3U5PA

Crystal structure of the complex of trim33 phd-bromo and h3(1-28)k9me3k14ack18ack23ac histone peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
188
Chain Sequence
DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 56
structure length 188
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5pA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5pA01
4FIPA 5HFRA 4NR4A 5DY7A 3O7AA 2ECNA 4Q0OA 4GNDA 4A0CD 2E6SA 5HRXA 4AYCB 4GNGA 4TU4A 2H60A 5EVAA 4NR6A 2MT5A 4IR3A 1X4JA 5HFQA 4O7BA 5LKUA 2MA6A 2QJ0A 5F2PA 5EV9A 4O7FA 4NR8A 3O33A 5TRBA 3ZPV1 2R0SA 2LXPC 3SOXA 5DKAA 4CUTA 3UV4A 4UP5A 2I7KA 4UIXA 5EM3A 3N9QA 4NUCA 5F61A 5A85A 2QIZA 5FG5A 5FE8A 5F60A 4IOOA 3C5KA 3NXBA 2I8NA 5COIA 3MB4A 4N4IA 4TZ8A 4BW2A 5G05B 5A5OA 3EB6A 4S3OC 5KO4A 2CSYA 2ECIA 4TT6A 2MUMA 4O70A 5CQTA 4KV1A 5DLZA 4LZ2A 3Q2EA 4WHWA 4HXPA 5L99A 5CUCA 3G0JA 4IR4A 4J0SA 3ONIA 4O72A 3U5LA 2D8SA 4X3GA 2C2LA 5KTWA 4PS5A 3HMEA 4PTBA 5LJ1A 5KH7A 4WZ2A 4N4FA 4MEQA 5TDWA 5FFWA 4CUSA 4NQMA 2YW8A 4O77A 5HQ7A 2DWWA 5C85A 3MHSA 2IDAA 4UYGA 4MR3A 3T7LA 5KTUA 5H1UA 3JVJA 2ECVA 4WZ3B 2RS9B 4OGIA 5I83A 5B78A 5LVQA 4HBYA 5EWCA 3M62A 2LV9A 5FG6A 4QF3A 4QR4A 2PUYA 5DINA 5H9MA 2KU3A 5KHMA 3C6WA 4TQNA 4XUBA 5J3XA 4A9NA 3UVDA 2KWKA 2RO1A 2YQDA 3DQVR 4LZSA 4PPEA 4ZUXU 4OGJA 2FUUA 1WEQA 5D3HA 4IR5A 3ZPVE 2R10A 4P5OB 5I89A 3JVMA 1WEWA 3HCTA 4QEWA 3FKMX 2G43A 5IGMA 1N87A 5EPBA 2E7OA 4HXLA 4YBSA 5B79A 4HBXA 4NRAA 2M6MA 4QZSA 4A4BA 4L7XA 5HCLA 1IYMA 2E3KA 5L96A 5EPRA 2RFJA 5F1HA 3EB5A 1X4UA 2G45A 3U5OA 1WFKA 4YYNA 3N9OA 1Z2QA 3G0LA 3JVLA 3DAIA 4Q0NA 5CQ8A 3TLPA 1WESA 3U5MA 3N9MA 1WEPA 5F36A 1JOCA 5G4RA 4YYKA 2RSDA 3PUQA 1RMDA 5EWHA 2ECJA 2VP7A 1G25A 1WE9A 4ZDTA 5H1VA 5C7NA 1WEMA 2VPBA 4AKNA 1X4IA 5EGUA 5BT3A 5IG6A 4FLPA 5ENIA 4NS5A 4GB0A 3MXFA 4KCXA 2K1JA 3LRQA 1E6IA 4CUPA 3IHPA 2YURA 4Z1QA 4HXRA 5B75A 4QBMA 2KGGA 1K2FA 1MM2A 3QZSA 1LDKC 2LGKA 2YU4A 3ZTGA 5FG4A 2LQ6A 5AMFA 2UZGA 3GL6A 1WEOA 5BT4A 5CQ7A 5EP7A 5JI8A 4NYVA 4BW3A 2QICA 2VPGA 3ZYQA 2D9EA 2HYED 1FP0A 4HXSA 5A5QA 4O75A 2MNZA 4S3OB 4PCIA 5F62A 5DKHA 5A5SA 5I7YA 2L84A 2ECGA 5AIUA 2KREA 3GG3A 5C4QA 1Z60A 4QY4A 2AN6A 3ASLA 5D3LA 4YAXA 5EWVA 5DLXA 4A9OA 5JWMA 5D7XA 4KV4A 5EU1A 2BAYA 5ACYA 5FB0A 4IC3A 4O71A 5D1MB 4XYAA 4N4GA 4MEOA 5H85A 5A5PA 1WGMA 3UW9A 2VPEA 5DKDA 5ENHA 5I80A 4NN2A 2MIQA 5DYUA 4QNSA 2RNYA 1U6GB 4XI1A 5ENGA 2Y1NA 3MUKA 3LQHA 4YH4A 4J0RA 4PKLA 3M63A 4QEUA 3SOWA 3MB3A 5LJ2A 5C89A 4HXOA 5FBXA 3O35A 5FEYA 2LGLA 3L11A 3UVWA 2DKWA 1BORA 1CHCA 2F6NA 2VJFB 3AQAA 4YYHA 2VNFA 4GPJA 4LDFA 4O74A 4O7AA 4QEVA 4DONA 4I7CA 4CFKA 4V3KC 1HYIA 5DKCA 5AITA 1HYJA 4LC2A 3S91A 5A5NA 5HELA 4A4CA 4QSPA 5E73A 5F63A 2LGGA 3ZVZB 2R0YA 5F3AA 5CRZA 1E4UA 4CFLA 2CKLA 4UIUA 2YQLA 3AADA 3P1FA 5AD2A 5IBNA 5AMEA 5B8DA 4TTEA 4X2IA 5A81A 2F42A 2ECWA 2K4DA 1FBVA 2LGVA 5E3GA 4NQNA 5EI4A 4FO9A 5FFYA 5C8GA 2OUOA 2NAAA 1WILA 5LKTA 4PCEA 1ZS5A 2M3HA 2MA5A 4J1PA 3PHDA 5I40A 2KFTA 2LDRA 5E9LA 3NG2A 4R7EA 5ENCA 4UP0A 5FE1A 3JVKA 5C87A 5I7XA 4UYFA 1EQFA 5HM0A 2DVSA 5CPEA 5HRWA 2E6RA 4UI9B 5DFCA 4Q6FA 2L5UA 5CP5A 5CY9A 4F52B 3LQJA 4B7YC 3DWYA 4LRGA 5HJCA 3S92A 5I1QA 4CL9A 4A49A 4YYIA 1XWHA 4A9EA 4IOQA 5DFDA 2CT2A 2G6QA 2JMJA 2L80A 4GNFA 5L98A 2MD8C 5EA1A 5ETDA 2KE1A 5B77A 2KR4A 3IU6A 2VPDA 2Y43A 5F1LA 4TZ2A 1WEVA 5D24A 5HQ5A 4BBQA 5II2A 4LR6A 5I3LA 4QB3A 4C66A 5DFBA 2WP1A 4ZC9A 3KV6A 4LYSA 2E7NA 2F6JA 4WHUA 4YYJA 5E74A 2YT5A 2EGPA 5FB1A 4MENA 4A9HA 5IGKA 5CQ5A 5DYCA 2CKLB 2RNWA 4A9IA 5D3TA 5HLSA 5B76A 1N72A 5FE4A 2CSZA 3MHHA 5EK9A 4YYDA 5CQAA 5ENFA 2JRJA 4WZ0A 4QSXA 1WENA 5FDZA 4W4UA 2YSJA 4E96A 5IGLA 1WEEA 4AP4A 2FUIA 4TYLA 2YEKA 4A9JA 2JMIA 4QSQA 4IORA 4MR4A 3K2JA 4YY4A 4LADB 5D3NA 4NUEA 2L43A 2DVQA 4UIZA 4YK0A 4UITA 4QSTA 1JSPB 4UYFB 3RPGC 4Z93A 5LCWB 4UYDA 2VJFA 2FSAA 4O7EA 4O7CA 5CQ3A 5HRVA 4NRCA 5I86A 2M85A 2YSMA 3N9NA 5KH9A 5E9IA 5FH7A 5HEMA 2YELA 3ZYUA 5EWDA 4Y03A 4QSSA 4MR5A 2VJEB 2KGIA 3HCUA 4BHWA 5CUBA 3N9PA 4O64A 5ENBA 4WIVA 4NXJA 2OO1A 4V3LC 4LLBA 5TABA 5A83A 3ZNIA 1X0JA 2DATA 4QSUA 4A9KA 1MM3A 4CUUA 4XY9A 2KYUA 1JM7B 5E9KA 4BJXA 5BT5A 3SVHA 3O36A 5E9VA 5E7DA 2KWOA 2MJVB 3SOUA 4LKAA 4ALGA 2YQMA 4FJCA 5G0FA 5D25A 4YC9A 1ZBDB 5CTLA 5E9YA 4UYEA 4YBMA 2K17A 5D0CA 2RI7A 2L0BA 5EPSA 4R2YA 4CCGX 3P1EA 2OXQC 2K16A 4A9MA 4NUDA 5LKZA 3U5KA 4Z6HA 5EYAF 5CS8A 2D82A 4QSVA 3P1CA 1WUGA 4QC3A 4YY6A 3SHBA 5G04B 5D3PA 5FE2A 4LYIA 3SVGA 5KU3A 2PNXA 5A5RA 2DVRA 4UIYA 3RCWA 5LUUA 4YADA 1T1HA 2YHOA 5FERA 3Q2FA 5IGNA 3L1XA 4NRBA 4Z6IA 3HMFA 4F3IA 2DX8A 3D7CA 4J3IA 4QYLA 5LJ0A 4QUTA 5DBMA 4A9LA 5DW1A 5ENEA 2XB1A 4TS8A 3HTKC 2LRIC 5I29A 2YEMA 4NYWA 4LYWA 4CLBA 2MD7B 2WP2A 4ZQLA 4YYGA 5FE7A 1VYXA 3VK6A 5L8TA 5TBNA 5JG6A 5J0DA 3LXJA 3QZVA 2L5EA 4BW1A 5CU8A 3GV4A 4Z1SA 1JM4B 2H0DA 3HCSA 4PY6A 4NYXA 3RTRB 3T6RA 5FH8A 5H1TA 3P5OA 5E9MA 2KTBB 4UIVA 2LSPB 1Z6UA 2KWJA 5DYXA 2ZETC 4AUQB 5D1LB 4YATA 3U5JA 3HMHA 5A7CA 5D26A 2JMDA 2YUCA 4GNEA 4WA6A 2LXHC 4HBVA 5EISA 4C9ZA 2DVVA 3LJWA 5KTXA 2L75A 5HENA 1LDJB 2KIZA 5ENJA 2Y1MA 5C13A 2G4AA 5CGPA 5E3DA 5F25A 5FE6A 4QC1A 5EQ1A 4QR3A 3UVYA 1DVPA 2YREA 4IC2A 3DPLR 4LK9A 4MR6A 4TU6A 2R0VA 2VJEA 5E0RA 3PURA 2MNYA 4UIWA 4MVTA 2M1RA 5TDRA 2YYNA 1WEUA 5D3JA 4NR5A 3FL2A 4UYHA 2L85A 5CUGA 4XY8A 4YBTA 5CQ4A 4LJNA 4CUQA 3M99A 2GRCA 4LZRA 3LQIA 4HXKA 1JM7A 1F68A 2EA6A 3I2DA 5CUDA 5CQ6A 5LVRA 3KV5A 5K29A 2KWNA 4C67A 1V87A 5DW2A 5FFVA 4CA1A 4OUFA 4NR7A 4TT2A 2YDWA 3I3JA 3N9LA 4XUAA 3UV2A 4TT4A 5G4SA 5FH6A 5TCMA 4R8PK 2YW5A 4NR9A 4A9FA 2H0DB 4I7DA 4MSXA 4AYCA 4TKPB 1WIMA 5CRMA 4QR5A 5CUEA 1WUMA 5EICA 4B86C 3QZTA 1F62A 4QF2A 2YHNA 4FK5A 5CZGA 4L58A 3UV5A 3RPGB 4O76A 3P1DA 5A82A 3U5PA 5C11A 3SVFA 4QSRA 4QSWA 2YYRA 3IU5A 5D3SA 3O37A 5EWWA 5CFWA 2I50A 5LKXA 4O78A 2EODA 4QUUA 5F5ZA 4YYMA 4HXNA 2C2VS 5DX4A 4RVRA 4AVXA 3MQMA 5IIDA 3O70A 2XEUA 2RNXA 4ALHA 3U5NA 3ZVYA 4CURA 3UVXA 3KNVA 4YH3A 4IR6A 5DYAA 4ZW1A 3MULA 5II1A 5FE5A 1VD4A 4HBWA 1VFYA 2NXBA 2ECTA 2HDPA 3V43A 5AD3A 5KH3A 5HQ6A 4QYDA 3KQIA 5D3RA 5FE3A 5L97A 4YABA 3L1ZB 3O34A 4N3WA 5D1KB 2N9GA 4MEPA 5TB6A 5ETBA 5L8UA 5I88A 2LN0A 4HXMA 4N4HA 4I7BA 5CUAA 4BW4A 2OSSA 5FE9A 5FE0A
