3U5PA

Crystal structure of the complex of trim33 phd-bromo and h3(1-28)k9me3k14ack18ack23ac histone peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
188
Chain Sequence
b'DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 56
structure length 188
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5pA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5pA01
4AP4A 4PS5A 3SOWA 5CGPA 1EQFA 2NAAA 3S91A 4TU4A 2RNXA 5B77A 5FDZA 2WP2A 4CURA 3LQJA 5TB6A 2FUIA 4YBTA 5CPEA 5DW1A 4CUTA 5A82A 3ONIA 1X4JA 3KV6A 4ZDTA 5F1LA 4ZUXU 4ZW1A 5DYCA 3QZTA 5I7YA 2JMIA 2OSSA 3D7CA 4LYSA 4QYDA 2K4DA 3MQMA 4GNGA 5E3GA 5CUBA 2D82A 2KU3A 5KTWA 4YY6A 4W4UA 3O34A 5FFYA 5E74A 5BT5A 3JVLA 3RCWA 2VP7A 1N72A 4RVRA 4UP5A 4XY8A 2LXPC 5TDWA 2DVSA 5COIA 1JOCA 3O70A 5CS8A 3L1ZB 4LADB 3G0LA 2I50A 3KV5A 3FKMX 4LZ2A 4NQNA 3UVDA 2VJFA 3N9QA 4IR3A 4I7BA 2YREA 4MR4A 1WUGA 5EA1A 5HRXA 4YATA 4QC1A 4O74A 1F62A 4LJNA 5LVQA 5KH9A 5F62A 1MM3A 3ZVZB 4AUQB 1WFKA 4LK9A 3U5OA 5I3LA 2KTBB 5FG4A 4TKPB 4QEWA 1CHCA 4BW2A 4Z6IA 3ZYQA 4R8PK 5E3DA 3MUKA 2KFTA 4MEPA 2CKLB 4NR6A 3SOUA 3P1EA 5CRMA 4Q6FA 4A9OA 4IR5A 3MHSA 2GRCA 4UYFB 5G04B 1FBVA 4J1PA 5I29A 3L1XA 1BORA 4WZ3B 5EVAA 5ENJA 2ECIA 4BBQA 1WEEA 1JM7B 1WEUA 2LQ6A 1WEWA 3LQHA 5DBMA 1FP0A 5EWCA 4YBSA 5BT4A 2XEUA 2R0VA 4YYJA 3U5JA 2BAYA 5G0FA 4MR6A 2YHNA 4O7AA 4ALHA 2I7KA 4A9EA 2DWWA 5F61A 4NR9A 1DVPA 1ZS5A 2OXQC 4O64A 5LKUA 5DLXA 5TDRA 5A5OA 4UIXA 5EWHA 2YU4A 5HRVA 2MT5A 5C8GA 5DINA 5DFCA 5DYAA 4Z1QA 5C87A 5TBNA 4UITA 2VJEB 1JSPB 2EGPA 3U5MA 2CSYA 2YT5A 3JVKA 4WZ2A 1U6GB 5EQ1A 2DVRA 4N4GA 4YYIA 5A83A 5A5PA 5D3PA 2VPDA 5C85A 4O70A 5K29A 4QYLA 1ZBDB 5DFDA 2HYED 2KGIA 4QEVA 3T7LA 5E7DA 4WHWA 5E9MA 4O77A 4P5OB 5G05B 4YAXA 4NYVA 2MIQA 5H1TA 2E7OA 3HMFA 3RPGB 5F5ZA 5ETBA 5DKAA 1WEVA 2K17A 4LZRA 5H1VA 2F6JA 4N3WA 3C5KA 5II1A 2ZETC 5KH3A 