  3JVM A;  5E3D A;  5F25 A;  2DX8 A;  2F6J A;  5HQ6 A;  2M3H A;  4BHW A;  3RTR B;  4AUQ B;  5ENH A;  4IC3 A;  4F52 B;  1LDK C;  3ZYQ A;  2OSS A;  4LLB A;  2KWK A;  5HRV A;  5CQ5 A;  5D3N A;  2VJF A;  5EA1 A;  5F61 A;  4A9M A;  4GB0 A;  1FBV A;  4L7X A;  2DVS A;  4A4B A;  5DKD A;  4YYN A;  3AAD A;  2DVV A;  5H1V A;  5CFW A;  5C8G A;  2G43 A;  2JMJ A;  5KHM A;  4GNF A;  4MEN A;  4QSR A;  4O7B A;  1HYJ A;  4O77 A;  5CP5 A;  3L1X A;  5CQT A;  5FFV A;  2M6M A;  2VPB A;  1WEE A;  4WZ0 A;  5FE0 A;  5CQ7 A;  2L5U A;  5L98 A;  4QSV A;  4UIV A;  5A5Q A;  5IGN A;  4S3O C;  2K4D A;  2F42 A;  3DWY A;  5CPE A;  4O75 A;  4A9H A;  5FE3 A;  4I7D A;  4A9O A;  4QR5 A;  2KWO A;  5EVA A;  2LQ6 A;  2MA6 A;  3MHH A;  4QEU A;  2RNW A;  3Q2F A;  4BBQ A;  5AME A;  2KWN A;  4IR3 A;  4QY4 A;  2D9E A;  4HXP A;  2RNX A;  4GPJ A;  4TT4 A;  4XUA A;  2LGK A;  2LGV A;  4ZQL A;  5D1L B;  5IBN A;  4NR9 A;  2ECW A;  5H85 A;  4X2I A;  2XEU A;  5FE1 A;  5DW2 A;  5E9V A;  5FE8 A;  4N4G A;  5DLZ A;  4PCI A;  1K2F A;  1N72 A;  4A9E A;  4OUF A;  1WEO A;  4WHW A;  5EGU A;  2DWW A;  5EPR A;  1U6G B;  4NR8 A;  3JVK A;  4HXL A;  4HXO A;  4RVR A;  5JWM A;  2QJ0 A;  2R0Y A;  2VPD A;  2RO1 A;  2HYE D;  3M99 A;  5ENI A;  2YW5 A;  1VYX A;  4CCG X;  4LZR A;  3V43 A;  5IGK A;  1FP0 A;  5TAB A;  4CUQ A;  5HRW A;  2JMD A;  2BAY A;  3ZVZ B;  3MB4 A;  2M1R A;  2MNZ A;  3S91 A;  5TDW A;  5C4Q A;  5HRX A;  5D3S A;  5HEN A;  2L5E A;  2YSJ A;  5A85 A;  4QZS A;  4A9K A;  4NR7 A;  3DQV R;  3PUQ A;  4I7B A;  5I3L A;  3O33 A;  5G4R A;  3P1D A;  3KNV A;  4UIZ A;  5KH7 A;  4NR6 A;  5ACY A;  4O71 A;  4LZ2 A;  5TRB A;  2CKL B;  4CUU A;  3ZNI A;  4CA1 A;  3SOU A;  3FKM X;  4TU6 A;  2LSP B;  4AYC B;  5G05 B;  2RFJ A;  5DFB A;  3UV2 A;  4TYL A;  5D24 A;  4LYI A;  4XYA A;  1ZS5 A;  4BW4 A;  4YH4 A;  3ZPV 1;  4MR6 A;  2YYN A;  5E73 A;  2R0S A;  2OUO A;  4DON A;  2MD8 C;  4MSX A;  2K17 A;  2MNY A;  1V87 A;  4GND A;  5AIT A;  4LRG A;  1Z2Q A;  4O7A A;  2YQD A;  5DFC A;  5II1 A;  3M63 A;  1ZBD B;  3ZYU A;  5BT4 A;  4HXR A;  5LVR A;  2ZET C;  4UYF A;  5HLS A;  3IU5 A;  2WP1 A;  5E9K A;  1X0J A;  4QUU A;  5CQ3 A;  5F2P A;  4QSW A;  5L8T A;  2KGG A;  4MR5 A;  1HYI A;  4A9L A;  5CRZ A;  5A81 A;  5EU1 A;  5FBX A;  3UVX A;  2L84 A;  4QSQ A;  5EP7 A;  2KRE A;  5DLX A;  4O7F A;  5I40 A;  4BW1 A;  5LJ0 A;  4HXM A;  4O74 A;  5C7N A;  2MT5 A;  5CS8 A;  4WZ3 B;  5F5Z A;  5FEY A;  5E9I A;  4QEV A;  5E9Y A;  2KWJ A;  3U5N A;  4KCX A;  5I7Y A;  2C2V S;  4J1P A;  1XWH A;  2QIZ A;  2L85 A;  2LRI C;  2KIZ A;  5E7D A;  5KTU A;  3RPG C;  5F63 A;  4PS5 A;  3LQJ A;  3O7A A;  5FFW A;  2YUR A;  4AVX A;  5J0D A;  3IU6 A;  1JOC A;  3QZS A;  4YYG A;  5I83 A;  2I7K A;  4A9I A;  4QNS A;  5E0R A;  4PCE A;  3JVJ A;  4UYH A;  4HBX A;  4QBM A;  4GNG A;  3G0J A;  3GL6 A;  5A5R A;  5CGP A;  5F1H A;  2VJF B;  3U5L A;  3MUL A;  4B86 C;  2RI7 A;  5CQ6 A;  3O35 A;  5H1U A;  3N9M A;  4C9Z