chains in the Genus database with same CATH superfamily
4FIPA 5HFRA 4NR4A 5DY7A 4OGEA 3O7AA 2ECNA 4Q0OA 4GNDA 4A0CD 2E6SA 5HRXA 4AYCB 4GNGA 4TU4A 2H60A 5EVAA 4NR6A 2MT5A 3JUEA 4IR3A 1X4JA 5HFQA 4O7BA 5LKUA 2MA6A 2QJ0A 5F2PA 5EV9A 4O7FA 2E61A 4NR8A 3O33A 5TRBA 3ZPV1 2R0SA 2LXPC 3SOXA 5DKAA 4CUTA 3UV4A 4UP5A 2I7KA 4UIXA 5EM3A 3N9QA 4NUCA 3KDEC 5F61A 5A85A 2QIZA 5FG5A 5FE8A 5F60A 4IOOA 3C5KA 3NXBA 2I8NA 5COIA 3MB4A 4N4IA 4TZ8A 4BW2A 5G05B 5A5OA 3EB6A 4S3OC 5KO4A 2CSYA 2ECIA 4TT6A 2MUMA 4O70A 5CQTA 4KV1A 5DLZA 4LZ2A 3Q2EA 4WHWA 1DCQA 4HXPA 5L99A 5CUCA 3G0JA 4IR4A 4J0SA 3ONIA 4O72A 3U5LA 2D8SA 2XOCA 4X3GA 2C2LA 5KTWA 4PS5A 3HMEA 4PTBA 5LJ1A 1PUOA 5KH7A 4WZ2A 4N4FA 4MEQA 5TDWA 5FFWA 4CUSA 4NQMA 2YW8A 4O77A 2KKYA 5HQ7A 2DWWA 5C85A 3MHSA 2IDAA 4UYGA 4MR3A 2KKXA 3T7LA 5KTUA 5H1UA 3JVJA 4AI6A 2ECVA 4WZ3B 2RS9B 4OGIA 5I83A 3LVRE 5SVXA 5B78A 5LVQA 2JUNA 4HBYA 5EWCA 2CRWA 3M62A 2LV9A 5FG6A 3FM8C 4QF3A 4QR4A 2PUYA 5DINA 5H9MA 2KU3A 5KHMA 2EGMA 3C6WA 4TQNA 4XUBA 5J3XA 4A9NA 3UVDA 2KWKA 2RO1A 2YQDA 3DQVR 4LZSA 4PPEA 4ZUXU 4OGJA 2FUUA 1WEQA 5D3HA 4IR5A 3ZPVE 2R10A 4P5OB 2EJNA 5I89A 3JVMA 1WEWA 3HCTA 4QEWA 3FKMX 2G43A 5IGMA 1N87A 5EPBA 2E7OA 4HXLA 4YBSA 5B79A 4HBXA 4NRAA 2M6MA 4QZSA 4A4BA 4L7XA 5HCLA 1IYMA 2E3KA 5L96A 3LDYA 5EPRA 2RFJA 5F1HA 3EB5A 1X4UA 2G45A 3FEHA 3U5OA 1WFKA 4YYNA 3N9OA 1Z2QA 3G0LA 3JVLA 3D1DA 3DAIA 4Q0NA 5CQ8A 3TLPA 1WESA 3U5MA 3N9MA 1WEPA 5F36A 1JOCA 5G4RA 4YYKA 2RSDA 3PUQA 1RMDA 5EWHA 2ECJA 2VP7A 1G25A 1WE9A 4ZDTA 5H1VA 5C7NA 1WEMA 2VPBA 4AKNA 1X4IA 5EGUA 5BT3A 2D8UA 3VKHA 5IG6A 4FLPA 5ENIA 4NS5A 4GB0A 3MXFA 4KCXA 2K1JA 3LRQA 1E6IA 4CUPA 3LVQE 3IHPA 2YURA 4Z1QA 4HXRA 5B75A 4QBMA 2KGGA 1K2FA 1MM2A 4Z0OA 3QZSA 1LDKC 2LGKA 2YU4A 3ZTGA 5FG4A 2LQ6A 5AMFA 2UZGA 3GL6A 5SVIA 1WEOA 5BT4A 5CQ7A 5EP7A 5JI8A 4NYVA 4BW3A 2QICA 2VPGA 3ZYQA 2D9EA 2HYED 2IQJA 1FP0A 4HXSA 5A5QA 4O75A 2MNZA 4QQ4A 4S3OB 4PCIA 5F62A 5DKHA 5SVYA 5A5SA 3Q1DA 5I7YA 2L84A 2ECGA 5AIUA 2KREA 3GG3A 5C4QA 1Z60A 4QY4A 2AN6A 3ASLA 5D3LA 4YAXA 5EWVA 5DLXA 4A9OA 5JWMA 5D7XA 4KV4A 5EU1A 2BAYA 5ACYA 5FB0A 4IC3A 4O71A 5D1MB 4XYAA 4N4GA 4MEOA 5H85A 5A5PA 1WGMA 3UW9A 2VPEA 5DKDA 5ENHA 5I80A 4NN2A 2FD4A 2MIQA 5DYUA 4QNSA 2RNYA 1U6GB 4XI1A 5ENGA 2Y1NA 3MUKA 3LQHA 4YH4A 4J0RA 4PKLA 3M63A 2CRRA 4QEUA 3SOWA 3MB3A 5LJ2A 5C89A 4HXOA 5FBXA 3O35A 5FEYA 2LGLA 3L11A 3UVWA 2DKWA 1BORA 1CHCA 2F6NA 2VJFB 3AQAA 4YYHA 2VNFA 4GPJA 4LDFA 4O74A 4O7AA 4QEVA 4DONA 4I7CA 4CFKA 4V3KC 1HYIA 5DKCA 5AITA 1HYJA 4LC2A 3S91A 5A5NA 5HELA 5SVIB 4A4CA 1ZKRA 4QSPA 5E73A 4H9DA 5F63A 2CONA 2LGGA 3VKGA 3ZVZB 2R0YA 5F3AA 5CRZA 1E4UA 4CFLA 2CKLA 4UIUA 2YQLA 3AADA 3P1FA 5AD2A 5IBNA 4O62A 5AMEA 5B8DA 4TTEA 4X2IA 5A81A 2F42A 2ECWA 2K4DA 1FBVA 4OGCA 2XP0A 2LGVA 5E3GA 4NQNA 5EI4A 3FAOA 4AKHA 5FFYA 4FO9A 5C8GA 2OUOA 2NAAA 1WILA 5LKTA 4PCEA 1ZS5A 2M3HA 2MA5A 4J1PA 3PHDA 5I40A 2KFTA 2LDRA 5E9LA 3NG2A 4R7EA 5ENCA 4UP0A 5FE1A 3JVKA 5C87A 5I7XA 4UYFA 1EQFA 5HM0A 2DVSA 5CPEA 5HRWA 2E6RA 3E2DA 4UI9B 5DFCA 4Q6FA 2L5UA 5CP5A 5CY9A 4F52B 3LQJA 4B7YC 3DWYA 4LRGA 5HJCA 3S92A 5I1QA 4CL9A 4A49A 4YYIA 1XWHA 4A9EA 4IOQA 5DFDA 2CT2A 2FFWA 2G6QA 2JMJA 2L80A 5L98A 4GNFA 5EA1A 5ETDA 2KE1A 5B77A 2KR4A 3IU6A 2LAUA 2VPDA 2Y43A 3MDBC 5F1LA 4TZ2A 1WEVA 5D24A 5HQ5A 4BBQA 5II2A 4LR6A 5I3LA 4QB3A 4C66A 5DFBA 2WP1A 4ZC9A 3KV6A 3M7KA 4LYSA 2E7NA 2F6JA 4WHUA 4YYJA 5E74A 2YT5A 2EGPA 5FB1A 4MENA 4A9HA 5IGKA 5CQ5A 5DYCA 2CKLB 2RNWA 4A9IA 5D3TA 5HLSA 5B76A 1N72A 5FE4A 2CSZA 3MHHA 5EK9A 4YYDA 2RR4A 5CQAA 5ENFA 2JRJA 4WZ0A 4QSXA 1WENA 5FDZA 4W4UA 2YSJA 4E96A 5IGLA 1WEEA 4AP4A 2FUIA 4TYLA 2YEKA 4A9JA 2JMIA 4QSQA 4IORA 4MR4A 3K2JA 4YY4A 4LADB 5D3NA 4NUEA 2L43A 2DVQA 2L7PA 4UIZA 4YK0A 4UITA 4QSTA 1JSPB 4UYFB 3RPGC 4Z93A 5LCWB 4UYDA 2VJFA 1MBMA 2FSAA 4O7EA 4O7CA 5CQ3A 5HRVA 4NRCA 5I86A 2M85A 2YSMA 2YVRA 3N9NA 5KH9A 5E9IA 5FH7A 5HEMA 2YELA 3ZYUA 5EWDA 4Y03A 4QSSA 4MR5A 2VJEB 2B0OE 2KGIA 3HCUA 4BHWA 5CUBA 3N9PA 4O64A 5ENBA 4AKGA 4WIVA 4NXJA 2OO1A 4V3LC 4LLBA 5TABA 5A83A 3ZNIA 1X0JA 2DATA 4QSUA 4A9KA 1MM3A 4CUUA 4XY9A 2KYUA 2MKEA 1JM7B 5E9KA 4BJXA 5K3QA 5BT5A 3SVHA 3O36A 5E9VA 5E7DA 3DWDA 2KWOA 2MJVB 3SOUA 4LKAA 4ALGA 2YQMA 4FJCA 5G0FA 5D25A 4YC9A 1ZBDB 5CTLA 5E9YA 4UYEA 4YBMA 2K17A 5D0CA 2RI7A 2L0BA 5EPSA 4R2YA 3H7HA 4CCGX 3P1EA 2OXQC 2K16A 4A9MA 4NUDA 3PLWA 5LKZA 4Z0RA 3U5KA 4Z6HA 5EYAF 5CS8A 2D82A 4QSVA 3P1CA 1WUGA 4QC3A 4YY6A 3SHBA 5G04B 5D3PA 5FE2A 4LYIA 3SVGA 5KU3A 2PNXA 5A5RA 2DVRA 4UIYA 3RCWA 5LUUA 4YADA 1T1HA 2YHOA 5FERA 3Q2FA 5IGNA 3L1XA 4NRBA 4Z6IA 3HMFA 4F3IA 2DX8A 3D7CA 4J3IA 4QYLA 3T9KA 5LJ0A 4QUTA 5DBMA 4A9LA 3FANA 5DW1A 5ENEA 2XB1A 4TS8A 3HTKC 2LRIC 5I29A 2YEMA 4NYWA 4LYWA 4CLBA 2MD7B 2WP2A 4ZQLA 4YYGA 5FE7A 1VYXA 2MD8C 5L8TA 3VK6A 5TBNA 5JG6A 5J0DA 3LXJA 3QZVA 2L5EA 4BW1A 5CU8A 3GV4A 4Z1SA 1JM4B 2H0DA 3HCSA 3ERRA 4PY6A 4NYXA 3RTRB 3T6RA 5FH8A 5H1TA 3P5OA 5E9MA 2KTBB 4UIVA 2LSPB 1Z6UA 2KWJA 5DYXA 2ZETC 4AUQB 5D1LB 4YATA 3U5JA 3HMHA 5A7CA 5D26A 2JMDA 2YUCA 4GNEA 4WA6A 2EXUA 2LXHC 4HBVA 5EISA 4C9ZA 2DVVA 3LJWA 5KTXA 2L75A 5HENA 1LDJB 2KIZA 5ENJA 2Y1MA 5C13A 2G4AA 5CGPA 5E3DA 5F25A 5FE6A 4QC1A 5EQ1A 4QR3A 3UVYA 1DVPA 2YREA 4IC2A 3DPLR 3O47A 4LK9A 4MR6A 4TU6A 2R0VA 2VJEA 5E0RA 3PURA 2MNYA 4UIWA 4MVTA 2M1RA 5TDRA 2YYNA 1WEUA 5D3JA 4NR5A 3FL2A 4UYHA 2L85A 5CUGA 4XY8A 2XOYA 4YBTA 5CQ4A 4LJNA 4CUQA 3M99A 2GRCA 4LZRA 3LQIA 4HXKA 1JM7A 1F68A 2EA6A 3I2DA 5CUDA 3LJUX 5CQ6A 5LVRA 3KV5A 5K29A 2KWNA 3FJUB 4C67A 1V87A 5DW2A 5FFVA 4CA1A 3SUBA 4OUFA 4NR7A 4TT2A 2YDWA 3I3JA 3N9LA 4XUAA 3UV2A 4TT4A 5G4SA 5FH6A 5TCMA 4R8PK 2YW5A 4NR9A 4A9FA 2H0DB 4I7DA 4MSXA 2P57A 4AYCA 4TKPB 1WIMA 5CRMA 4QR5A 5CUEA 1WUMA 5EICA 4B86C 3QZTA 1F62A 4F1PA 4QF2A 2YHNA 4FK5A 5CZGA 4L58A 3UV5A 3RPGB 4O76A 3P1DA 5A82A 3U5PA 5C11A 3SVFA 4QSRA 4QSWA 2YYRA 3IU5A 5D3SA 3O37A 5EWWA 5CFWA 2I50A 5LKXA 4O78A 2EODA 4QUUA 5F5ZA 4YYMA 4HXNA 4AKIA 2C2VS 5DX4A 4RVRA 2DSMA 4AVXA 3MQMA 5IIDA 3O70A 2M13A 2XEUA 2RNXA 4ALHA 3U5NA 2JM3A 4CURA 3ZVYA 3UVXA 3KNVA 4YH3A 4IR6A 5DYAA 4ZW1A 3MULA 2DJAA 5II1A 5FE5A 1VD4A 2OWAA 3DDTA 4HBWA 2XOZA 1VFYA 2NXBA 2ECTA 2HDPA 3V43A 5AD3A 5KH3A 5HQ6A 3D1BA 4QYDA 3KQIA 2CSVA 5D3RA 5FE3A 5L97A 4YABA 3L1ZB 3O34A 4N3WA 5D1KB 2N9GA 4MEPA 5TB6A 5ETBA 5L8UA 5I88A 2LN0A 4HXMA 4N4HA 4I7BA 5CUAA 4BW4A 2OSSA 5FE9A 5FE0A
chains in the Genus database with same CATH topology
4FIPA 5HFRA 4NR4A 5DY7A 3O7AA 2ECNA 4Q0OA 4GNDA 4A0CD 2E6SA 5HRXA 4AYCB 4GNGA 4TU4A 2H60A 5EVAA 4NR6A 2MT5A 4IR3A 1X4JA 5HFQA 4O7BA 5LKUA 2MA6A 2QJ0A 5F2PA 5EV9A 4O7FA 4NR8A 3O33A 5TRBA 3ZPV1 2R0SA 2LXPC 3SOXA 5DKAA 4CUTA 3UV4A 4UP5A 2I7KA 4UIXA 5EM3A 3N9QA 4NUCA 5F61A 5A85A 2QIZA 5FG5A 5FE8A 5F60A 4IOOA 3C5KA 3NXBA 2I8NA 5COIA 3MB4A 4N4IA 4TZ8A 4BW2A 5G05B 5A5OA 3EB6A 4S3OC 5KO4A 2CSYA 2ECIA 4TT6A 2MUMA 4O70A 5CQTA 4KV1A 5DLZA 4LZ2A 3Q2EA 4WHWA 4HXPA 5L99A 5CUCA 3G0JA 4IR4A 4J0SA 3ONIA 4O72A 3U5LA 2D8SA 4X3GA 2C2LA 5KTWA 4PS5A 3HMEA 4PTBA 5LJ1A 5KH7A 4WZ2A 4N4FA 4MEQA 5TDWA 5FFWA 4CUSA 4NQMA 2YW8A 4O77A 5HQ7A 2DWWA 5C85A 3MHSA 2IDAA 4UYGA 4MR3A 3T7LA 5KTUA 5H1UA 3JVJA 2ECVA 4WZ3B 2RS9B 4OGIA 5I83A 5B78A 5LVQA 4HBYA 5EWCA 3M62A 2LV9A 5FG6A 4QF3A 4QR4A 2PUYA 5DINA 5H9MA 2KU3A 5KHMA 3C6WA 4TQNA 4XUBA 5J3XA 4A9NA 3UVDA 2KWKA 2RO1A 2YQDA 3DQVR 4LZSA 4PPEA 4ZUXU 4OGJA 2FUUA 1WEQA 5D3HA 4IR5A 3ZPVE 2R10A 4P5OB 5I89A 3JVMA 1WEWA 3HCTA 4QEWA 3FKMX 2G43A 5IGMA 1N87A 5EPBA 2E7OA 4HXLA 4YBSA 5B79A 4HBXA 4NRAA 2M6MA 4QZSA 4A4BA 4L7XA 5HCLA 1IYMA 2E3KA 5L96A 5EPRA 2RFJA 5F1HA 3EB5A 1X4UA 2G45A 3U5OA 1WFKA 4YYNA 3N9OA 1Z2QA 3G0LA 3JVLA 3DAIA 4Q0NA 5CQ8A 3TLPA 1WESA 3U5MA 3N9MA 1WEPA 5F36A 1JOCA 5G4RA 4YYKA 2RSDA 3PUQA 1RMDA 5EWHA 2ECJA 2VP7A 1G25A 1WE9A 4ZDTA 5H1VA 5C7NA 1WEMA 2VPBA 4AKNA 1X4IA 5EGUA 5BT3A 5IG6A 4FLPA 5ENIA 4NS5A 4GB0A 3MXFA 4KCXA 2K1JA 3LRQA 1E6IA 4CUPA 3IHPA 2YURA 4Z1QA 4HXRA 5B75A 4QBMA 2KGGA 1K2FA 1MM2A 3QZSA 1LDKC 2LGKA 2YU4A 3ZTGA 5FG4A 2LQ6A 5AMFA 2UZGA 3GL6A 1WEOA 5BT4A 5CQ7A 5EP7A 5JI8A 4NYVA 4BW3A 2QICA 2VPGA 3ZYQA 2D9EA 2HYED 1FP0A 4HXSA 5A5QA 4O75A 2MNZA 4S3OB 4PCIA 5F62A 5DKHA 5A5SA 5I7YA 2L84A 2ECGA 5AIUA 2KREA 3GG3A 5C4QA 1Z60A 4QY4A 2AN6A 3ASLA 5D3LA 4YAXA 5EWVA 5DLXA 4A9OA 5JWMA 5D7XA 4KV4A 5EU1A 2BAYA 5ACYA 5FB0A 4IC3A 4O71A 5D1MB 4XYAA 4N4GA 4MEOA 5H85A 5A5PA 1WGMA 3UW9A 2VPEA 5DKDA 5ENHA 5I80A 4NN2A 2MIQA 5DYUA 4QNSA 2RNYA 1U6GB 4XI1A 5ENGA 2Y1NA 3MUKA 3LQHA 4YH4A 4J0RA 4PKLA 3M63A 4QEUA 3SOWA 3MB3A 5LJ2A 5C89A 4HXOA 5FBXA 3O35A 5FEYA 2LGLA 3L11A 3UVWA 2DKWA 1BORA 1CHCA 2F6NA 2VJFB 3AQAA 4YYHA 2VNFA 4GPJA 4LDFA 4O74A 4O7AA 4QEVA 4DONA 4I7CA 4CFKA 4V3KC 1HYIA 5DKCA 5AITA 1HYJA 4LC2A 3S91A 5A5NA 5HELA 4A4CA 4QSPA 5E73A 5F63A 2LGGA 3ZVZB 2R0YA 5F3AA 5CRZA 1E4UA 4CFLA 2CKLA 4UIUA 2YQLA 3AADA 3P1FA 5AD2A 5IBNA 5AMEA 5B8DA 4TTEA 4X2IA 5A81A 2F42A 2ECWA 2K4DA 1FBVA 2LGVA 5E3GA 4NQNA 5EI4A 4FO9A 5FFYA 5C8GA 2OUOA 2NAAA 1WILA 5LKTA 4PCEA 1ZS5A 2M3HA 2MA5A 4J1PA 3PHDA 5I40A 2KFTA 2LDRA 5E9LA 3NG2A 4R7EA 5ENCA 4UP0A 5FE1A 3JVKA 5C87A 5I7XA 4UYFA 1EQFA 5HM0A 2DVSA 5CPEA 5HRWA 2E6RA 4UI9B 5DFCA 4Q6FA 2L5UA 5CP5A 5CY9A 4F52B 3LQJA 4B7YC 3DWYA 4LRGA 5HJCA 3S92A 5I1QA 4CL9A 4A49A 4YYIA 1XWHA 4A9EA 4IOQA 5DFDA 2CT2A 2G6QA 2JMJA 2L80A 4GNFA 5L98A 2MD8C 5EA1A 5ETDA 2KE1A 5B77A 2KR4A 3IU6A 2VPDA 2Y43A 5F1LA 4TZ2A 1WEVA 5D24A 5HQ5A 4BBQA 5II2A 4LR6A 5I3LA 4QB3A 4C66A 5DFBA 2WP1A 4ZC9A 3KV6A 4LYSA 2E7NA 2F6JA 4WHUA 4YYJA 5E74A 2YT5A 2EGPA 5FB1A 4MENA 4A9HA 5IGKA 5CQ5A 5DYCA 2CKLB 2RNWA 4A9IA 5D3TA 5HLSA 5B76A 1N72A 5FE4A 2CSZA 3MHHA 5EK9A 4YYDA 5CQAA 5ENFA 2JRJA 4WZ0A 4QSXA 1WENA 5FDZA 4W4UA 2YSJA 4E96A 5IGLA 1WEEA 4AP4A 2FUIA 4TYLA 2YEKA 4A9JA 2JMIA 4QSQA 4IORA 4MR4A 3K2JA 4YY4A 4LADB 5D3NA 4NUEA 2L43A 2DVQA 4UIZA 4YK0A 4UITA 4QSTA 1JSPB 4UYFB 3RPGC 4Z93A 5LCWB 4UYDA 2VJFA 2FSAA 4O7EA 4O7CA 5CQ3A 5HRVA 4NRCA 5I86A 2M85A 2YSMA 3N9NA 5KH9A 5E9IA 5FH7A 5HEMA 2YELA 3ZYUA 5EWDA 4Y03A 4QSSA 4MR5A 2VJEB 2KGIA 3HCUA 4BHWA 5CUBA 3N9PA 4O64A 5ENBA 4WIVA 4NXJA 2OO1A 4V3LC 4LLBA 5TABA 5A83A 3ZNIA 1X0JA 2DATA 4QSUA 4A9KA 1MM3A 4CUUA 4XY9A 2KYUA 1JM7B 5E9KA 4BJXA 5BT5A 3SVHA 3O36A 5E9VA 5E7DA 2KWOA 2MJVB 3SOUA 4LKAA 4ALGA 2YQMA 4FJCA 5G0FA 5D25A 4YC9A 1ZBDB 5CTLA 5E9YA 4UYEA 4YBMA 2K17A 5D0CA 2RI7A 2L0BA 5EPSA 4R2YA 4CCGX 3P1EA 2OXQC 2K16A 4A9MA 4NUDA 5LKZA 3U5KA 4Z6HA 5EYAF 5CS8A 2D82A 4QSVA 3P1CA 1WUGA 4QC3A 4YY6A 3SHBA 5G04B 5D3PA 5FE2A 4LYIA 3SVGA 5KU3A 2PNXA 5A5RA 2DVRA 4UIYA 3RCWA 5LUUA 4YADA 1T1HA 2YHOA 5FERA 3Q2FA 5IGNA 3L1XA 4NRBA 4Z6IA 3HMFA 4F3IA 2DX8A 3D7CA 4J3IA 4QYLA 5LJ0A 4QUTA 5DBMA 4A9LA 5DW1A 5ENEA 2XB1A 4TS8A 3HTKC 2LRIC 5I29A 2YEMA 4NYWA 4LYWA 4CLBA 2MD7B 2WP2A 4ZQLA 4YYGA 5FE7A 1VYXA 3VK6A 5L8TA 5TBNA 5JG6A 5J0DA 3LXJA 3QZVA 2L5EA 4BW1A 5CU8A 3GV4A 4Z1SA 1JM4B 2H0DA 3HCSA 4PY6A 4NYXA 