3U5PA

Crystal structure of the complex of trim33 phd-bromo and h3(1-28)k9me3k14ack18ack23ac histone peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
188
Chain Sequence
DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 56
structure length 188
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5pA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5pA01
3MQMA 4J3IA 5FERA 3ZPV1 4CUTA 2LGLA 4NQNA 2KREA 4LYIA 4TT2A 5L96A 4A9LA 2DKWA 5ENBA 4WIVA 3NXBA 1FBVA 5LUUA 5IGNA 4XI1A 3UVDA 4A9MA 5EM3A 4ALGA 4HBXA 4LJNA 5DYCA 4W4UA 4AKNA 3GG3A 5J3XA 2E6RA 4NYVA 4UITA 2IDAA 5CQ3A 3KV5A 4XY9A 5A5SA 2RO1A 4A9FA 5DKHA 1JM4B 4NUDA 2D9EA 2F6NA 4WZ2A 4N4IA 5D25A 3MUKA 3QZSA 5I86A 1CHCA 1MM3A 1WE9A 5LCWB 1IYMA 5CGPA 2MA6A 4A9JA 4QUUA 3P1FA 2EA6A 4LLBA 4IR5A 4A49A 5D1KB 4F52B 5EISA 2K4DA 2YQDA 4MEQA 5CUDA 4O64A 5H1VA 1WEVA 5CPEA 4WA6A 2FUIA 5DYAA 3O37A 4LK9A 5A5PA 1EQFA 1WEPA 3HCSA 1Z2QA 3N9QA 3M63A 4BJXA 2Y1NA 2VP7A 5CP5A 4CA1A 2LXHC 4O7CA 4IOOA 4QSVA 1LDKC 4CFKA 4O7FA 2C2LA 5A83A 2MD8C 4AVXA 4S3OB 2K16A 4HXOA 4MVTA 4DONA 3QZVA 5BT4A 4QBMA 2C2VS 4CFLA 1HYJA 4J0SA 5BT5A 4Q0NA 3L11A 5C87A 4BW1A 3V43A 2EGPA 2L84A 5C89A 3U5MA 4V3LC 1V87A 4CUSA 4Q0OA 5D3SA 2CT2A 4I7BA 5KTWA 3UW9A 4BHWA 5L97A 4PTBA 1WGMA 4NUCA 4QSWA 2L75A 4GNEA 3RPGC 5FH8A 5FG6A 2YELA 4GB0A 1ZS5A 2YREA 2YSMA 5B77A 1VD4A 4GNGA 3P1EA 3HMFA 2WP2A 2KWNA 5E3DA 5EWHA 4AYCA 3SOWA 4NR7A 4LR6A 3MULA 5D7XA 3ZVYA 2RNWA 4N4GA 4MEPA 4E96A 2RNYA 2D8SA 3DQVR 4NYWA 4MR6A 4BW3A 4F3IA 2XEUA 2YYRA 4I7DA 4A9IA 5DFDA 2R0SA 4LRGA 3HCUA 4IR3A 5EQ1A 5FE0A 5DKCA 3AQAA 4A0CD 4NUEA 4UIXA 2KE1A 5ENJA 1RMDA 5EWVA 5E7DA 4UP0A 4YATA 4UYFB 4CUPA 4GNDA 4O74A 4X2IA 5EPBA 2MUMA 4QSTA 2OO1A 5FB0A 4NR6A 1X4IA 4MEOA 5COIA 2M85A 1JOCA 2KYUA 1N87A 2DVQA 3S92A 4QSPA 5EPRA 4TTEA 4HBYA 1FP0A 3M99A 1WUMA 2YYNA 5D3HA 5ENEA 3UV2A 4NRBA 2M3HA 1U6GB 4N3WA 5CY9A 4C9ZA 4WZ3B 2K17A 4HXSA 2KU3A 5FH7A 5C85A 5AMFA 4UIYA 5ETDA 4HXKA 2CSZA 2NXBA 2UZGA 2OSSA 5CUAA 5HM0A 4Z6IA 1T1HA 2ECVA 1N72A 4YH3A 3LRQA 4QF2A 5DKDA 4FLPA 4I7CA 4YYKA 1WENA 3I3JA 3RTRB 2L85A 3UV4A 4YBMA 2YDWA 3SVHA 5HQ7A 2M6MA 2VJEA 5CTLA 5E0RA 5F60A 5A5NA 3IU6A 4PCIA 3ONIA 5TCMA 3MB4A 4BW4A 2KGIA 2YU4A 5B79A 2WP1A 2L5EA 5DY7A 5F2PA 2OUOA 3UV5A 3U5PA 2ECWA 4RVRA 4NXJA 4QR5A 5HEMA 5A5RA 5HRXA 5HQ6A 3EB5A 3EB6A 4TT4A 2KWKA 5F62A 2LXPC 2YSJA 3DAIA 2E7OA 5F25A 3C6WA 5CUBA 5DW2A 4R2YA 4YABA 2NAAA 3N9NA 3S91A 3LXJA 5DKAA 5D3RA 4CL9A 4O72A 2VJFB 4OUFA 5B78A 2ECJA 4CLBA 3VK6A 5FFVA 4FO9A 5H1TA 2YQMA 4NR9A 3PHDA 4WHWA 2MT5A 5EA1A 4Y03A 5HQ5A 2L0BA 2LGKA 4IR6A 3QZTA 5AD2A 4MENA 1F62A 2DVRA 4A9HA 2G45A 5HFRA 2E3KA 2MIQA 5DBMA 4ZQLA 2H0DB 4NQMA 5H85A 2JRJA 4O7BA 3MHSA 4Q6FA 5HRVA 4QB3A 5TDWA 3MB3A 4HXPA 4QR3A 4IORA 4HBWA 4O7AA 5EWWA 5CS8A 5IG6A 5EYAF 5EVAA 3ZYQA 4ALHA 5E3GA 2MNZA 2R0YA 2M1RA 2KGGA 5H1UA 2LDRA 2YT5A 4O70A 4P5OB 5E9YA 4UYEA 5JG6A 5AMEA 5DW1A 2CSYA 4NRCA 5CZGA 5ENCA 2OXQC 4PY6A 5KH7A 4N4FA 4FK5A 3ZYUA 4NS5A 5D1MB 4O75A 4BBQA 2RI7A 3N9LA 5TB6A 5CUGA 4A9NA 2LN0A 5D3JA 1F68A 5FE5A 5AITA 3U5NA 4HBVA 4NR4A 5LKTA 2KIZA 4QR4A 2L80A 3N9OA 2LGVA 3SOUA 2ZETC 4O77A 5B75A 4A9KA 5C11A 2G4AA 3JVLA 4LADB 2KWJA 3HCTA 3M62A 2YW5A 2F6JA 3SVFA 5D26A 3P1CA 3TLPA 3U5KA 4MR4A 5K29A 1WESA 5TRBA 5ENFA 5AD3A 5E74A 4YYIA 5A81A 4R7EA 5B8DA 3KQIA 3HMEA 5B76A 5FG5A 3HTKC 2DVVA 4CUQA 5FE4A 4A4CA 3LQJA 5D3NA 5G4RA 2FUUA 5LJ0A 5CQ5A 3T7LA 4TU4A 4L7XA 3GL6A 4LDFA 1WEMA 4R8PK 3DPLR 4LZSA 5DLXA 4TS8A 4C66A 3P1DA 3P5OA 4QYLA 1BORA 5EU1A 5TBNA 5KH3A 2I50A 2YEMA 5A85A 2MA5A 3ASLA 2Y43A 5CQ7A 1WEQA 4B7YC 5A5OA 4HXNA 2YHNA 3T6RA 5G05B 5HENA 3DWYA 2CKLB 2DX8A 5I7YA 5I40A 4N4HA 4ZDTA 4GNFA 5F5ZA 2BAYA 3ZTGA 5EPSA 2L43A 5EGUA 2VPDA 3D7CA 5EK9A 3MXFA 3KNVA 5CQ4A 4XYAA 4LZ2A 5CQ8A 4A9OA 3IHPA 3O36A 3FL2A 4QUTA 4OGJA 5F1LA 5LKXA 3UVWA 3JVKA 4UYFA 1JM7B 5HRWA 5KH9A 2DWWA 5DYUA 3I2DA 4TT6A 3LQHA 3Q2EA 2R10A 5I29A 1X4UA 4A4BA 3SHBA 5FE9A 3K2JA 4YYGA 4YYJA 5FBXA 4GPJA 2LGGA 4UIWA 2GRCA 5A7CA 2JMIA 4YY4A 1DVPA 5J0DA 1WEWA 4LYWA 4PPEA 4QSUA 5II2A 4KV4A 1WIMA 5I3LA 4IOQA 5HELA 5HLSA 4HXLA 3RCWA 5KO4A 4Z1QA 3NG2A 5FEYA 4YYHA 2YURA 1XWHA 3G0LA 4NR8A 4QSQA 5II1A 1LDJB 5KHMA 5HFQA 5F1HA 3UVYA 5KTXA 1Z60A 5F63A 2QJ0A 2QIZA 4Z1SA 5CUEA 4YH4A 5IBNA 5DINA 5CRZA 5EI4A 4QEVA 5FG4A 2YEKA 4YY6A 3ZPVE 5E9KA 5LVQA 4XUAA 5E9MA 3L1XA 4S3OC 4QC3A 3FKMX 2YHOA 5EWCA 5IIDA 5JWMA 5C13A 2YW8A 5DLZA 4FIPA 5ETBA 4YBSA 4NN2A 3ZVZB 4TYLA 2E7NA 5D3PA 5LKUA 4O71A 1ZBDB 4CURA 2RS9B 2KFTA 3HMHA 4O7EA 2PNXA 2ECTA 4WZ0A 3JVJA 2MD7B 4UYHA 4CCGX 4A9EA 5I83A 5KTUA 5LKZA 2L5UA 2YUCA 2D82A 4QYDA 5ACYA 5DFBA 5IGMA 3O70A 5L99A 2VJFA 5FE8A 5FFWA 4HXRA 4LYSA 2VPGA 1G25A 5JI8A 1WILA 3LQIA 4V3KC 2HDPA 4TZ8A 5CQTA 4QY4A 5FB1A 5FH6A 1WEEA 2RFJA 5HCLA 4KV1A 4YYMA 5TDRA 1VYXA 4PKLA 3O7AA 5ENGA 2VNFA 5DYXA 5D0CA 5IGKA 3O34A 2H0DA 3KV6A 1E4UA 5DFCA 4PS5A 4YADA 5I88A 4TQNA 2KR4A 3C5KA 4LC2A 2ECGA 4MSXA 2VPBA 1VFYA 4UIZA 4UYDA 5EP7A 5EV9A 4UIVA 4O76A 1E6IA 4TU6A 2VPEA 2DVSA 3AADA 1MM2A 4HXMA 3UVXA 1JSPB 5AIUA 4KCXA 4YAXA 4C67A 4AUQB 2LQ6A 4IC3A 2JMJA 2LV9A 5D3LA 4FJCA 5E9LA 2HYED 5A82A 5E73A 1HYIA 5FE3A 2LRIC 3MHHA 1K2FA 5ENIA 2LSPB 5CUCA 5IGLA 5C7NA 3U5JA 3O35A 4XUBA 1X0JA 2EODA 4UIUA 5D3TA 5L98A 5A5QA 4AYCB 4IR4A 4PCEA 3SVGA 5CU8A 4LZRA 2XB1A 2FSAA 2H60A 4O78A 5D24A 4QZSA 2MJVB 5L8TA 2JMDA 3GV4A 5D1LB 5HJCA 5EICA 4QEUA 4QNSA 4UYGA 4YC9A 2AN6A 5BT3A 4NR5A 5FDZA 1X4JA 4ZUXU 5CRMA 2K1JA 5I7XA 2QICA 5F3AA 5CQ6A 5E9IA 4BW2A 2ECNA 5FFYA 4J0RA 3ZNIA 4QEWA 2KTBB 4MR5A 4J1PA 2YQLA 3PUQA 4L58A 4LKAA 2DATA 2R0VA 4IC2A 3SOXA 4CUUA 4YBTA 1Z6UA 4YYDA 5FE7A 4AP4A 4QSXA 5CQAA 3N9MA 4QF3A 5G0FA 2ECIA 5G04B 5C4QA 5C8GA 5I1QA 3N9PA 4UI9B 5H9MA 4TZ2A 2CKLA 4B86C 5LJ2A 3RPGB 5TABA 4X3GA 3O33A 2Y1MA 4TKPB 4ZC9A 1WFKA 4OGIA 4Z93A 5FE6A 4YYNA 2RNXA 5LVRA 5F61A 4XY8A 3L1ZB 5LJ1A 1WEOA 3G0JA 4YK0A 5E9VA 2RSDA 5EWDA 3PURA 2F42A 3U5LA 5L8UA 1WUGA 4NYXA 5G4SA 3Q2FA 3LJWA 5FE1A 3IU5A 5I80A 2G43A 4QC1A 1JM7A 2I8NA 1WEUA 3JVMA 2E6SA 2G6QA 5I89A 2VJEB 5FE2A 4QSSA 2PUYA 2MNYA 4MR3A 5DX4A 3U5OA 2KWOA 4WHUA 2I7KA 5CFWA 2N9GA 4NRAA 4Z6HA 5F36A 4ZW1A 4UP5A 5ENHA 4QSRA 5KU3A