A;  5EV9 A;  5A82 A;  4Z1Q A;  5E9M A;  4HXK A;  2IDA A;  4PPE A;  1RMD A;  5B77 A;  2DVR A;  3T7L A;  1MM3 A;  3N9Q A;  4CUR A;  2R0V A;  4V3L C;  5B78 A;  1WUG A;  1MM2 A;  5F3A A;  5COI A;  3NXB A;  1WEQ A;  5KTW A;  5FB0 A;  5HM0 A;  3UV5 A;  5EPB A;  5I29 A;  5A83 A;  2LV9 A;  2L75 A;  1WFK A;  4X3G A;  4A4C A;  5DFD A;  5I80 A;  1T1H A;  1E4U A;  1WEU A;  5EI4 A;  4KV4 A;  4IR5 A;  4QUT A;  5A5O A;  5FE7 A;  5FH8 A;  4Z6I A;  2ECN A;  2YQM A;  5AD2 A;  4PTB A;  4QST A;  5CUB A;  5BT5 A;  2L43 A;  2YSM A;  4WIV A;  4NR5 A;  2PUY A;  2YUC A;  2GRC A;  5ETD A;  2KTB B;  5CTL A;  3HCS A;  5DX4 A;  5FE4 A;  4NYV A;  2F6N A;  2ECI A;  2RNY A;  4YH3 A;  5L96 A;  2G45 A;  2YU4 A;  3L11 A;  5B79 A;  2I50 A;  2ECG A;  2MUM A;  3SOX A;  4YYD A;  2YEL A;  2AN6 A;  4QR3 A;  1CHC A;  5TDR A;  4KV1 A;  4YYI A;  5A5S A;  2LGG A;  3HCT A;  5BT3 A;  5B8D A;  2LN0 A;  3EB6 A;  4CL9 A;  3N9P A;  4Z6H A;  4Z1S A;  5AMF A;  3HME A;  5EWH A;  3IHP A;  5D3T A;  2VNF A;  4YBT A;  5D3P A;  3O36 A;  4CFL A;  4IOQ A;  4YAX A;  5EPS A;  3S92 A;  1WEW A;  3L1Z B;  4TKP B;  4O76 A;  2KU3 A;  5I89 A;  5G4S A;  3N9N A;  1VFY A;  4IR6 A;  4A9J A;  4LC2 A;  4ZC9 A;  3ZPV E;  5DYA A;  5EYA F;  5A5N A;  5L99 A;  2E7O A;  4OGI A;  3VK6 A;  1JM7 A;  5ENB A;  3C5K A;  4YAT A;  4XY9 A;  2YRE A;  4ZW1 A;  4YBS A;  5LKX A;  3MUK A;  5ENJ A;  1G25 A;  3ASL A;  5LJ1 A;  4P5O B;  1Z6U A;  2YDW A;  5LKZ A;  4R8P K;  5TBN A;  3HMF A;  4Q0O A;  5G04 B;  3LJW A;  5I1Q A;  4QYD A;  2ECT A;  3HCU A;  2NAA A;  3ZTG A;  4QF3 A;  4C66 A;  5EM3 A;  5D3L A;  4ALH A;  5FG6 A;  3ZVY A;  5D26 A;  4GNE A;  5I88 A;  1JSP B;  2K1J A;  5F62 A;  5ENE A;  4J3I A;  5LCW B;  5CZG A;  4CFK A;  3M62 A;  4NYW A;  2D8S A;  5E74 A;  2YEM A;  5ENF A;  4R2Y A;  3P5O A;  4UIW A;  4UYD A;  5IGL A;  4O64 A;  5ENG A;  2JRJ A;  3UVD A;  4NUC A;  4MVT A;  5DW1 A;  5EQ1 A;  2MA5 A;  2MIQ A;  4AYC A;  3TLP A;  3UVW A;  2K16 A;  2XB1 A;  1WE9 A;  2I8N A;  4XY8 A;  2E3K A;  4MEO A;  5HQ5 A;  2YHN A;  4Z93 A;  3SOW A;  4FIP A;  3U5O A;  2YT5 A;  1E6I A;  5FE9 A;  5F36 A;  5IGM A;  5EIS A;  3MXF A;  4O78 A;  2L80 A;  2Y1N A;  3N9O A;  3KV5 A;  4W4U A;  5D1K B;  4A0C D;  4CUS A;  4QEW A;  2R10 A;  4TT6 A;  4YC9 A;  3U5K A;  4S3O B;  5CU8 A;  3RPG B;  4MR3 A;  1IYM A;  3DPL R;  4QR4 A;  5CRM A;  3LRQ A;  4LR6 A;  4TS8 A;  3G0L A;  4FLP A;  5F1L A;  1DVP A;  4QC1 A;  1LDJ B;  2YHO A;  2HDP A;  5HFR A;  5LKU A;  5CUC A;  4CLB A;  5ENC A;  1JM7 B;  4YY6 A;  1WGM A;  3K2J A;  5AIU A;  5CQ4 A;  5LJ2 A;  3ONI A;  1WEN A;  4CUP A;  2VP7 A;  2Y1M A;  1WEM A;  3SHB A;  3PUR A;  4LYW A;  4BW2 A;  2H60 A;  3PHD A;  5DYX A; 
#chains in the Genus database with same CATH topology
