3U5OA

Crystal structure of the complex of trim33 phd-bromo and h3(1-22)k9me3k14ack18ac histone peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
189
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 54
structure length 189
sequence length 205
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5oA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5oA01
3C5KA 4LYWA 5KO4A 3S91A 4V3LC 4HBXA 3T6RA 4HXOA 2L75A 4IR3A 4TZ8A 4UIWA 5FB0A 3ZPVE 4CA1A 4CL9A 5ENHA 5I7XA 5LKUA 3K2JA 4Z1SA 3MXFA 4NRBA 1VYXA 5FG5A 2G4AA 5C8GA 1EQFA 1X4JA 4TZ2A 5CQ5A 4QNSA 4YYHA 4YYKA 3N9NA 4WZ0A 4BW1A 4QSSA 1T1HA 5D3SA 2EGPA 4F52B 5FE4A 4TS8A 2E3KA 5ENEA 5G4SA 2Y43A 5IG6A 2LSPB 5FEYA 4UYFB 5DKHA 1WGMA 5FB1A 2H0DA 4O77A 4PS5A 2QICA 1LDJB 2RNYA 4XUBA 5FE6A 4CUUA 4A4CA 5CQ7A 4WHUA 5FBXA 2MD8C 3U5MA 4BW3A 1ZBDB 2VPGA 4PY6A 4J0SA 4A9FA 4QSXA 4O7AA 4O64A 4NR5A 3MB4A 2R10A 5ENJA 1XWHA 5A7CA 5H9MA 4TU4A 2LXPC 4WHWA 5LVRA 5KTWA 5JG6A 4LR6A 5EVAA 3JVMA 5D3NA 4YYJA 2CT2A 1K2FA 4LJNA 1X0JA 3ONIA 4CFLA 4YYIA 4YYNA 1X4UA 2D9EA 5EP7A 2I8NA 4FLPA 4IOQA 5HRWA 4QEWA 4CUTA 5A5RA 3U5JA 5A85A 2RNWA 5EU1A 4CFKA 4BW2A 3PUQA 1WE9A 2L5UA 3N9QA 2R0VA 3ZYUA 5DYXA 2YQMA 3O34A 2K1JA 2YEKA 3JVLA 5D3JA 5EM3A 2YDWA 2LRIC 2YW5A 4TT4A 5E3GA 4XY9A 4CUQA 4MR4A 2HYED 4GNEA 3GV4A 4IR6A 4BBQA 2DVRA 4NRAA 2L85A 5CZGA 2KR4A 5B77A 5LKZA 5ENGA 5EWDA 2RSDA 3ZNIA 2YURA 4KCXA 5EWWA 5HQ7A 5JI8A 5BT4A 2D82A 4QC3A 5G0FA 1WENA 2YW8A 5HFRA 5HRXA 3UVDA 4CLBA 2OSSA 5DINA 3DWYA 4E96A 3UVXA 3HMFA 5FH6A 3O35A 5BT5A 4YABA 4QSTA 1DVPA 1HYIA 3O70A 4L58A 5F1LA 2FSAA 3VK6A 2IDAA 4QYDA 2XEUA 5DFBA 5AMFA 4HXKA 4A9EA 2JMJA 4QR5A 5CUEA 5EWVA 2YT5A 2K17A 4QSUA 1E6IA 4WZ2A 2H60A 5KU3A 3JVJA 4QR4A 4NUCA 5A81A 2E7NA 1RMDA 4O71A 4PTBA 5HLSA 4O74A 4LRGA 5EGUA 2DVQA 5H1UA 5IGKA 5G04B 3KV5A 3N9MA 4UITA 2ECIA 5FH8A 4B86C 3N9PA 3U5LA 4AKNA 2RI7A 2YHOA 3QZVA 1WFKA 4ZUXU 1WEOA 4IC2A 3MB3A 4UIXA 5FE1A 4HXLA 5FE8A 4ZW1A 4N4FA 3GL6A 2L0BA 4NXJA 4LADB 4UIZA 3NXBA 4QB3A 4O75A 5E0RA 4MEPA 4QR3A 4BW4A 5I83A 2F42A 5F63A 2KU3A 5D0CA 3HCUA 5EQ1A 4QUTA 5ENFA 5ACYA 2OUOA 4YY6A 1JSPB 5CY9A 5C4QA 5CP5A 2KGGA 2M6MA 5D1LB 5AMEA 3N9LA 5E9YA 1Z2QA 2MNYA 4A9IA 2VPBA 4BJXA 2EODA 4NN2A 2KYUA 2AN6A 3L11A 4GNGA 5FE0A 2VPEA 5D3LA 4J1PA 2E7OA 2D8SA 4IOOA 4Z93A 5I1QA 3LXJA 4Y03A 2E6SA 1WEMA 4QSWA 5CRMA 4NQNA 5ENIA 2C2VS 4YADA 5J3XA 5I80A 2CKLA 4XI1A 5E9MA 2H0DB 2KREA 5A5NA 3D7CA 2YELA 3IU6A 5E73A 3L1ZB 2LGVA 2KGIA 4QF3A 1JM4B 4IORA 4QSQA 1IYMA 2LGGA 3V43A 5D24A 5FFWA 4TTEA 4Z6HA 1WEVA 3GG3A 4HXNA 2ECNA 4QYLA 2NXBA 1MM2A 4MENA 4FK5A 2LV9A 2JMDA 2RO1A 2ECVA 4RVRA 3JVKA 5FG6A 4LC2A 5LVQA 5CQ4A 3G0JA 5DYAA 4N4IA 4A9JA 3KQIA 5DYCA 3MHHA 5CQ6A 4NYVA 2L80A 3AQAA 2VNFA 4YATA 2L43A 5DKDA 4UYFA 2PNXA 2KWJA 3KNVA 2KIZA 5ETBA 5CQ3A 1WIMA 5CQ8A 5LJ0A 2UZGA 5F3AA 5CFWA 5DFDA 3RPGC 5HENA 5L98A 2DATA 4MEOA 1N87A 5EPBA 3HCTA 5B79A 1F62A 2RFJA 4XY8A 5DLZA 2LGKA 4YH3A 4NYWA 2ECJA 4WA6A 4A9KA 4S3OC 3S92A 4UYGA 3U5OA 4LK9A 3SHBA 1WEWA 4MSXA 4MVTA 3MULA 4AVXA 5L8TA 2BAYA 1WEQA 1Z6UA 5F61A 4HXPA 3LJWA 4QC1A 4NUEA 4A9MA 4IR5A 5LJ1A 5DKAA 5EPRA 4N4HA 4QEVA 5CUCA 1CHCA 2QJ0A 5E9LA 4O7CA 2VJEA 2RS9B 5IBNA 5I86A 2KTBB 5C13A 5D3RA 4YAXA 4UI9B 2YYNA 5EYAF 1WEUA 5EA1A 5L97A 5TBNA 3P1DA 5F2PA 3O33A 4LZSA 4R7EA 4NUDA 1BORA 4FO9A 1WUMA 3PHDA 4QSVA 4TT6A 5F5ZA 5HJCA 4R2YA 5CUAA 5EK9A 4LKAA 5E9VA 5L8UA 5HQ5A 4YYDA 2DX8A 5KHMA 4AP4A 4QY4A 4QSRA 2KWOA 4AYCA 3M99A 4V3KC 3SVGA 4YYMA 5D26A 5EV9A 3MHSA 3N9OA 4YYGA 1WUGA 2FUIA 2RNXA 5CU8A 5F25A 3Q2FA 4O7FA 2KWKA 2K4DA 2E6RA 4S3OB 3TLPA 2EA6A 2YHNA 3IU5A 3O36A 5DYUA 4NR8A 3U5KA 5HFQA 3M62A 5A5QA 3UV5A 2ECWA 4HXMA 1JM7A 1F68A 4NS5A 3ZYQA 4YH4A 4A9HA 4Z1QA 5DY7A 5C89A 4QZSA 5F62A 3I2DA 3ZTGA 5I7YA 5C85A 5AD3A 3DQVR 4BHWA 5ETDA 2MUMA 1FP0A 5TABA 2VJFB 4UYDA 3SVHA 2JRJA 4FJCA 4O76A 2DVSA 3P1EA 5IIDA 3P5OA 3UV2A 4C66A 2MD7B 4YBMA 2OO1A 2FUUA 4AUQB 4UP5A 3HCSA 5KH9A 5TDWA 4KV1A 1G25A 3O37A 5DW1A 5G05B 5II1A 2CSZA 4MR5A 3MQMA 5FFVA 4LYIA 1V87A 4OUFA 5DX4A 5E9KA 2M1RA 5DFCA 5I88A 2Y1NA 4PCEA 4UIYA 2YSJA 4GNFA 4QF2A 4HBYA 1HYJA 4QSPA 2CSYA 5COIA 3L1XA 5KH7A 4TKPB 5AD2A 4LZ2A 2ECTA 5FE3A 1VFYA 3NG2A 3G0LA 5C7NA 4L7XA 5CUBA 1JOCA 4UYEA 5D3HA 4A9LA 3M63A 2R0YA 4O70A 5EICA 2WP2A 5A5PA 5DBMA 4NR9A 4O7BA 4X3GA 5KTXA 4A4BA 5ENBA 2VPDA 3SOWA 4LLBA 4I7DA 3EB6A 5C87A 4QUUA 1VD4A 4LYSA 5DW2A 5F60A 5D25A 4YK0A 4PPEA 5EWCA 2CKLB 4ALHA 5CS8A 4A0CD 3EB5A 4LDFA 4O7EA 3ZVYA 4P5OB 4R8PK 4J3IA 5H85A 2I7KA 4A9OA 2JMIA 3RTRB 3HMEA 2F6JA 5AIUA 4MR6A 4GPJA 4O72A 4HXRA 2YSMA 5EI4A 5A5OA 2KFTA 2DKWA 2YQLA 4KV4A 5H1VA 2XB1A 3LQHA 3RCWA 5FE7A 2LGLA 2PUYA 5I40A 3ZVZB 3SOXA 3KV6A 4NQMA 5FDZA 4CURA 2ZETC 5A5SA 4YC9A 4Q0OA 5E74A 2ECGA 2K16A 4B7YC 5CQAA 2DWWA 2LXHC 2YYRA 4MEQA 4MR3A 3QZTA 4ZQLA 2KWNA 2NAAA 5F1HA 1JM7B 3C6WA 5HM0A 2YREA 5FE5A 4UIVA 4A9NA 4HBVA 4FIPA 4Q6FA 4NR6A 5D3TA 5E9IA 4CUSA 5KH3A 5BT3A 4Z6IA 3UW9A 2LQ6A 5CQTA 3LRQA 3UVWA 3T7LA 4NR7A 3SOUA 2VJFA 5I89A 1ZS5A 4PCIA 4XYAA 5B75A 5HRVA 5LKTA 5E3DA 5IGNA 3QZSA 3DPLR 4TQNA 2M85A 5TCMA 4AYCB 5FE9A 4C9ZA 5HCLA 5AITA 3O7AA 2YEMA 3MUKA 4TU6A 4A49A 5ENCA 5G4RA 4NRCA 5HQ6A 2G6QA 5KTUA 4HBWA 2YQDA 2M3HA 4IR4A 1WILA 2LN0A 3PURA 5F36A 1N72A 4ZDTA 5LUUA 4UYHA 4IC3A 3I3JA 3IHPA 5EPSA 3HMHA 3LQJA 2VJEB 3UV4A 3FL2A 4N4GA 3U5PA 1X4IA 2MA5A 5II2A 4O78A 2G45A 4DONA 2WP1A 5CUDA 5C11A 2LDRA 5L96A 5I3LA 4GB0A 4GNDA 5D3PA 2G43A 1MM3A 4HXSA 2MA6A 3AADA 4WIVA 1U6GB 2KE1A 4N3WA 4WZ3B 3RPGB 4I7CA 4NR4A 3UVYA 4CCGX 2QIZA 3U5NA 2HDPA 4QEUA 5LCWB 5FG4A 4X2IA 5CRZA 4NYXA 5LJ2A 5CUGA 5FE2A 5B76A 5CTLA 2I50A 2VP7A 4UP0A 2DVVA 4ALGA 3DAIA 5EISA 2MIQA 4Q0NA 4UIUA 4YBTA 2F6NA 1Z60A 5D1MB 5TDRA 4CUPA 4F3IA 5D1KB 4C67A 4YBSA 5HEMA 1WESA 1LDKC 5HELA 5LKXA 5DKCA 5FFYA 1WEPA 4QBMA 2L5EA 2MJVB 4OGIA 5JWMA 5IGMA 2MT5A 4YY4A 2Y1MA 4TT2A 5B78A 4W4UA 5EWHA 5J0DA 5K29A 4LZRA 5B8DA 2R0SA 4J0RA 2L84A 4XUAA 5E7DA 3P1FA 4PKLA 2GRCA 2MNZA 2OXQC 5FH7A 5D7XA 2YU4A 5H1TA 3ZPV1 4OGJA 3P1CA 5IGLA 2C2LA 1E4UA 3HTKC 3SVFA 5CPEA 5TRBA 2N9GA 5A82A 5TB6A 5L99A 5I29A 3LQIA 2YUCA 5CGPA 4ZC9A 3ASLA 3FKMX 1FBVA 4I7BA 5FERA 3Q2EA 1WEEA 4TYLA 5DLXA 5A83A