chains in the Genus database with same CATH superfamily
3MQMA 4J3IA 5FERA 3ZPV1 4CUTA 2LGLA 4NQNA 2KREA 4LYIA 4TT2A 2MKEA 5L96A 4A9LA 2DKWA 5ENBA 4WIVA 3NXBA 1FBVA 5LUUA 5IGNA 4XI1A 3UVDA 4A9MA 5EM3A 4ALGA 4HBXA 1MBMA 5DYCA 4LJNA 4W4UA 4AKNA 3GG3A 5J3XA 2E6RA 4NYVA 4UITA 4Z0RA 2IDAA 5CQ3A 3KV5A 4XY9A 5A5SA 2KKXA 2RO1A 4A9FA 5DKHA 1JM4B 4NUDA 2D9EA 2F6NA 3LVQE 4WZ2A 4N4IA 5D25A 3MUKA 3QZSA 5I86A 1CHCA 1MM3A 1WE9A 5LCWB 1IYMA 5CGPA 2MA6A 4A9JA 4QUUA 2DSMA 3P1FA 2EA6A 4LLBA 4IR5A 4A49A 4AI6A 5D1KB 4F52B 5EISA 2K4DA 2YQDA 3EB5A 4MEQA 5CUDA 4O64A 5H1VA 1WEVA 5CPEA 4WA6A 2FUIA 5DYAA 3O37A 4LK9A 5A5PA 1EQFA 1WEPA 3HCSA 1Z2QA 3N9QA 3M63A 4BJXA 2Y1NA 2VP7A 5CP5A 4CA1A 2LXHC 4O7CA 4IOOA 2L7PA 4QSVA 1LDKC 4CFKA 4O7FA 2C2LA 5A83A 2MD8C 4AVXA 4S3OB 2K16A 4HXOA 4MVTA 4DONA 3QZVA 5BT4A 4QBMA 2C2VS 4CFLA 1HYJA 4J0SA 5BT5A 4Q0NA 3L11A 5C87A 4BW1A 3LJUX 3V43A 5K3QA 5SVIB 2EGPA 2L84A 3EB6A 5C89A 3U5MA 4V3LC 1V87A 4CUSA 4Q0OA 5D3SA 2CT2A 4H9DA 4I7BA 5KTWA 3UW9A 4BHWA 2FFWA 5L97A 4PTBA 1WGMA 2EXUA 4NUCA 4QSWA 2L75A 4GNEA 3RPGC 5FH8A 5FG6A 3LDYA 2YELA 4GB0A 1ZS5A 2YREA 2YSMA 5B77A 1VD4A 4GNGA 3P1EA 3HMFA 2WP2A 2KWNA 5E3DA 5EWHA 4AYCA 3SOWA 4NR7A 4LR6A 3MULA 5D7XA 3ZVYA 2RNWA 4N4GA 4MEPA 4E96A 2RNYA 2D8SA 3DQVR 4NYWA 1DCQA 2CSVA 4MR6A 4BW3A 4F3IA 2XEUA 2YYRA 4I7DA 4A9IA 5DFDA 2R0SA 4LRGA 3HCUA 3VKHA 4IR3A 5EQ1A 3T9KA 3SUBA 5FE0A 5DKCA 3AQAA 2XOZA 4A0CD 4NUEA 4UIXA 4AKIA 2KE1A 3KDEC 5ENJA 1RMDA 5EWVA 5E7DA 4UP0A 4O62A 4YATA 4UYFB 4CUPA 4GNDA 4O74A 4X2IA 5EPBA 2MUMA 4QSTA 2OO1A 5FB0A 4NR6A 1X4IA 4MEOA 5COIA 2M85A 1JOCA 2KYUA 2B0OE 1N87A 2DVQA 3S92A 4QSPA 5EPRA 4TTEA 4HBYA 1FP0A 3M99A 1WUMA 2YYNA 5D3HA 5ENEA 3PLWA 3UV2A 4NRBA 2M3HA 1U6GB 4N3WA 5CY9A 4C9ZA 4WZ3B 2K17A 4HXSA 2KU3A 5FH7A 5C85A 3H7HA 5AMFA 4UIYA 5ETDA 4HXKA 2CSZA 2NXBA 2UZGA 2OSSA 5CUAA 5HM0A 4Z6IA 1T1HA 2ECVA 1N72A 4YH3A 3LRQA 4QF2A 5DKDA 4FLPA 4I7CA 4YYKA 1WENA 3I3JA 3RTRB 2L85A 3UV4A 4YBMA 2YDWA 3SVHA 5HQ7A 2M6MA 2VJEA 5CTLA 5E0RA 5F60A 5A5NA 3IU6A 4PCIA 3ONIA 5TCMA 3MB4A 4BW4A 2CRWA 2KGIA 2YU4A 5B79A 2WP1A 2L5EA 5DY7A 5F2PA 2OUOA 3UV5A 3U5PA 2ECWA 4RVRA 4NXJA 4QR5A 5HEMA 5A5RA 5HRXA 5HQ6A 2IQJA 2JM3A 4TT4A 2KWKA 5F62A 2LXPC 2YSJA 3DAIA 2E7OA 5F25A 3C6WA 3E2DA 5CUBA 5DW2A 4R2YA 4YABA 2NAAA 3N9NA 3S91A 3LXJA 5DKAA 5D3RA 4CL9A 4O72A 2VJFB 4OUFA 5B78A 2ECJA 4CLBA 3VK6A 5FFVA 4FO9A 5H1TA 2YQMA 4NR9A 3PHDA 4WHWA 2MT5A 5EA1A 4Y03A 5HQ5A 2L0BA 2LGKA 4IR6A 3QZTA 5AD2A 4MENA 1F62A 2DVRA 4A9HA 2G45A 5HFRA 2E3KA 2MIQA 5DBMA 4ZQLA 2H0DB 4NQMA 5H85A 2JRJA 4O7BA 3MHSA 4Q6FA 5HRVA 4QB3A 5TDWA 3MB3A 4HXPA 4QR3A 4IORA 4HBWA 4O7AA 5EWWA 5CS8A 5IG6A 5EYAF 5EVAA 3ZYQA 2LAUA 2M13A 4ALHA 5E3GA 2MNZA 2R0YA 2M1RA 2KGGA 5H1UA 2LDRA 2YT5A 4O70A 4P5OB 5E9YA 4UYEA 5JG6A 5AMEA 5DW1A 2CSYA 4NRCA 5CZGA 5ENCA 2OXQC 4PY6A 5KH7A 4N4FA 4FK5A 3ZYUA 4NS5A 5D1MB 4O75A 4BBQA 2RI7A 3N9LA 5TB6A 5CUGA 4A9NA 2LN0A 5D3JA 1F68A 5FE5A 5AITA 3U5NA 4HBVA 4NR4A 5LKTA 2KIZA 4QR4A 2L80A 3N9OA 2LGVA 3SOUA 2ZETC 4O77A 5B75A 4A9KA 5C11A 2G4AA 3JVLA 4LADB 2KWJA 3HCTA 3M62A 2YW5A 2F6JA 3SVFA 5D26A 3P1CA 3TLPA 3U5KA 4MR4A 5K29A 1WESA 2RR4A 3M7KA 5TRBA 5ENFA 5AD3A 5E74A 5SVIA 4YYIA 5A81A 4R7EA 5B8DA 3KQIA 3HMEA 4Z0OA 5B76A 5FG5A 3HTKC 2DVVA 4CUQA 5FE4A 4A4CA 3LQJA 5D3NA 5G4RA 2FUUA 5LJ0A 5CQ5A 3T7LA 4TU4A 4L7XA 3GL6A 4LDFA 1WEMA 3FJUB 4R8PK 3DPLR 4LZSA 5DLXA 4TS8A 4C66A 3P1DA 3P5OA 4QYLA 1BORA 5EU1A 5TBNA 5KH3A 2I50A 2YEMA 5A85A 2MA5A 3ASLA 2Y43A 5CQ7A 1WEQA 4B7YC 5A5OA 4HXNA 2YHNA 3T6RA 5G05B 5HENA 2OWAA 3DWYA 2CKLB 2EJNA 5I7YA 2DX8A 2KKYA 5I40A 4N4HA 4ZDTA 4GNFA 5F5ZA 2BAYA 2XOYA 5EPSA 2L43A 3ZTGA 5EGUA 2VPDA 3D7CA 5EK9A 3MXFA 3KNVA 5CQ4A 4XYAA 4LZ2A 5CQ8A 4A9OA 3IHPA 3O36A 3JUEA 3FL2A 4QUTA 4QQ4A 3ERRA 4OGJA 5F1LA 5LKXA 3UVWA 3JVKA 4UYFA 1JM7B 5HRWA 5KH9A 2DWWA 5DYUA 3I2DA 4TT6A 3LQHA 3Q2EA 2R10A 5I29A 1X4UA 4A4BA 4OGEA 3SHBA 5FE9A 3K2JA 4YYGA 4YYJA 4AKHA 5FBXA 4GPJA 2LGGA 4UIWA 2GRCA 5A7CA 2JMIA 4YY4A 1DVPA 5J0DA 1WEWA 4LYWA 4PPEA 4QSUA 5II2A 4KV4A 1WIMA 5I3LA 4IOQA 5HELA 5HLSA 4HXLA 2CRRA 3RCWA 5KO4A 4Z1QA 3NG2A 5FEYA 4YYHA 2YURA 2FD4A 1XWHA 3G0LA 4NR8A 4QSQA 5II1A 1LDJB 5KHMA 5HFQA 5F1HA 3UVYA 5KTXA 1Z60A 5F63A 2QJ0A 2QIZA 4Z1SA 5CUEA 4YH4A 5SVXA 5IBNA 2XP0A 5DINA 5CRZA 5EI4A 3D1BA 4QEVA 5FG4A 2YEKA 4YY6A 3ZPVE 5E9KA 5LVQA 4XUAA 5E9MA 3L1XA 4S3OC 4QC3A 3FKMX 2YHOA 5EWCA 5IIDA 5JWMA 5C13A 2YW8A 5DLZA 4FIPA 5ETBA 4YBSA 2CONA 4NN2A 3ZVZB 4TYLA 2E7NA 5D3PA 5LKUA 4O71A 1ZBDB 4CURA 2RS9B 2KFTA 4OGCA 3HMHA 4O7EA 2PNXA 2ECTA 4WZ0A 3JVJA 2MD7B 4UYHA 4CCGX 4A9EA 5I83A 5KTUA 5LKZA 2L5UA 2YUCA 2D82A 4QYDA 5ACYA 5DFBA 5IGMA 3O70A 5L99A 2VJFA 5FE8A 5FFWA 4HXRA 4LYSA 2VPGA 3FAOA 1G25A 5JI8A 1WILA 3LQIA 4V3KC 2HDPA 4TZ8A 5CQTA 4QY4A 5FB1A 5FH6A 1WEEA 2RFJA 5HCLA 4KV1A 4YYMA 5TDRA 1VYXA 4PKLA 3O7AA 5SVYA 5ENGA 2XOCA 2VNFA 5DYXA 5D0CA 1PUOA 3O34A 5IGKA 2H0DA 3KV6A 1E4UA 5DFCA 3FEHA 4PS5A 4YADA 5I88A 4TQNA 2KR4A 3C5KA 4LC2A 2ECGA 4MSXA 2VPBA 1VFYA 4UIZA 4UYDA 5EP7A 5EV9A 4UIVA 3VKGA 4O76A 1E6IA 4TU6A 2VPEA 2DVSA 3AADA 1MM2A 4HXMA 3UVXA 1JSPB 5AIUA 4KCXA 4YAXA 4C67A 2EGMA 4AUQB 2LQ6A 4IC3A 2JMJA 2LV9A 