 4A9F A;  3GV4 A;  4FK5 A;  3C6W A;  3N9L A;  5D3J A;  3FEH A;  5DBM A;  4ZDT A;  4QYL A;  4OGJ A;  4QB3 A;  2NXB A;  4WHU A;  3ERR A;  2UZG A;  4QF2 A;  4C67 A;  4O62 A;  5EIC A;  5EWC A;  4WZ2 A;  2D82 A;  4NYX A;  5TB6 A;  4MR4 A;  5C13 A;  5D3H A;  2YW8 A;  1X4I A;  5H9M A;  5ETB A;  4LK9 A;  2FSA A;  4BJX A;  3UVY A;  3EB5 A;  4A49 A;  3T6R A;  4NN2 A;  5CY9 A;  4O70 A;  4QSP A;  2KGI A;  2LGL A;  4IOR A;  5F60 A;  5II2 A;  3U5M A;  1JM4 B;  5JI8 A;  2FUI A;  2RS9 B;  4ALG A;  4PY6 A;  4YAD A;  5IID A;  1N87 A;  3P1E A;  2CSZ A;  2VPE A;  1WUM A;  5CQ8 A;  5C89 A;  3U5P A;  2EXU A;  4TQN A;  3O70 A;  2EA6 A;  3SVH A;  5DKC A;  2CT2 A;  5A5P A;  5L97 A;  3MB3 A;  4O7E A;  3P1F A;  4N4F A;  4QSX A;  5J3X A;  5I86 A;  5B75 A;  3U5J A;  4WA6 A;  1WIM A;  4V3K C;  4YBM A;  2E7N A;  5KU3 A;  1WEP A;  2LXP C;  3AQA A;  4FJC A;  4LYS A;  5FE5 A;  4HBV A;  5TCM A;  2CSY A;  3HTK C;  4L58 A;  4N4H A;  5FE6 A;  2MD7 B;  2XOZ A;  5D0C A;  5HEL A;  2YYR A;  5E3G A;  5D1M B;  5CUE A;  2G4A A;  2YEK A;  4Y03 A;  2H0D A;  3DDT A;  5KH9 A;  5FDZ A;  4TZ2 A;  3SVG A;  4IOO A;  5CUA A;  2QIC A;  5CUD A;  3Q2E A;  5K29 A;  4AKN A;  2G6Q A;  5FG4 A;  3O34 A;  5H1T A;  2ECV A;  5AD3 A;  2RSD A;  2KFT A;  5E9L A;  5A7C A;  2DAT A;  4LDF A;  4I7C A;  4ZUX U;  5B76 A;  2EOD A;  5C87 A;  2N9G A;  4XUB A;  3HMH A;  4YYH A;  2MJV B;  4NUE A;  4YYM A;  2LDR A;  4XI1 A;  4CUT A;  4LZS A;  4BW3 A;  5DYU A;  1BOR A;  4UIX A;  5HJC A;  4UIU A;  4QSU A;  2ECJ A;  4NXJ A;  2VJE B;  3NG2 A;  4IC2 A;  2KR4 A;  1VD4 A;  1ZKR A;  4TU4 A;  5D25 A;  5FH6 A;  1WEV A;  4A9N A;  2C2L A;  2OO1 A;  2EGP A;  4YAB A;  4Q6F A;  1DCQ A;  4UP0 A;  5EWV A;  5HFQ A;  3LVR E;  4UIY A;  4Q0N A;  2M13 A;  5LUU A;  2Y43 A;  2YQL A;  4O72 A;  1F68 A;  4F3I A;  4AP4 A;  5KO4 A;  5KTX A;  5EK9 A;  5DIN A;  4TT2 A;  5DKH A;  4QQ4 A;  4QSS A;  3KQI A;  2FD4 A;  4N4I A;  3GG3 A;  3LQI A;  3I3J A;  4MEP A;  4YYJ A;  4MEQ A;  5FFY A;  5FER A;  4HBW A;  4NQM A;  4PKL A;  4UIT A;  3DAI A;  2CSV A;  2E6R A;  2M85 A;  3D7C A;  3O37 A;  5HEM A;  5FH7 A;  3MHS A;  1X4J A;  1Z60 A;  4FO9 A;  4UYE A;  2VPG A;  4UYF B;  4N3W A;  5EWD A;  5FG5 A;  5D3R A;  4QC3 A;  4B7Y C;  1EQF A;  1F62 A;  4TTE A;  3LXJ A;  4TZ8 A;  3LQH A;  5EWW A;  3UW9 A;  2OXQ C;  2KE1 A;  2LXH C;  3I2D A;  4NQN A;  5D7X A;  5LVQ A;  2L0B A;  5LKT A;  5DKA A;  4LAD B;  4UYG A;  4J0R A;  5HCL A;  4O7C A;  4HXS A;  4UI9 B;  5HQ7 A;  4NS5 A;  2WP2 A;  1X4U A;  4HBY A;  2KKY A;  4LJN A;  5FE2 A;  4NRC A;  5I7X A;  4J0S A;  2PNX A;  4E96 A;  4LKA A;  4R7E A;  4YYK A;  5KH3 A;  5FB1 A;  2CKL A;  1WIL A;  4YK0 A;  5C11 A;  4NR4 A;  3KV6 A;  1WES A;  2E6S A;  4NRB A;  4UP5 A;  4AKG A;  4YY4 A;  3MQM A;  5CQA A;  5G0F A;  2KYU A;  4NUD A;  4IR4 A;  5CUG A;  2FUU A;  4NRA A;  3RCW A;  5C85 A;  2DKW A;  5JG6 A;  3SVF A;  4HXN A;  2H0D B;  2VJE A;  2JMI A;  3JVL A;  3P1C A;  2DVQ A;  5DYC A;  3UV4 A;  2YVR A;  4AI6 A;  3FL2 A;  5L8U A;  2CRR A;  5DY7 A;  3QZV A;  3QZT A;  5IG6 A;  3JVM A;  5E3D A;  5F25 A;  2DX8 A;  3LJU X;  2F6J A;  5HQ6 A;  2M3H A;  4BHW A;  3RTR B;  4AUQ B;  5ENH A;  4IC3 A;  4F52 B;  1LDK C;  3ZYQ A;  2OSS A;  4LLB A;  2KWK A;  5HRV A;  5CQ5 A;  5D3N A;  2VJF A;  5EA1 A;  5F61 A;  4A9M A;  4GB0 A;  1FBV A;  4L7X A;  3Q1D A;  2DVS A;  4A4B A;  5DKD A;  4YYN A;  3AAD A;  2DVV A;  5H1V A;  5CFW A;  5C8G A;  2G43 A;  2JMJ A;  5KHM A;  4GNF A;  4MEN A;  4QSR A;  4O7B A;  1HYJ A;  4O77 A;  5CP5 A;  3L1X A;  5CQT A;  5FFV A;  2M6M A;  2VPB A;  1WEE A;  4WZ0 A;  5FE0 A;  5CQ7 A;  2L5U A;  5L98 A;  4QSV A;  4UIV A;  5A5Q A;  5IGN A;  4S3O C;  2K4D A;  2F42 A;  3DWY A;  5CPE A;  4O75 A;  4A9H A;  5FE3 A;  4I7D A;  4A9O A;  4QR5 A;  2KWO A;  5EVA A;  2LQ6 A;  2MA6 A;  3MHH A;  3PLW A;  2RR4 A;  4QEU A;  5SVI A;  2RNW A;  2OWA A;  3Q2F A;  4BBQ A;  5AME A;  2KWN A;  4IR3 A;  4QY4 A;  2D9E A;  4HXP A;  2RNX A;  4GPJ A;  4TT4 A;  4XUA A;  2LGK A;  2LGV A;  4ZQL A;  5D1L B;  5IBN A;  4NR9 A;  3VKG A;  2ECW A;  5H85 A;  4X2I A;  2XEU A;  5FE1 A;  5DW2 A;  5E9V A;  5FE8 A;  4N4G A;  2DSM A;  4AKH A;  5DLZ A;  4PCI A;  1K2F A;  1N72 A;  4A9E A;  4OUF A;  1WEO A;  4WHW A;  5EGU A;  2DWW A;  5EPR A;  1U6G B;  4NR8 A;  3JVK A;  4HXL A;  4HXO A;  4RVR A;  5JWM A;  2QJ0 A;  2R0Y A;  2VPD A;  2RO1 A;  2HYE D;  3M99 A;  5ENI A;  2YW5 A;  1VYX A;  4CCG X;  4LZR A;  2DJA A;  3V43 A;  5IGK A;  1FP0 A;  5TAB A;  4CUQ A;  5HRW A;  2JMD A;  3VKH A;  2BAY A;  3MB4 A;  4H9D A;  2M1R A;  2MNZ A;  3S91 A;  3MDB C;  5TDW A;  3ZVZ B;  5C4Q A;  5HRX A;  5D3S A;  5HEN A;  2L5E A;  2YSJ A;  5A85 A;  4QZS A;  4A9K A;  4NR7 A;  3DQV R;  3PUQ A;  4I7B A;  4Z0O A;  5I3L A;  2XOY A;  3O33 A;  5G4R A;  3P1D A;  3KNV A;  4UIZ A;  5KH7 A;  4NR6 A;  5ACY A;  3FM8 C;  2EGM A;  4O71 A;  4LZ2 A;  5TRB A;  2CKL B;  4CUU A;  3ZNI A;  4CA1 A;  3SOU A;  2XOC A;  3FKM X;  5SVI B;  4TU6 A;  3O47 A;  2LSP B;  4AYC B;  5G05 B;  2RFJ A;  5DFB A;  3UV2 A;  4TYL A;  5D24 A;  4LYI A;  4XYA A;  1ZS5 A;  4BW4 A;  4YH4 A;  3ZPV 1;  2XP0 A;  4MR6 A;  2YYN A;  5E73 A;  2R0S A;  2OUO A;  4F1P A;  3H7H A;  4DON A;  3LDY A;  2MD8 C;  4MSX A;  2K17 A;  2MNY A;  1V87 A;  4GND A;  5AIT A;  4LRG A;  1Z2Q A;  4O7A A;  2YQD A;  5DFC A;  5II1 A;  3M63 A;  1ZBD B;  3ZYU A;  5BT4 A;  4HXR A;  5LVR A;  2ZET C;  4UYF A;  5HLS A;  3IU5 A;  2WP1 A;  3FAN A;  5E9K A;  2L7P A;  1X0J A;  4QUU A;  5CQ3 A;  5F2P A;  4QSW A;  5L8T A;  2KGG A;  4MR5 A;  1MBM A;  2EJN A;  1HYI A;  4A9L A;  5CRZ A;  5A81 A;  5EU1 A;  5FBX A;  3DWD A;  3UVX A;  2L84 A;  2JUN A;  4QSQ A;  5EP7 A;  2KRE A;  5DLX A;  4O7F A;  5I40 A;  4BW1 A;  5LJ0 A;  4HXM A;  4O74 A;  5C7N A;  2MT5 A;  5CS8 A;  4WZ3 B;  5F5Z A;  5FEY A;  5E9I A;  4QEV A;  5E9Y A;  2KWJ A;  3U5N A;  4KCX A;  5I7Y A;  2C2V S;  4J1P A;  1XWH A;  2QIZ A;  2L85 A;  2LRI C;  2KIZ A;  2P57 A;  5E7D A;  5KTU A;  3RPG C;  5F63 A;  4PS5 A;  3LQJ A;  3O7A A;  5FFW A;  2YUR A;  4AVX A;  5J0D A;  3IU6 A;  1JOC A;  3QZS A;  4YYG A;  5I83 A;  2I7K A;  4A9I A;  4QNS A;  5E0R A;  