chains in the Genus database with same CATH superfamily
3C5KA 4LYWA 5KO4A 3S91A 4V3LC 4HBXA 3T6RA 2JUNA 4HXOA 2L75A 4IR3A 4TZ8A 4UIWA 5FB0A 3VKGA 5SVYA 3ZPVE 4CA1A 4CL9A 5ENHA 5I7XA 5LKUA 3K2JA 4Z1SA 3MXFA 4AKHA 4NRBA 1VYXA 5FG5A 5K3QA 2G4AA 5C8GA 1EQFA 1X4JA 4TZ2A 5CQ5A 4QNSA 4YYHA 4YYKA 3N9NA 4WZ0A 4BW1A 4QSSA 1T1HA 5D3SA 2EGPA 4H9DA 4F52B 5FE4A 4TS8A 2E3KA 5ENEA 5G4SA 2Y43A 5IG6A 2LSPB 3FEHA 5FEYA 4UYFB 2M13A 5DKHA 1WGMA 5FB1A 2H0DA 4O77A 4PS5A 2QICA 1LDJB 2RNYA 4XUBA 5FE6A 4CUUA 4A4CA 5CQ7A 4WHUA 5FBXA 2MD8C 3U5MA 4BW3A 1ZBDB 2VPGA 4PY6A 4J0SA 4A9FA 4QSXA 4O7AA 4O64A 4NR5A 3MB4A 2R10A 5ENJA 1XWHA 5A7CA 5H9MA 4TU4A 2LXPC 4WHWA 5LVRA 5KTWA 5JG6A 4LR6A 3T9KA 5EVAA 3JVMA 5D3NA 4YYJA 2CT2A 1K2FA 4LJNA 1X0JA 5SVIA 3ONIA 4CFLA 4YYIA 4YYNA 1X4UA 2D9EA 5EP7A 2I8NA 4FLPA 4IOQA 5HRWA 4QEWA 4CUTA 5A5RA 3U5JA 2KKYA 5A85A 3LVRE 2RNWA 5EU1A 4CFKA 5SVXA 4BW2A 3PUQA 1WE9A 2L5UA 3N9QA 2R0VA 3ZYUA 5DYXA 2YQMA 3O34A 2K1JA 2YEKA 3JVLA 5D3JA 5EM3A 2YDWA 2LRIC 2YW5A 4TT4A 5E3GA 4XY9A 4CUQA 4MR4A 2HYED 4GNEA 3GV4A 4IR6A 4BBQA 2DVRA 4NRAA 2L85A 5CZGA 2KR4A 3FANA 5B77A 5LKZA 5ENGA 5EWDA 2CONA 2RSDA 3FM8C 3ZNIA 2YURA 4KCXA 5EWWA 5HQ7A 5JI8A 5BT4A 2D82A 4QC3A 5G0FA 1WENA 2YW8A 5HFRA 5HRXA 3UVDA 4CLBA 2OSSA 3FJUB 5DINA 3DWYA 4E96A 3UVXA 3HMFA 5FH6A 2MKEA 3O35A 5BT5A 4YABA 4QSTA 1DVPA 1HYIA 3O70A 4L58A 5F1LA 2FSAA 3VK6A 2IDAA 4QYDA 2XEUA 5DFBA 5AMFA 2CSVA 2JM3A 4HXKA 4A9EA 2JMJA 4QR5A 5CUEA 5EWVA 2YT5A 2K17A 4QSUA 1E6IA 4WZ2A 3ERRA 2H60A 5KU3A 3JVJA 4QR4A 4NUCA 5A81A 2E7NA 1RMDA 2CRRA 2KKXA 3O47A 3D1DA 4O71A 4PTBA 5HLSA 4O74A 4LRGA 5EGUA 2DVQA 5H1UA 5IGKA 5G04B 3KV5A 3N9MA 4UITA 2ECIA 5FH8A 4B86C 3N9PA 1MBMA 3U5LA 4AKNA 2RI7A 3KDEC 2YHOA 2XOZA 3QZVA 1WFKA 4ZUXU 1WEOA 3LVQE 4IC2A 3MB3A 4UIXA 5FE1A 4HXLA 5FE8A 4ZW1A 4N4FA 3GL6A 2L0BA 4NXJA 4LADB 4UIZA 3NXBA 4QB3A 4O75A 5E0RA 4MEPA 4QR3A 4BW4A 5I83A 2F42A 5F63A 2KU3A 5D0CA 3HCUA 5EQ1A 4QUTA 5ENFA 5ACYA 2OUOA 4YY6A 1JSPB 5CY9A 5C4QA 5CP5A 2KGGA 2M6MA 5D1LB 5AMEA 3N9LA 5E9YA 1Z2QA 2MNYA 4A9IA 2VPBA 4BJXA 2EODA 4NN2A 2KYUA 2AN6A 3L11A 4GNGA 5FE0A 2VPEA 5D3LA 4J1PA 2E7OA 2D8SA 4IOOA 4Z93A 5I1QA 3LXJA 4Y03A 2E6SA 1WEMA 4QSWA 5CRMA 4NQNA 5ENIA 2C2VS 4YADA 5J3XA 5I80A 2CKLA 4XI1A 5E9MA 2H0DB 2KREA 5A5NA 3D7CA 2YELA 3IU6A 5E73A 3L1ZB 2LGVA 2KGIA 4QF3A 1JM4B 4IORA 4QSQA 1IYMA 2LGGA 3V43A 5D24A 5FFWA 4TTEA 4Z6HA 1WEVA 3GG3A 4HXNA 2ECNA 4QYLA 2NXBA 3Q1DA 1MM2A 4MENA 4FK5A 2LV9A 2JMDA 2RO1A 2ECVA 4RVRA 3JVKA 5FG6A 4LC2A 5LVQA 5CQ4A 3G0JA 5DYAA 4N4IA 4A9JA 3KQIA 5DYCA 3MHHA 5CQ6A 4NYVA 2L80A 2EJNA 3AQAA 2VNFA 4YATA 2L43A 5DKDA 4UYFA 2PNXA 2KWJA 3KNVA 2KIZA 5ETBA 5CQ3A 1WIMA 5CQ8A 5LJ0A 2UZGA 5F3AA 5CFWA 5DFDA 3RPGC 5HENA 5L98A 2DATA 4MEOA 1N87A 5EPBA 3HCTA 5B79A 1F62A 2RFJA 4XY8A 5DLZA 2LGKA 4YH3A 4NYWA 2ECJA 4WA6A 4A9KA 4S3OC 3S92A 4UYGA 3U5OA 4LK9A 3SHBA 1WEWA 4MSXA 4MVTA 3MULA 4AVXA 5L8TA 2BAYA 1WEQA 1Z6UA 3DDTA 5F61A 4HXPA 3LJWA 4QC1A 4NUEA 4A9MA 4IR5A 5SVIB 5LJ1A 5DKAA 5EPRA 4N4HA 4QEVA 5CUCA 1CHCA 2QJ0A 5E9LA 4O7CA 2VJEA 2RS9B 5IBNA 5I86A 2KTBB 5C13A 3LDYA 5D3RA 4YAXA 4UI9B 2YYNA 5EYAF 1WEUA 5EA1A 5L97A 5TBNA 3P1DA 2FD4A 5F2PA 3O33A 4LZSA 4Z0OA 4R7EA 4NUDA 1BORA 4FO9A 1WUMA 3PHDA 4QSVA 4TT6A 5F5ZA 5HJCA 4R2YA 5CUAA 5EK9A 4LKAA 5E9VA 4F1PA 5L8UA 5HQ5A 4YYDA 2DX8A 5KHMA 4AP4A 4QY4A 4QSRA 2KWOA 4AYCA 3M99A 4V3KC 3SVGA 4YYMA 5D26A 5EV9A 2L7PA 3MHSA 3N9OA 4YYGA 2LAUA 1WUGA 2FUIA 2RNXA 5CU8A 5F25A 3Q2FA 4O7FA 2KWKA 2K4DA 2E6RA 4S3OB 3TLPA 3DWDA 2EA6A 2YHNA 3IU5A 2EXUA 3O36A 5DYUA 4NR8A 3U5KA 5HFQA 3M62A 5A5QA 3UV5A 2ECWA 4HXMA 1JM7A 1F68A 4NS5A 3ZYQA 4YH4A 4A9HA 4Z1QA 5DY7A 5C89A 4QZSA 5F62A 3I2DA 3ZTGA 5I7YA 4AKIA 5C85A 5AD3A 3DQVR 4BHWA 5ETDA 2MUMA 1FP0A 5TABA 2VJFB 4UYDA 3SVHA 2JRJA 2DSMA 4FJCA 4O76A 2DVSA 3P1EA 5IIDA 3P5OA 3UV2A 4C66A 2MD7B 4YBMA 2OO1A 2FUUA 4AUQB 4UP5A 3HCSA 5KH9A 5TDWA 4KV1A 1G25A 3O37A 2CRWA 5DW1A 5G05B 5II1A 2CSZA 4MR5A 3MQMA 5FFVA 4LYIA 1V87A 4OUFA 5DX4A 5E9KA 2D8UA 5DFCA 5I88A 2M1RA 4PCEA 4UIYA 2Y1NA 2YSJA 4GNFA 4HBYA 4QF2A 1HYJA 4QSPA 2CSYA 5COIA 3L1XA 4OGCA 5KH7A 4TKPB 4OGEA 5AD2A 4LZ2A 2ECTA 5FE3A 1ZKRA 1VFYA 3NG2A 3G0LA 5C7NA 4L7XA 5CUBA 1JOCA 4UYEA 2OWAA 2XOCA 5D3HA 4A9LA 3M63A 2R0YA 4O70A 2WP2A 5EICA 5A5PA 5DBMA 4NR9A 4O7BA 4X3GA 5KTXA 4A4BA 5ENBA 2VPDA 2E61A 3JUEA 4LLBA 4I7DA 3EB6A 5C87A 3SOWA 4QUUA 1VD4A 4LYSA 5DW2A 5F60A 5D25A 4YK0A 4PPEA 5EWCA 2CKLB 4ALHA 5CS8A 4A0CD 3EB5A 4LDFA 4O7EA 3ZVYA 4P5OB 4R8PK 4J3IA 5H85A 2I7KA 4A9OA 2JMIA 3RTRB 3HMEA 2F6JA 5AIUA 4MR6A 4GPJA 4O72A 4HXRA 2YSMA 5EI4A 5A5OA 2KFTA 2DKWA 2YQLA 4KV4A 5H1VA 2XB1A 2EGMA 3LQHA 3RCWA 5FE7A 3MDBC 2LGLA 2PUYA 5I40A 3ZVZB 3SOXA 4O62A 3KV6A 4NQMA 5FDZA 4CURA 2ZETC 5A5SA 4YC9A 2XOYA 4Q0OA 5E74A 2ECGA 2K16A 3PLWA 5CQAA 4B7YC 2DWWA 2LXHC 2YYRA 4QQ4A 4MEQA 4MR3A 3QZTA 4ZQLA 2KWNA 2NAAA 5F1HA 3E2DA 1JM7B 3FAOA 3C6WA 5HM0A 2YREA 3LJUX 5FE5A 4UIVA 4A9NA 4AKGA 4HBVA 4FIPA 4Q6FA 4NR6A 5D3TA 5E9IA 4CUSA 5KH3A 5BT3A 4Z6IA 3UW9A 2LQ6A 5CQTA 2P57A 3LRQA 3UVWA 3T7LA 4NR7A 3SOUA 2VJFA 5I89A 1ZS5A 4PCIA 4XYAA 5B75A 5HRVA 5LKTA 5E3DA 5IGNA 3QZSA 3DPLR 4TQNA 2M85A 5TCMA 4AYCB 5FE9A 