4ZC9A 1RMDA 4I7CA 3UV5A 5D3RA 3SVGA 4S3OC 5EK9A 5ENEA 2E6RA 4LKAA 4FJCA 4A4CA 4HXSA 5FB0A 5KTUA 2DVVA 5LKXA 4A0CD 2E7NA 4TT2A 3N9PA 5L99A 5D25A 2L75A 2YQLA 2YSMA 4TZ8A 3QZSA 5CUAA 4J0SA 5L96A 2CSZA 5CRZA 4UIVA 4GNDA 4NRAA 5FERA 4HBYA 5EM3A 3SOXA 1N87A 3K2JA 3UV2A 3SHBA 5CUEA 4A9IA 4QNSA 5D1LB 4AVXA 5D1MB 4TU6A 2M85A 3P1FA 4QEUA 4PCEA 5DY7A 3ZYUA 5H85A 4NUEA 2NXBA 2FSAA 1WEMA 3LRQA 3I2DA 3GV4A 5KH7A 2RI7A 3MULA 3P5OA 4AKNA 4LYWA 3EB5A 5E0RA 4PY6A 3FL2A 1V87A 2YEMA 1WUMA 4TQNA 3T6RA 3LXJA 5AMFA 3M62A 5ENIA 5DLZA 4IR6A 5E9KA 5ENBA 5DKDA 2LXHC 3QZVA 2HDPA 2M3HA 2VPEA 1WIMA 5EICA 5CQ5A 5EPRA 4NR5A 4UYEA 4QR5A 2MNYA 4OGJA 5FH6A 2YQMA 5FE0A 5LVRA 2MA6A 5LKTA 1VYXA 1IYMA 3DWYA 5CQTA 5II2A 2N9GA 5I7XA 2RSDA 1XWHA 4WIVA 5KO4A 1E6IA 4HXLA 2L43A 2YQDA 3HMEA 4Q0OA 5IGMA 5JI8A 2H60A 1LDJB 5EU1A 3UVWA 3NXBA 5FE5A 5ENHA 5J3XA 2KIZA 3O36A 2G45A 2YYRA 4BHWA 2KWNA 5LJ1A 4A9LA 2XB1A 4YYKA 2LV9A 5D3SA 4V3LC 2ECJA 4QR4A 3KQIA 4QUUA 5I86A 2F6NA 4FLPA 5CQ8A 5HM0A 2KE1A 3KNVA 5AITA 4AYCA 3IU6A 2LN0A 4NR8A 5FBXA 5L97A 3UV4A 4HXRA 5FH7A 5EWWA 4J3IA 2YURA 5D1KB 5EWVA 3Q2EA 3LJWA 5HLSA 4A4BA 1WILA 4QR3A 2VJFB 1MM2A 3M63A 4B86C 4YH3A 4FIPA 2LRIC 5D3NA 2LDRA 2KR4A 2QJ0A 2DATA 5F3AA 5H9MA 4TYLA 2F42A 4PTBA 4NYWA 4OGIA 4CCGX 3S92A 3PHDA 2PUYA 2MD8C 5C11A 5FE8A 4QF3A 2R0YA 4CFLA 2K1JA 4QY4A 4YK0A 5FE7A 4R7EA 5A5SA 4KV4A 5DW2A 4V3KC 4A9JA 5B8DA 5J0DA 4O7CA 4NUCA 1WE9A 1E4UA 4UYHA 4CUPA 2JMDA 5C7NA 5JG6A 3ZTGA 4QSVA 5F36A 4LC2A 4Z93A 4MEQA 4NS5A 5FE6A 5AD2A 2L85A 4ALGA 5HFQA 4TT6A 5DX4A 3MHHA 3DAIA 2MUMA 5CUDA 4A9MA 5BT3A 5I88A 4O7FA 4QUTA 3SVHA 1X4UA 2YDWA 2H0DB 5HENA 5E9LA 2WP1A 4NRBA 3V43A 5EI4A 3HTKC 5H1UA 2ECVA 5TRBA 2C2LA 2KWOA 2LGKA 4QSQA 5CQ6A 1LDKC 2YYNA 4C67A 1X0JA 3NG2A 5D3JA 5FE2A 2EA6A 1F68A 4O75A 5IGKA 4YYMA 4HXNA 3UVYA 4C9ZA 2RNYA 5D3LA 4WZ0A 4TZ2A 4IR4A 