4PCE A;  3JVJ A;  2E61 A;  4UYH A;  4HBX A;  4QBM A;  4GNG A;  3G0J A;  3GL6 A;  5A5R A;  5CGP A;  5F1H A;  2VJF B;  3U5L A;  3MUL A;  4B86 C;  2RI7 A;  5CQ6 A;  3O35 A;  5H1U A;  3N9M A;  4C9Z A;  5EV9 A;  5A82 A;  4Z1Q A;  5E9M A;  4HXK A;  2IDA A;  4PPE A;  1RMD A;  2B0O E;  5B77 A;  2DVR A;  3T7L A;  1MM3 A;  3N9Q A;  4CUR A;  2R0V A;  4V3L C;  5B78 A;  1WUG A;  1MM2 A;  5F3A A;  5COI A;  3NXB A;  2IQJ A;  1WEQ A;  5KTW A;  5FB0 A;  5HM0 A;  3UV5 A;  5EPB A;  5I29 A;  5A83 A;  2LV9 A;  2L75 A;  1WFK A;  4X3G A;  4A4C A;  5DFD A;  5I80 A;  1T1H A;  3KDE C;  1E4U A;  1WEU A;  3LVQ E;  4KV4 A;  5EI4 A;  4IR5 A;  4QUT A;  5A5O A;  5FE7 A;  5FH8 A;  4Z6I A;  2ECN A;  4Z0R A;  2YQM A;  5AD2 A;  4PTB A;  4QST A;  5CUB A;  5BT5 A;  2L43 A;  2YSM A;  4WIV A;  4NR5 A;  2PUY A;  3D1B A;  2YUC A;  2GRC A;  5ETD A;  2CON A;  2KTB B;  5CTL A;  3HCS A;  5DX4 A;  5FE4 A;  4NYV A;  2F6N A;  2ECI A;  2RNY A;  4YH3 A;  5L96 A;  2G45 A;  2YU4 A;  3L11 A;  5B79 A;  2I50 A;  2ECG A;  2MUM A;  5SVX A;  3SOX A;  4YYD A;  2YEL A;  2AN6 A;  4QR3 A;  3D1D A;  1CHC A;  4KV1 A;  4YYI A;  5A5S A;  2LGG A;  3HCT A;  5BT3 A;  5TDR A;  5B8D A;  2LN0 A;  3EB6 A;  4CL9 A;  3N9P A;  4Z6H A;  4Z1S A;  5AMF A;  3HME A;  5EWH A;  3IHP A;  5D3T A;  2VNF A;  4YBT A;  5D3P A;  3O36 A;  4CFL A;  4IOQ A;  4YAX A;  5EPS A;  3S92 A;  1WEW A;  1PUO A;  3L1Z B;  4O76 A;  4TKP B;  2KU3 A;  5I89 A;  5G4S A;  3JUE A;  3N9N A;  1VFY A;  4IR6 A;  4AKI A;  4A9J A;  4LC2 A;  4ZC9 A;  3ZPV E;  5DYA A;  5EYA F;  5A5N A;  5L99 A;  2E7O A;  4OGI A;  3VK6 A;  1JM7 A;  5ENB A;  3C5K A;  4YAT A;  4XY9 A;  2YRE A;  5K3Q A;  4ZW1 A;  4YBS A;  5LKX A;  3MUK A;  5ENJ A;  1G25 A;  3ASL A;  5LJ1 A;  4P5O B;  1Z6U A;  2YDW A;  5LKZ A;  4R8P K;  5TBN A;  3HMF A;  4Q0O A;  5G04 B;  3E2D A;  3LJW A;  5I1Q A;  5SVY A;  4QYD A;  2ECT A;  3HCU A;  2MKE A;  2NAA A;  3ZTG A;  4QF3 A;  4C66 A;  5EM3 A;  5D3L A;  4ALH A;  5FG6 A;  3ZVY A;  5D26 A;  4GNE A;  5I88 A;  1JSP B;  2K1J A;  5F62 A;  5ENE A;  4J3I A;  5LCW B;  5CZG A;  4CFK A;  3M62 A;  4NYW A;  2D8S A;  5E74 A;  2YEM A;  5ENF A;  4R2Y A;  3P5O A;  4UIW A;  4UYD A;  5IGL A;  4O64 A;  5ENG A;  2JRJ A;  3UVD A;  4NUC A;  3FJU B;  4MVT A;  5DW1 A;  5EQ1 A;  2MA5 A;  2MIQ A;  4AYC A;  3TLP A;  3UVW A;  2K16 A;  2XB1 A;  1WE9 A;  2I8N A;  4XY8 A;  3SUB A;  4OGC A;  2E3K A;  4MEO A;  5HQ5 A;  2YHN A;  3FAO A;  4Z93 A;  2KKX A;  3SOW A;  4FIP A;  3U5O A;  2YT5 A;  3T9K A;  1E6I A;  3M7K A;  5FE9 A;  5F36 A;  5IGM A;  5EIS A;  3MXF A;  4O78 A;  2L80 A;  2Y1N A;  3N9O A;  3KV5 A;  4W4U A;  5D1K B;  4A0C D;  2LAU A;  4CUS A;  4QEW A;  4OGE A;  2R10 A;  4TT6 A;  4YC9 A;  3U5K A;  4S3O B;  5CU8 A;  3RPG B;  4MR3 A;  2FFW A;  1IYM A;  3DPL R;  4QR4 A;  5CRM A;  3LRQ A;  4LR6 A;  4TS8 A;  3G0L A;  4FLP A;  5F1L A;  1DVP A;  4QC1 A;  1LDJ B;  2CRW A;  2YHO A;  2HDP A;  5HFR A;  2JM3 A;  5LKU A;  5CUC A;  4CLB A;  5ENC A;  1JM7 B;  4YY6 A;  1WGM A;  3K2J A;  5AIU A;  5CQ4 A;  5LJ2 A;  3ONI A;  2D8U A;  1WEN A;  4CUP A;  2VP7 A;  2Y1M A;  1WEM A;  3SHB A;  3PUR A;  4LYW A;  4BW2 A;  2H60 A;  3PHD A;  5DYX A; 