3RTRB 3T6RA 5FH8A 5H1TA 3P5OA 5E9MA 2KTBB 4UIVA 2LSPB 1Z6UA 2KWJA 5DYXA 2ZETC 4AUQB 5D1LB 4YATA 3U5JA 3HMHA 5A7CA 5D26A 2JMDA 2YUCA 4GNEA 4WA6A 2LXHC 4HBVA 5EISA 4C9ZA 2DVVA 3LJWA 5KTXA 2L75A 5HENA 1LDJB 2KIZA 5ENJA 2Y1MA 5C13A 2G4AA 5CGPA 5E3DA 5F25A 5FE6A 4QC1A 5EQ1A 4QR3A 3UVYA 1DVPA 2YREA 4IC2A 3DPLR 4LK9A 4MR6A 4TU6A 2R0VA 2VJEA 5E0RA 3PURA 2MNYA 4UIWA 4MVTA 2M1RA 5TDRA 2YYNA 1WEUA 5D3JA 4NR5A 3FL2A 4UYHA 2L85A 5CUGA 4XY8A 4YBTA 5CQ4A 4LJNA 4CUQA 3M99A 2GRCA 4LZRA 3LQIA 4HXKA 1JM7A 1F68A 2EA6A 3I2DA 5CUDA 5CQ6A 5LVRA 3KV5A 5K29A 2KWNA 4C67A 1V87A 5DW2A 5FFVA 4CA1A 4OUFA 4NR7A 4TT2A 2YDWA 3I3JA 3N9LA 4XUAA 3UV2A 4TT4A 5G4SA 5FH6A 5TCMA 4R8PK 2YW5A 4NR9A 4A9FA 2H0DB 4I7DA 4MSXA 4AYCA 4TKPB 1WIMA 5CRMA 4QR5A 5CUEA 1WUMA 5EICA 4B86C 3QZTA 1F62A 4QF2A 2YHNA 4FK5A 5CZGA 4L58A 3UV5A 3RPGB 4O76A 3P1DA 5A82A 3U5PA 5C11A 3SVFA 4QSRA 4QSWA 2YYRA 3IU5A 5D3SA 3O37A 5EWWA 5CFWA 2I50A 5LKXA 4O78A 2EODA 4QUUA 5F5ZA 4YYMA 4HXNA 2C2VS 5DX4A 4RVRA 4AVXA 3MQMA 5IIDA 3O70A 2XEUA 2RNXA 4ALHA 3U5NA 3ZVYA 4CURA 3UVXA 3KNVA 4YH3A 4IR6A 5DYAA 4ZW1A 3MULA 5II1A 5FE5A 1VD4A 4HBWA 1VFYA 2NXBA 2ECTA 2HDPA 3V43A 5AD3A 5KH3A 5HQ6A 4QYDA 3KQIA 5D3RA 5FE3A 5L97A 4YABA 3L1ZB 3O34A 4N3WA 5D1KB 2N9GA 4MEPA 5TB6A 5ETBA 5L8UA 5I88A 2LN0A 4HXMA 4N4HA 4I7BA 5CUAA 4BW4A 2OSSA 5FE9A 5FE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIP A;  5HFR A;  4NR4 A;  5DY7 A;  3O7A A;  2ECN A;  4Q0O A;  4GND A;  4A0C D;  2E6S A;  5HRX A;  4AYC B;  4GNG A;  4TU4 A;  2H60 A;  5EVA A;  4NR6 A;  2MT5 A;  4IR3 A;  1X4J A;  5HFQ A;  4O7B A;  5LKU A;  2MA6 A;  2QJ0 A;  5F2P A;  5EV9 A;  4O7F A;  4NR8 A;  3O33 A;  5TRB A;  3ZPV 1;  2R0S A;  2LXP C;  3SOX A;  5DKA A;  4CUT A;  3UV4 A;  4UP5 A;  2I7K A;  4UIX A;  5EM3 A;  3N9Q A;  4NUC A;  5F61 A;  5A85 A;  2QIZ A;  5FG5 A;  5FE8 A;  5F60 A;  4IOO A;  3C5K A;  3NXB A;  2I8N A;  5COI A;  3MB4 A;  4N4I A;  4TZ8 A;  4BW2 A;  5G05 B;  5A5O A;  3EB6 A;  4S3O C;  5KO4 A;  2CSY A;  2ECI A;  4TT6 A;  2MUM A;  4O70 A;  5CQT A;  4KV1 A;  5DLZ A;  4LZ2 A;  3Q2E A;  4WHW A;  4HXP A;  5L99 A;  5CUC A;  3G0J A;  4IR4 A;  4J0S A;  3ONI A;  4O72 A;  3U5L A;  2D8S A;  4X3G A;  2C2L A;  5KTW A;  4PS5 A;  3HME A;  4PTB A;  5LJ1 A;  5KH7 A;  4WZ2 A;  4N4F A;  4MEQ A;  5TDW A;  5FFW A;  4CUS A;  4NQM A;  2YW8 A;  4O77 A;  5HQ7 A;  2DWW A;  5C85 A;  3MHS A;  2IDA A;  4UYG A;  4MR3 A;  3T7L A;  5KTU A;  5H1U A;  3JVJ A;  2ECV A;  4WZ3 B;  2RS9 B;  4OGI A;  5I83 A;  5B78 A;  5LVQ A;  4HBY A;  5EWC A;  3M62 A;  2LV9 A;  5FG6 A;  4QF3 A;  4QR4 A;  2PUY A;  5DIN A;  5H9M A;  2KU3 A;  5KHM A;  3C6W A;  4TQN A;  4XUB A;  5J3X A;  4A9N A;  3UVD A;  2KWK A;  2RO1 A;  2YQD A;  3DQV R;  4LZS A;  4PPE A;  4ZUX U;  4OGJ A;  2FUU A;  1WEQ A;  5D3H A;  4IR5 A;  3ZPV E;  2R10 A;  4P5O B;  5I89 A;  3JVM A;  1WEW A;  3HCT A;  4QEW A;  3FKM X;  2G43 A;  5IGM A;  1N87 A;  5EPB A;  2E7O A;  4HXL A;  4YBS A;  5B79 A;  4HBX A;  4NRA A;  2M6M A;  4QZS A;  4A4B A;  4L7X A;  5HCL A;  1IYM A;  2E3K A;  5L96 A;  5EPR A;  2RFJ A;  5F1H A;  3EB5 A;  1X4U A;  2G45 A;  3U5O A;  1WFK A;  4YYN A;  3N9O A;  1Z2Q A;  3G0L A;  3JVL A;  3DAI A;  4Q0N A;  5CQ8 A;  3TLP A;  1WES A;  3U5M A;  3N9M A;  1WEP A;  5F36 A;  1JOC A;  5G4R A;  4YYK A;  2RSD A;  3PUQ A;  1RMD A;  5EWH A;  2ECJ A;  2VP7 A;  1G25 A;  1WE9 A;  4ZDT A;  5H1V A;  5C7N A;  1WEM A;  2VPB A;  4AKN A;  1X4I A;  5EGU A;  5BT3 A;  5IG6 A;  4FLP A;  5ENI A;  4NS5 A;  4GB0 A;  3MXF A;  4KCX A;  2K1J A;  3LRQ A;  1E6I A;  4CUP A;  3IHP A;  2YUR A;  4Z1Q A;  4HXR A;  5B75 A;  4QBM A;  2KGG A;  1K2F A;  1MM2 A;  3QZS A;  1LDK C;  2LGK A;  2YU4 A;  3ZTG A;  5FG4 A;  2LQ6 A;  5AMF A;  2UZG A;  3GL6 A;  1WEO A;  5BT4 A;  5CQ7 A;  5EP7 A;  5JI8 A;  4NYV A;  4BW3 A;  2QIC A;  2VPG A;  3ZYQ A;  2D9E A;  2HYE D;  1FP0 A;  4HXS A;  5A5Q A;  4O75 A;  2MNZ A;  4S3O B;  4PCI A;  5F62 A;  5DKH A;  5A5S A;  5I7Y A;  2L84 A;  2ECG A;  5AIU A;  2KRE A;  3GG3 A;  5C4Q A;  1Z60 A;  4QY4 A;  2AN6 A;  3ASL A;  5D3L A;  4YAX A;  5EWV A;  5DLX A;  4A9O A;  5JWM A;  5D7X A;  4KV4 A;  5EU1 A;  2BAY A;  5ACY A;  5FB0 A;  4IC3 A;  4O71 A;  5D1M B;  4XYA A;  4N4G A;  4MEO A;  5H85 A;  5A5P A;  1WGM A;  3UW9 A;  2VPE A;  5DKD A;  5ENH A;  5I80 A;  4NN2 A;  2MIQ A;  5DYU A;  4QNS A;  2RNY A;  1U6G B;  4XI1 A;  5ENG A;  2Y1N A;  3MUK A;  3LQH A;  4YH4 A;  4J0R A;  4PKL A;  3M63 A;  4QEU A;  3SOW A;  3MB3 A;  5LJ2 A;  5C89 A;  4HXO A;  5FBX A;  3O35 A;  5FEY A;  2LGL A;  3L11 A;  3UVW A;  2DKW A;  1BOR A;  1CHC A;  2F6N A;  2VJF B;  3AQA A;  4YYH A;  2VNF A;  4GPJ A;  4LDF A;  4O74 A;  4O7A A;  4QEV A;  4DON A;  4I7C A;  4CFK A;  4V3K C;  1HYI A;  5DKC A;  5AIT A;  1HYJ A;  4LC2 A;  3S91 A;  5A5N A;  5HEL A;  4A4C A;  4QSP A;  5E73 A;  5F63 A;  2LGG A;  3ZVZ B;  2R0Y A;  5F3A A;  5CRZ A;  1E4U A;  4CFL A;  2CKL A;  4UIU A;  2YQL A;  3AAD A;  3P1F A;  5AD2 A;  5IBN A;  5AME A;  5B8D A;  4TTE A;  4X2I A;  5A81 A;  2F42 A;  2ECW A;  2K4D A;  1FBV A;  2LGV A;  5E3G A;  4NQN A;  5EI4 A;  4FO9 A;  5FFY A;  5C8G A;  2OUO A;  2NAA A;  1WIL A;  5LKT A;  4PCE A;  1ZS5 A;  2M3H A;  2MA5 A;  4J1P A;  3PHD A;  5I40 A;  2KFT A;  2LDR A;  5E9L A;  3NG2 A;  4R7E A;  5ENC A;  4UP0 A;  5FE1 A;  3JVK A;  5C87 A;  5I7X A;  4UYF A;  1EQF A;  5HM0 A;  2DVS A;  5CPE A;  5HRW A;  2E6R A;  4UI9 B;  5DFC A;  4Q6F A;  2L5U A;  5CP5 A;  5CY9 A;  4F52 B;  3LQJ A;  4B7Y C;  3DWY A;  4LRG A;  5HJC A;  3S92 A;  5I1Q A;  4CL9 A;  4A49 A;  4YYI A;  1XWH A;  4A9E A;  4IOQ A;  5DFD A;  2CT2 A;  2G6Q A;  