3LVRE 5D3LA 4FJCA 5E9LA 2HYED 3DWDA 5A82A 5E73A 1HYIA 5FE3A 2LRIC 3MHHA 2JUNA 1K2FA 5ENIA 2LSPB 5CUCA 5IGLA 5C7NA 3U5JA 3O35A 4XUBA 1X0JA 2EODA 4UIUA 5D3TA 5L98A 5A5QA 4AYCB 4IR4A 4PCEA 3SVGA 5CU8A 3O47A 4LZRA 2XB1A 2FSAA 2H60A 4O78A 5D24A 2E61A 4QZSA 2MJVB 5L8TA 2JMDA 3GV4A 5D1LB 5HJCA 2D8UA 5EICA 4QEUA 4QNSA 4UYGA 4YC9A 2AN6A 5BT3A 4NR5A 5FDZA 3DDTA 1X4JA 4ZUXU 5CRMA 2K1JA 5I7XA 2QICA 5F3AA 5CQ6A 5E9IA 4BW2A 2ECNA 5FFYA 4J0RA 3ZNIA 4QEWA 2KTBB 4MR5A 4J1PA 2P57A 2YQLA 3PUQA 4L58A 4LKAA 3Q1DA 2DATA 2R0VA 4IC2A 3SOXA 4CUUA 4YBTA 1Z6UA 4YYDA 5FE7A 4AP4A 4QSXA 4F1PA 5CQAA 3N9MA 4QF3A 5G0FA 2ECIA 5G04B 5C4QA 5C8GA 5I1QA 3N9PA 4UI9B 5H9MA 3MDBC 4TZ2A 2CKLA 4B86C 4AKGA 5LJ2A 3RPGB 5TABA 4X3GA 3O33A 2Y1MA 4TKPB 4ZC9A 1WFKA 4OGIA 3D1DA 4Z93A 5FE6A 4YYNA 2RNXA 5LVRA 5F61A 3FANA 4XY8A 3L1ZB 5LJ1A 1WEOA 3G0JA 4YK0A 5E9VA 2RSDA 5EWDA 3PURA 2F42A 3U5LA 3FM8C 5L8UA 1WUGA 4NYXA 5G4SA 3Q2FA 3LJWA 5FE1A 3IU5A 5I80A 2G43A 4QC1A 1JM7A 2I8NA 1WEUA 3JVMA 2E6SA 2G6QA 5I89A 2VJEB 5FE2A 4QSSA 2PUYA 2MNYA 4MR3A 2YVRA 5DX4A 3U5OA 2KWOA 4WHUA 2I7KA 1ZKRA 5CFWA 2N9GA 4NRAA 4Z6HA 2DJAA 5F36A 4ZW1A 4UP5A 5ENHA 4QSRA 5KU3A
chains in the Genus database with same CATH topology
3MQMA 4J3IA 5FERA 3ZPV1 4CUTA 2LGLA 4NQNA 2KREA 4LYIA 4TT2A 5L96A 4A9LA 2DKWA 5ENBA 4WIVA 3NXBA 1FBVA 5LUUA 5IGNA 4XI1A 3UVDA 4A9MA 5EM3A 4ALGA 4HBXA 4LJNA 5DYCA 4W4UA 4AKNA 3GG3A 5J3XA 2E6RA 4NYVA 4UITA 2IDAA 5CQ3A 3KV5A 4XY9A 5A5SA 2RO1A 4A9FA 5DKHA 1JM4B 4NUDA 2D9EA 2F6NA 4WZ2A 4N4IA 5D25A 3MUKA 3QZSA 5I86A 1CHCA 1MM3A 1WE9A 5LCWB 1IYMA 5CGPA 2MA6A 4A9JA 4QUUA 3P1FA 2EA6A 4LLBA 4IR5A 4A49A 5D1KB 4F52B 5EISA 2K4DA 2YQDA 4MEQA 5CUDA 4O64A 5H1VA 1WEVA 5CPEA 4WA6A 2FUIA 5DYAA 3O37A 4LK9A 5A5PA 1EQFA 1WEPA 3HCSA 1Z2QA 3N9QA 3M63A 4BJXA 2Y1NA 2VP7A 5CP5A 4CA1A 2LXHC 4O7CA 4IOOA 4QSVA 1LDKC 4CFKA 4O7FA 2C2LA 5A83A 2MD8C 4AVXA 4S3OB 2K16A 4HXOA 4MVTA 4DONA 3QZVA 5BT4A 4QBMA 2C2VS 4CFLA 1HYJA 4J0SA 5BT5A 4Q0NA 3L11A 5C87A 4BW1A 3V43A 2EGPA 2L84A 5C89A 3U5MA 4V3LC 1V87A 4CUSA 4Q0OA 5D3SA 2CT2A 4I7BA 5KTWA 3UW9A 4BHWA 5L97A 4PTBA 1WGMA 4NUCA 4QSWA 2L75A 4GNEA 3RPGC 5FH8A 5FG6A 2YELA 4GB0A 1ZS5A 2YREA 2YSMA 5B77A 1VD4A 4GNGA 3P1EA 3HMFA 2WP2A 2KWNA 5E3DA 5EWHA 4AYCA 3SOWA 4NR7A 4LR6A 3MULA 5D7XA 3ZVYA 2RNWA 4N4GA 4MEPA 4E96A 2RNYA 2D8SA 3DQVR 4NYWA 4MR6A 4BW3A 4F3IA 2XEUA 2YYRA 4I7DA 4A9IA 5DFDA 2R0SA 4LRGA 3HCUA 4IR3A 5EQ1A 5FE0A 5DKCA 3AQAA 4A0CD 4NUEA 4UIXA 2KE1A 5ENJA 1RMDA 5EWVA 5E7DA 4UP0A 4YATA 4UYFB 4CUPA 4GNDA 4O74A 4X2IA 5EPBA 2MUMA 4QSTA 2OO1A 5FB0A 4NR6A 1X4IA 4MEOA 5COIA 2M85A 1JOCA 2KYUA 1N87A 2DVQA 3S92A 4QSPA 5EPRA 4TTEA 4HBYA 1FP0A 3M99A 1WUMA 2YYNA 5D3HA 5ENEA 3UV2A 4NRBA 2M3HA 1U6GB 4N3WA 5CY9A 4C9ZA 4WZ3B 2K17A 4HXSA 2KU3A 5FH7A 5C85A 5AMFA 4UIYA 5ETDA 4HXKA 2CSZA 2NXBA 2UZGA 2OSSA 5CUAA 5HM0A 4Z6IA 1T1HA 2ECVA 1N72A 4YH3A 3LRQA 4QF2A 5DKDA 4FLPA 4I7CA 4YYKA 1WENA 3I3JA 3RTRB 2L85A 3UV4A 4YBMA 2YDWA 3SVHA 5HQ7A 2M6MA 2VJEA 5CTLA 5E0RA 5F60A 5A5NA 3IU6A 4PCIA 3ONIA 5TCMA 3MB4A 4BW4A 2KGIA 2YU4A 5B79A 2WP1A 2L5EA 5DY7A 5F2PA 2OUOA 3UV5A 3U5PA 2ECWA 4RVRA 4NXJA 4QR5A 5HEMA 5A5RA 5HRXA 5HQ6A 3EB5A 3EB6A 4TT4A 2KWKA 5F62A 2LXPC 2YSJA 3DAIA 2E7OA 5F25A 3C6WA 5CUBA 5DW2A 4R2YA 4YABA 2NAAA 3N9NA 3S91A 3LXJA 5DKAA 5D3RA 4CL9A 4O72A 2VJFB 4OUFA 5B78A 2ECJA 4CLBA 3VK6A 5FFVA 4FO9A 5H1TA 2YQMA 4NR9A 3PHDA 4WHWA 2MT5A 5EA1A 4Y03A 5HQ5A 2L0BA 2LGKA 4IR6A 3QZTA 5AD2A 4MENA 1F62A 2DVRA 4A9HA 2G45A 5HFRA 2E3KA 2MIQA 5DBMA 4ZQLA 2H0DB 4NQMA 5H85A 2JRJA 4O7BA 3MHSA 4Q6FA 5HRVA 4QB3A 5TDWA 3MB3A 4HXPA 4QR3A 4IORA 4HBWA 4O7AA 5EWWA 5CS8A 5IG6A 5EYAF 5EVAA 3ZYQA 4ALHA 5E3GA 2MNZA 2R0YA 2M1RA 2KGGA 5H1UA 2LDRA 2YT5A 4O70A 4P5OB 5E9YA 4UYEA 5JG6A 5AMEA 5DW1A 2CSYA 4NRCA 5CZGA 5ENCA 2OXQC 4PY6A 5KH7A 4N4FA 4FK5A 3ZYUA 4NS5A 5D1MB 4O75A 4BBQA 2RI7A 3N9LA 5TB6A 5CUGA 4A9NA 2LN0A 5D3JA 1F68A 5FE5A 5AITA 3U5NA 4HBVA 4NR4A 5LKTA 2KIZA 4QR4A 2L80A 3N9OA 2LGVA 3SOUA 2ZETC 4O77A 5B75A 4A9KA 5C11A 2G4AA 3JVLA 4LADB 2KWJA 3HCTA 3M62A 2YW5A 2F6JA 3SVFA 5D26A 3P1CA 3TLPA 3U5KA 4MR4A 5K29A 1WESA 5TRBA 5ENFA 5AD3A 5E74A 4YYIA 5A81A 4R7EA 5B8DA 3KQIA 3HMEA 5B76A 5FG5A 3HTKC 2DVVA 4CUQA 5FE4A 4A4CA 3LQJA 5D3NA 5G4RA 2FUUA 5LJ0A 5CQ5A 3T7LA 4TU4A 4L7XA 3GL6A 4LDFA 1WEMA 4R8PK 3DPLR 4LZSA 5DLXA 4TS8A 4C66A 3P1DA 3P5OA 4QYLA 1BORA 5EU1A 5TBNA 5KH3A 2I50A 2YEMA 5A85A 2MA5A 3ASLA 2Y43A 5CQ7A 1WEQA 4B7YC 5A5OA 4HXNA 2YHNA 3T6RA 5G05B 5HENA 3DWYA 2CKLB 2DX8A 5I7YA 5I40A 4N4HA 4ZDTA 4GNFA 5F5ZA 2BAYA 3ZTGA 5EPSA 2L43A 5EGUA 2VPDA 3D7CA 5EK9A 3MXFA 3KNVA 5CQ4A 4XYAA 4LZ2A 5CQ8A 4A9OA 3IHPA 3O36A 3FL2A 4QUTA 4OGJA 5F1LA 5LKXA 3UVWA 3JVKA 4UYFA 1JM7B 5HRWA 5KH9A 2DWWA 5DYUA 3I2DA 4TT6A 3LQHA 3Q2EA 2R10A 5I29A 1X4UA 4A4BA 3SHBA 5FE9A 3K2JA 4YYGA 4YYJA 5FBXA 4GPJA 2LGGA 4UIWA 2GRCA 5A7CA 2JMIA 4YY4A 1DVPA 5J0DA 1WEWA 4LYWA 4PPEA 4QSUA 5II2A 4KV4A 1WIMA 5I3LA 4IOQA 5HELA 5HLSA 4HXLA 3RCWA 5KO4A 4Z1QA 3NG2A 5FEYA 4YYHA 2YURA 1XWHA 3G0LA 4NR8A 4QSQA 5II1A 1LDJB 5KHMA 5HFQA 5F1HA 3UVYA 5KTXA 1Z60A 5F63A 2QJ0A 2QIZA 4Z1SA 5CUEA 4YH4A 5IBNA 5DINA 5CRZA 5EI4A 4QEVA 5FG4A 2YEKA 4YY6A 3ZPVE 5E9KA 5LVQA 4XUAA 5E9MA 3L1XA 4S3OC 4QC3A 3FKMX 2YHOA 5EWCA 5IIDA 5JWMA 5C13A 2YW8A 5DLZA 4FIPA 5ETBA 4YBSA 4NN2A 3ZVZB 4TYLA 2E7NA 5D3PA 5LKUA 4O71A 1ZBDB 4CURA 2RS9B 2KFTA 3HMHA 4O7EA 2PNXA 2ECTA 4WZ0A 3JVJA 2MD7B 4UYHA 4CCGX 4A9EA 5I83A 5KTUA 5LKZA 2L5UA 2YUCA 2D82A 4QYDA 5ACYA 5DFBA 5IGMA 3O70A 5L99A 2VJFA 5FE8A 5FFWA 4HXRA 4LYSA 2VPGA 1G25A 5JI8A 1WILA 3LQIA 4V3KC 2HDPA 4TZ8A 5CQTA 4QY4A 5FB1A 5FH6A 1WEEA 2RFJA 5HCLA 4KV1A 4YYMA 5TDRA 1VYXA 4PKLA 3O7AA 