4C9ZA 5HCLA 5AITA 3O7AA 2YEMA 3MUKA 4TU6A 4A49A 5ENCA 3SUBA 5G4RA 4NRCA 5HQ6A 2G6QA 5KTUA 4HBWA 2YQDA 2M3HA 4IR4A 3D1BA 1WILA 2LN0A 3PURA 4Z0RA 3M7KA 5F36A 1N72A 4ZDTA 5LUUA 4UYHA 3H7HA 4IC3A 3I3JA 3IHPA 5EPSA 3HMHA 3LQJA 2VJEB 3UV4A 3FL2A 4N4GA 3VKHA 3U5PA 1X4IA 2MA5A 1DCQA 5II2A 4O78A 2G45A 4DONA 2WP1A 5CUDA 5C11A 2LDRA 5L96A 5I3LA 4GB0A 4GNDA 5D3PA 2G43A 1MM3A 4HXSA 2MA6A 3AADA 4WIVA 1U6GB 2KE1A 4N3WA 4WZ3B 3RPGB 2YVRA 4I7CA 4NR4A 3UVYA 4CCGX 2QIZA 3U5NA 2HDPA 4QEUA 2IQJA 5FG4A 4X2IA 5CRZA 5LCWB 4NYXA 5LJ2A 5CUGA 5FE2A 5B76A 5CTLA 2I50A 2VP7A 4UP0A 2DVVA 4ALGA 3DAIA 5EISA 2MIQA 4Q0NA 4UIUA 4YBTA 1PUOA 2F6NA 1Z60A 5D1MB 5TDRA 4CUPA 4F3IA 2RR4A 4C67A 4YBSA 5HEMA 5D1KB 2B0OE 1WESA 1LDKC 5HELA 5LKXA 5DKCA 5FFYA 1WEPA 4QBMA 2L5EA 2MJVB 4OGIA 5JWMA 5IGMA 2MT5A 4YY4A 2Y1MA 4TT2A 5B78A 4W4UA 5EWHA 5J0DA 5K29A 4LZRA 2XP0A 5B8DA 2R0SA 4J0RA 2L84A 4XUAA 2FFWA 5E7DA 3P1FA 4PKLA 2GRCA 2MNZA 2OXQC 5FH7A 5D7XA 2YU4A 5H1TA 3ZPV1 4OGJA 3P1CA 5IGLA 2C2LA 1E4UA 3HTKC 3SVFA 5CPEA 5TRBA 2N9GA 5A82A 5TB6A 5L99A 5I29A 2DJAA 3LQIA 2YUCA 5CGPA 4ZC9A 3ASLA 3FKMX 1FBVA 4AI6A 4I7BA 5FERA 3Q2EA 1WEEA 4TYLA 5DLXA 5A83A
chains in the Genus database with same CATH topology
3C5KA 4LYWA 5KO4A 3S91A 4V3LC 4HBXA 3T6RA 4HXOA 2L75A 4IR3A 4TZ8A 4UIWA 5FB0A 3ZPVE 4CA1A 4CL9A 5ENHA 5I7XA 5LKUA 3K2JA 4Z1SA 3MXFA 4NRBA 1VYXA 5FG5A 2G4AA 5C8GA 1EQFA 1X4JA 4TZ2A 5CQ5A 4QNSA 4YYHA 4YYKA 3N9NA 4WZ0A 4BW1A 4QSSA 1T1HA 5D3SA 2EGPA 4F52B 5FE4A 4TS8A 2E3KA 5ENEA 5G4SA 2Y43A 5IG6A 2LSPB 5FEYA 4UYFB 5DKHA 1WGMA 5FB1A 2H0DA 4O77A 4PS5A 2QICA 1LDJB 2RNYA 4XUBA 5FE6A 4CUUA 4A4CA 5CQ7A 4WHUA 5FBXA 2MD8C 3U5MA 4BW3A 1ZBDB 2VPGA 4PY6A 4J0SA 4A9FA 4QSXA 4O7AA 4O64A 4NR5A 3MB4A 2R10A 5ENJA 1XWHA 5A7CA 5H9MA 4TU4A 2LXPC 4WHWA 5LVRA 5KTWA 5JG6A 4LR6A 5EVAA 3JVMA 5D3NA 4YYJA 2CT2A 1K2FA 4LJNA 1X0JA 3ONIA 4CFLA 4YYIA 4YYNA 1X4UA 2D9EA 5EP7A 2I8NA 4FLPA 4IOQA 5HRWA 4QEWA 4CUTA 5A5RA 3U5JA 5A85A 2RNWA 5EU1A 4CFKA 4BW2A 3PUQA 1WE9A 2L5UA 3N9QA 2R0VA 3ZYUA 5DYXA 2YQMA 3O34A 2K1JA 2YEKA 3JVLA 5D3JA 5EM3A 2YDWA 2LRIC 2YW5A 4TT4A 5E3GA 4XY9A 4CUQA 4MR4A 2HYED 4GNEA 3GV4A 4IR6A 4BBQA 2DVRA 4NRAA 2L85A 5CZGA 2KR4A 5B77A 5LKZA 5ENGA 5EWDA 2RSDA 3ZNIA 2YURA 4KCXA 5EWWA 5HQ7A 5JI8A 5BT4A 2D82A 4QC3A 5G0FA 1WENA 2YW8A 5HFRA 5HRXA 3UVDA 4CLBA 2OSSA 5DINA 3DWYA 4E96A 3UVXA 3HMFA 5FH6A 3O35A 5BT5A 4YABA 4QSTA 1DVPA 1HYIA 3O70A 4L58A 5F1LA 2FSAA 3VK6A 2IDAA 4QYDA 2XEUA 5DFBA 5AMFA 4HXKA 4A9EA 2JMJA 4QR5A 5CUEA 5EWVA 2YT5A 2K17A 4QSUA 1E6IA 4WZ2A 2H60A 5KU3A 3JVJA 4QR4A 4NUCA 5A81A 2E7NA 1RMDA 4O71A 4PTBA 5HLSA 4O74A 4LRGA 5EGUA 2DVQA 5H1UA 5IGKA 5G04B 3KV5A 3N9MA 4UITA 2ECIA 5FH8A 4B86C 3N9PA 3U5LA 4AKNA 2RI7A 2YHOA 3QZVA 1WFKA 4ZUXU 1WEOA 4IC2A 3MB3A 4UIXA 5FE1A 4HXLA 5FE8A 4ZW1A 4N4FA 3GL6A 2L0BA 4NXJA 4LADB 4UIZA 3NXBA 4QB3A 4O75A 5E0RA 4MEPA 4QR3A 4BW4A 5I83A 2F42A 5F63A 2KU3A 5D0CA 3HCUA 5EQ1A 4QUTA 5ENFA 5ACYA 2OUOA 4YY6A 1JSPB 5CY9A 5C4QA 5CP5A 2KGGA 2M6MA 5D1LB 5AMEA 3N9LA 5E9YA 1Z2QA 2MNYA 4A9IA 2VPBA 4BJXA 2EODA 4NN2A 2KYUA 2AN6A 3L11A 4GNGA 5FE0A 2VPEA 5D3LA 4J1PA 2E7OA 2D8SA 4IOOA 4Z93A 5I1QA 3LXJA 4Y03A 2E6SA 1WEMA 4QSWA 5CRMA 4NQNA 5ENIA 2C2VS 4YADA 5J3XA 5I80A 2CKLA 4XI1A 5E9MA 2H0DB 2KREA 5A5NA 3D7CA 2YELA 3IU6A 5E73A 3L1ZB 2LGVA 2KGIA 4QF3A 1JM4B 4IORA 4QSQA 1IYMA 2LGGA 3V43A 5D24A 5FFWA 4TTEA 4Z6HA 1WEVA 3GG3A 4HXNA 2ECNA 4QYLA 2NXBA 1MM2A 4MENA 4FK5A 2LV9A 2JMDA 2RO1A 2ECVA 4RVRA 3JVKA 5FG6A 4LC2A 5LVQA 5CQ4A 3G0JA 5DYAA 4N4IA 4A9JA 3KQIA 5DYCA 3MHHA 5CQ6A 4NYVA 2L80A 3AQAA 2VNFA 4YATA 2L43A 5DKDA 4UYFA 2PNXA 2KWJA 3KNVA 2KIZA 5ETBA 5CQ3A 1WIMA 5CQ8A 5LJ0A 2UZGA 5F3AA 5CFWA 5DFDA 3RPGC 5HENA 5L98A 2DATA 4MEOA 1N87A 5EPBA 3HCTA 5B79A 1F62A 2RFJA 4XY8A 5DLZA 2LGKA 4YH3A 4NYWA 2ECJA 4WA6A 4A9KA 4S3OC 3S92A 4UYGA 3U5OA 4LK9A 3SHBA 1WEWA 4MSXA 4MVTA 3MULA 4AVXA 5L8TA 2BAYA 1WEQA 1Z6UA 5F61A 4HXPA 3LJWA 4QC1A 4NUEA 4A9MA 4IR5A 5LJ1A 5DKAA 5EPRA 4N4HA 4QEVA 5CUCA 1CHCA 2QJ0A 5E9LA 4O7CA 2VJEA 2RS9B 5IBNA 5I86A 2KTBB 5C13A 5D3RA 4YAXA 4UI9B 2YYNA 5EYAF 1WEUA 5EA1A 5L97A 5TBNA 3P1DA 5F2PA 3O33A 4LZSA 4R7EA 4NUDA 1BORA 4FO9A 1WUMA 3PHDA 4QSVA 4TT6A 5F5ZA 5HJCA 4R2YA 5CUAA 5EK9A 4LKAA 5E9VA 5L8UA 5HQ5A 4YYDA 2DX8A 5KHMA 4AP4A 4QY4A 4QSRA 2KWOA 4AYCA 3M99A 4V3KC 3SVGA 4YYMA 5D26A 5EV9A 3MHSA 3N9OA 4YYGA 1WUGA 2FUIA 2RNXA 5CU8A 5F25A 3Q2FA 4O7FA 2KWKA 2K4DA 2E6RA 4S3OB 3TLPA 2EA6A 2YHNA 3IU5A 3O36A 5DYUA 4NR8A 3U5KA 5HFQA 3M62A 5A5QA 3UV5A 2ECWA 4HXMA 1JM7A 1F68A 4NS5A 3ZYQA 4YH4A 4A9HA 4Z1QA 5DY7A 5C89A 4QZSA 5F62A 3I2DA 3ZTGA 5I7YA 5C85A 5AD3A 3DQVR 4BHWA 5ETDA 2MUMA 1FP0A 5TABA 2VJFB 4UYDA 3SVHA 2JRJA 4FJCA 4O76A 2DVSA 3P1EA 5IIDA 3P5OA 3UV2A 4C66A 2MD7B 4YBMA 2OO1A 2FUUA 4AUQB 4UP5A 3HCSA 5KH9A 5TDWA 4KV1A 1G25A 3O37A 5DW1A 5G05B 5II1A 2CSZA 4MR5A 3MQMA 5FFVA 4LYIA 1V87A 4OUFA 5DX4A 5E9KA 2M1RA 5DFCA 5I88A 2Y1NA 4PCEA 4UIYA 2YSJA 4GNFA 4QF2A 4HBYA 1HYJA 4QSPA 2CSYA 5COIA 3L1XA 5KH7A 4TKPB 5AD2A 4LZ2A 2ECTA 5FE3A 1VFYA 3NG2A 3G0LA 5C7NA 4L7XA 5CUBA 1JOCA 4UYEA 5D3HA 4A9LA 3M63A 2R0YA 4O70A 5EICA 2WP2A 5A5PA 5DBMA 4NR9A 4O7BA 4X3GA 5KTXA 4A4BA 5ENBA 2VPDA 3SOWA 4LLBA 4I7DA 3EB6A 5C87A 4QUUA 1VD4A 4LYSA 5DW2A 5F60A 5D25A 4YK0A 4PPEA 5EWCA 2CKLB 4ALHA 5CS8A 4A0CD 3EB5A 4LDFA 4O7EA 3ZVYA 4P5OB 4R8PK 4J3IA 5H85A 2I7KA 4A9OA 2JMIA 3RTRB 3HMEA 2F6JA 5AIUA 4MR6A 4GPJA 4O72A 4HXRA 2YSMA 5EI4A 5A5OA 2KFTA 2DKWA 2YQLA 4KV4A 5H1VA 2XB1A 3LQHA 3RCWA 5FE7A 2LGLA 2PUYA 5I40A 3ZVZB 3SOXA 3KV6A 4NQMA 5FDZA 4CURA 2ZETC 5A5SA 4YC9A 4Q0OA 5E74A 2ECGA 2K16A 4B7YC 5CQAA 2DWWA 2LXHC 2YYRA 4MEQA 4MR3A 3QZTA 4ZQLA 2KWNA 2NAAA 