2JMJ A;  2L80 A;  4GNF A;  5L98 A;  2MD8 C;  5EA1 A;  5ETD A;  2KE1 A;  5B77 A;  2KR4 A;  3IU6 A;  2VPD A;  2Y43 A;  5F1L A;  4TZ2 A;  1WEV A;  5D24 A;  5HQ5 A;  4BBQ A;  5II2 A;  4LR6 A;  5I3L A;  4QB3 A;  4C66 A;  5DFB A;  2WP1 A;  4ZC9 A;  3KV6 A;  4LYS A;  2E7N A;  2F6J A;  4WHU A;  4YYJ A;  5E74 A;  2YT5 A;  2EGP A;  5FB1 A;  4MEN A;  4A9H A;  5IGK A;  5CQ5 A;  5DYC A;  2CKL B;  2RNW A;  4A9I A;  5D3T A;  5HLS A;  5B76 A;  1N72 A;  5FE4 A;  2CSZ A;  3MHH A;  5EK9 A;  4YYD A;  5CQA A;  5ENF A;  2JRJ A;  4WZ0 A;  4QSX A;  1WEN A;  5FDZ A;  4W4U A;  2YSJ A;  4E96 A;  5IGL A;  1WEE A;  4AP4 A;  2FUI A;  4TYL A;  2YEK A;  4A9J A;  2JMI A;  4QSQ A;  4IOR A;  4MR4 A;  3K2J A;  4YY4 A;  4LAD B;  5D3N A;  4NUE A;  2L43 A;  2DVQ A;  4UIZ A;  4YK0 A;  4UIT A;  4QST A;  1JSP B;  4UYF B;  3RPG C;  4Z93 A;  5LCW B;  4UYD A;  2VJF A;  2FSA A;  4O7E A;  4O7C A;  5CQ3 A;  5HRV A;  4NRC A;  5I86 A;  2M85 A;  2YSM A;  3N9N A;  5KH9 A;  5E9I A;  5FH7 A;  5HEM A;  2YEL A;  3ZYU A;  5EWD A;  4Y03 A;  4QSS A;  4MR5 A;  2VJE B;  2KGI A;  3HCU A;  4BHW A;  5CUB A;  3N9P A;  4O64 A;  5ENB A;  4WIV A;  4NXJ A;  2OO1 A;  4V3L C;  4LLB A;  5TAB A;  5A83 A;  3ZNI A;  1X0J A;  2DAT A;  4QSU A;  4A9K A;  1MM3 A;  4CUU A;  4XY9 A;  2KYU A;  1JM7 B;  5E9K A;  4BJX A;  5BT5 A;  3SVH A;  3O36 A;  5E9V A;  5E7D A;  2KWO A;  2MJV B;  3SOU A;  4LKA A;  4ALG A;  2YQM A;  4FJC A;  5G0F A;  5D25 A;  4YC9 A;  1ZBD B;  5CTL A;  5E9Y A;  4UYE A;  4YBM A;  2K17 A;  5D0C A;  2RI7 A;  2L0B A;  5EPS A;  4R2Y A;  4CCG X;  3P1E A;  2OXQ C;  2K16 A;  4A9M A;  4NUD A;  5LKZ A;  3U5K A;  4Z6H A;  5EYA F;  5CS8 A;  2D82 A;  4QSV A;  3P1C A;  1WUG A;  4QC3 A;  4YY6 A;  3SHB A;  5G04 B;  5D3P A;  5FE2 A;  4LYI A;  3SVG A;  5KU3 A;  2PNX A;  5A5R A;  2DVR A;  4UIY A;  3RCW A;  5LUU A;  4YAD A;  1T1H A;  2YHO A;  5FER A;  3Q2F A;  5IGN A;  3L1X A;  4NRB A;  4Z6I A;  3HMF A;  4F3I A;  2DX8 A;  3D7C A;  4J3I A;  4QYL A;  5LJ0 A;  4QUT A;  5DBM A;  4A9L A;  5DW1 A;  5ENE A;  2XB1 A;  4TS8 A;  3HTK C;  2LRI C;  5I29 A;  2YEM A;  4NYW A;  4LYW A;  4CLB A;  2MD7 B;  2WP2 A;  4ZQL A;  4YYG A;  5FE7 A;  1VYX A;  3VK6 A;  5L8T A;  5TBN A;  5JG6 A;  5J0D A;  3LXJ A;  3QZV A;  2L5E A;  4BW1 A;  5CU8 A;  3GV4 A;  4Z1S A;  1JM4 B;  2H0D A;  3HCS A;  4PY6 A;  4NYX A;  3RTR B;  3T6R A;  5FH8 A;  5H1T A;  3P5O A;  5E9M A;  2KTB B;  4UIV A;  2LSP B;  1Z6U A;  2KWJ A;  5DYX A;  2ZET C;  4AUQ B;  5D1L B;  4YAT A;  3U5J A;  3HMH A;  5A7C A;  5D26 A;  2JMD A;  2YUC A;  4GNE A;  4WA6 A;  2LXH C;  4HBV A;  5EIS A;  4C9Z A;  2DVV A;  3LJW A;  5KTX A;  2L75 A;  5HEN A;  1LDJ B;  2KIZ A;  5ENJ A;  2Y1M A;  5C13 A;  2G4A A;  5CGP A;  5E3D A;  5F25 A;  5FE6 A;  4QC1 A;  5EQ1 A;  4QR3 A;  3UVY A;  1DVP A;  2YRE A;  4IC2 A;  3DPL R;  4LK9 A;  4MR6 A;  4TU6 A;  2R0V A;  2VJE A;  5E0R A;  3PUR A;  2MNY A;  4UIW A;  4MVT A;  2M1R A;  5TDR A;  2YYN A;  1WEU A;  5D3J A;  4NR5 A;  3FL2 A;  4UYH A;  2L85 A;  5CUG A;  4XY8 A;  4YBT A;  5CQ4 A;  4LJN A;  4CUQ A;  3M99 A;  2GRC A;  4LZR A;  3LQI A;  4HXK A;  1JM7 A;  1F68 A;  2EA6 A;  3I2D A;  5CUD A;  5CQ6 A;  5LVR A;  3KV5 A;  5K29 A;  2KWN A;  4C67 A;  1V87 A;  5DW2 A;  5FFV A;  4CA1 A;  4OUF A;  4NR7 A;  4TT2 A;  2YDW A;  3I3J A;  3N9L A;  4XUA A;  3UV2 A;  4TT4 A;  5G4S A;  5FH6 A;  5TCM A;  4R8P K;  2YW5 A;  4NR9 A;  4A9F A;  2H0D B;  4I7D A;  4MSX A;  4AYC A;  4TKP B;  1WIM A;  5CRM A;  4QR5 A;  5CUE A;  1WUM A;  5EIC A;  4B86 C;  3QZT A;  1F62 A;  4QF2 A;  2YHN A;  4FK5 A;  5CZG A;  4L58 A;  3UV5 A;  3RPG B;  4O76 A;  3P1D A;  5A82 A;  3U5P A;  5C11 A;  3SVF A;  4QSR A;  4QSW A;  2YYR A;  3IU5 A;  5D3S A;  3O37 A;  5EWW A;  5CFW A;  2I50 A;  5LKX A;  4O78 A;  2EOD A;  4QUU A;  5F5Z A;  4YYM A;  4HXN A;  2C2V S;  5DX4 A;  4RVR A;  4AVX A;  3MQM A;  5IID A;  3O70 A;  2XEU A;  2RNX A;  4ALH A;  3U5N A;  3ZVY A;  4CUR A;  3UVX A;  3KNV A;  4YH3 A;  4IR6 A;  5DYA A;  4ZW1 A;  3MUL A;  5II1 A;  5FE5 A;  1VD4 A;  4HBW A;  1VFY A;  2NXB A;  2ECT A;  2HDP A;  3V43 A;  5AD3 A;  5KH3 A;  5HQ6 A;  4QYD A;  3KQI A;  5D3R A;  5FE3 A;  5L97 A;  4YAB A;  3L1Z B;  3O34 A;  4N3W A;  5D1K B;  2N9G A;  4MEP A;  5TB6 A;  5ETB A;  5L8U A;  5I88 A;  2LN0 A;  4HXM A;  4N4H A;  4I7B A;  5CUA A;  4BW4 A;  2OSS A;  5FE9 A;  5FE0 A; 
#chains in the Genus database with same CATH topology
 4FIP A;  5HFR A;  4NR4 A;  5DY7 A;  4OGE A;  3O7A A;  2ECN A;  4Q0O A;  4GND A;  4A0C D;  2E6S A;  5HRX A;  4AYC B;  4GNG A;  4TU4 A;  2H60 A;  5EVA A;  4NR6 A;  2MT5 A;  3JUE A;  4IR3 A;  1X4J A;  5HFQ A;  4O7B A;  5LKU A;  2MA6 A;  2QJ0 A;  5F2P A;  5EV9 A;  4O7F A;  2E61 A;  4NR8 A;  3O33 A;  5TRB A;  3ZPV 1;  2R0S A;  2LXP C;  3SOX A;  5DKA A;  4CUT A;  3UV4 A;  4UP5 A;  2I7K A;  4UIX A;  5EM3 A;  3N9Q A;  4NUC A;  3KDE C;  5F61 A;  5A85 A;  2QIZ A;  5FG5 A;  5FE8 A;  5F60 A;  4IOO A;  3C5K A;  3NXB A;  2I8N A;  5COI A;  3MB4 A;  4N4I A;  4TZ8 A;  4BW2 A;  5G05 B;  5A5O A;  3EB6 A;  4S3O C;  5KO4 A;  2CSY A;  2ECI A;  4TT6 A;  2MUM A;  4O70 A;  5CQT A;  4KV1 A;  5DLZ A;  4LZ2 A;  3Q2E A;  4WHW A;  1DCQ A;  4HXP A;  5L99 A;  5CUC A;  3G0J A;  4IR4 A;  4J0S A;  3ONI A;  4O72 A;  3U5L A;  2D8S A;  2XOC A;  4X3G A;  2C2L A;  5KTW A;  4PS5 A;  3HME A;  4PTB A;  5LJ1 A;  1PUO A;  5KH7 A;  4WZ2 A;  4N4F A;  4MEQ A;  5TDW A;  5FFW A;  4CUS A;  4NQM A;  2YW8 A;  4O77 A;  2KKY A;  5HQ7 A;  2DWW A;  5C85 A;  3MHS A;  2IDA A;  4UYG A;  4MR3 A;  2KKX A;  3T7L A;  5KTU A;  5H1U A;  3JVJ A;  4AI6 A;  2ECV A;  4WZ3 B;  2RS9 B;  