#chains in the Genus database with same CATH homology
 4A9F A;  3GV4 A;  4FK5 A;  3C6W A;  3N9L A;  5D3J A;  4ZDT A;  5DBM A;  4QYL A;  4OGJ A;  4QB3 A;  2NXB A;  4WHU A;  2UZG A;  4QF2 A;  4C67 A;  5EIC A;  5EWC A;  4WZ2 A;  2D82 A;  4NYX A;  5TB6 A;  4MR4 A;  5C13 A;  5D3H A;  2YW8 A;  1X4I A;  5H9M A;  5ETB A;  4LK9 A;  2FSA A;  4BJX A;  3UVY A;  3EB5 A;  4A49 A;  3T6R A;  4NN2 A;  5CY9 A;  4O70 A;  4QSP A;  2KGI A;  2LGL A;  4IOR A;  5F60 A;  5II2 A;  3U5M A;  1JM4 B;  5JI8 A;  2FUI A;  2RS9 B;  4ALG A;  4PY6 A;  4YAD A;  5IID A;  1N87 A;  3P1E A;  2CSZ A;  2VPE A;  1WUM A;  5CQ8 A;  5C89 A;  3U5P A;  4TQN A;  3O70 A;  2EA6 A;  3SVH A;  5DKC A;  2CT2 A;  5A5P A;  5L97 A;  3MB3 A;  4O7E A;  3P1F A;  4N4F A;  4QSX A;  5J3X A;  5I86 A;  5B75 A;  3U5J A;  4WA6 A;  1WIM A;  4V3K C;  4YBM A;  2E7N A;  5KU3 A;  1WEP A;  2LXP C;  3AQA A;  4FJC A;  4LYS A;  5FE5 A;  4HBV A;  5TCM A;  2CSY A;  3HTK C;  4L58 A;  4N4H A;  5FE6 A;  2MD7 B;  5D0C A;  5HEL A;  2YYR A;  5E3G A;  5D1M B;  5CUE A;  2G4A A;  2YEK A;  4Y03 A;  2H0D A;  5KH9 A;  5FDZ A;  4TZ2 A;  3SVG A;  4IOO A;  5CUA A;  2QIC A;  5CUD A;  3Q2E A;  5K29 A;  4AKN A;  2G6Q A;  5FG4 A;  3O34 A;  5H1T A;  2ECV A;  5AD3 A;  2RSD A;  2KFT A;  5E9L A;  5A7C A;  2DAT A;  4LDF A;  4I7C A;  4ZUX U;  5B76 A;  2EOD A;  5C87 A;  2N9G A;  4XUB A;  3HMH A;  4YYH A;  2MJV B;  4NUE A;  4YYM A;  2LDR A;  4XI1 A;  4CUT A;  4LZS A;  4BW3 A;  5DYU A;  1BOR A;  4UIX A;  5HJC A;  4UIU A;  4QSU A;  2ECJ A;  4NXJ A;  2VJE B;  3NG2 A;  4IC2 A;  2KR4 A;  1VD4 A;  4TU4 A;  5D25 A;  5FH6 A;  1WEV A;  4A9N A;  2C2L A;  2OO1 A;  2EGP A;  4YAB A;  4Q6F A;  4UP0 A;  5EWV A;  5HFQ A;  4UIY A;  4Q0N A;  2Y43 A;  5LUU A;  2YQL A;  4O72 A;  1F68 A;  4F3I A;  4AP4 A;  5KO4 A;  5KTX A;  5EK9 A;  5DIN A;  4TT2 A;  5DKH A;  4QSS A;  3KQI A;  4N4I A;  3GG3 A;  3LQI A;  3I3J A;  4MEP A;  4YYJ A;  4MEQ A;  5FFY A;  5FER A;  4HBW A;  4NQM A;  4PKL A;  4UIT A;  3DAI A;  2E6R A;  2M85 A;  3D7C A;  3O37 A;  5HEM A;  5FH7 A;  3MHS A;  1X4J A;  1Z60 A;  4FO9 A;  4UYE A;  2VPG A;  4UYF B;  4N3W A;  5EWD A;  5FG5 A;  5D3R A;  4QC3 A;  4B7Y C;  1EQF A;  1F62 A;  4TTE A;  3LXJ A;  4TZ8 A;  3LQH A;  5EWW A;  3UW9 A;  2OXQ C;  2KE1 A;  2LXH C;  3I2D A;  4NQN A;  5D7X A;  5LVQ A;  2L0B A;  5LKT A;  5DKA A;  4LAD B;  4UYG A;  4J0R A;  5HCL A;  4O7C A;  4HXS A;  4UI9 B;  5HQ7 A;  4NS5 A;  2WP2 A;  1X4U A;  4HBY A;  4LJN A;  5FE2 A;  4NRC A;  5I7X A;  4J0S A;  2PNX A;  4E96 A;  4LKA A;  4R7E A;  4YYK A;  5KH3 A;  5FB1 A;  2CKL A;  1WIL A;  4YK0 A;  5C11 A;  4NR4 A;  3KV6 A;  1WES A;  2E6S A;  4NRB A;  4UP5 A;  4YY4 A;  3MQM A;  5CQA A;  5G0F A;  2KYU A;  4NUD A;  4IR4 A;  5CUG A;  