4J0RA 4E96A 2YHOA 3DPLR 2K16A 4HXMA 3RPGC 5I80A 2ECWA 4C66A 4IC3A 5E73A 1VD4A 1JM4B 2L80A 5CY9A 3N9OA 4KCXA 5CQ4A 5EWDA 2LGVA 4O71A 5DYXA 2ECTA 4FK5A 4FO9A 1HYIA 4YYGA 4BJXA 1K2FA 4BW4A 4TTEA 5I89A 4F52B 2QIZA 5FB1A 5F25A 4IOQA 3C6WA 4L7XA 2YSJA 5E9VA 4A9HA 5I83A 5HELA 3PURA 4NR7A 4A49A 1Z6UA 2Y1MA 3ZPVE 4QSSA 4NXJA 4Q0NA 3N9NA 2RNWA 3N9LA 4QF2A 1WEQA 4NQMA 4YYDA 5D26A 4N4IA 5EV9A 4HBWA 2OO1A 4QZSA 5FFVA 5AD3A 5C13A 4XUAA 3AQAA 4Z6HA 2JMJA 2IDAA 4X2IA 5F60A 5HFRA 3UVXA 5LUUA 4QSPA 5FE3A 2D9EA 2DX8A 2LGGA 3LQIA 5FE1A 5FE4A 2RO1A 2MJVB 5CUCA 5IG6A 4CLBA 2KGGA 5DKHA 5LJ0A 4XI1A 3G0JA 3RTRB 5A81A 5CZGA 3TLPA 5C89A 4QSXA 2R0SA 5ENFA 4UIUA 4QSRA 5LJ2A 1Z60A 2YW5A 2QICA 3N9MA 2L5EA 5B76A 5D3TA 4A9KA 5B79A 4QSUA 4MENA 4O78A 5A5RA 5CU8A 5KU3A 3ZPV1 3Q2FA 4CUUA 4ZQLA 4UYGA 4O7BA 4QSWA 5F63A 2EODA 3PUQA 3U5PA 4HXOA 5EGUA 3MXFA 2L5UA 5A85A 1WEOA 4MEOA 4YC9A 2CKLA 2LSPB 4BW3A 4HXPA 2E6SA 5ENGA 2CT2A 5FG5A 5HQ6A 4UIWA 2AN6A 2RFJA 4UYFA 1JM7A 3IU5A 5DYUA 4UIYA 4YYHA 4GNFA 4CL9A 5G4RA 4PPEA 5HRWA 5TCMA 5IGNA 3P1CA 5CQ7A 5D7XA 2G6QA 4CFKA 2G43A 2OUOA 4I7DA 3HCSA 5L98A 3O33A 5EP7A 3U5LA 4YY4A 4WA6A 5CUGA 3EB6A 4YADA 2RS9B 4HBXA 5F1HA 4PCIA 1T1HA 5ENCA 3IHPA 4UI9B 2KYUA 2YELA 1WESA 3DQVR 4A9NA 4WHUA 5CQ3A 4QBMA 5E9YA 2MD7B 4LZSA 4Y03A 5CP5A 5KTXA 4YABA 1WEPA 2YEKA 4OUFA 5AIUA 5I1QA 2D8SA 4NRCA 5FFWA 4DONA 2ECGA 5FEYA 4MR3A 5ETDA 5HQ7A 2VJEA 3GG3A 4X3GA 4AYCB 4QC3A 2LGLA 3SVFA 5F2PA 3VK6A 5DKCA 2UZGA 4GB0A 4QB3A 4R2YA 5KHMA 4A9FA 4XYAA 5D0CA 2DVQA 3U5NA 3HCUA 2VNFA 2Y1NA 5FG6A 4N4HA 3UW9A 5B78A 3JVJA 3ZNIA 2L84A 1HYJA 1Z2QA 4HBVA 4O76A 4NUDA 2H0DA 2MA5A 5D24A 2YUCA 3AADA 3I3JA 2PNXA 2L0BA 5AMEA 2Y43A 4IOOA 4MSXA 2I8NA 4LR6A 3JVMA 4YBMA 4IORA 5B75A 3GL6A 2ECNA 5EYAF 1WGMA 5IBNA 5DFBA 5L8UA 4GPJA 3MB3A 5HJCA 4BW1A 1X4IA 3O7AA 5C4QA 4NR4A 4XUBA 5FE9A 2C2VS 