4OGI A;  5I83 A;  3LVR E;  5SVX A;  5B78 A;  5LVQ A;  2JUN A;  4HBY A;  5EWC A;  2CRW A;  3M62 A;  2LV9 A;  5FG6 A;  3FM8 C;  4QF3 A;  4QR4 A;  2PUY A;  5DIN A;  5H9M A;  2KU3 A;  5KHM A;  2EGM A;  3C6W A;  4TQN A;  4XUB A;  5J3X A;  4A9N A;  3UVD A;  2KWK A;  2RO1 A;  2YQD A;  3DQV R;  4LZS A;  4PPE A;  4ZUX U;  4OGJ A;  2FUU A;  1WEQ A;  5D3H A;  4IR5 A;  3ZPV E;  2R10 A;  4P5O B;  2EJN A;  5I89 A;  3JVM A;  1WEW A;  3HCT A;  4QEW A;  3FKM X;  2G43 A;  5IGM A;  1N87 A;  5EPB A;  2E7O A;  4HXL A;  4YBS A;  5B79 A;  4HBX A;  4NRA A;  2M6M A;  4QZS A;  4A4B A;  4L7X A;  5HCL A;  1IYM A;  2E3K A;  5L96 A;  3LDY A;  5EPR A;  2RFJ A;  5F1H A;  3EB5 A;  1X4U A;  2G45 A;  3FEH A;  3U5O A;  1WFK A;  4YYN A;  3N9O A;  1Z2Q A;  3G0L A;  3JVL A;  3D1D A;  3DAI A;  4Q0N A;  5CQ8 A;  3TLP A;  1WES A;  3U5M A;  3N9M A;  1WEP A;  5F36 A;  1JOC A;  5G4R A;  4YYK A;  2RSD A;  3PUQ A;  1RMD A;  5EWH A;  2ECJ A;  2VP7 A;  1G25 A;  1WE9 A;  4ZDT A;  5H1V A;  5C7N A;  1WEM A;  2VPB A;  4AKN A;  1X4I A;  5EGU A;  5BT3 A;  2D8U A;  3VKH A;  5IG6 A;  4FLP A;  5ENI A;  4NS5 A;  4GB0 A;  3MXF A;  4KCX A;  2K1J A;  3LRQ A;  1E6I A;  4CUP A;  3LVQ E;  3IHP A;  2YUR A;  4Z1Q A;  4HXR A;  5B75 A;  4QBM A;  2KGG A;  1K2F A;  1MM2 A;  4Z0O A;  3QZS A;  1LDK C;  2LGK A;  2YU4 A;  3ZTG A;  5FG4 A;  2LQ6 A;  5AMF A;  2UZG A;  3GL6 A;  5SVI A;  1WEO A;  5BT4 A;  5CQ7 A;  5EP7 A;  5JI8 A;  4NYV A;  4BW3 A;  2QIC A;  2VPG A;  3ZYQ A;  2D9E A;  2HYE D;  2IQJ A;  1FP0 A;  4HXS A;  5A5Q A;  4O75 A;  2MNZ A;  4QQ4 A;  4S3O B;  4PCI A;  5F62 A;  5DKH A;  5SVY A;  5A5S A;  3Q1D A;  5I7Y A;  2L84 A;  2ECG A;  5AIU A;  2KRE A;  3GG3 A;  5C4Q A;  1Z60 A;  4QY4 A;  2AN6 A;  3ASL A;  5D3L A;  4YAX A;  5EWV A;  5DLX A;  4A9O A;  5JWM A;  5D7X A;  4KV4 A;  5EU1 A;  2BAY A;  5ACY A;  5FB0 A;  4IC3 A;  4O71 A;  5D1M B;  4XYA A;  4N4G A;  4MEO A;  5H85 A;  5A5P A;  1WGM A;  3UW9 A;  2VPE A;  5DKD A;  5ENH A;  5I80 A;  4NN2 A;  2FD4 A;  2MIQ A;  5DYU A;  4QNS A;  2RNY A;  1U6G B;  4XI1 A;  5ENG A;  2Y1N A;  3MUK A;  3LQH A;  4YH4 A;  4J0R A;  4PKL A;  3M63 A;  2CRR A;  4QEU A;  3SOW A;  3MB3 A;  5LJ2 A;  5C89 A;  4HXO A;  5FBX A;  3O35 A;  5FEY A;  2LGL A;  3L11 A;  3UVW A;  2DKW A;  1BOR A;  1CHC A;  2F6N A;  2VJF B;  3AQA A;  4YYH A;  2VNF A;  4GPJ A;  4LDF A;  4O74 A;  4O7A A;  4QEV A;  4DON A;  4I7C A;  4CFK A;  4V3K C;  1HYI A;  5DKC A;  5AIT A;  1HYJ A;  4LC2 A;  3S91 A;  5A5N A;  5HEL A;  5SVI B;  4A4C A;  1ZKR A;  4QSP A;  5E73 A;  4H9D A;  5F63 A;  2CON A;  2LGG A;  3VKG A;  3ZVZ B;  2R0Y A;  5F3A A;  5CRZ A;  1E4U A;  4CFL A;  2CKL A;  4UIU A;  2YQL A;  3AAD A;  3P1F A;  5AD2 A;  5IBN A;  4O62 A;  5AME A;  5B8D A;  4TTE A;  4X2I A;  5A81 A;  2F42 A;  2ECW A;  2K4D A;  1FBV A;  4OGC A;  2XP0 A;  2LGV A;  5E3G A;  4NQN A;  5EI4 A;  3FAO A;  4AKH A;  5FFY A;  4FO9 A;  5C8G A;  2OUO A;  2NAA A;  1WIL A;  5LKT A;  4PCE A;  1ZS5 A;  2M3H A;  2MA5 A;  4J1P A;  3PHD A;  5I40 A;  2KFT A;  2LDR A;  5E9L A;  3NG2 A;  4R7E A;  5ENC A;  4UP0 A;  5FE1 A;  3JVK A;  5C87 A;  5I7X A;  4UYF A;  1EQF A;  5HM0 A;  2DVS A;  5CPE A;  5HRW A;  2E6R A;  3E2D A;  4UI9 B;  5DFC A;  4Q6F A;  2L5U A;  5CP5 A;  5CY9 A;  4F52 B;  3LQJ A;  4B7Y C;  3DWY A;  4LRG A;  5HJC A;  3S92 A;  5I1Q A;  4CL9 A;  4A49 A;  4YYI A;  1XWH A;  4A9E A;  4IOQ A;  5DFD A;  2CT2 A;  2FFW A;  2G6Q A;  2JMJ A;  2L80 A;  5L98 A;  4GNF A;  5EA1 A;  5ETD A;  2KE1 A;  5B77 A;  2KR4 A;  3IU6 A;  2LAU A;  2VPD A;  2Y43 A;  3MDB C;  5F1L A;  4TZ2 A;  1WEV A;  5D24 A;  5HQ5 A;  4BBQ A;  5II2 A;  4LR6 A;  5I3L A;  4QB3 A;  4C66 A;  5DFB A;  2WP1 A;  4ZC9 A;  3KV6 A;  3M7K A;  4LYS A;  2E7N A;  2F6J A;  4WHU A;  4YYJ A;  5E74 A;  2YT5 A;  2EGP A;  5FB1 A;  4MEN A;  4A9H A;  5IGK A;  5CQ5 A;  5DYC A;  2CKL B;  2RNW A;  4A9I A;  5D3T A;  5HLS A;  5B76 A;  1N72 A;  5FE4 A;  2CSZ A;  3MHH A;  5EK9 A;  4YYD A;  2RR4 A;  5CQA A;  5ENF A;  2JRJ A;  4WZ0 A;  4QSX A;  1WEN A;  5FDZ A;  4W4U A;  2YSJ A;  4E96 A;  5IGL A;  1WEE A;  4AP4 A;  2FUI A;  4TYL A;  2YEK A;  4A9J A;  2JMI A;  4QSQ A;  4IOR A;  4MR4 A;  3K2J A;  4YY4 A;  4LAD B;  5D3N A;  4NUE A;  2L43 A;  2DVQ A;  2L7P A;  4UIZ A;  4YK0 A;  4UIT A;  4QST A;  1JSP B;  4UYF B;  3RPG C;  4Z93 A;  5LCW B;  4UYD A;  2VJF A;  1MBM A;  2FSA A;  4O7E A;  4O7C A;  5CQ3 A;  5HRV A;  4NRC A;  5I86 A;  2M85 A;  2YSM A;  2YVR A;  3N9N A;  5KH9 A;  5E9I A;  5FH7 A;  5HEM A;  2YEL A;  3ZYU A;  5EWD A;  4Y03 A;  4QSS A;  4MR5 A;  2VJE B;  2B0O E;  2KGI A;  3HCU A;  4BHW A;  5CUB A;  3N9P A;  4O64 A;  5ENB A;  4AKG A;  4WIV A;  4NXJ A;  2OO1 A;  4V3L C;  4LLB A;  5TAB A;  5A83 A;  3ZNI A;  1X0J A;  2DAT A;  4QSU A;  4A9K A;  1MM3 A;  4CUU A;  4XY9 A;  2KYU A;  2MKE A;  1JM7 B;  5E9K A;  4BJX A;  5K3Q A;  5BT5 A;  3SVH A;  3O36 A;  5E9V A;  5E7D A;  3DWD A;  2KWO A;  2MJV B;  3SOU A;  4LKA A;  4ALG A;  2YQM A;  4FJC A;  5G0F A;  5D25 A;  4YC9 A;  1ZBD B;  5CTL A;  5E9Y A;  4UYE A;  4YBM A;  2K17 A;  5D0C A;  2RI7 A;  2L0B A;  5EPS A;  4R2Y A;  3H7H A;  4CCG X;  3P1E A;  2OXQ C;  2K16 A;  4A9M A;  4NUD A;  3PLW A;  5LKZ A;  4Z0R A;  3U5K A;  4Z6H A;  5EYA F;  5CS8 A;  2D82 A;  4QSV A;  3P1C A;  1WUG A;  4QC3 A;  4YY6 A;  3SHB A;  5G04 B;  5D3P A;  5FE2 A;  4LYI A;  3SVG A;  5KU3 A;  2PNX A;  5A5R A;  2DVR A;  4UIY A;  3RCW A;  5LUU A;  4YAD A;  1T1H A;  2YHO A;  5FER A;  3Q2F A;  5IGN A;  3L1X A;  4NRB A;  4Z6I A;  3HMF A;  4F3I A;  2DX8 A;  3D7C A;  4J3I A;  4QYL A;  3T9K A;  5LJ0 A;  4QUT A;  5DBM A;  4A9L A;  