5ENGA 2VNFA 5DYXA 5D0CA 5IGKA 3O34A 2H0DA 3KV6A 1E4UA 5DFCA 4PS5A 4YADA 5I88A 4TQNA 2KR4A 3C5KA 4LC2A 2ECGA 4MSXA 2VPBA 1VFYA 4UIZA 4UYDA 5EP7A 5EV9A 4UIVA 4O76A 1E6IA 4TU6A 2VPEA 2DVSA 3AADA 1MM2A 4HXMA 3UVXA 1JSPB 5AIUA 4KCXA 4YAXA 4C67A 4AUQB 2LQ6A 4IC3A 2JMJA 2LV9A 5D3LA 4FJCA 5E9LA 2HYED 5A82A 5E73A 1HYIA 5FE3A 2LRIC 3MHHA 1K2FA 5ENIA 2LSPB 5CUCA 5IGLA 5C7NA 3U5JA 3O35A 4XUBA 1X0JA 2EODA 4UIUA 5D3TA 5L98A 5A5QA 4AYCB 4IR4A 4PCEA 3SVGA 5CU8A 4LZRA 2XB1A 2FSAA 2H60A 4O78A 5D24A 4QZSA 2MJVB 5L8TA 2JMDA 3GV4A 5D1LB 5HJCA 5EICA 4QEUA 4QNSA 4UYGA 4YC9A 2AN6A 5BT3A 4NR5A 5FDZA 1X4JA 4ZUXU 5CRMA 2K1JA 5I7XA 2QICA 5F3AA 5CQ6A 5E9IA 4BW2A 2ECNA 5FFYA 4J0RA 3ZNIA 4QEWA 2KTBB 4MR5A 4J1PA 2YQLA 3PUQA 4L58A 4LKAA 2DATA 2R0VA 4IC2A 3SOXA 4CUUA 4YBTA 1Z6UA 4YYDA 5FE7A 4AP4A 4QSXA 5CQAA 3N9MA 4QF3A 5G0FA 2ECIA 5G04B 5C4QA 5C8GA 5I1QA 3N9PA 4UI9B 5H9MA 4TZ2A 2CKLA 4B86C 5LJ2A 3RPGB 5TABA 4X3GA 3O33A 2Y1MA 4TKPB 4ZC9A 1WFKA 4OGIA 4Z93A 5FE6A 4YYNA 2RNXA 5LVRA 5F61A 4XY8A 3L1ZB 5LJ1A 1WEOA 3G0JA 4YK0A 5E9VA 2RSDA 5EWDA 3PURA 2F42A 3U5LA 5L8UA 1WUGA 4NYXA 5G4SA 3Q2FA 3LJWA 5FE1A 3IU5A 5I80A 2G43A 4QC1A 1JM7A 2I8NA 1WEUA 3JVMA 2E6SA 2G6QA 5I89A 2VJEB 5FE2A 4QSSA 2PUYA 2MNYA 4MR3A 5DX4A 3U5OA 2KWOA 4WHUA 2I7KA 5CFWA 2N9GA 4NRAA 4Z6HA 5F36A 4ZW1A 4UP5A 5ENHA 4QSRA 5KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQM A;  4J3I A;  5FER A;  3ZPV 1;  4CUT A;  2LGL A;  4NQN A;  2KRE A;  4LYI A;  4TT2 A;  5L96 A;  4A9L A;  2DKW A;  5ENB A;  4WIV A;  3NXB A;  1FBV A;  5LUU A;  5IGN A;  4XI1 A;  3UVD A;  4A9M A;  5EM3 A;  4ALG A;  4HBX A;  4LJN A;  5DYC A;  4W4U A;  4AKN A;  3GG3 A;  5J3X A;  2E6R A;  4NYV A;  4UIT A;  2IDA A;  5CQ3 A;  3KV5 A;  4XY9 A;  5A5S A;  2RO1 A;  4A9F A;  5DKH A;  1JM4 B;  4NUD A;  2D9E A;  2F6N A;  4WZ2 A;  4N4I A;  5D25 A;  3MUK A;  3QZS A;  5I86 A;  1CHC A;  1MM3 A;  1WE9 A;  5LCW B;  1IYM A;  5CGP A;  2MA6 A;  4A9J A;  4QUU A;  3P1F A;  2EA6 A;  4LLB A;  4IR5 A;  4A49 A;  5D1K B;  4F52 B;  5EIS A;  2K4D A;  2YQD A;  4MEQ A;  5CUD A;  4O64 A;  5H1V A;  1WEV A;  5CPE A;  4WA6 A;  2FUI A;  5DYA A;  3O37 A;  4LK9 A;  5A5P A;  1EQF A;  1WEP A;  3HCS A;  1Z2Q A;  3N9Q A;  3M63 A;  4BJX A;  2Y1N A;  2VP7 A;  5CP5 A;  4CA1 A;  2LXH C;  4O7C A;  4IOO A;  4QSV A;  1LDK C;  4CFK A;  4O7F A;  2C2L A;  5A83 A;  2MD8 C;  4AVX A;  4S3O B;  2K16 A;  4HXO A;  4MVT A;  4DON A;  3QZV A;  5BT4 A;  4QBM A;  2C2V S;  4CFL A;  1HYJ A;  4J0S A;  5BT5 A;  4Q0N A;  3L11 A;  5C87 A;  4BW1 A;  3V43 A;  2EGP A;  2L84 A;  5C89 A;  3U5M A;  4V3L C;  1V87 A;  4CUS A;  4Q0O A;  5D3S A;  2CT2 A;  4I7B A;  5KTW A;  3UW9 A;  4BHW A;  5L97 A;  4PTB A;  1WGM A;  4NUC A;  4QSW A;  2L75 A;  4GNE A;  3RPG C;  5FH8 A;  5FG6 A;  2YEL A;  4GB0 A;  1ZS5 A;  2YRE A;  2YSM A;  5B77 A;  1VD4 A;  4GNG A;  3P1E A;  3HMF A;  2WP2 A;  2KWN A;  5E3D A;  5EWH A;  4AYC A;  3SOW A;  4NR7 A;  4LR6 A;  3MUL A;  5D7X A;  3ZVY A;  2RNW A;  4N4G A;  4MEP A;  4E96 A;  2RNY A;  2D8S A;  3DQV R;  4NYW A;  4MR6 A;  4BW3 A;  4F3I A;  2XEU A;  2YYR A;  4I7D A;  4A9I A;  5DFD A;  2R0S A;  4LRG A;  3HCU A;  4IR3 A;  5EQ1 A;  5FE0 A;  5DKC A;  3AQA A;  4A0C D;  4NUE A;  4UIX A;  2KE1 A;  5ENJ A;  1RMD A;  5EWV A;  5E7D A;  4UP0 A;  4YAT A;  4UYF B;  4CUP A;  4GND A;  4O74 A;  4X2I A;  5EPB A;  2MUM A;  4QST A;  2OO1 A;  5FB0 A;  4NR6 A;  1X4I A;  4MEO A;  5COI A;  2M85 A;  1JOC A;  2KYU A;  1N87 A;  2DVQ A;  3S92 A;  4QSP A;  5EPR A;  4TTE A;  4HBY A;  1FP0 A;  3M99 A;  1WUM A;  2YYN A;  5D3H A;  5ENE A;  3UV2 A;  4NRB A;  2M3H A;  1U6G B;  4N3W A;  5CY9 A;  4C9Z A;  4WZ3 B;  2K17 A;  4HXS A;  2KU3 A;  5FH7 A;  5C85 A;  5AMF A;  4UIY A;  5ETD A;  4HXK A;  2CSZ A;  2NXB A;  2UZG A;  2OSS A;  5CUA A;  5HM0 A;  4Z6I A;  1T1H A;  2ECV A;  1N72 A;  4YH3 A;  3LRQ A;  4QF2 A;  5DKD A;  4FLP A;  4I7C A;  4YYK A;  1WEN A;  3I3J A;  3RTR B;  2L85 A;  3UV4 A;  4YBM A;  2YDW A;  3SVH A;  5HQ7 A;  2M6M A;  2VJE A;  5CTL A;  5E0R A;  5F60 A;  5A5N A;  3IU6 A;  4PCI A;  3ONI A;  5TCM A;  3MB4 A;  4BW4 A;  2KGI A;  2YU4 A;  5B79 A;  2WP1 A;  2L5E A;  5DY7 A;  5F2P A;  2OUO A;  3UV5 A;  3U5P A;  2ECW A;  4RVR A;  4NXJ A;  4QR5 A;  5HEM A;  5A5R A;  5HRX A;  5HQ6 A;  3EB5 A;  3EB6 A;  4TT4 A;  2KWK A;  5F62 A;  2LXP C;  2YSJ A;  3DAI A;  2E7O A;  5F25 A;  3C6W A;  5CUB A;  5DW2 A;  4R2Y A;  4YAB A;  2NAA A;  3N9N A;  3S91 A;  3LXJ A;  5DKA A;  5D3R A;  4CL9 A;  4O72 A;  2VJF B;  4OUF A;  5B78 A;  2ECJ A;  4CLB A;  3VK6 A;  5FFV A;  4FO9 A;  5H1T A;  2YQM A;  4NR9 A;  3PHD A;  4WHW A;  2MT5 A;  5EA1 A;  4Y03 A;  5HQ5 A;  2L0B A;  2LGK A;  4IR6 A;  3QZT A;  5AD2 A;  4MEN A;  1F62 A;  2DVR A;  4A9H A;  2G45 A;  5HFR A;  2E3K A;  2MIQ A;  5DBM A;  4ZQL A;  2H0D B;  4NQM A;  5H85 A;  2JRJ A;  4O7B A;  3MHS A;  4Q6F A;  5HRV A;  4QB3 A;  5TDW A;  3MB3 A;  4HXP A;  4QR3 A;  4IOR A;  4HBW A;  4O7A A;  5EWW A;  5CS8 A;  5IG6 A;  5EYA F;  5EVA A;  3ZYQ A;  4ALH A;  5E3G A;  2MNZ A;  2R0Y A;  2M1R A;  2KGG A;  5H1U A;  2LDR A;  2YT5 A;  4O70 A;  4P5O B;  5E9Y A;  4UYE A;  5JG6 A;  5AME A;  5DW1 A;  2CSY A;  4NRC A;  5CZG A;  5ENC A;  2OXQ C;  4PY6 A;  5KH7 A;  4N4F A;  4FK5 A;  3ZYU A;  4NS5 A;  5D1M B;  4O75 A;  4BBQ A;  2RI7 A;  3N9L A;  5TB6 A;  5CUG A;  4A9N A;  2LN0 A;  5D3J A;  1F68 A;  5FE5 A;  5AIT A;  3U5N A;  4HBV A;  4NR4 A;  5LKT A;  2KIZ A;  4QR4 A;  2L80 A;  3N9O A;  2LGV A;  3SOU A;  2ZET C;  4O77 A;  5B75 A;  4A9K A;  5C11 A;  2G4A A;  3JVL A;  4LAD B;  2KWJ A;  3HCT A;  3M62 A;  2YW5 A;  2F6J A;  3SVF A;  