5A5NA 2DKWA 4NYXA 5LKZA 3ZVYA 2R10A 5A7CA 4YH4A 4LRGA 5FH8A 5L8TA 3M99A 4S3OB 4IC2A 5D3HA 4B7YC 5CTLA 3U5KA 4CUQA 2G4AA 5CQAA 4N4FA 4QSTA 5HEMA 5I40A 1G25A 5EISA 1WENA 4TS8A 4CUSA 4LLBA 2VPGA 2KREA 5IIDA 4LYIA 2FUUA 5ACYA 5E9IA 2E3KA 4PKLA 2JRJA 2M6MA 4LDFA 2VPBA 2YW8A 4KV1A 5G4SA 2MNZA 4CA1A 2KWJA 3HCTA 4MVTA 3P1DA 4F3IA 2KWKA 5CFWA 3O35A 3ASLA 5EPSA 3L11A 5HQ5A 4O72A 3MB4A 4HXKA 4O7EA 4L58A 4MR5A 3HMHA 5EPBA 4GNEA 4NN2A 5JWMA 4UP0A 4XY9A 3O37A 4UYDA 5A5QA 4YYNA 5IGLA 4Z1SA 2M1RA 5LCWB 4UIZA 5TABA 5HCLA 4TT4A 1VFYA
chains in the Genus database with same CATH superfamily
4AP4A 4PS5A 3SOWA 5CGPA 1EQFA 2NAAA 3S91A 2KKXA 4TU4A 2RNXA 5B77A 4AI6A 5FDZA 2WP2A 4CURA 3LQJA 5TB6A 5SVIB 2FUIA 4YBTA 5CPEA 5DW1A 4CUTA 5A82A 3ONIA 1X4JA 3KV6A 4ZDTA 5F1LA 4ZUXU 2XOZA 3VKGA 4ZW1A 5DYCA 3QZTA 5I7YA 2JMIA 2OSSA 3D7CA 4LYSA 4QYDA 2K4DA 3MQMA 3DDTA 4GNGA 5E3GA 5CUBA 2D82A 2KU3A 5KTWA 4YY6A 4W4UA 3O34A 5FFYA 5E74A 5BT5A 3JVLA 3RCWA 2VP7A 1N72A 4RVRA 4UP5A 4XY8A 2LXPC 5TDWA 2DVSA 5COIA 1JOCA 3O70A 5CS8A 3L1ZB 4LADB 3G0LA 2I50A 3KV5A 3FKMX 4LZ2A 4NQNA 3UVDA 2VJFA 3N9QA 4IR3A 4I7BA 2YREA 4MR4A 1WUGA 5EA1A 5HRXA 4YATA 4QC1A 4O74A 1F62A 4LJNA 5LVQA 5KH9A 5F62A 1MM3A 2D8UA 3ZVZB 3FJUB 1WFKA 4LK9A 4AUQB 3U5OA 5I3LA 2KTBB 5FG4A 4TKPB 4QEWA 1CHCA 4BW2A 4Z6IA 3ZYQA 4R8PK 5E3DA 3MUKA 2KFTA 4MEPA 2CKLB 4NR6A 3SOUA 3P1EA 5CRMA 2XP0A 4Q6FA 4A9OA 4IR5A 3MHSA 2GRCA 4UYFB 5G04B 1FBVA 4J1PA 5I29A 3L1XA 1BORA 4WZ3B 5EVAA 5ENJA 2ECIA 4BBQA 1WEEA 1JM7B 1WEUA 2LQ6A 1WEWA 3FANA 3LQHA 5DBMA 1FP0A 2EXUA 5EWCA 4YBSA 5BT4A 2XEUA 2R0VA 4AKGA 4YYJA 3U5JA 2BAYA 3Q1DA 5G0FA 4MR6A 2YHNA 4O7AA 4ALHA 2I7KA 4A9EA 2DWWA 5F61A 4NR9A 1DVPA 1ZS5A 2OXQC 4O64A 5LKUA 5DLXA 5TDRA 5A5OA 4UIXA 5EWHA 2YU4A 5HRVA 2MT5A 5C8GA 5DINA 5DFCA 5DYAA 4Z1QA 5C87A 5TBNA 4UITA 2VJEB 1JSPB 2EGPA 3U5MA 2CSYA 