3FAN A;  5DW1 A;  5ENE A;  2XB1 A;  4TS8 A;  3HTK C;  2LRI C;  5I29 A;  2YEM A;  4NYW A;  4LYW A;  4CLB A;  2MD7 B;  2WP2 A;  4ZQL A;  4YYG A;  5FE7 A;  1VYX A;  2MD8 C;  5L8T A;  3VK6 A;  5TBN A;  5JG6 A;  5J0D A;  3LXJ A;  3QZV A;  2L5E A;  4BW1 A;  5CU8 A;  3GV4 A;  4Z1S A;  1JM4 B;  2H0D A;  3HCS A;  3ERR A;  4PY6 A;  4NYX A;  3RTR B;  3T6R A;  5FH8 A;  5H1T A;  3P5O A;  5E9M A;  2KTB B;  4UIV A;  2LSP B;  1Z6U A;  2KWJ A;  5DYX A;  2ZET C;  4AUQ B;  5D1L B;  4YAT A;  3U5J A;  3HMH A;  5A7C A;  5D26 A;  2JMD A;  2YUC A;  4GNE A;  4WA6 A;  2EXU A;  2LXH C;  4HBV A;  5EIS A;  4C9Z A;  2DVV A;  3LJW A;  5KTX A;  2L75 A;  5HEN A;  1LDJ B;  2KIZ A;  5ENJ A;  2Y1M A;  5C13 A;  2G4A A;  5CGP A;  5E3D A;  5F25 A;  5FE6 A;  4QC1 A;  5EQ1 A;  4QR3 A;  3UVY A;  1DVP A;  2YRE A;  4IC2 A;  3DPL R;  3O47 A;  4LK9 A;  4MR6 A;  4TU6 A;  2R0V A;  2VJE A;  5E0R A;  3PUR A;  2MNY A;  4UIW A;  4MVT A;  2M1R A;  5TDR A;  2YYN A;  1WEU A;  5D3J A;  4NR5 A;  3FL2 A;  4UYH A;  2L85 A;  5CUG A;  4XY8 A;  2XOY A;  4YBT A;  5CQ4 A;  4LJN A;  4CUQ A;  3M99 A;  2GRC A;  4LZR A;  3LQI A;  4HXK A;  1JM7 A;  1F68 A;  2EA6 A;  3I2D A;  5CUD A;  3LJU X;  5CQ6 A;  5LVR A;  3KV5 A;  5K29 A;  2KWN A;  3FJU B;  4C67 A;  1V87 A;  5DW2 A;  5FFV A;  4CA1 A;  3SUB A;  4OUF A;  4NR7 A;  4TT2 A;  2YDW A;  3I3J A;  3N9L A;  4XUA A;  3UV2 A;  4TT4 A;  5G4S A;  5FH6 A;  5TCM A;  4R8P K;  2YW5 A;  4NR9 A;  4A9F A;  2H0D B;  4I7D A;  4MSX A;  2P57 A;  4AYC A;  4TKP B;  1WIM A;  5CRM A;  4QR5 A;  5CUE A;  1WUM A;  5EIC A;  4B86 C;  3QZT A;  1F62 A;  4F1P A;  4QF2 A;  2YHN A;  4FK5 A;  5CZG A;  4L58 A;  3UV5 A;  3RPG B;  4O76 A;  3P1D A;  5A82 A;  3U5P A;  5C11 A;  3SVF A;  4QSR A;  4QSW A;  2YYR A;  3IU5 A;  5D3S A;  3O37 A;  5EWW A;  5CFW A;  2I50 A;  5LKX A;  4O78 A;  2EOD A;  4QUU A;  5F5Z A;  4YYM A;  4HXN A;  4AKI A;  2C2V S;  5DX4 A;  4RVR A;  2DSM A;  4AVX A;  3MQM A;  5IID A;  3O70 A;  2M13 A;  2XEU A;  2RNX A;  4ALH A;  3U5N A;  2JM3 A;  4CUR A;  3ZVY A;  3UVX A;  3KNV A;  4YH3 A;  4IR6 A;  5DYA A;  4ZW1 A;  3MUL A;  2DJA A;  5II1 A;  5FE5 A;  1VD4 A;  2OWA A;  3DDT A;  4HBW A;  2XOZ A;  1VFY A;  2NXB A;  2ECT A;  2HDP A;  3V43 A;  5AD3 A;  5KH3 A;  5HQ6 A;  3D1B A;  4QYD A;  3KQI A;  2CSV A;  5D3R A;  5FE3 A;  5L97 A;  4YAB A;  3L1Z B;  3O34 A;  4N3W A;  5D1K B;  2N9G A;  4MEP A;  5TB6 A;  5ETB A;  5L8U A;  5I88 A;  2LN0 A;  4HXM A;  4N4H A;  4I7B A;  5CUA A;  4BW4 A;  2OSS A;  5FE9 A;  5FE0 A; 
#chains in the Genus database with same CATH homology
 4FIP A;  5HFR A;  4NR4 A;  5DY7 A;  3O7A A;  2ECN A;  4Q0O A;  4GND A;  4A0C D;  2E6S A;  5HRX A;  4AYC B;  4GNG A;  4TU4 A;  2H60 A;  5EVA A;  4NR6 A;  2MT5 A;  4IR3 A;  1X4J A;  5HFQ A;  4O7B A;  5LKU A;  2MA6 A;  2QJ0 A;  5F2P A;  5EV9 A;  4O7F A;  4NR8 A;  3O33 A;  5TRB A;  3ZPV 1;  2R0S A;  2LXP C;  3SOX A;  5DKA A;  4CUT A;  3UV4 A;  4UP5 A;  2I7K A;  4UIX A;  5EM3 A;  3N9Q A;  4NUC A;  5F61 A;  5A85 A;  2QIZ A;  5FG5 A;  5FE8 A;  5F60 A;  4IOO A;  3C5K A;  3NXB A;  2I8N A;  5COI A;  3MB4 A;  4N4I A;  4TZ8 A;  4BW2 A;  5G05 B;  5A5O A;  3EB6 A;  4S3O C;  5KO4 A;  2CSY A;  2ECI A;  4TT6 A;  2MUM A;  4O70 A;  5CQT A;  4KV1 A;  5DLZ A;  4LZ2 A;  3Q2E A;  4WHW A;  4HXP A;  5L99 A;  5CUC A;  3G0J A;  4IR4 A;  4J0S A;  3ONI A;  4O72 A;  3U5L A;  2D8S A;  4X3G A;  2C2L A;  5KTW A;  4PS5 A;  3HME A;  4PTB A;  5LJ1 A;  5KH7 A;  4WZ2 A;  4N4F A;  4MEQ A;  5TDW A;  5FFW A;  4CUS A;  4NQM A;  2YW8 A;  4O77 A;  5HQ7 A;  2DWW A;  5C85 A;  3MHS A;  2IDA A;  4UYG A;  4MR3 A;  3T7L A;  5KTU A;  5H1U A;  3JVJ A;  2ECV A;  4WZ3 B;  2RS9 B;  4OGI A;  5I83 A;  5B78 A;  5LVQ A;  4HBY A;  5EWC A;  3M62 A;  2LV9 A;  5FG6 A;  4QF3 A;  4QR4 A;  2PUY A;  5DIN A;  5H9M A;  2KU3 A;  5KHM A;  3C6W A;  4TQN A;  4XUB A;  5J3X A;  4A9N A;  3UVD A;  2KWK A;  2RO1 A;  2YQD A;  3DQV R;  4LZS A;  4PPE A;  4ZUX U;  4OGJ A;  2FUU A;  1WEQ A;  5D3H A;  4IR5 A;  3ZPV E;  2R10 A;  4P5O B;  5I89 A;  3JVM A;  1WEW A;  3HCT A;  4QEW A;  3FKM X;  2G43 A;  5IGM A;  1N87 A;  5EPB A;  2E7O A;  4HXL A;  4YBS A;  5B79 A;  4HBX A;  4NRA A;  2M6M A;  4QZS A;  4A4B A;  4L7X A;  5HCL A;  1IYM A;  2E3K A;  5L96 A;  5EPR A;  2RFJ A;  5F1H A;  3EB5 A;  1X4U A;  2G45 A;  3U5O A;  1WFK A;  4YYN A;  3N9O A;  1Z2Q A;  3G0L A;  3JVL A;  3DAI A;  4Q0N A;  5CQ8 A;  3TLP A;  1WES A;  3U5M A;  3N9M A;  1WEP A;  5F36 A;  1JOC A;  5G4R A;  4YYK A;  2RSD A;  3PUQ A;  1RMD A;  5EWH A;  2ECJ A;  2VP7 A;  1G25 A;  1WE9 A;  4ZDT A;  5H1V A;  5C7N A;  1WEM A;  2VPB A;  4AKN A;  1X4I A;  5EGU A;  5BT3 A;  5IG6 A;  4FLP A;  5ENI A;  4NS5 A;  4GB0 A;  3MXF A;  4KCX A;  2K1J A;  3LRQ A;  1E6I A;  4CUP A;  3IHP A;  2YUR A;  4Z1Q A;  4HXR A;  5B75 A;  4QBM A;  2KGG A;  1K2F A;  1MM2 A;  3QZS A;  1LDK C;  2LGK A;  2YU4 A;  3ZTG A;  5FG4 A;  2LQ6 A;  5AMF A;  2UZG A;  3GL6 A;  1WEO A;  5BT4 A;  5CQ7 A;  5EP7 A;  5JI8 A;  4NYV A;  4BW3 A;  2QIC A;  2VPG A;  3ZYQ A;  2D9E A;  2HYE D;  1FP0 A;  4HXS A;  5A5Q A;  4O75 A;  2MNZ A;  4S3O B;  4PCI A;  5F62 A;  5DKH A;  5A5S A;  5I7Y A;  2L84 A;  2ECG A;  5AIU A;  2KRE A;  3GG3 A;  5C4Q A;  1Z60 A;  4QY4 A;  2AN6 A;  3ASL A;  5D3L A;  4YAX A;  5EWV A;  5DLX A;  4A9O A;  5JWM A;  5D7X A;  4KV4 A;  5EU1 A;  2BAY A;  5ACY A;  5FB0 A;  4IC3 A;  4O71 A;  5D1M B;  4XYA A;  4N4G A;  4MEO A;  5H85 A;  5A5P A;  1WGM A;  3UW9 A;  2VPE A;  5DKD A;  5ENH A;  5I80 A;  4NN2 A;  2MIQ A;  5DYU A;  4QNS A;  2RNY A;  1U6G B;  4XI1 A;  5ENG A;  2Y1N A;  3MUK A;  3LQH A;  4YH4 