5D26 A;  3P1C A;  3TLP A;  3U5K A;  4MR4 A;  5K29 A;  1WES A;  5TRB A;  5ENF A;  5AD3 A;  5E74 A;  4YYI A;  5A81 A;  4R7E A;  5B8D A;  3KQI A;  3HME A;  5B76 A;  5FG5 A;  3HTK C;  2DVV A;  4CUQ A;  5FE4 A;  4A4C A;  3LQJ A;  5D3N A;  5G4R A;  2FUU A;  5LJ0 A;  5CQ5 A;  3T7L A;  4TU4 A;  4L7X A;  3GL6 A;  4LDF A;  1WEM A;  4R8P K;  3DPL R;  4LZS A;  5DLX A;  4TS8 A;  4C66 A;  3P1D A;  3P5O A;  4QYL A;  1BOR A;  5EU1 A;  5TBN A;  5KH3 A;  2I50 A;  2YEM A;  5A85 A;  2MA5 A;  3ASL A;  2Y43 A;  5CQ7 A;  1WEQ A;  4B7Y C;  5A5O A;  4HXN A;  2YHN A;  3T6R A;  5G05 B;  5HEN A;  3DWY A;  2CKL B;  2DX8 A;  5I7Y A;  5I40 A;  4N4H A;  4ZDT A;  4GNF A;  5F5Z A;  2BAY A;  3ZTG A;  5EPS A;  2L43 A;  5EGU A;  2VPD A;  3D7C A;  5EK9 A;  3MXF A;  3KNV A;  5CQ4 A;  4XYA A;  4LZ2 A;  5CQ8 A;  4A9O A;  3IHP A;  3O36 A;  3FL2 A;  4QUT A;  4OGJ A;  5F1L A;  5LKX A;  3UVW A;  3JVK A;  4UYF A;  1JM7 B;  5HRW A;  5KH9 A;  2DWW A;  5DYU A;  3I2D A;  4TT6 A;  3LQH A;  3Q2E A;  2R10 A;  5I29 A;  1X4U A;  4A4B A;  3SHB A;  5FE9 A;  3K2J A;  4YYG A;  4YYJ A;  5FBX A;  4GPJ A;  2LGG A;  4UIW A;  2GRC A;  5A7C A;  2JMI A;  4YY4 A;  1DVP A;  5J0D A;  1WEW A;  4LYW A;  4PPE A;  4QSU A;  5II2 A;  4KV4 A;  1WIM A;  5I3L A;  4IOQ A;  5HEL A;  5HLS A;  4HXL A;  3RCW A;  5KO4 A;  4Z1Q A;  3NG2 A;  5FEY A;  4YYH A;  2YUR A;  1XWH A;  3G0L A;  4NR8 A;  4QSQ A;  5II1 A;  1LDJ B;  5KHM A;  5HFQ A;  5F1H A;  3UVY A;  5KTX A;  1Z60 A;  5F63 A;  2QJ0 A;  2QIZ A;  4Z1S A;  5CUE A;  4YH4 A;  5IBN A;  5DIN A;  5CRZ A;  5EI4 A;  4QEV A;  5FG4 A;  2YEK A;  4YY6 A;  3ZPV E;  5E9K A;  5LVQ A;  4XUA A;  5E9M A;  3L1X A;  4S3O C;  4QC3 A;  3FKM X;  2YHO A;  5EWC A;  5IID A;  5JWM A;  5C13 A;  2YW8 A;  5DLZ A;  4FIP A;  5ETB A;  4YBS A;  4NN2 A;  3ZVZ B;  4TYL A;  2E7N A;  5D3P A;  5LKU A;  4O71 A;  1ZBD B;  4CUR A;  2RS9 B;  2KFT A;  3HMH A;  4O7E A;  2PNX A;  2ECT A;  4WZ0 A;  3JVJ A;  2MD7 B;  4UYH A;  4CCG X;  4A9E A;  5I83 A;  5KTU A;  5LKZ A;  2L5U A;  2YUC A;  2D82 A;  4QYD A;  5ACY A;  5DFB A;  5IGM A;  3O70 A;  5L99 A;  2VJF A;  5FE8 A;  5FFW A;  4HXR A;  4LYS A;  2VPG A;  1G25 A;  5JI8 A;  1WIL A;  3LQI A;  4V3K C;  2HDP A;  4TZ8 A;  5CQT A;  4QY4 A;  5FB1 A;  5FH6 A;  1WEE A;  2RFJ A;  5HCL A;  4KV1 A;  4YYM A;  5TDR A;  1VYX A;  4PKL A;  3O7A A;  5ENG A;  2VNF A;  5DYX A;  5D0C A;  5IGK A;  3O34 A;  2H0D A;  3KV6 A;  1E4U A;  5DFC A;  4PS5 A;  4YAD A;  5I88 A;  4TQN A;  2KR4 A;  3C5K A;  4LC2 A;  2ECG A;  4MSX A;  2VPB A;  1VFY A;  4UIZ A;  4UYD A;  5EP7 A;  5EV9 A;  4UIV A;  4O76 A;  1E6I A;  4TU6 A;  2VPE A;  2DVS A;  3AAD A;  1MM2 A;  4HXM A;  3UVX A;  1JSP B;  5AIU A;  4KCX A;  4YAX A;  4C67 A;  4AUQ B;  2LQ6 A;  4IC3 A;  2JMJ A;  2LV9 A;  5D3L A;  4FJC A;  5E9L A;  2HYE D;  5A82 A;  5E73 A;  1HYI A;  5FE3 A;  2LRI C;  3MHH A;  1K2F A;  5ENI A;  2LSP B;  5CUC A;  5IGL A;  5C7N A;  3U5J A;  3O35 A;  4XUB A;  1X0J A;  2EOD A;  4UIU A;  5D3T A;  5L98 A;  5A5Q A;  4AYC B;  4IR4 A;  4PCE A;  3SVG A;  5CU8 A;  4LZR A;  2XB1 A;  2FSA A;  2H60 A;  4O78 A;  5D24 A;  4QZS A;  2MJV B;  5L8T A;  2JMD A;  3GV4 A;  5D1L B;  5HJC A;  5EIC A;  4QEU A;  4QNS A;  4UYG A;  4YC9 A;  2AN6 A;  5BT3 A;  4NR5 A;  5FDZ A;  1X4J A;  4ZUX U;  5CRM A;  2K1J A;  5I7X A;  2QIC A;  5F3A A;  5CQ6 A;  5E9I A;  4BW2 A;  2ECN A;  5FFY A;  4J0R A;  3ZNI A;  4QEW A;  2KTB B;  4MR5 A;  4J1P A;  2YQL A;  3PUQ A;  4L58 A;  4LKA A;  2DAT A;  2R0V A;  4IC2 A;  3SOX A;  4CUU A;  4YBT A;  1Z6U A;  4YYD A;  5FE7 A;  4AP4 A;  4QSX A;  5CQA A;  3N9M A;  4QF3 A;  5G0F A;  2ECI A;  5G04 B;  5C4Q A;  5C8G A;  5I1Q A;  3N9P A;  4UI9 B;  5H9M A;  4TZ2 A;  2CKL A;  4B86 C;  5LJ2 A;  3RPG B;  5TAB A;  4X3G A;  3O33 A;  2Y1M A;  4TKP B;  4ZC9 A;  1WFK A;  4OGI A;  4Z93 A;  5FE6 A;  4YYN A;  2RNX A;  5LVR A;  5F61 A;  4XY8 A;  3L1Z B;  5LJ1 A;  1WEO A;  3G0J A;  4YK0 A;  5E9V A;  2RSD A;  5EWD A;  3PUR A;  2F42 A;  3U5L A;  5L8U A;  1WUG A;  4NYX A;  5G4S A;  3Q2F A;  3LJW A;  5FE1 A;  3IU5 A;  5I80 A;  2G43 A;  4QC1 A;  1JM7 A;  2I8N A;  1WEU A;  3JVM A;  2E6S A;  2G6Q A;  5I89 A;  2VJE B;  5FE2 A;  4QSS A;  2PUY A;  2MNY A;  4MR3 A;  5DX4 A;  3U5O A;  2KWO A;  4WHU A;  2I7K A;  5CFW A;  2N9G A;  4NRA A;  4Z6H A;  5F36 A;  4ZW1 A;  4UP5 A;  5ENH A;  4QSR A;  5KU3 A; 
#chains in the Genus database with same CATH topology
 3MQM A;  4J3I A;  5FER A;  3ZPV 1;  4CUT A;  2LGL A;  4NQN A;  2KRE A;  4LYI A;  4TT2 A;  2MKE A;  5L96 A;  4A9L A;  2DKW A;  5ENB A;  4WIV A;  3NXB A;  1FBV A;  5LUU A;  5IGN A;  4XI1 A;  3UVD A;  4A9M A;  5EM3 A;  4ALG A;  4HBX A;  1MBM A;  5DYC A;  4LJN A;  4W4U A;  4AKN A;  3GG3 A;  5J3X A;  2E6R A;  4NYV A;  4UIT A;  4Z0R A;  2IDA A;  5CQ3 A;  3KV5 A;  4XY9 A;  5A5S A;  2KKX A;  2RO1 A;  4A9F A;  5DKH A;  1JM4 B;  4NUD A;  2D9E A;  2F6N A;  3LVQ E;  4WZ2 A;  4N4I A;  5D25 A;  3MUK A;  3QZS A;  5I86 A;  1CHC A;  1MM3 A;  1WE9 A;  5LCW B;  1IYM A;  5CGP A;  2MA6 A;  4A9J A;  4QUU A;  2DSM A;  3P1F A;  2EA6 A;  4LLB A;  4IR5 A;  4A49 A;  4AI6 A;  5D1K B;  4F52 B;  5EIS A;  2K4D A;  2YQD A;  3EB5 A;  4MEQ A;  5CUD A;  4O64 A;  5H1V A;  1WEV A;  5CPE A;  4WA6 A;  2FUI A;  5DYA A;  3O37 A;  4LK9 A;  5A5P A;  1EQF A;  1WEP A;  3HCS A;  1Z2Q A;  3N9Q A;  3M63 A;  4BJX A;  2Y1N A;  2VP7 A;  5CP5 A;  4CA1 A;  2LXH C;  4O7C A;  4IOO A;  2L7P A;  4QSV A;  1LDK C;  4CFK A;  4O7F A;  2C2L A;  5A83 A;  2MD8 C;  4AVX A;  4S3O B;  2K16 A;  4HXO A;  4MVT A;  4DON A;  3QZV A;  5BT4 A;  4QBM A;  2C2V S;  4CFL A;  1HYJ A;  4J0S A;  