5F1HA 1JM7B 3C6WA 5HM0A 2YREA 5FE5A 4UIVA 4A9NA 4HBVA 4FIPA 4Q6FA 4NR6A 5D3TA 5E9IA 4CUSA 5KH3A 5BT3A 4Z6IA 3UW9A 2LQ6A 5CQTA 3LRQA 3UVWA 3T7LA 4NR7A 3SOUA 2VJFA 5I89A 1ZS5A 4PCIA 4XYAA 5B75A 5HRVA 5LKTA 5E3DA 5IGNA 3QZSA 3DPLR 4TQNA 2M85A 5TCMA 4AYCB 5FE9A 4C9ZA 5HCLA 5AITA 3O7AA 2YEMA 3MUKA 4TU6A 4A49A 5ENCA 5G4RA 4NRCA 5HQ6A 2G6QA 5KTUA 4HBWA 2YQDA 2M3HA 4IR4A 1WILA 2LN0A 3PURA 5F36A 1N72A 4ZDTA 5LUUA 4UYHA 4IC3A 3I3JA 3IHPA 5EPSA 3HMHA 3LQJA 2VJEB 3UV4A 3FL2A 4N4GA 3U5PA 1X4IA 2MA5A 5II2A 4O78A 2G45A 4DONA 2WP1A 5CUDA 5C11A 2LDRA 5L96A 5I3LA 4GB0A 4GNDA 5D3PA 2G43A 1MM3A 4HXSA 2MA6A 3AADA 4WIVA 1U6GB 2KE1A 4N3WA 4WZ3B 3RPGB 4I7CA 4NR4A 3UVYA 4CCGX 2QIZA 3U5NA 2HDPA 4QEUA 5LCWB 5FG4A 4X2IA 5CRZA 4NYXA 5LJ2A 5CUGA 5FE2A 5B76A 5CTLA 2I50A 2VP7A 4UP0A 2DVVA 4ALGA 3DAIA 5EISA 2MIQA 4Q0NA 4UIUA 4YBTA 2F6NA 1Z60A 5D1MB 5TDRA 4CUPA 4F3IA 5D1KB 4C67A 4YBSA 5HEMA 1WESA 1LDKC 5HELA 5LKXA 5DKCA 5FFYA 1WEPA 4QBMA 2L5EA 2MJVB 4OGIA 5JWMA 5IGMA 2MT5A 4YY4A 2Y1MA 4TT2A 5B78A 4W4UA 5EWHA 5J0DA 5K29A 4LZRA 5B8DA 2R0SA 4J0RA 2L84A 4XUAA 5E7DA 3P1FA 4PKLA 2GRCA 2MNZA 2OXQC 5FH7A 5D7XA 2YU4A 5H1TA 3ZPV1 4OGJA 3P1CA 5IGLA 2C2LA 1E4UA 3HTKC 3SVFA 5CPEA 5TRBA 2N9GA 5A82A 5TB6A 5L99A 5I29A 3LQIA 2YUCA 5CGPA 4ZC9A 3ASLA 3FKMX 1FBVA 4I7BA 5FERA 3Q2EA 1WEEA 4TYLA 5DLXA 5A83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  4LYW A;  5KO4 A;  3S91 A;  4V3L C;  4HBX A;  3T6R A;  4HXO A;  2L75 A;  4IR3 A;  4TZ8 A;  4UIW A;  5FB0 A;  3ZPV E;  4CA1 A;  4CL9 A;  5ENH A;  5I7X A;  5LKU A;  3K2J A;  4Z1S A;  3MXF A;  4NRB A;  1VYX A;  5FG5 A;  2G4A A;  5C8G A;  1EQF A;  1X4J A;  4TZ2 A;  5CQ5 A;  4QNS A;  4YYH A;  4YYK A;  3N9N A;  4WZ0 A;  4BW1 A;  4QSS A;  1T1H A;  5D3S A;  2EGP A;  4F52 B;  5FE4 A;  4TS8 A;  2E3K A;  5ENE A;  5G4S A;  2Y43 A;  5IG6 A;  2LSP B;  5FEY A;  4UYF B;  5DKH A;  1WGM A;  5FB1 A;  2H0D A;  4O77 A;  4PS5 A;  2QIC A;  1LDJ B;  2RNY A;  4XUB A;  5FE6 A;  4CUU A;  4A4C A;  5CQ7 A;  4WHU A;  5FBX A;  2MD8 C;  3U5M A;  4BW3 A;  1ZBD B;  2VPG A;  4PY6 A;  4J0S A;  4A9F A;  4QSX A;  4O7A A;  4O64 A;  4NR5 A;  3MB4 A;  2R10 A;  5ENJ A;  1XWH A;  5A7C A;  5H9M A;  4TU4 A;  2LXP C;  4WHW A;  5LVR A;  5KTW A;  5JG6 A;  4LR6 A;  5EVA A;  3JVM A;  5D3N A;  4YYJ A;  2CT2 A;  1K2F A;  4LJN A;  1X0J A;  3ONI A;  4CFL A;  4YYI A;  4YYN A;  1X4U A;  2D9E A;  5EP7 A;  2I8N A;  4FLP A;  4IOQ A;  5HRW A;  4QEW A;  4CUT A;  5A5R A;  3U5J A;  5A85 A;  2RNW A;  5EU1 A;  4CFK A;  4BW2 A;  3PUQ A;  1WE9 A;  2L5U A;  3N9Q A;  2R0V A;  3ZYU A;  5DYX A;  2YQM A;  3O34 A;  2K1J A;  2YEK A;  3JVL A;  5D3J A;  5EM3 A;  2YDW A;  2LRI C;  2YW5 A;  4TT4 A;  5E3G A;  4XY9 A;  4CUQ A;  4MR4 A;  2HYE D;  4GNE A;  3GV4 A;  4IR6 A;  4BBQ A;  2DVR A;  4NRA A;  2L85 A;  5CZG A;  2KR4 A;  5B77 A;  5LKZ A;  5ENG A;  5EWD A;  2RSD A;  3ZNI A;  2YUR A;  4KCX A;  5EWW A;  5HQ7 A;  5JI8 A;  5BT4 A;  2D82 A;  4QC3 A;  5G0F A;  1WEN A;  2YW8 A;  5HFR A;  5HRX A;  3UVD A;  4CLB A;  2OSS A;  5DIN A;  3DWY A;  4E96 A;  3UVX A;  3HMF A;  5FH6 A;  3O35 A;  5BT5 A;  4YAB A;  4QST A;  1DVP A;  1HYI A;  3O70 A;  4L58 A;  5F1L A;  2FSA A;  3VK6 A;  2IDA A;  4QYD A;  2XEU A;  5DFB A;  5AMF A;  4HXK A;  4A9E A;  2JMJ A;  4QR5 A;  5CUE A;  5EWV A;  2YT5 A;  2K17 A;  4QSU A;  1E6I A;  4WZ2 A;  2H60 A;  5KU3 A;  3JVJ A;  4QR4 A;  4NUC A;  5A81 A;  2E7N A;  1RMD A;  4O71 A;  4PTB A;  5HLS A;  4O74 A;  4LRG A;  5EGU A;  2DVQ A;  5H1U A;  5IGK A;  5G04 B;  3KV5 A;  3N9M A;  4UIT A;  2ECI A;  5FH8 A;  4B86 C;  3N9P A;  3U5L A;  4AKN A;  2RI7 A;  2YHO A;  3QZV A;  1WFK A;  4ZUX U;  1WEO A;  4IC2 A;  3MB3 A;  4UIX A;  5FE1 A;  4HXL A;  5FE8 A;  4ZW1 A;  4N4F A;  3GL6 A;  2L0B A;  4NXJ A;  4LAD B;  4UIZ A;  3NXB A;  4QB3 A;  4O75 A;  5E0R A;  4MEP A;  4QR3 A;  4BW4 A;  5I83 A;  2F42 A;  5F63 A;  2KU3 A;  5D0C A;  3HCU A;  5EQ1 A;  4QUT A;  5ENF A;  5ACY A;  2OUO A;  4YY6 A;  1JSP B;  5CY9 A;  5C4Q A;  5CP5 A;  2KGG A;  2M6M A;  5D1L B;  5AME A;  3N9L A;  5E9Y A;  1Z2Q A;  2MNY A;  4A9I A;  2VPB A;  4BJX A;  2EOD A;  4NN2 A;  2KYU A;  2AN6 A;  3L11 A;  4GNG A;  5FE0 A;  2VPE A;  5D3L A;  4J1P A;  2E7O A;  2D8S A;  4IOO A;  4Z93 A;  5I1Q A;  3LXJ A;  4Y03 A;  2E6S A;  1WEM A;  4QSW A;  5CRM A;  4NQN A;  5ENI A;  2C2V S;  4YAD A;  5J3X A;  5I80 A;  2CKL A;  4XI1 A;  5E9M A;  2H0D B;  2KRE A;  5A5N A;  3D7C A;  2YEL A;  3IU6 A;  5E73 A;  3L1Z B;  2LGV A;  2KGI A;  4QF3 A;  1JM4 B;  4IOR A;  4QSQ A;  1IYM A;  2LGG A;  3V43 A;  5D24 A;  5FFW A;  4TTE A;  4Z6H A;  1WEV A;  3GG3 A;  4HXN A;  2ECN A;  4QYL A;  2NXB A;  1MM2 A;  4MEN A;  4FK5 A;  2LV9 A;  2JMD A;  2RO1 A;  2ECV A;  4RVR A;  3JVK A;  5FG6 A;  4LC2 A;  5LVQ A;  5CQ4 A;  3G0J A;  5DYA A;  4N4I A;  4A9J A;  3KQI A;  5DYC A;  3MHH A;  5CQ6 A;  4NYV A;  2L80 A;  3AQA A;  2VNF A;  4YAT A;  2L43 A;  5DKD A;  4UYF A;  2PNX A;  2KWJ A;  3KNV A;  2KIZ A;  5ETB A;  5CQ3 A;  1WIM A;  5CQ8 A;  5LJ0 A;  2UZG A;  5F3A A;  5CFW A;  5DFD A;  3RPG C;  5HEN A;  5L98 A;  2DAT A;  4MEO A;  1N87 A;  5EPB A;  3HCT A;  5B79 A;  1F62 A;  2RFJ A;  4XY8 A;  5DLZ A;  2LGK A;  4YH3 A;  4NYW A;  2ECJ A;  4WA6 A;  4A9K A;  4S3O C;  3S92 A;  4UYG A;  3U5O A;  4LK9 A;  3SHB A;  1WEW A;  4MSX A;  4MVT A;  3MUL A;  4AVX A;  5L8T A;  2BAY A;  1WEQ A;  1Z6U A;  5F61 A;  4HXP A;  3LJW A;  4QC1 A;  4NUE A;  4A9M A;  4IR5 A;  5LJ1 A;  5DKA A;  5EPR A;  4N4H A;  4QEV A;  5CUC A;  1CHC A;  2QJ0 A;  5E9L A;  4O7C A;  2VJE A;  2RS9 B;  5IBN A;  5I86 A;  2KTB B;  5C13 A;  5D3R A;  4YAX A;  4UI9 