A;  4J0R A;  4PKL A;  3M63 A;  4QEU A;  3SOW A;  3MB3 A;  5LJ2 A;  5C89 A;  4HXO A;  5FBX A;  3O35 A;  5FEY A;  2LGL A;  3L11 A;  3UVW A;  2DKW A;  1BOR A;  1CHC A;  2F6N A;  2VJF B;  3AQA A;  4YYH A;  2VNF A;  4GPJ A;  4LDF A;  4O74 A;  4O7A A;  4QEV A;  4DON A;  4I7C A;  4CFK A;  4V3K C;  1HYI A;  5DKC A;  5AIT A;  1HYJ A;  4LC2 A;  3S91 A;  5A5N A;  5HEL A;  4A4C A;  4QSP A;  5E73 A;  5F63 A;  2LGG A;  3ZVZ B;  2R0Y A;  5F3A A;  5CRZ A;  1E4U A;  4CFL A;  2CKL A;  4UIU A;  2YQL A;  3AAD A;  3P1F A;  5AD2 A;  5IBN A;  5AME A;  5B8D A;  4TTE A;  4X2I A;  5A81 A;  2F42 A;  2ECW A;  2K4D A;  1FBV A;  2LGV A;  5E3G A;  4NQN A;  5EI4 A;  4FO9 A;  5FFY A;  5C8G A;  2OUO A;  2NAA A;  1WIL A;  5LKT A;  4PCE A;  1ZS5 A;  2M3H A;  2MA5 A;  4J1P A;  3PHD A;  5I40 A;  2KFT A;  2LDR A;  5E9L A;  3NG2 A;  4R7E A;  5ENC A;  4UP0 A;  5FE1 A;  3JVK A;  5C87 A;  5I7X A;  4UYF A;  1EQF A;  5HM0 A;  2DVS A;  5CPE A;  5HRW A;  2E6R A;  4UI9 B;  5DFC A;  4Q6F A;  2L5U A;  5CP5 A;  5CY9 A;  4F52 B;  3LQJ A;  4B7Y C;  3DWY A;  4LRG A;  5HJC A;  3S92 A;  5I1Q A;  4CL9 A;  4A49 A;  4YYI A;  1XWH A;  4A9E A;  4IOQ A;  5DFD A;  2CT2 A;  2G6Q A;  2JMJ A;  2L80 A;  4GNF A;  5L98 A;  2MD8 C;  5EA1 A;  5ETD A;  2KE1 A;  5B77 A;  2KR4 A;  3IU6 A;  2VPD A;  2Y43 A;  5F1L A;  4TZ2 A;  1WEV A;  5D24 A;  5HQ5 A;  4BBQ A;  5II2 A;  4LR6 A;  5I3L A;  4QB3 A;  4C66 A;  5DFB A;  2WP1 A;  4ZC9 A;  3KV6 A;  4LYS A;  2E7N A;  2F6J A;  4WHU A;  4YYJ A;  5E74 A;  2YT5 A;  2EGP A;  5FB1 A;  4MEN A;  4A9H A;  5IGK A;  5CQ5 A;  5DYC A;  2CKL B;  2RNW A;  4A9I A;  5D3T A;  5HLS A;  5B76 A;  1N72 A;  5FE4 A;  2CSZ A;  3MHH A;  5EK9 A;  4YYD A;  5CQA A;  5ENF A;  2JRJ A;  4WZ0 A;  4QSX A;  1WEN A;  5FDZ A;  4W4U A;  2YSJ A;  4E96 A;  5IGL A;  1WEE A;  4AP4 A;  2FUI A;  4TYL A;  2YEK A;  4A9J A;  2JMI A;  4QSQ A;  4IOR A;  4MR4 A;  3K2J A;  4YY4 A;  4LAD B;  5D3N A;  4NUE A;  2L43 A;  2DVQ A;  4UIZ A;  4YK0 A;  4UIT A;  4QST A;  1JSP B;  4UYF B;  3RPG C;  4Z93 A;  5LCW B;  4UYD A;  2VJF A;  2FSA A;  4O7E A;  4O7C A;  5CQ3 A;  5HRV A;  4NRC A;  5I86 A;  2M85 A;  2YSM A;  3N9N A;  5KH9 A;  5E9I A;  5FH7 A;  5HEM A;  2YEL A;  3ZYU A;  5EWD A;  4Y03 A;  4QSS A;  4MR5 A;  2VJE B;  2KGI A;  3HCU A;  4BHW A;  5CUB A;  3N9P A;  4O64 A;  5ENB A;  4WIV A;  4NXJ A;  2OO1 A;  4V3L C;  4LLB A;  5TAB A;  5A83 A;  3ZNI A;  1X0J A;  2DAT A;  4QSU A;  4A9K A;  1MM3 A;  4CUU A;  4XY9 A;  2KYU A;  1JM7 B;  5E9K A;  4BJX A;  5BT5 A;  3SVH A;  3O36 A;  5E9V A;  5E7D A;  2KWO A;  2MJV B;  3SOU A;  4LKA A;  4ALG A;  2YQM A;  4FJC A;  5G0F A;  5D25 A;  4YC9 A;  1ZBD B;  5CTL A;  5E9Y A;  4UYE A;  4YBM A;  2K17 A;  5D0C A;  2RI7 A;  2L0B A;  5EPS A;  4R2Y A;  4CCG X;  3P1E A;  2OXQ C;  2K16 A;  4A9M A;  4NUD A;  5LKZ A;  3U5K A;  4Z6H A;  5EYA F;  5CS8 A;  2D82 A;  4QSV A;  3P1C A;  1WUG A;  4QC3 A;  4YY6 A;  3SHB A;  5G04 B;  5D3P A;  5FE2 A;  4LYI A;  3SVG A;  5KU3 A;  2PNX A;  5A5R A;  2DVR A;  4UIY A;  3RCW A;  5LUU A;  4YAD A;  1T1H A;  2YHO A;  5FER A;  3Q2F A;  5IGN A;  3L1X A;  4NRB A;  4Z6I A;  3HMF A;  4F3I A;  2DX8 A;  3D7C A;  4J3I A;  4QYL A;  5LJ0 A;  4QUT A;  5DBM A;  4A9L A;  5DW1 A;  5ENE A;  2XB1 A;  4TS8 A;  3HTK C;  2LRI C;  5I29 A;  2YEM A;  4NYW A;  4LYW A;  4CLB A;  2MD7 B;  2WP2 A;  4ZQL A;  4YYG A;  5FE7 A;  1VYX A;  3VK6 A;  5L8T A;  5TBN A;  5JG6 A;  5J0D A;  3LXJ A;  3QZV A;  2L5E A;  4BW1 A;  5CU8 A;  3GV4 A;  4Z1S A;  1JM4 B;  2H0D A;  3HCS A;  4PY6 A;  4NYX A;  3RTR B;  3T6R A;  5FH8 A;  5H1T A;  3P5O A;  5E9M A;  2KTB B;  4UIV A;  2LSP B;  1Z6U A;  2KWJ A;  5DYX A;  2ZET C;  4AUQ B;  5D1L B;  4YAT A;  3U5J A;  3HMH A;  5A7C A;  5D26 A;  2JMD A;  2YUC A;  4GNE A;  4WA6 A;  2LXH C;  4HBV A;  5EIS A;  4C9Z A;  2DVV A;  3LJW A;  5KTX A;  2L75 A;  5HEN A;  1LDJ B;  2KIZ A;  5ENJ A;  2Y1M A;  5C13 A;  2G4A A;  5CGP A;  5E3D A;  5F25 A;  5FE6 A;  4QC1 A;  5EQ1 A;  4QR3 A;  3UVY A;  1DVP A;  2YRE A;  4IC2 A;  3DPL R;  4LK9 A;  4MR6 A;  4TU6 A;  2R0V A;  2VJE A;  5E0R A;  3PUR A;  2MNY A;  4UIW A;  4MVT A;  2M1R A;  5TDR A;  2YYN A;  1WEU A;  5D3J A;  4NR5 A;  3FL2 A;  4UYH A;  2L85 A;  5CUG A;  4XY8 A;  4YBT A;  5CQ4 A;  4LJN A;  4CUQ A;  3M99 A;  2GRC A;  4LZR A;  3LQI A;  4HXK A;  1JM7 A;  1F68 A;  2EA6 A;  3I2D A;  5CUD A;  5CQ6 A;  5LVR A;  3KV5 A;  5K29 A;  2KWN A;  4C67 A;  1V87 A;  5DW2 A;  5FFV A;  4CA1 A;  4OUF A;  4NR7 A;  4TT2 A;  2YDW A;  3I3J A;  3N9L A;  4XUA A;  3UV2 A;  4TT4 A;  5G4S A;  5FH6 A;  5TCM A;  4R8P K;  2YW5 A;  4NR9 A;  4A9F A;  2H0D B;  4I7D A;  4MSX A;  4AYC A;  4TKP B;  1WIM A;  5CRM A;  4QR5 A;  5CUE A;  1WUM A;  5EIC A;  4B86 C;  3QZT A;  1F62 A;  4QF2 A;  2YHN A;  4FK5 A;  5CZG A;  4L58 A;  3UV5 A;  3RPG B;  4O76 A;  3P1D A;  5A82 A;  3U5P A;  5C11 A;  3SVF A;  4QSR A;  4QSW A;  2YYR A;  3IU5 A;  5D3S A;  3O37 A;  5EWW A;  5CFW A;  2I50 A;  5LKX A;  4O78 A;  2EOD A;  4QUU A;  5F5Z A;  4YYM A;  4HXN A;  2C2V S;  5DX4 A;  4RVR A;  4AVX A;  3MQM A;  5IID A;  3O70 A;  2XEU A;  2RNX A;  4ALH A;  3U5N A;  3ZVY A;  4CUR A;  3UVX A;  3KNV A;  4YH3 A;  4IR6 A;  5DYA A;  4ZW1 A;  3MUL A;  5II1 A;  5FE5 A;  1VD4 A;  4HBW A;  1VFY A;  2NXB A;  2ECT A;  2HDP A;  3V43 A;  5AD3 A;  5KH3 A;  5HQ6 A;  4QYD A;  3KQI A;  5D3R A;  5FE3 A;  5L97 A;  4YAB A;  3L1Z B;  3O34 A;  4N3W A;  5D1K B;  2N9G A;  4MEP A;  5TB6 A;  5ETB A;  5L8U A;  5I88 A;  2LN0 A;  4HXM A;  4N4H A;  4I7B A;  5CUA A;  4BW4 A;  2OSS A;  5FE9 A;  5FE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...