5BT5 A;  4Q0N A;  3L11 A;  5C87 A;  4BW1 A;  3LJU X;  3V43 A;  5K3Q A;  5SVI B;  2EGP A;  2L84 A;  3EB6 A;  5C89 A;  3U5M A;  4V3L C;  1V87 A;  4CUS A;  4Q0O A;  5D3S A;  2CT2 A;  4H9D A;  4I7B A;  5KTW A;  3UW9 A;  4BHW A;  2FFW A;  5L97 A;  4PTB A;  1WGM A;  2EXU A;  4NUC A;  4QSW A;  2L75 A;  4GNE A;  3RPG C;  5FH8 A;  5FG6 A;  3LDY A;  2YEL A;  4GB0 A;  1ZS5 A;  2YRE A;  2YSM A;  5B77 A;  1VD4 A;  4GNG A;  3P1E A;  3HMF A;  2WP2 A;  2KWN A;  5E3D A;  5EWH A;  4AYC A;  3SOW A;  4NR7 A;  4LR6 A;  3MUL A;  5D7X A;  3ZVY A;  2RNW A;  4N4G A;  4MEP A;  4E96 A;  2RNY A;  2D8S A;  3DQV R;  4NYW A;  1DCQ A;  2CSV A;  4MR6 A;  4BW3 A;  4F3I A;  2XEU A;  2YYR A;  4I7D A;  4A9I A;  5DFD A;  2R0S A;  4LRG A;  3HCU A;  3VKH A;  4IR3 A;  5EQ1 A;  3T9K A;  3SUB A;  5FE0 A;  5DKC A;  3AQA A;  2XOZ A;  4A0C D;  4NUE A;  4UIX A;  4AKI A;  2KE1 A;  3KDE C;  5ENJ A;  1RMD A;  5EWV A;  5E7D A;  4UP0 A;  4O62 A;  4YAT A;  4UYF B;  4CUP A;  4GND A;  4O74 A;  4X2I A;  5EPB A;  2MUM A;  4QST A;  2OO1 A;  5FB0 A;  4NR6 A;  1X4I A;  4MEO A;  5COI A;  2M85 A;  1JOC A;  2KYU A;  2B0O E;  1N87 A;  2DVQ A;  3S92 A;  4QSP A;  5EPR A;  4TTE A;  4HBY A;  1FP0 A;  3M99 A;  1WUM A;  2YYN A;  5D3H A;  5ENE A;  3PLW A;  3UV2 A;  4NRB A;  2M3H A;  1U6G B;  4N3W A;  5CY9 A;  4C9Z A;  4WZ3 B;  2K17 A;  4HXS A;  2KU3 A;  5FH7 A;  5C85 A;  3H7H A;  5AMF A;  4UIY A;  5ETD A;  4HXK A;  2CSZ A;  2NXB A;  2UZG A;  2OSS A;  5CUA A;  5HM0 A;  4Z6I A;  1T1H A;  2ECV A;  1N72 A;  4YH3 A;  3LRQ A;  4QF2 A;  5DKD A;  4FLP A;  4I7C A;  4YYK A;  1WEN A;  3I3J A;  3RTR B;  2L85 A;  3UV4 A;  4YBM A;  2YDW A;  3SVH A;  5HQ7 A;  2M6M A;  2VJE A;  5CTL A;  5E0R A;  5F60 A;  5A5N A;  3IU6 A;  4PCI A;  3ONI A;  5TCM A;  3MB4 A;  4BW4 A;  2CRW A;  2KGI A;  2YU4 A;  5B79 A;  2WP1 A;  2L5E A;  5DY7 A;  5F2P A;  2OUO A;  3UV5 A;  3U5P A;  2ECW A;  4RVR A;  4NXJ A;  4QR5 A;  5HEM A;  5A5R A;  5HRX A;  5HQ6 A;  2IQJ A;  2JM3 A;  4TT4 A;  2KWK A;  5F62 A;  2LXP C;  2YSJ A;  3DAI A;  2E7O A;  5F25 A;  3C6W A;  3E2D A;  5CUB A;  5DW2 A;  4R2Y A;  4YAB A;  2NAA A;  3N9N A;  3S91 A;  3LXJ A;  5DKA A;  5D3R A;  4CL9 A;  4O72 A;  2VJF B;  4OUF A;  5B78 A;  2ECJ A;  4CLB A;  3VK6 A;  5FFV A;  4FO9 A;  5H1T A;  2YQM A;  4NR9 A;  3PHD A;  4WHW A;  2MT5 A;  5EA1 A;  4Y03 A;  5HQ5 A;  2L0B A;  2LGK A;  4IR6 A;  3QZT A;  5AD2 A;  4MEN A;  1F62 A;  2DVR A;  4A9H A;  2G45 A;  5HFR A;  2E3K A;  2MIQ A;  5DBM A;  4ZQL A;  2H0D B;  4NQM A;  5H85 A;  2JRJ A;  4O7B A;  3MHS A;  4Q6F A;  5HRV A;  4QB3 A;  5TDW A;  3MB3 A;  4HXP A;  4QR3 A;  4IOR A;  4HBW A;  4O7A A;  5EWW A;  5CS8 A;  5IG6 A;  5EYA F;  5EVA A;  3ZYQ A;  2LAU A;  2M13 A;  4ALH A;  5E3G A;  2MNZ A;  2R0Y A;  2M1R A;  2KGG A;  5H1U A;  2LDR A;  2YT5 A;  4O70 A;  4P5O B;  5E9Y A;  4UYE A;  5JG6 A;  5AME A;  5DW1 A;  2CSY A;  4NRC A;  5CZG A;  5ENC A;  2OXQ C;  4PY6 A;  5KH7 A;  4N4F A;  4FK5 A;  3ZYU A;  4NS5 A;  5D1M B;  4O75 A;  4BBQ A;  2RI7 A;  3N9L A;  5TB6 A;  5CUG A;  4A9N A;  2LN0 A;  5D3J A;  1F68 A;  5FE5 A;  5AIT A;  3U5N A;  4HBV A;  4NR4 A;  5LKT A;  2KIZ A;  4QR4 A;  2L80 A;  3N9O A;  2LGV A;  3SOU A;  2ZET C;  4O77 A;  5B75 A;  4A9K A;  5C11 A;  2G4A A;  3JVL A;  4LAD B;  2KWJ A;  3HCT A;  3M62 A;  2YW5 A;  2F6J A;  3SVF A;  5D26 A;  3P1C A;  3TLP A;  3U5K A;  4MR4 A;  5K29 A;  1WES A;  2RR4 A;  3M7K A;  5TRB A;  5ENF A;  5AD3 A;  5E74 A;  5SVI A;  4YYI A;  5A81 A;  4R7E A;  5B8D A;  3KQI A;  3HME A;  4Z0O A;  5B76 A;  5FG5 A;  3HTK C;  2DVV A;  4CUQ A;  5FE4 A;  4A4C A;  3LQJ A;  5D3N A;  5G4R A;  2FUU A;  5LJ0 A;  5CQ5 A;  3T7L A;  4TU4 A;  4L7X A;  3GL6 A;  4LDF A;  1WEM A;  3FJU B;  4R8P K;  3DPL R;  4LZS A;  5DLX A;  4TS8 A;  4C66 A;  3P1D A;  3P5O A;  4QYL A;  1BOR A;  5EU1 A;  5TBN A;  5KH3 A;  2I50 A;  2YEM A;  5A85 A;  2MA5 A;  3ASL A;  2Y43 A;  5CQ7 A;  1WEQ A;  4B7Y C;  5A5O A;  4HXN A;  2YHN A;  3T6R A;  5G05 B;  5HEN A;  2OWA A;  3DWY A;  2CKL B;  2EJN A;  5I7Y A;  2DX8 A;  2KKY A;  5I40 A;  4N4H A;  4ZDT A;  4GNF A;  5F5Z A;  2BAY A;  2XOY A;  5EPS A;  2L43 A;  3ZTG A;  5EGU A;  2VPD A;  3D7C A;  5EK9 A;  3MXF A;  3KNV A;  5CQ4 A;  4XYA A;  4LZ2 A;  5CQ8 A;  4A9O A;  3IHP A;  3O36 A;  3JUE A;  3FL2 A;  4QUT A;  4QQ4 A;  3ERR A;  4OGJ A;  5F1L A;  5LKX A;  3UVW A;  3JVK A;  4UYF A;  1JM7 B;  5HRW A;  5KH9 A;  2DWW A;  5DYU A;  3I2D A;  4TT6 A;  3LQH A;  3Q2E A;  2R10 A;  5I29 A;  1X4U A;  4A4B A;  4OGE A;  3SHB A;  5FE9 A;  3K2J A;  4YYG A;  4YYJ A;  4AKH A;  5FBX A;  4GPJ A;  2LGG A;  4UIW A;  2GRC A;  5A7C A;  2JMI A;  4YY4 A;  1DVP A;  5J0D A;  1WEW A;  4LYW A;  4PPE A;  4QSU A;  5II2 A;  4KV4 A;  1WIM A;  5I3L A;  4IOQ A;  5HEL A;  5HLS A;  4HXL A;  2CRR A;  3RCW A;  5KO4 A;  4Z1Q A;  3NG2 A;  5FEY A;  4YYH A;  2YUR A;  2FD4 A;  1XWH A;  3G0L A;  4NR8 A;  4QSQ A;  5II1 A;  1LDJ B;  5KHM A;  5HFQ A;  5F1H A;  3UVY A;  5KTX A;  1Z60 A;  5F63 A;  2QJ0 A;  2QIZ A;  4Z1S A;  5CUE A;  4YH4 A;  5SVX A;  5IBN A;  2XP0 A;  5DIN A;  5CRZ A;  5EI4 A;  3D1B A;  4QEV A;  5FG4 A;  2YEK A;  4YY6 A;  3ZPV E;  5E9K A;  5LVQ A;  4XUA A;  5E9M A;  3L1X A;  4S3O C;  4QC3 A;  3FKM X;  2YHO A;  5EWC A;  5IID A;  5JWM A;  5C13 A;  2YW8 A;  5DLZ A;  4FIP A;  5ETB A;  4YBS A;  2CON A;  4NN2 A;  3ZVZ B;  4TYL A;  2E7N A;  5D3P A;  5LKU A;  4O71 A;  1ZBD B;  4CUR A;  2RS9 B;  2KFT A;  4OGC A;  3HMH A;  4O7E A;  2PNX A;  2ECT A;  4WZ0 A;  3JVJ A;  2MD7 B;  4UYH A;  4CCG X;  4A9E A;  5I83 A;  5KTU A;  5LKZ A;  2L5U A;  2YUC A;  2D82 A;  4QYD A;  5ACY A;  