B;  2YYN A;  5EYA F;  1WEU A;  5EA1 A;  5L97 A;  5TBN A;  3P1D A;  5F2P A;  3O33 A;  4LZS A;  4R7E A;  4NUD A;  1BOR A;  4FO9 A;  1WUM A;  3PHD A;  4QSV A;  4TT6 A;  5F5Z A;  5HJC A;  4R2Y A;  5CUA A;  5EK9 A;  4LKA A;  5E9V A;  5L8U A;  5HQ5 A;  4YYD A;  2DX8 A;  5KHM A;  4AP4 A;  4QY4 A;  4QSR A;  2KWO A;  4AYC A;  3M99 A;  4V3K C;  3SVG A;  4YYM A;  5D26 A;  5EV9 A;  3MHS A;  3N9O A;  4YYG A;  1WUG A;  2FUI A;  2RNX A;  5CU8 A;  5F25 A;  3Q2F A;  4O7F A;  2KWK A;  2K4D A;  2E6R A;  4S3O B;  3TLP A;  2EA6 A;  2YHN A;  3IU5 A;  3O36 A;  5DYU A;  4NR8 A;  3U5K A;  5HFQ A;  3M62 A;  5A5Q A;  3UV5 A;  2ECW A;  4HXM A;  1JM7 A;  1F68 A;  4NS5 A;  3ZYQ A;  4YH4 A;  4A9H A;  4Z1Q A;  5DY7 A;  5C89 A;  4QZS A;  5F62 A;  3I2D A;  3ZTG A;  5I7Y A;  5C85 A;  5AD3 A;  3DQV R;  4BHW A;  5ETD A;  2MUM A;  1FP0 A;  5TAB A;  2VJF B;  4UYD A;  3SVH A;  2JRJ A;  4FJC A;  4O76 A;  2DVS A;  3P1E A;  5IID A;  3P5O A;  3UV2 A;  4C66 A;  2MD7 B;  4YBM A;  2OO1 A;  2FUU A;  4AUQ B;  4UP5 A;  3HCS A;  5KH9 A;  5TDW A;  4KV1 A;  1G25 A;  3O37 A;  5DW1 A;  5G05 B;  5II1 A;  2CSZ A;  4MR5 A;  3MQM A;  5FFV A;  4LYI A;  1V87 A;  4OUF A;  5DX4 A;  5E9K A;  2M1R A;  5DFC A;  5I88 A;  2Y1N A;  4PCE A;  4UIY A;  2YSJ A;  4GNF A;  4QF2 A;  4HBY A;  1HYJ A;  4QSP A;  2CSY A;  5COI A;  3L1X A;  5KH7 A;  4TKP B;  5AD2 A;  4LZ2 A;  2ECT A;  5FE3 A;  1VFY A;  3NG2 A;  3G0L A;  5C7N A;  4L7X A;  5CUB A;  1JOC A;  4UYE A;  5D3H A;  4A9L A;  3M63 A;  2R0Y A;  4O70 A;  5EIC A;  2WP2 A;  5A5P A;  5DBM A;  4NR9 A;  4O7B A;  4X3G A;  5KTX A;  4A4B A;  5ENB A;  2VPD A;  3SOW A;  4LLB A;  4I7D A;  3EB6 A;  5C87 A;  4QUU A;  1VD4 A;  4LYS A;  5DW2 A;  5F60 A;  5D25 A;  4YK0 A;  4PPE A;  5EWC A;  2CKL B;  4ALH A;  5CS8 A;  4A0C D;  3EB5 A;  4LDF A;  4O7E A;  3ZVY A;  4P5O B;  4R8P K;  4J3I A;  5H85 A;  2I7K A;  4A9O A;  2JMI A;  3RTR B;  3HME A;  2F6J A;  5AIU A;  4MR6 A;  4GPJ A;  4O72 A;  4HXR A;  2YSM A;  5EI4 A;  5A5O A;  2KFT A;  2DKW A;  2YQL A;  4KV4 A;  5H1V A;  2XB1 A;  3LQH A;  3RCW A;  5FE7 A;  2LGL A;  2PUY A;  5I40 A;  3ZVZ B;  3SOX A;  3KV6 A;  4NQM A;  5FDZ A;  4CUR A;  2ZET C;  5A5S A;  4YC9 A;  4Q0O A;  5E74 A;  2ECG A;  2K16 A;  4B7Y C;  5CQA A;  2DWW A;  2LXH C;  2YYR A;  4MEQ A;  4MR3 A;  3QZT A;  4ZQL A;  2KWN A;  2NAA A;  5F1H A;  1JM7 B;  3C6W A;  5HM0 A;  2YRE A;  5FE5 A;  4UIV A;  4A9N A;  4HBV A;  4FIP A;  4Q6F A;  4NR6 A;  5D3T A;  5E9I A;  4CUS A;  5KH3 A;  5BT3 A;  4Z6I A;  3UW9 A;  2LQ6 A;  5CQT A;  3LRQ A;  3UVW A;  3T7L A;  4NR7 A;  3SOU A;  2VJF A;  5I89 A;  1ZS5 A;  4PCI A;  4XYA A;  5B75 A;  5HRV A;  5LKT A;  5E3D A;  5IGN A;  3QZS A;  3DPL R;  4TQN A;  2M85 A;  5TCM A;  4AYC B;  5FE9 A;  4C9Z A;  5HCL A;  5AIT A;  3O7A A;  2YEM A;  3MUK A;  4TU6 A;  4A49 A;  5ENC A;  5G4R A;  4NRC A;  5HQ6 A;  2G6Q A;  5KTU A;  4HBW A;  2YQD A;  2M3H A;  4IR4 A;  1WIL A;  2LN0 A;  3PUR A;  5F36 A;  1N72 A;  4ZDT A;  5LUU A;  4UYH A;  4IC3 A;  3I3J A;  3IHP A;  5EPS A;  3HMH A;  3LQJ A;  2VJE B;  3UV4 A;  3FL2 A;  4N4G A;  3U5P A;  1X4I A;  2MA5 A;  5II2 A;  4O78 A;  2G45 A;  4DON A;  2WP1 A;  5CUD A;  5C11 A;  2LDR A;  5L96 A;  5I3L A;  4GB0 A;  4GND A;  5D3P A;  2G43 A;  1MM3 A;  4HXS A;  2MA6 A;  3AAD A;  4WIV A;  1U6G B;  2KE1 A;  4N3W A;  4WZ3 B;  3RPG B;  4I7C A;  4NR4 A;  3UVY A;  4CCG X;  2QIZ A;  3U5N A;  2HDP A;  4QEU A;  5LCW B;  5FG4 A;  4X2I A;  5CRZ A;  4NYX A;  5LJ2 A;  5CUG A;  5FE2 A;  5B76 A;  5CTL A;  2I50 A;  2VP7 A;  4UP0 A;  2DVV A;  4ALG A;  3DAI A;  5EIS A;  2MIQ A;  4Q0N A;  4UIU A;  4YBT A;  2F6N A;  1Z60 A;  5D1M B;  5TDR A;  4CUP A;  4F3I A;  5D1K B;  4C67 A;  4YBS A;  5HEM A;  1WES A;  1LDK C;  5HEL A;  5LKX A;  5DKC A;  5FFY A;  1WEP A;  4QBM A;  2L5E A;  2MJV B;  4OGI A;  5JWM A;  5IGM A;  2MT5 A;  4YY4 A;  2Y1M A;  4TT2 A;  5B78 A;  4W4U A;  5EWH A;  5J0D A;  5K29 A;  4LZR A;  5B8D A;  2R0S A;  4J0R A;  2L84 A;  4XUA A;  5E7D A;  3P1F A;  4PKL A;  2GRC A;  2MNZ A;  2OXQ C;  5FH7 A;  5D7X A;  2YU4 A;  5H1T A;  3ZPV 1;  4OGJ A;  3P1C A;  5IGL A;  2C2L A;  1E4U A;  3HTK C;  3SVF A;  5CPE A;  5TRB A;  2N9G A;  5A82 A;  5TB6 A;  5L99 A;  5I29 A;  3LQI A;  2YUC A;  5CGP A;  4ZC9 A;  3ASL A;  3FKM X;  1FBV A;  4I7B A;  5FER A;  3Q2E A;  1WEE A;  4TYL A;  5DLX A;  5A83 A; 
#chains in the Genus database with same CATH topology
 3C5K A;  4LYW A;  5KO4 A;  3S91 A;  4V3L C;  4HBX A;  3T6R A;  2JUN A;  4HXO A;  2L75 A;  4IR3 A;  4TZ8 A;  4UIW A;  5FB0 A;  3VKG A;  5SVY A;  3ZPV E;  4CA1 A;  4CL9 A;  5ENH A;  5I7X A;  5LKU A;  3K2J A;  4Z1S A;  3MXF A;  4AKH A;  4NRB A;  1VYX A;  5FG5 A;  5K3Q A;  2G4A A;  5C8G A;  1EQF A;  1X4J A;  4TZ2 A;  5CQ5 A;  4QNS A;  4YYH A;  4YYK A;  3N9N A;  4WZ0 A;  4BW1 A;  4QSS A;  1T1H A;  5D3S A;  2EGP A;  4H9D A;  4F52 B;  5FE4 A;  4TS8 A;  2E3K A;  5ENE A;  5G4S A;  2Y43 A;  5IG6 A;  2LSP B;  3FEH A;  5FEY A;  4UYF B;  2M13 A;  5DKH A;  1WGM A;  5FB1 A;  2H0D A;  4O77 A;  4PS5 A;  2QIC A;  1LDJ B;  2RNY A;  4XUB A;  5FE6 A;  4CUU A;  4A4C A;  5CQ7 A;  4WHU A;  5FBX A;  2MD8 C;  3U5M A;  4BW3 A;  1ZBD B;  2VPG A;  4PY6 A;  4J0S A;  4A9F A;  4QSX A;  4O7A A;  4O64 A;  4NR5 A;  3MB4 A;  2R10 A;  5ENJ A;  1XWH A;  5A7C A;  5H9M A;  4TU4 A;  2LXP C;  4WHW A;  5LVR A;  5KTW A;  5JG6 A;  4LR6 A;  3T9K A;  5EVA A;  3JVM A;  5D3N A;  4YYJ A;  2CT2 A;  1K2F A;  4LJN A;  1X0J A;  5SVI A;  3ONI A;  4CFL A;  4YYI A;  4YYN A;  1X4U A;  2D9E A;  5EP7 A;  2I8N A;  4FLP A;  4IOQ A;  5HRW A;  4QEW A;  4CUT A;  5A5R A;  3U5J A;  2KKY