2FUU A;  4NRA A;  3RCW A;  5C85 A;  2DKW A;  5JG6 A;  3SVF A;  4HXN A;  2H0D B;  2VJE A;  2JMI A;  3JVL A;  3P1C A;  2DVQ A;  5DYC A;  3UV4 A;  3FL2 A;  5L8U A;  5DY7 A;  3QZV A;  3QZT A;  5IG6 A;  3JVM A;  5E3D A;  5F25 A;  2DX8 A;  2F6J A;  5HQ6 A;  2M3H A;  4BHW A;  3RTR B;  4AUQ B;  5ENH A;  4IC3 A;  4F52 B;  1LDK C;  3ZYQ A;  2OSS A;  4LLB A;  2KWK A;  5HRV A;  5CQ5 A;  5D3N A;  2VJF A;  5EA1 A;  5F61 A;  4A9M A;  4GB0 A;  1FBV A;  4L7X A;  2DVS A;  4A4B A;  5DKD A;  4YYN A;  3AAD A;  2DVV A;  5H1V A;  5CFW A;  5C8G A;  2G43 A;  2JMJ A;  5KHM A;  4GNF A;  4MEN A;  4QSR A;  4O7B A;  1HYJ A;  4O77 A;  5CP5 A;  3L1X A;  5CQT A;  5FFV A;  2M6M A;  2VPB A;  1WEE A;  4WZ0 A;  5FE0 A;  5CQ7 A;  2L5U A;  5L98 A;  4QSV A;  4UIV A;  5A5Q A;  5IGN A;  4S3O C;  2K4D A;  2F42 A;  3DWY A;  5CPE A;  4O75 A;  4A9H A;  5FE3 A;  4I7D A;  4A9O A;  4QR5 A;  2KWO A;  5EVA A;  2LQ6 A;  2MA6 A;  3MHH A;  4QEU A;  2RNW A;  3Q2F A;  4BBQ A;  5AME A;  2KWN A;  4IR3 A;  4QY4 A;  2D9E A;  4HXP A;  2RNX A;  4GPJ A;  4TT4 A;  4XUA A;  2LGK A;  2LGV A;  4ZQL A;  5D1L B;  5IBN A;  4NR9 A;  2ECW A;  5H85 A;  4X2I A;  2XEU A;  5FE1 A;  5DW2 A;  5E9V A;  5FE8 A;  4N4G A;  5DLZ A;  4PCI A;  1K2F A;  1N72 A;  4A9E A;  4OUF A;  1WEO A;  4WHW A;  5EGU A;  2DWW A;  5EPR A;  1U6G B;  4NR8 A;  3JVK A;  4HXL A;  4HXO A;  4RVR A;  5JWM A;  2QJ0 A;  2R0Y A;  2VPD A;  2RO1 A;  2HYE D;  3M99 A;  5ENI A;  2YW5 A;  1VYX A;  4CCG X;  4LZR A;  3V43 A;  5IGK A;  1FP0 A;  5TAB A;  4CUQ A;  5HRW A;  2JMD A;  2BAY A;  3ZVZ B;  3MB4 A;  2M1R A;  2MNZ A;  3S91 A;  5TDW A;  5C4Q A;  5HRX A;  5D3S A;  5HEN A;  2L5E A;  2YSJ A;  5A85 A;  4QZS A;  4A9K A;  4NR7 A;  3DQV R;  3PUQ A;  4I7B A;  5I3L A;  3O33 A;  5G4R A;  3P1D A;  3KNV A;  4UIZ A;  5KH7 A;  4NR6 A;  5ACY A;  4O71 A;  4LZ2 A;  5TRB A;  2CKL B;  4CUU A;  3ZNI A;  4CA1 A;  3SOU A;  3FKM X;  4TU6 A;  2LSP B;  4AYC B;  5G05 B;  2RFJ A;  5DFB A;  3UV2 A;  4TYL A;  5D24 A;  4LYI A;  4XYA A;  1ZS5 A;  4BW4 A;  4YH4 A;  3ZPV 1;  4MR6 A;  2YYN A;  5E73 A;  2R0S A;  2OUO A;  4DON A;  2MD8 C;  4MSX A;  2K17 A;  2MNY A;  1V87 A;  4GND A;  5AIT A;  4LRG A;  1Z2Q A;  4O7A A;  2YQD A;  5DFC A;  5II1 A;  3M63 A;  1ZBD B;  3ZYU A;  5BT4 A;  4HXR A;  5LVR A;  2ZET C;  4UYF A;  5HLS A;  3IU5 A;  2WP1 A;  5E9K A;  1X0J A;  4QUU A;  5CQ3 A;  5F2P A;  4QSW A;  5L8T A;  2KGG A;  4MR5 A;  1HYI A;  4A9L A;  5CRZ A;  5A81 A;  5EU1 A;  5FBX A;  3UVX A;  2L84 A;  4QSQ A;  5EP7 A;  2KRE A;  5DLX A;  4O7F A;  5I40 A;  4BW1 A;  5LJ0 A;  4HXM A;  4O74 A;  5C7N A;  2MT5 A;  5CS8 A;  4WZ3 B;  5F5Z A;  5FEY A;  5E9I A;  4QEV A;  5E9Y A;  2KWJ A;  3U5N A;  4KCX A;  5I7Y A;  2C2V S;  4J1P A;  1XWH A;  2QIZ A;  2L85 A;  2LRI C;  2KIZ A;  5E7D A;  5KTU A;  3RPG C;  5F63 A;  4PS5 A;  3LQJ A;  3O7A A;  5FFW A;  2YUR A;  4AVX A;  5J0D A;  3IU6 A;  1JOC A;  3QZS A;  4YYG A;  5I83 A;  2I7K A;  4A9I A;  4QNS