5DFB A;  5IGM A;  3O70 A;  5L99 A;  2VJF A;  5FE8 A;  5FFW A;  4HXR A;  4LYS A;  2VPG A;  3FAO A;  1G25 A;  5JI8 A;  1WIL A;  3LQI A;  4V3K C;  2HDP A;  4TZ8 A;  5CQT A;  4QY4 A;  5FB1 A;  5FH6 A;  1WEE A;  2RFJ A;  5HCL A;  4KV1 A;  4YYM A;  5TDR A;  1VYX A;  4PKL A;  3O7A A;  5SVY A;  5ENG A;  2XOC A;  2VNF A;  5DYX A;  5D0C A;  1PUO A;  3O34 A;  5IGK A;  2H0D A;  3KV6 A;  1E4U A;  5DFC A;  3FEH A;  4PS5 A;  4YAD A;  5I88 A;  4TQN A;  2KR4 A;  3C5K A;  4LC2 A;  2ECG A;  4MSX A;  2VPB A;  1VFY A;  4UIZ A;  4UYD A;  5EP7 A;  5EV9 A;  4UIV A;  3VKG A;  4O76 A;  1E6I A;  4TU6 A;  2VPE A;  2DVS A;  3AAD A;  1MM2 A;  4HXM A;  3UVX A;  1JSP B;  5AIU A;  4KCX A;  4YAX A;  4C67 A;  2EGM A;  4AUQ B;  2LQ6 A;  4IC3 A;  2JMJ A;  2LV9 A;  3LVR E;  5D3L A;  4FJC A;  5E9L A;  2HYE D;  3DWD A;  5A82 A;  5E73 A;  1HYI A;  5FE3 A;  2LRI C;  3MHH A;  2JUN A;  1K2F A;  5ENI A;  2LSP B;  5CUC A;  5IGL A;  5C7N A;  3U5J A;  3O35 A;  4XUB A;  1X0J A;  2EOD A;  4UIU A;  5D3T A;  5L98 A;  5A5Q A;  4AYC B;  4IR4 A;  4PCE A;  3SVG A;  5CU8 A;  3O47 A;  4LZR A;  2XB1 A;  2FSA A;  2H60 A;  4O78 A;  5D24 A;  2E61 A;  4QZS A;  2MJV B;  5L8T A;  2JMD A;  3GV4 A;  5D1L B;  5HJC A;  2D8U A;  5EIC A;  4QEU A;  4QNS A;  4UYG A;  4YC9 A;  2AN6 A;  5BT3 A;  4NR5 A;  5FDZ A;  3DDT A;  1X4J A;  4ZUX U;  5CRM A;  2K1J A;  5I7X A;  2QIC A;  5F3A A;  5CQ6 A;  5E9I A;  4BW2 A;  2ECN A;  5FFY A;  4J0R A;  3ZNI A;  4QEW A;  2KTB B;  4MR5 A;  4J1P A;  2P57 A;  2YQL A;  3PUQ A;  4L58 A;  4LKA A;  3Q1D A;  2DAT A;  2R0V A;  4IC2 A;  3SOX A;  4CUU A;  4YBT A;  1Z6U A;  4YYD A;  5FE7 A;  4AP4 A;  4QSX A;  4F1P A;  5CQA A;  3N9M A;  4QF3 A;  5G0F A;  2ECI A;  5G04 B;  5C4Q A;  5C8G A;  5I1Q A;  3N9P A;  4UI9 B;  5H9M A;  3MDB C;  4TZ2 A;  2CKL A;  4B86 C;  4AKG A;  5LJ2 A;  3RPG B;  5TAB A;  4X3G A;  3O33 A;  2Y1M A;  4TKP B;  4ZC9 A;  1WFK A;  4OGI A;  3D1D A;  4Z93 A;  5FE6 A;  4YYN A;  2RNX A;  5LVR A;  5F61 A;  3FAN A;  4XY8 A;  3L1Z B;  5LJ1 A;  1WEO A;  3G0J A;  4YK0 A;  5E9V A;  2RSD A;  5EWD A;  3PUR A;  2F42 A;  3U5L A;  3FM8 C;  5L8U A;  1WUG A;  4NYX A;  5G4S A;  3Q2F A;  3LJW A;  5FE1 A;  3IU5 A;  5I80 A;  2G43 A;  4QC1 A;  1JM7 A;  2I8N A;  1WEU A;  3JVM A;  2E6S A;  2G6Q A;  5I89 A;  2VJE B;  5FE2 A;  4QSS A;  2PUY A;  2MNY A;  4MR3 A;  2YVR A;  5DX4 A;  3U5O A;  2KWO A;  4WHU A;  2I7K A;  1ZKR A;  5CFW A;  2N9G A;  4NRA A;  4Z6H A;  2DJA A;  5F36 A;  4ZW1 A;  4UP5 A;  5ENH A;  4QSR A;  5KU3 A; 
#chains in the Genus database with same CATH homology
 3MQM A;  4J3I A;  5FER A;  3ZPV 1;  4CUT A;  2LGL A;  4NQN A;  2KRE A;  4LYI A;  4TT2 A;  5L96 A;  4A9L A;  2DKW A;  5ENB A;  4WIV A;  3NXB A;  1FBV A;  5LUU A;  5IGN A;  4XI1 A;  3UVD A;  4A9M A;  5EM3 A;  4ALG A;  4HBX A;  4LJN A;  5DYC A;  4W4U A;  4AKN A;  3GG3 A;  5J3X A;  2E6R A;  4NYV A;  4UIT A;  2IDA A;  5CQ3 A;  3KV5 A;  4XY9 A;  5A5S A;  2RO1 A;  4A9F A;  5DKH A;  1JM4 B;  4NUD A;  2D9E A;  2F6N A;  4WZ2 A;  4N4I A;  5D25 A;  3MUK A;  3QZS A;  5I86 A;  1CHC A;  1MM3 A;  1WE9 A;  5LCW B;  1IYM A;  5CGP A;  2MA6 A;  4A9J A;  4QUU A;  3P1F A;  2EA6 A;  4LLB A;  4IR5 A;  4A49 A;  5D1K B;  4F52 B;  5EIS A;  2K4D A;  2YQD A;  4MEQ A;  5CUD A;  4O64 A;  5H1V A;  1WEV A;  5CPE A;  4WA6 A;  2FUI A;  5DYA A;  3O37 A;  4LK9 A;  5A5P A;  1EQF A;  1WEP A;  3HCS A;  1Z2Q A;  3N9Q A;  3M63 A;  4BJX A;  2Y1N A;  2VP7 A;  5CP5 A;  4CA1 A;  2LXH C;  4O7C A;  4IOO A;  4QSV A;  1LDK C;  4CFK A;  4O7F A;  2C2L A;  5A83 A;  2MD8 C;  4AVX A;  4S3O B;  2K16 A;  4HXO A;  4MVT A;  4DON A;  3QZV A;  5BT4 A;  4QBM A;  2C2V S;  4CFL A;  1HYJ A;  4J0S A;  5BT5 A;  4Q0N A;  3L11 A;  5C87 A;  4BW1 A;  3V43 A;  2EGP A;  2L84 A;  5C89 A;  3U5M A;  4V3L C;  1V87 A;  4CUS A;  4Q0O A;  5D3S A;  2CT2 A;  4I7B A;  5KTW A;  3UW9 A;  4BHW A;  5L97 A;  4PTB A;  1WGM A;  4NUC A;  4QSW A;  2L75 A;  4GNE A;  3RPG C;  5FH8 A;  5FG6 A;  2YEL A;  4GB0 A;  1ZS5 A;  2YRE A;  2YSM A;  5B77 A;  1VD4 A;  4GNG A;  3P1E A;  3HMF A;  2WP2 A;  2KWN A;  5E3D A;  5EWH A;  4AYC A;  3SOW A;  4NR7 A;  4LR6 A;  3MUL A;  5D7X A;  3ZVY A;  2RNW A;  4N4G A;  4MEP A;  4E96 A;  2RNY A;  2D8S A;  3DQV R;  4NYW A;  4MR6 A;  4BW3 A;  4F3I A;  2XEU A;  2YYR A;  4I7D A;  4A9I A;  5DFD A;  2R0S A;  4LRG A;  3HCU A;  4IR3 A;  5EQ1 A;  5FE0 A;  5DKC A;  3AQA A;  4A0C D;  4NUE A;  4UIX A;  2KE1 A;  5ENJ A;  1RMD A;  5EWV A;  5E7D A;  4UP0 A;  4YAT A;  4UYF B;  4CUP A;  4GND A;  4O74 A;  4X2I A;  5EPB A;  2MUM A;  4QST A;  2OO1 A;  5FB0 A;  4NR6 A;  1X4I A;  4MEO A;  5COI A;  2M85 A;  1JOC A;  2KYU A;  1N87 A;  2DVQ A;  3S92 A;  4QSP A;  5EPR A;  4TTE A;  4HBY A;  1FP0 A;  3M99 A;  1WUM A;  2YYN A;  5D3H A;  5ENE A;  3UV2 A;  4NRB A;  2M3H A;  1U6G B;  4N3W A;  5CY9 A;  4C9Z A;  4WZ3 B;  2K17 A;  4HXS A;  2KU3 A;  5FH7 A;  5C85 A;  5AMF A;  4UIY A;  5ETD A;  4HXK A;  2CSZ A;  2NXB A;  2UZG A;  2OSS A;  5CUA A;  5HM0 A;  4Z6I A;  1T1H A;  2ECV A;  1N72 A;  4YH3 A;  3LRQ A;  4QF2 A;  5DKD A;  4FLP A;  4I7C A;  4YYK A;  1WEN A;  3I3J A;  3RTR B;  2L85 A;  3UV4 A;  4YBM A;  2YDW A;  3SVH A;  5HQ7 A;  2M6M A;  2VJE A;  5CTL A;  5E0R A;  5F60 A;  5A5N A;  3IU6 A;  4PCI A;  3ONI A;  5TCM A;  3MB4 A;  4BW4 A;  2KGI A;  2YU4 A;  5B79 A;  2WP1 A;  2L5E A;  5DY7 A;  5F2P A;  2OUO A;  3UV5 A;  3U5P A;  2ECW A;  4RVR A;  4NXJ A;  4QR5 A;  5HEM A;  5A5R A;  5HRX A;  5HQ6 A;  3EB5 A;  3EB6 A;  4TT4 A;  2KWK A;  5F62 A;  2LXP C;  2YSJ A;  3DAI A;  2E7O A;  5F25 A;  3C6W A;  5CUB A;  5DW2 A;  4R2Y A;  4YAB