A;  5A85 A;  3LVR E;  2RNW A;  5EU1 A;  4CFK A;  5SVX A;  4BW2 A;  3PUQ A;  1WE9 A;  2L5U A;  3N9Q A;  2R0V A;  3ZYU A;  5DYX A;  2YQM A;  3O34 A;  2K1J A;  2YEK A;  3JVL A;  5D3J A;  5EM3 A;  2YDW A;  2LRI C;  2YW5 A;  4TT4 A;  5E3G A;  4XY9 A;  4CUQ A;  4MR4 A;  2HYE D;  4GNE A;  3GV4 A;  4IR6 A;  4BBQ A;  2DVR A;  4NRA A;  2L85 A;  5CZG A;  2KR4 A;  3FAN A;  5B77 A;  5LKZ A;  5ENG A;  5EWD A;  2CON A;  2RSD A;  3FM8 C;  3ZNI A;  2YUR A;  4KCX A;  5EWW A;  5HQ7 A;  5JI8 A;  5BT4 A;  2D82 A;  4QC3 A;  5G0F A;  1WEN A;  2YW8 A;  5HFR A;  5HRX A;  3UVD A;  4CLB A;  2OSS A;  3FJU B;  5DIN A;  3DWY A;  4E96 A;  3UVX A;  3HMF A;  5FH6 A;  2MKE A;  3O35 A;  5BT5 A;  4YAB A;  4QST A;  1DVP A;  1HYI A;  3O70 A;  4L58 A;  5F1L A;  2FSA A;  3VK6 A;  2IDA A;  4QYD A;  2XEU A;  5DFB A;  5AMF A;  2CSV A;  2JM3 A;  4HXK A;  4A9E A;  2JMJ A;  4QR5 A;  5CUE A;  5EWV A;  2YT5 A;  2K17 A;  4QSU A;  1E6I A;  4WZ2 A;  3ERR A;  2H60 A;  5KU3 A;  3JVJ A;  4QR4 A;  4NUC A;  5A81 A;  2E7N A;  1RMD A;  2CRR A;  2KKX A;  3O47 A;  3D1D A;  4O71 A;  4PTB A;  5HLS A;  4O74 A;  4LRG A;  5EGU A;  2DVQ A;  5H1U A;  5IGK A;  5G04 B;  3KV5 A;  3N9M A;  4UIT A;  2ECI A;  5FH8 A;  4B86 C;  3N9P A;  1MBM A;  3U5L A;  4AKN A;  2RI7 A;  3KDE C;  2YHO A;  2XOZ A;  3QZV A;  1WFK A;  4ZUX U;  1WEO A;  3LVQ E;  4IC2 A;  3MB3 A;  4UIX A;  5FE1 A;  4HXL A;  5FE8 A;  4ZW1 A;  4N4F A;  3GL6 A;  2L0B A;  4NXJ A;  4LAD B;  4UIZ A;  3NXB A;  4QB3 A;  4O75 A;  5E0R A;  4MEP A;  4QR3 A;  4BW4 A;  5I83 A;  2F42 A;  5F63 A;  2KU3 A;  5D0C A;  3HCU A;  5EQ1 A;  4QUT A;  5ENF A;  5ACY A;  2OUO A;  4YY6 A;  1JSP B;  5CY9 A;  5C4Q A;  5CP5 A;  2KGG A;  2M6M A;  5D1L B;  5AME A;  3N9L A;  5E9Y A;  1Z2Q A;  2MNY A;  4A9I A;  2VPB A;  4BJX A;  2EOD A;  4NN2 A;  2KYU A;  2AN6 A;  3L11 A;  4GNG A;  5FE0 A;  2VPE A;  5D3L A;  4J1P A;  2E7O A;  2D8S A;  4IOO A;  4Z93 A;  5I1Q A;  3LXJ A;  4Y03 A;  2E6S A;  1WEM A;  4QSW A;  5CRM A;  4NQN A;  5ENI A;  2C2V S;  4YAD A;  5J3X A;  5I80 A;  2CKL A;  4XI1 A;  5E9M A;  2H0D B;  2KRE A;  5A5N A;  3D7C A;  2YEL A;  3IU6 A;  5E73 A;  3L1Z B;  2LGV A;  2KGI A;  4QF3 A;  1JM4 B;  4IOR A;  4QSQ A;  1IYM A;  2LGG A;  3V43 A;  5D24 A;  5FFW A;  4TTE A;  4Z6H A;  1WEV A;  3GG3 A;  4HXN A;  2ECN A;  4QYL A;  2NXB A;  3Q1D A;  1MM2 A;  4MEN A;  4FK5 A;  2LV9 A;  2JMD A;  2RO1 A;  2ECV A;  4RVR A;  3JVK A;  5FG6 A;  4LC2 A;  5LVQ A;  5CQ4 A;  3G0J A;  5DYA A;  4N4I A;  4A9J A;  3KQI A;  5DYC A;  3MHH A;  5CQ6 A;  4NYV A;  2L80 A;  2EJN A;  3AQA A;  2VNF A;  4YAT A;  2L43 A;  5DKD A;  4UYF A;  2PNX A;  2KWJ A;  3KNV A;  2KIZ A;  5ETB A;  5CQ3 A;  1WIM A;  5CQ8 A;  5LJ0 A;  2UZG A;  5F3A A;  5CFW A;  5DFD A;  3RPG C;  5HEN A;  5L98 A;  2DAT A;  4MEO A;  1N87 A;  5EPB A;  3HCT A;  5B79 A;  1F62 A;  2RFJ A;  4XY8 A;  5DLZ A;  2LGK A;  4YH3 A;  4NYW A;  2ECJ A;  4WA6 A;  4A9K A;  4S3O C;  3S92 A;  4UYG A;  3U5O A;  4LK9 A;  3SHB A;  1WEW A;  4MSX A;  4MVT A;  3MUL A;  4AVX A;  5L8T A;  2BAY A;  1WEQ A;  1Z6U A;  3DDT A;  5F61 A;  4HXP A;  3LJW A;  4QC1 A;  4NUE A;  4A9M A;  4IR5 A;  5SVI B;  5LJ1 A;  5DKA A;  5EPR A;  4N4H A;  4QEV A;  5CUC A;  1CHC A;  2QJ0 A;  5E9L A;  4O7C A;  2VJE A;  2RS9 B;  5IBN A;  5I86 A;  2KTB B;  5C13 A;  3LDY A;  5D3R A;  4YAX A;  4UI9 B;  2YYN A;  5EYA F;  1WEU A;  5EA1 A;  5L97 A;  5TBN A;  3P1D A;  2FD4 A;  5F2P A;  3O33 A;  4LZS A;  4Z0O A;  4R7E A;  4NUD A;  1BOR A;  4FO9 A;  1WUM A;  3PHD A;  4QSV A;  4TT6 A;  5F5Z A;  5HJC A;  4R2Y A;  5CUA A;  5EK9 A;  4LKA A;  5E9V A;  4F1P A;  5L8U A;  5HQ5 A;  4YYD A;  2DX8 A;  5KHM A;  4AP4 A;  4QY4 A;  4QSR A;  2KWO A;  4AYC A;  3M99 A;  4V3K C;  3SVG A;  4YYM A;  5D26 A;  5EV9 A;  2L7P A;  3MHS A;  3N9O A;  4YYG A;  2LAU A;  1WUG A;  2FUI A;  2RNX A;  5CU8 A;  5F25 A;  3Q2F A;  4O7F A;  2KWK A;  2K4D A;  2E6R A;  4S3O B;  3TLP A;  3DWD A;  2EA6 A;  2YHN A;  3IU5 A;  2EXU A;  3O36 A;  5DYU A;  4NR8 A;  3U5K A;  5HFQ A;  3M62 A;  5A5Q A;  3UV5 A;  2ECW A;  4HXM A;  1JM7 A;  1F68 A;  4NS5 A;  3ZYQ A;  4YH4 A;  4A9H A;  4Z1Q A;  5DY7 A;  5C89 A;  4QZS A;  5F62 A;  3I2D A;  3ZTG A;  5I7Y A;  4AKI A;  5C85 A;  5AD3 A;  3DQV R;  4BHW A;  5ETD A;  2MUM A;  1FP0 A;  5TAB A;  2VJF B;  4UYD A;  3SVH A;  2JRJ A;  2DSM A;  4FJC A;  4O76 A;  2DVS A;  3P1E A;  5IID A;  3P5O A;  3UV2 A;  4C66 A;  2MD7 B;  4YBM A;  2OO1 A;  2FUU A;  4AUQ B;  4UP5 A;  3HCS A;  5KH9 A;  5TDW A;  4KV1 A;  1G25 A;  3O37 A;  2CRW A;  5DW1 A;  5G05 B;  5II1 A;  2CSZ A;  4MR5 A;  3MQM A;  5FFV A;  4LYI A;  1V87 A;  4OUF A;  5DX4 A;  5E9K A;  2D8U A;  5DFC A;  5I88 A;  2M1R A;  4PCE A;  4UIY A;  2Y1N A;  2YSJ A;  4GNF A;  4HBY A;  4QF2 A;  1HYJ A;  4QSP A;  2CSY A;  5COI A;  3L1X A;  4OGC A;  5KH7 A;  4TKP B;  4OGE A;  5AD2 A;  4LZ2 A;  2ECT A;  5FE3 A;  1ZKR A;  1VFY A;  3NG2 A;  3G0L A;  5C7N A;  4L7X A;  5CUB A;  1JOC A;  4UYE A;  2OWA A;  2XOC A;  5D3H A;  4A9L A;  3M63 A;  2R0Y A;  4O70 A;  2WP2 A;  5EIC A;  5A5P A;  5DBM A;  4NR9 A;  4O7B A;  4X3G A;  5KTX A;  4A4B A;  5ENB A;  2VPD A;  2E61 A;  3JUE A;  4LLB A;  4I7D A;  3EB6 A;  5C87 A;  3SOW A;  4QUU A;  1VD4 A;  4LYS A;  5DW2 A;  5F60 A;  5D25 A;  4YK0 A;  4PPE A;  5EWC A;  2CKL B;  4ALH A;  5CS8 A;  4A0C D;  3EB5 A;  4LDF A;  4O7E A;  3ZVY A;  4P5O B;  4R8P K;  4J3I A;  5H85 A;  2I7K A;  4A9O A;  2JMI A;  3RTR B;  3HME A;  2F6J A;  5AIU A;  4MR6 A;  4GPJ A;  4O72 A;  4HXR A;  2YSM A;  5EI4 A;  5A5O A;  2KFT A;  2DKW A;  2YQL A;  4KV4 A;  5H1V A;  2XB1 A;  2EGM A;  3LQH A;  