A;  5E0R A;  4PCE A;  3JVJ A;  4UYH A;  4HBX A;  4QBM A;  4GNG A;  3G0J A;  3GL6 A;  5A5R A;  5CGP A;  5F1H A;  2VJF B;  3U5L A;  3MUL A;  4B86 C;  2RI7 A;  5CQ6 A;  3O35 A;  5H1U A;  3N9M A;  4C9Z A;  5EV9 A;  5A82 A;  4Z1Q A;  5E9M A;  4HXK A;  2IDA A;  4PPE A;  1RMD A;  5B77 A;  2DVR A;  3T7L A;  1MM3 A;  3N9Q A;  4CUR A;  2R0V A;  4V3L C;  5B78 A;  1WUG A;  1MM2 A;  5F3A A;  5COI A;  3NXB A;  1WEQ A;  5KTW A;  5FB0 A;  5HM0 A;  3UV5 A;  5EPB A;  5I29 A;  5A83 A;  2LV9 A;  2L75 A;  1WFK A;  4X3G A;  4A4C A;  5DFD A;  5I80 A;  1T1H A;  1E4U A;  1WEU A;  5EI4 A;  4KV4 A;  4IR5 A;  4QUT A;  5A5O A;  5FE7 A;  5FH8 A;  4Z6I A;  2ECN A;  2YQM A;  5AD2 A;  4PTB A;  4QST A;  5CUB A;  5BT5 A;  2L43 A;  2YSM A;  4WIV A;  4NR5 A;  2PUY A;  2YUC A;  2GRC A;  5ETD A;  2KTB B;  5CTL A;  3HCS A;  5DX4 A;  5FE4 A;  4NYV A;  2F6N A;  2ECI A;  2RNY A;  4YH3 A;  5L96 A;  2G45 A;  2YU4 A;  3L11 A;  5B79 A;  2I50 A;  2ECG A;  2MUM A;  3SOX A;  4YYD A;  2YEL A;  2AN6 A;  4QR3 A;  1CHC A;  5TDR A;  4KV1 A;  4YYI A;  5A5S A;  2LGG A;  3HCT A;  5BT3 A;  5B8D A;  2LN0 A;  3EB6 A;  4CL9 A;  3N9P A;  4Z6H A;  4Z1S A;  5AMF A;  3HME A;  5EWH A;  3IHP A;  5D3T A;  2VNF A;  4YBT A;  5D3P A;  3O36 A;  4CFL A;  4IOQ A;  4YAX A;  5EPS A;  3S92 A;  1WEW A;  3L1Z B;  4TKP B;  4O76 A;  2KU3 A;  5I89 A;  5G4S A;  3N9N A;  1VFY A;  4IR6 A;  4A9J A;  4LC2 A;  4ZC9 A;  3ZPV E;  5DYA A;  5EYA F;  5A5N A;  5L99 A;  2E7O A;  4OGI A;  3VK6 A;  1JM7 A;  5ENB A;  3C5K A;  4YAT A;  4XY9 A;  2YRE A;  4ZW1 A;  4YBS A;  5LKX A;  3MUK A;  5ENJ A;  1G25 A;  3ASL A;  5LJ1 A;  4P5O B;  1Z6U A;  2YDW A;  5LKZ A;  4R8P K;  5TBN A;  3HMF A;  4Q0O A;  5G04 B;  3LJW A;  5I1Q A;  4QYD A;  2ECT A;  3HCU A;  2NAA A;  3ZTG A;  4QF3 A;  4C66 A;  5EM3 A;  5D3L A;  4ALH A;  5FG6 A;  3ZVY A;  5D26 A;  4GNE A;  5I88 A;  1JSP B;  2K1J A;  5F62 A;  5ENE A;  4J3I A;  5LCW B;  5CZG A;  4CFK A;  3M62 A;  4NYW A;  2D8S A;  5E74 A;  2YEM A;  5ENF A;  4R2Y A;  3P5O A;  4UIW A;  4UYD A;  5IGL A;  4O64 A;  5ENG A;  2JRJ A;  3UVD A;  4NUC A;  4MVT A;  5DW1 A;  5EQ1 A;  2MA5 A;  2MIQ A;  4AYC A;  3TLP A;  3UVW A;  2K16 A;  2XB1 A;  1WE9 A;  2I8N A;  4XY8 A;  2E3K A;  4MEO A;  5HQ5 A;  2YHN A;  4Z93 A;  3SOW A;  4FIP A;  3U5O A;  2YT5 A;  1E6I A;  5FE9 A;  5F36 A;  5IGM A;  5EIS A;  3MXF A;  4O78 A;  2L80 A;  2Y1N A;  3N9O A;  3KV5 A;  4W4U A;  5D1K B;  4A0C D;  4CUS A;  4QEW A;  2R10 A;  4TT6 A;  4YC9 A;  3U5K A;  4S3O B;  5CU8 A;  3RPG B;  4MR3 A;  1IYM A;  3DPL R;  4QR4 A;  5CRM A;  3LRQ A;  4LR6 A;  4TS8 A;  3G0L A;  4FLP A;  5F1L A;  1DVP A;  4QC1 A;  1LDJ B;  2YHO A;  2HDP A;  5HFR A;  5LKU A;  5CUC A;  4CLB A;  5ENC A;  1JM7 B;  4YY6 A;  1WGM A;  3K2J A;  5AIU A;  5CQ4 A;  5LJ2 A;  3ONI A;  1WEN A;  4CUP A;  2VP7 A;  2Y1M A;  1WEM A;  3SHB A;  3PUR A;  4LYW A;  4BW2 A;  2H60 A;  3PHD A;  5DYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...