A;  2NAA A;  3N9N A;  3S91 A;  3LXJ A;  5DKA A;  5D3R A;  4CL9 A;  4O72 A;  2VJF B;  4OUF A;  5B78 A;  2ECJ A;  4CLB A;  3VK6 A;  5FFV A;  4FO9 A;  5H1T A;  2YQM A;  4NR9 A;  3PHD A;  4WHW A;  2MT5 A;  5EA1 A;  4Y03 A;  5HQ5 A;  2L0B A;  2LGK A;  4IR6 A;  3QZT A;  5AD2 A;  4MEN A;  1F62 A;  2DVR A;  4A9H A;  2G45 A;  5HFR A;  2E3K A;  2MIQ A;  5DBM A;  4ZQL A;  2H0D B;  4NQM A;  5H85 A;  2JRJ A;  4O7B A;  3MHS A;  4Q6F A;  5HRV A;  4QB3 A;  5TDW A;  3MB3 A;  4HXP A;  4QR3 A;  4IOR A;  4HBW A;  4O7A A;  5EWW A;  5CS8 A;  5IG6 A;  5EYA F;  5EVA A;  3ZYQ A;  4ALH A;  5E3G A;  2MNZ A;  2R0Y A;  2M1R A;  2KGG A;  5H1U A;  2LDR A;  2YT5 A;  4O70 A;  4P5O B;  5E9Y A;  4UYE A;  5JG6 A;  5AME A;  5DW1 A;  2CSY A;  4NRC A;  5CZG A;  5ENC A;  2OXQ C;  4PY6 A;  5KH7 A;  4N4F A;  4FK5 A;  3ZYU A;  4NS5 A;  5D1M B;  4O75 A;  4BBQ A;  2RI7 A;  3N9L A;  5TB6 A;  5CUG A;  4A9N A;  2LN0 A;  5D3J A;  1F68 A;  5FE5 A;  5AIT A;  3U5N A;  4HBV A;  4NR4 A;  5LKT A;  2KIZ A;  4QR4 A;  2L80 A;  3N9O A;  2LGV A;  3SOU A;  2ZET C;  4O77 A;  5B75 A;  4A9K A;  5C11 A;  2G4A A;  3JVL A;  4LAD B;  2KWJ A;  3HCT A;  3M62 A;  2YW5 A;  2F6J A;  3SVF A;  5D26 A;  3P1C A;  3TLP A;  3U5K A;  4MR4 A;  5K29 A;  1WES A;  5TRB A;  5ENF A;  5AD3 A;  5E74 A;  4YYI A;  5A81 A;  4R7E A;  5B8D A;  3KQI A;  3HME A;  5B76 A;  5FG5 A;  3HTK C;  2DVV A;  4CUQ A;  5FE4 A;  4A4C A;  3LQJ A;  5D3N A;  5G4R A;  2FUU A;  5LJ0 A;  5CQ5 A;  3T7L A;  4TU4 A;  4L7X A;  3GL6 A;  4LDF A;  1WEM A;  4R8P K;  3DPL R;  4LZS A;  5DLX A;  4TS8 A;  4C66 A;  3P1D A;  3P5O A;  4QYL A;  1BOR A;  5EU1 A;  5TBN A;  5KH3 A;  2I50 A;  2YEM A;  5A85 A;  2MA5 A;  3ASL A;  2Y43 A;  5CQ7 A;  1WEQ A;  4B7Y C;  5A5O A;  4HXN A;  2YHN A;  3T6R A;  5G05 B;  5HEN A;  3DWY A;  2CKL B;  2DX8 A;  5I7Y A;  5I40 A;  4N4H A;  4ZDT A;  4GNF A;  5F5Z A;  2BAY A;  3ZTG A;  5EPS A;  2L43 A;  5EGU A;  2VPD A;  3D7C A;  5EK9 A;  3MXF A;  3KNV A;  5CQ4 A;  4XYA A;  4LZ2 A;  5CQ8 A;  4A9O A;  3IHP A;  3O36 A;  3FL2 A;  4QUT A;  4OGJ A;  5F1L A;  5LKX A;  3UVW A;  3JVK A;  4UYF A;  1JM7 B;  5HRW A;  5KH9 A;  2DWW A;  5DYU A;  3I2D A;  4TT6 A;  3LQH A;  3Q2E A;  2R10 A;  5I29 A;  1X4U A;  4A4B A;  3SHB A;  5FE9 A;  3K2J A;  4YYG A;  4YYJ A;  5FBX A;  4GPJ A;  2LGG A;  4UIW A;  2GRC A;  5A7C A;  2JMI A;  4YY4 A;  1DVP A;  5J0D A;  1WEW A;  4LYW A;  4PPE A;  4QSU A;  5II2 A;  4KV4 A;  1WIM A;  5I3L A;  4IOQ A;  5HEL A;  5HLS A;  4HXL A;  3RCW A;  5KO4 A;  4Z1Q A;  3NG2 A;  5FEY A;  4YYH A;  2YUR A;  1XWH A;  3G0L A;  4NR8 A;  4QSQ A;  5II1 A;  1LDJ B;  5KHM A;  5HFQ A;  5F1H A;  3UVY A;  5KTX A;  1Z60 A;  5F63 A;  2QJ0 A;  2QIZ A;  4Z1S A;  5CUE A;  4YH4 A;  5IBN A;  5DIN A;  5CRZ A;  5EI4 A;  4QEV A;  5FG4 A;  2YEK A;  4YY6 A;  3ZPV E;  5E9K A;  5LVQ A;  4XUA A;  5E9M A;  3L1X A;  4S3O C;  4QC3 A;  3FKM X;  2YHO A;  5EWC A;  5IID A;  5JWM A;  5C13 A;  2YW8 A;  5DLZ A;  4FIP A;  5ETB A;  4YBS A;  4NN2 A;  3ZVZ B;  4TYL A;  2E7N A;  5D3P A;  5LKU A;  4O71 A;  1ZBD B;  4CUR A;  2RS9 B;  2KFT A;  3HMH A;  4O7E A;  2PNX A;  2ECT A;  4WZ0 A;  3JVJ A;  2MD7 B;  4UYH A;  4CCG X;  4A9E A;  5I83 A;  5KTU A;  5LKZ A;  2L5U A;  2YUC A;  2D82 A;  4QYD A;  5ACY A;  5DFB A;  5IGM A;  3O70 A;  5L99 A;  2VJF A;  5FE8 A;  5FFW A;  4HXR A;  4LYS A;  2VPG A;  1G25 A;  5JI8 A;  1WIL A;  3LQI A;  4V3K C;  2HDP A;  4TZ8 A;  5CQT A;  4QY4 A;  5FB1 A;  5FH6 A;  1WEE A;  2RFJ A;  5HCL A;  4KV1 A;  4YYM A;  5TDR A;  1VYX A;  4PKL A;  3O7A A;  5ENG A;  2VNF A;  5DYX A;  5D0C A;  5IGK A;  3O34 A;  2H0D A;  3KV6 A;  1E4U A;  5DFC A;  4PS5 A;  4YAD A;  5I88 A;  4TQN A;  2KR4 A;  3C5K A;  4LC2 A;  2ECG A;  4MSX A;  2VPB A;  1VFY A;  4UIZ A;  4UYD A;  5EP7 A;  5EV9 A;  4UIV A;  4O76 A;  1E6I A;  4TU6 A;  2VPE A;  2DVS A;  3AAD A;  1MM2 A;  4HXM A;  3UVX A;  1JSP B;  5AIU A;  4KCX A;  4YAX A;  4C67 A;  4AUQ B;  2LQ6 A;  4IC3 A;  2JMJ A;  2LV9 A;  5D3L A;  4FJC A;  5E9L A;  2HYE D;  5A82 A;  5E73 A;  1HYI A;  5FE3 A;  2LRI C;  3MHH A;  1K2F A;  5ENI A;  2LSP B;  5CUC A;  5IGL A;  5C7N A;  3U5J A;  3O35 A;  4XUB A;  1X0J A;  2EOD A;  4UIU A;  5D3T A;  5L98 A;  5A5Q A;  4AYC B;  4IR4 A;  4PCE A;  3SVG A;  5CU8 A;  4LZR A;  2XB1 A;  2FSA A;  2H60 A;  4O78 A;  5D24 A;  4QZS A;  2MJV B;  5L8T A;  2JMD A;  3GV4 A;  5D1L B;  5HJC A;  5EIC A;  4QEU A;  4QNS A;  4UYG A;  4YC9 A;  2AN6 A;  5BT3 A;  4NR5 A;  5FDZ A;  1X4J A;  4ZUX U;  5CRM A;  2K1J A;  5I7X A;  2QIC A;  5F3A A;  5CQ6 A;  5E9I A;  4BW2 A;  2ECN A;  5FFY A;  4J0R A;  3ZNI A;  4QEW A;  2KTB B;  4MR5 A;  4J1P A;  2YQL A;  3PUQ A;  4L58 A;  4LKA A;  2DAT A;  2R0V A;  4IC2 A;  3SOX A;  4CUU A;  4YBT A;  1Z6U A;  4YYD A;  5FE7 A;  4AP4 A;  4QSX A;  5CQA A;  3N9M A;  4QF3 A;  5G0F A;  2ECI A;  5G04 B;  5C4Q A;  5C8G A;  5I1Q A;  3N9P A;  4UI9 B;  5H9M A;  4TZ2 A;  2CKL A;  4B86 C;  5LJ2 A;  3RPG B;  5TAB A;  4X3G A;  3O33 A;  2Y1M A;  4TKP B;  4ZC9 A;  1WFK A;  4OGI A;  4Z93 A;  5FE6 A;  4YYN A;  2RNX A;  5LVR A;  5F61 A;  4XY8 A;  3L1Z B;  5LJ1 A;  1WEO A;  3G0J A;  4YK0 A;  5E9V A;  2RSD A;  5EWD A;  3PUR A;  2F42 A;  3U5L A;  5L8U A;  1WUG A;  4NYX A;  5G4S A;  3Q2F A;  3LJW A;  5FE1 A;  3IU5 A;  5I80 A;  2G43 A;  4QC1 A;  1JM7 A;  2I8N A;  1WEU A;  3JVM A;  2E6S A;  2G6Q A;  5I89 A;  2VJE B;  5FE2 A;  4QSS A;  2PUY A;  2MNY A;  4MR3 A;  5DX4 A;  3U5O A;  2KWO A;  4WHU A;  2I7K A;  5CFW A;  2N9G A;  4NRA A;  4Z6H A;  5F36 A;  4ZW1 A;  4UP5 A;  5ENH A;  4QSR A;  5KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...