3RCW A;  5FE7 A;  3MDB C;  2LGL A;  2PUY A;  5I40 A;  3ZVZ B;  3SOX A;  4O62 A;  3KV6 A;  4NQM A;  5FDZ A;  4CUR A;  2ZET C;  5A5S A;  4YC9 A;  2XOY A;  4Q0O A;  5E74 A;  2ECG A;  2K16 A;  3PLW A;  5CQA A;  4B7Y C;  2DWW A;  2LXH C;  2YYR A;  4QQ4 A;  4MEQ A;  4MR3 A;  3QZT A;  4ZQL A;  2KWN A;  2NAA A;  5F1H A;  3E2D A;  1JM7 B;  3FAO A;  3C6W A;  5HM0 A;  2YRE A;  3LJU X;  5FE5 A;  4UIV A;  4A9N A;  4AKG A;  4HBV A;  4FIP A;  4Q6F A;  4NR6 A;  5D3T A;  5E9I A;  4CUS A;  5KH3 A;  5BT3 A;  4Z6I A;  3UW9 A;  2LQ6 A;  5CQT A;  2P57 A;  3LRQ A;  3UVW A;  3T7L A;  4NR7 A;  3SOU A;  2VJF A;  5I89 A;  1ZS5 A;  4PCI A;  4XYA A;  5B75 A;  5HRV A;  5LKT A;  5E3D A;  5IGN A;  3QZS A;  3DPL R;  4TQN A;  2M85 A;  5TCM A;  4AYC B;  5FE9 A;  4C9Z A;  5HCL A;  5AIT A;  3O7A A;  2YEM A;  3MUK A;  4TU6 A;  4A49 A;  5ENC A;  3SUB A;  5G4R A;  4NRC A;  5HQ6 A;  2G6Q A;  5KTU A;  4HBW A;  2YQD A;  2M3H A;  4IR4 A;  3D1B A;  1WIL A;  2LN0 A;  3PUR A;  4Z0R A;  3M7K A;  5F36 A;  1N72 A;  4ZDT A;  5LUU A;  4UYH A;  3H7H A;  4IC3 A;  3I3J A;  3IHP A;  5EPS A;  3HMH A;  3LQJ A;  2VJE B;  3UV4 A;  3FL2 A;  4N4G A;  3VKH A;  3U5P A;  1X4I A;  2MA5 A;  1DCQ A;  5II2 A;  4O78 A;  2G45 A;  4DON A;  2WP1 A;  5CUD A;  5C11 A;  2LDR A;  5L96 A;  5I3L A;  4GB0 A;  4GND A;  5D3P A;  2G43 A;  1MM3 A;  4HXS A;  2MA6 A;  3AAD A;  4WIV A;  1U6G B;  2KE1 A;  4N3W A;  4WZ3 B;  3RPG B;  2YVR A;  4I7C A;  4NR4 A;  3UVY A;  4CCG X;  2QIZ A;  3U5N A;  2HDP A;  4QEU A;  2IQJ A;  5FG4 A;  4X2I A;  5CRZ A;  5LCW B;  4NYX A;  5LJ2 A;  5CUG A;  5FE2 A;  5B76 A;  5CTL A;  2I50 A;  2VP7 A;  4UP0 A;  2DVV A;  4ALG A;  3DAI A;  5EIS A;  2MIQ A;  4Q0N A;  4UIU A;  4YBT A;  1PUO A;  2F6N A;  1Z60 A;  5D1M B;  5TDR A;  4CUP A;  4F3I A;  2RR4 A;  4C67 A;  4YBS A;  5HEM A;  5D1K B;  2B0O E;  1WES A;  1LDK C;  5HEL A;  5LKX A;  5DKC A;  5FFY A;  1WEP A;  4QBM A;  2L5E A;  2MJV B;  4OGI A;  5JWM A;  5IGM A;  2MT5 A;  4YY4 A;  2Y1M A;  4TT2 A;  5B78 A;  4W4U A;  5EWH A;  5J0D A;  5K29 A;  4LZR A;  2XP0 A;  5B8D A;  2R0S A;  4J0R A;  2L84 A;  4XUA A;  2FFW A;  5E7D A;  3P1F A;  4PKL A;  2GRC A;  2MNZ A;  2OXQ C;  5FH7 A;  5D7X A;  2YU4 A;  5H1T A;  3ZPV 1;  4OGJ A;  3P1C A;  5IGL A;  2C2L A;  1E4U A;  3HTK C;  3SVF A;  5CPE A;  5TRB A;  2N9G A;  5A82 A;  5TB6 A;  5L99 A;  5I29 A;  2DJA A;  3LQI A;  2YUC A;  5CGP A;  4ZC9 A;  3ASL A;  3FKM X;  1FBV A;  4AI6 A;  4I7B A;  5FER A;  3Q2E A;  1WEE A;  4TYL A;  5DLX A;  5A83 A; 
#chains in the Genus database with same CATH homology
 3C5K A;  4LYW A;  5KO4 A;  3S91 A;  4V3L C;  4HBX A;  3T6R A;  4HXO A;  2L75 A;  4IR3 A;  4TZ8 A;  4UIW A;  5FB0 A;  3ZPV E;  4CA1 A;  4CL9 A;  5ENH A;  5I7X A;  5LKU A;  3K2J A;  4Z1S A;  3MXF A;  4NRB A;  1VYX A;  5FG5 A;  2G4A A;  5C8G A;  1EQF A;  1X4J A;  4TZ2 A;  5CQ5 A;  4QNS A;  4YYH A;  4YYK A;  3N9N A;  4WZ0 A;  4BW1 A;  4QSS A;  1T1H A;  5D3S A;  2EGP A;  4F52 B;  5FE4 A;  4TS8 A;  2E3K A;  5ENE A;  5G4S A;  2Y43 A;  5IG6 A;  2LSP B;  5FEY A;  4UYF B;  5DKH A;  1WGM A;  5FB1 A;  2H0D A;  4O77 A;  4PS5 A;  2QIC A;  1LDJ B;  2RNY A;  4XUB A;  5FE6 A;  4CUU A;  4A4C A;  5CQ7 A;  4WHU A;  5FBX A;  2MD8 C;  3U5M A;  4BW3 A;  1ZBD B;  2VPG A;  4PY6 A;  4J0S A;  4A9F A;  4QSX A;  4O7A A;  4O64 A;  4NR5 A;  3MB4 A;  2R10 A;  5ENJ A;  1XWH A;  5A7C A;  5H9M A;  4TU4 A;  2LXP C;  4WHW A;  5LVR A;  5KTW A;  5JG6 A;  4LR6 A;  5EVA A;  3JVM A;  5D3N A;  4YYJ A;  2CT2 A;  1K2F A;  4LJN A;  1X0J A;  3ONI A;  4CFL A;  4YYI A;  4YYN A;  1X4U A;  2D9E A;  5EP7 A;  2I8N A;  4FLP A;  4IOQ A;  5HRW A;  4QEW A;  4CUT A;  5A5R A;  3U5J A;  5A85 A;  2RNW A;  5EU1 A;  4CFK A;  4BW2 A;  3PUQ A;  1WE9 A;  2L5U A;  3N9Q A;  2R0V A;  3ZYU A;  5DYX A;  2YQM A;  3O34 A;  2K1J A;  2YEK A;  3JVL A;  5D3J A;  5EM3 A;  2YDW A;  2LRI C;  2YW5 A;  4TT4 A;  5E3G A;  4XY9 A;  4CUQ A;  4MR4 A;  2HYE D;  4GNE A;  3GV4 A;  4IR6 A;  4BBQ A;  2DVR A;  4NRA A;  2L85 A;  5CZG A;  2KR4 A;  5B77 A;  5LKZ A;  5ENG A;  5EWD A;  2RSD A;  3ZNI A;  2YUR A;  4KCX A;  5EWW A;  5HQ7 A;  5JI8 A;  5BT4 A;  2D82 A;  4QC3 A;  5G0F A;  1WEN A;  2YW8 A;  5HFR A;  5HRX A;  3UVD A;  4CLB A;  2OSS A;  5DIN A;  3DWY A;  4E96 A;  3UVX A;  3HMF A;  5FH6 A;  3O35 A;  5BT5 A;  4YAB A;  4QST A;  1DVP A;  1HYI A;  3O70 A;  4L58 A;  5F1L A;  2FSA A;  3VK6 A;  2IDA A;  4QYD A;  2XEU A;  5DFB A;  5AMF A;  4HXK A;  4A9E A;  2JMJ A;  4QR5 A;  5CUE A;  5EWV A;  2YT5 A;  2K17 A;  4QSU A;  1E6I A;  4WZ2 A;  2H60 A;  5KU3 A;  3JVJ A;  4QR4 A;  4NUC A;  5A81 A;  2E7N A;  1RMD A;  4O71 A;  4PTB A;  5HLS A;  4O74 A;  4LRG A;  5EGU A;  2DVQ A;  5H1U A;  5IGK A;  5G04 B;  3KV5 A;  3N9M A;  4UIT A;  2ECI A;  5FH8 A;  4B86 C;  3N9P A;  3U5L A;  4AKN A;  2RI7 A;  2YHO A;  3QZV A;  1WFK A;  4ZUX U;  1WEO A;  4IC2 A;  3MB3 A;  4UIX A;  5FE1 A;  4HXL A;  5FE8 A;  4ZW1 A;  4N4F A;  3GL6 A;  2L0B A;  4NXJ A;  4LAD B;  4UIZ A;  3NXB A;  4QB3 A;  4O75 A;  5E0R A;  4MEP A;  4QR3 A;  4BW4 A;  5I83 A;  2F42 A;  5F63 A;  2KU3 A;  5D0C A;  3HCU A;  5EQ1 A;  4QUT A;  5ENF A;  5ACY A;  2OUO A;  4YY6 A;  1JSP B;  5CY9 A;  5C4Q A;  5CP5 A;  2KGG A;  2M6M A;  5D1L B;  5AME A;  3N9L A;  5E9Y A;  1Z2Q A;  2MNY A;  4A9I A;  2VPB A;  4BJX A;  2EOD A;  4NN2 A;  2KYU A;  2AN6 A;  3L11 A;  4GNG A;  5FE0 A;  2VPE A;  5D3L A;  4J1P A;  2E7O A;  2D8S A;  4IOO A;  4Z93 A;  5I1Q A;  3LXJ A;  4Y03 A;  2E6S A;  1WEM A;  4QSW A;  5CRM A;  4NQN A;  5ENI A;  2C2V S;  4YAD A;  5J3X A;  5I80 A;  2CKL A;  4XI1 A;  5E9M A;  2H0D B;  2KRE A;  5A5N A;  3D7C A;  2YEL A;  3IU6 A;  5E73 A;  3L1Z B;  2LGV A;  2KGI A;  4QF3 A;  1JM4 B;  4IOR A;  4QSQ A;  1IYM A;  2LGG A;  3V43 A;  5D24 A;  5FFW A;  4TTE A;  4Z6H A;  1WEV A;  3GG3 A;  4HXN A;  2ECN A;  4QYL A;  2NXB A;  1MM2 A;  4MEN A;  4FK5 A;  2LV9 A;  2JMD A;  2RO1 A;  2ECV A;  4RVR A;  3JVK A;  5FG6 A;  4LC2 A;  5LVQ A;  5CQ4 A;  3G0J A;  5DYA A;  4N4I A;  4A9J A;  3KQI A;  5DYC A;  3MHH A;  5CQ6 A;  4NYV A;  2L80 A;  3AQA A;  2VNF A;  4YAT A;  2L43 A;  5DKD A;  4UYF A;  2PNX A;  2KWJ A;  3KNV A;  2KIZ A;  5ETB A;  5CQ3 A;  1WIM A;  5CQ8 A;  5LJ0 A;  2UZG A;  5F3A A;  5CFW A;  5DFD A;  3RPG C;  5HEN A;  5L98 A;  2DAT A;  4MEO A;  1N87 A;  5EPB A;  3HCT A;  5B79 A;  1F62 A;  2RFJ A;  4XY8 A;  5DLZ A;  2LGK A;  4YH3 A;  4NYW A;  2ECJ A;  4WA6 A;  4A9K A;  4S3O C;  3S92 A;  4UYG A;  3U5O A;  4LK9 A;  3SHB A;  1WEW A;  4MSX A;  4MVT A;  3MUL A;  4AVX A;  5L8T A;  2BAY A;  1WEQ A;  1Z6U A;  5F61 A;  4HXP A;  3LJW A;  4QC1 A;  4NUE A;  4A9M A;  4IR5 A;  5LJ1 A;  5DKA A;  5EPR A;  4N4H A;  4QEV A;  5CUC A;  1CHC A;  2QJ0 A;  5E9L A;  4O7C A;  2VJE A;  2RS9 B;  5IBN A;  5I86 A;  2KTB B;  5C13 A;  5D3R A;  4YAX A;  4UI9 B;  2YYN A;  5EYA F;  1WEU A;  5EA1 A;  5L97 A;  5TBN A;  3P1D A;  5F2P A;  3O33 A;  4LZS A;  4R7E A;  4NUD A;  1BOR A;  4FO9 A;  1WUM A;  3PHD A;  4QSV A;  4TT6 A;  5F5Z A;  5HJC A;  4R2Y A;  5CUA A;  5EK9 A;  4LKA A;  5E9V A;  5L8U A;  5HQ5 A;  4YYD A;  2DX8 A;  5KHM A;  4AP4 A;  4QY4 A;  4QSR A;  2KWO A;  4AYC A;  3M99 A;  4V3K C;  3SVG A;  4YYM A;  5D26 A;  5EV9 A;  3MHS A;  3N9O A;  4YYG A;  1WUG A;  2FUI A;  2RNX A;  5CU8 A;  5F25 A;  3Q2F A;  4O7F A;  2KWK A;  2K4D A;  2E6R A;  4S3O B;  3TLP A;  2EA6 A;  2YHN A;  3IU5 A;  3O36 A;  5DYU A;  4NR8 A;  3U5K A;  5HFQ A;  3M62 A;  5A5Q A;  3UV5 A;  2ECW A;  4HXM A;  1JM7 A;  1F68 A;  4NS5 A;  3ZYQ A;  4YH4 A;  4A9H A;  4Z1Q A;  5DY7 A;  5C89 A;  4QZS A;  5F62 A;  3I2D A;  3ZTG A;  5I7Y A;  5C85 A;  5AD3 A;  3DQV R;  4BHW A;  5ETD A;  2MUM A;  1FP0 A;  5TAB A;  2VJF B;  4UYD A;  3SVH A;  2JRJ A;  4FJC A;  4O76 A;  2DVS A;  3P1E A;  5IID A;  3P5O A;  3UV2 A;  4C66 A;  2MD7 B;  4YBM A;  2OO1 A;  2FUU A;  4AUQ B;  4UP5 A;  3HCS A;  5KH9 A;  5TDW A;  4KV1 A;  1G25 A;  3O37 A;  5DW1 A;  5G05 B;  5II1 A;  2CSZ A;  4MR5 A;  3MQM A;  5FFV A;  4LYI A;  1V87 A;  4OUF A;  5DX4 A;  5E9K A;  2M1R A;  5DFC A;  5I88 A;  2Y1N A;  4PCE A;  4UIY A;  2YSJ A;  4GNF A;  4QF2 A;  4HBY A;  1HYJ A;  4QSP A;  2CSY A;  5COI A;  3L1X A;  5KH7 A;  4TKP B;  5AD2 A;  4LZ2 A;  2ECT A;  5FE3 A;  1VFY A;  3NG2 A;  3G0L A;  5C7N A;  4L7X A;  5CUB A;  1JOC A;  4UYE A;  5D3H A;  4A9L A;  3M63 A;  2R0Y A;  4O70 A;  5EIC A;  2WP2 A;  5A5P A;  5DBM A;  4NR9 A;  4O7B A;  4X3G A;  5KTX A;  4A4B A;  5ENB A;  2VPD A;  3SOW A;  4LLB A;  4I7D A;  3EB6 A;  5C87 A;  4QUU A;  1VD4 A;  4LYS A;  5DW2 A;  5F60 A;  5D25 A;  4YK0 A;  4PPE A;  5EWC A;  2CKL B;  4ALH A;  5CS8 A;  4A0C D;  3EB5 A;  4LDF A;  4O7E A;  3ZVY A;  4P5O B;  4R8P K;  4J3I A;  5H85 A;  2I7K A;  4A9O A;  2JMI A;  3RTR B;  3HME A;  2F6J A;  5AIU A;  4MR6 A;  4GPJ A;  4O72 A;  4HXR A;  2YSM A;  5EI4 A;  5A5O A;  2KFT A;  2DKW A;  2YQL A;  4KV4 A;  5H1V A;  2XB1 A;  3LQH A;  3RCW A;  5FE7 A;  2LGL A;  2PUY A;  5I40 A;  3ZVZ B;  3SOX A;  3KV6 A;  4NQM A;  5FDZ A;  4CUR A;  2ZET C;  5A5S A;  4YC9 A;  4Q0O A;  5E74 A;  2ECG A;  2K16 A;  4B7Y C;  5CQA A;  2DWW A;  2LXH C;  2YYR A;  4MEQ A;  4MR3 A;  3QZT A;  4ZQL A;  2KWN A;  2NAA A;  5F1H A;  1JM7 B;  3C6W A;  5HM0 A;  2YRE A;  5FE5 A;  4UIV A;  4A9N A;  4HBV A;  4FIP A;  4Q6F A;  4NR6 A;  5D3T A;  5E9I A;  4CUS A;  5KH3 A;  5BT3 A;  4Z6I A;  3UW9 A;  2LQ6 A;  5CQT A;  3LRQ A;  3UVW A;  3T7L A;  4NR7 A;  3SOU A;  2VJF A;  5I89 A;  1ZS5 A;  4PCI A;  4XYA A;  5B75 A;  5HRV A;  5LKT A;  5E3D A;  5IGN A;  3QZS A;  3DPL R;  4TQN A;  2M85 A;  5TCM A;  4AYC B;  5FE9 A;  4C9Z A;  5HCL A;  5AIT A;  3O7A A;  2YEM A;  3MUK A;  4TU6 A;  4A49 A;  5ENC A;  5G4R A;  4NRC A;  5HQ6 A;  2G6Q A;  5KTU A;  4HBW A;  2YQD A;  2M3H A;  4IR4 A;  1WIL A;  2LN0 A;  3PUR A;  5F36 A;  1N72 A;  4ZDT A;  5LUU A;  4UYH A;  4IC3 A;  3I3J A;  3IHP A;  5EPS A;  3HMH A;  3LQJ A;  2VJE B;  3UV4 A;  3FL2 A;  4N4G A;  3U5P A;  1X4I A;  2MA5 A;  5II2 A;  4O78 A;  2G45 A;  4DON A;  2WP1 A;  5CUD A;  5C11 A;  2LDR A;  5L96 A;  5I3L A;  4GB0 A;  4GND A;  5D3P A;  2G43 A;  1MM3 A;  4HXS A;  2MA6 A;  3AAD A;  4WIV A;  1U6G B;  2KE1 A;  4N3W A;  4WZ3 B;  3RPG B;  4I7C A;  4NR4 A;  3UVY A;  4CCG X;  2QIZ A;  3U5N A;  2HDP A;  4QEU A;  5LCW B;  5FG4 A;  4X2I A;  5CRZ A;  4NYX A;  5LJ2 A;  5CUG A;  5FE2 A;  5B76 A;  5CTL A;  2I50 A;  2VP7 A;  4UP0 A;  2DVV A;  4ALG A;  3DAI A;  5EIS A;  2MIQ A;  4Q0N A;  4UIU A;  4YBT A;  2F6N A;  1Z60 A;  5D1M B;  5TDR A;  4CUP A;  4F3I A;  5D1K B;  4C67 A;  4YBS A;  5HEM A;  1WES A;  1LDK C;  5HEL A;  5LKX A;  5DKC A;  5FFY A;  1WEP A;  4QBM A;  2L5E A;  2MJV B;  4OGI A;  5JWM A;  5IGM A;  2MT5 A;  4YY4 A;  2Y1M A;  4TT2 A;  5B78 A;  4W4U A;  5EWH A;  5J0D A;  5K29 A;  4LZR A;  5B8D A;  2R0S A;  4J0R A;  2L84 A;  4XUA A;  5E7D A;  3P1F A;  4PKL A;  2GRC A;  2MNZ A;  2OXQ C;  5FH7 A;  5D7X A;  2YU4 A;  5H1T A;  3ZPV 1;  4OGJ A;  3P1C A;  5IGL A;  2C2L A;  1E4U A;  3HTK C;  3SVF A;  5CPE A;  5TRB A;  2N9G A;  5A82 A;  5TB6 A;  5L99 A;  5I29 A;  3LQI A;  2YUC A;  5CGP A;  4ZC9 A;  3ASL A;  3FKM X;  1FBV A;  4I7B A;  5FER A;  3Q2E A;  1WEE A;  4TYL A;  5DLX A;  5A83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...