2YT5A 3JVKA 4WZ2A 1U6GB 5EQ1A 2DVRA 4N4GA 4YYIA 5A83A 5A5PA 5D3PA 2VPDA 5C85A 4O70A 5K29A 4QYLA 1ZBDB 5DFDA 2HYED 2KGIA 4QEVA 3T7LA 5E7DA 4WHWA 5E9MA 4O77A 3D1DA 4P5OB 5G05B 4YAXA 4NYVA 2MIQA 3DWDA 5H1TA 1DCQA 2E7OA 3HMFA 2XOYA 3RPGB 5F5ZA 5ETBA 5DKAA 1WEVA 2K17A 2JUNA 4LZRA 5H1VA 3O47A 2F6JA 4N3WA 3C5KA 5II1A 2ZETC 5KH3A 4ZC9A 1RMDA 4I7CA 3UV5A 5D3RA 3SVGA 4S3OC 5EK9A 5SVYA 5ENEA 2E6RA 4LKAA 4FJCA 4A4CA 4HXSA 5SVXA 5FB0A 5KTUA 2DVVA 5LKXA 4Z0OA 4A0CD 2E7NA 4TT2A 3N9PA 2CRWA 5L99A 5D25A 2L75A 2YQLA 2YSMA 4TZ8A 3QZSA 5CUAA 4AKHA 4J0SA 5L96A 2CSZA 5CRZA 2CONA 4UIVA 4GNDA 4NRAA 5FERA 4HBYA 5EM3A 3LJUX 3SOXA 1N87A 3K2JA 2IQJA 3UV2A 3SHBA 5CUEA 4A9IA 4QNSA 5D1LB 4AVXA 5D1MB 4TU6A 2M85A 3P1FA 4QEUA 4PCEA 5DY7A 3ZYUA 5H85A 4NUEA 2NXBA 2FSAA 1WEMA 3LRQA 4Z0RA 3I2DA 3GV4A 5KH7A 2RI7A 3MULA 3P5OA 4AKNA 4LYWA 2DSMA 3EB5A 5E0RA 4PY6A 3FL2A 1V87A 2YEMA 1WUMA 4TQNA 3T6RA 3LXJA 5AMFA 3M62A 5ENIA 5DLZA 4IR6A 5E9KA 5ENBA 5DKDA 2LXHC 3QZVA 2HDPA 2M3HA 2VPEA 1WIMA 5EICA 2OWAA 5CQ5A 5EPRA 4NR5A 4UYEA 4QR5A 2MNYA 4OGJA 5FH6A 2YQMA 5FE0A 5LVRA 2MA6A 5LKTA 1VYXA 1IYMA 3DWYA 5CQTA 5II2A 2N9GA 5I7XA 2RSDA 1XWHA 4WIVA 5KO4A 1E6IA 4HXLA 2L43A 2YQDA 3HMEA 4Q0OA 5IGMA 5JI8A 2H60A 1LDJB 5EU1A 3UVWA 3NXBA 5FE5A 5ENHA 5J3XA 3LVQE 2KIZA 3O36A 4AKIA 3FM8C 2G45A 2YYRA 4BHWA 2KWNA 5LJ1A 4A9LA 2XB1A 4YYKA 2LV9A 5D3SA 4V3LC 2ECJA 4QR4A 3KQIA 4QUUA 5I86A 2F6NA 4FLPA 5CQ8A 5HM0A 2KE1A 3KNVA 5AITA 4AYCA 3IU6A 2LN0A 4NR8A 5FBXA 5L97A 3UV4A 4HXRA 5FH7A 5EWWA 4J3IA 2YURA 5D1KB 5EWVA 3Q2EA 3LJWA 5HLSA 4A4BA 1WILA 4QR3A 2VJFB 1MM2A 3M63A 4B86C 4YH3A 4FIPA 2LRIC 5D3NA 2LDRA 2KR4A 2M13A 2QJ0A 2DATA 5F3AA 3H7HA 2FD4A 5H9MA 4TYLA 2F42A 4PTBA 4NYWA 4OGIA 4CCGX 4F1PA 3S92A 3PHDA 2PUYA 2MD8C 3PLWA 5C11A 5FE8A 4QF3A 2R0YA 4CFLA 2K1JA 4QY4A 4YK0A 5FE7A 4R7EA 5A5SA 4KV4A 5DW2A 4V3KC 4A9JA 4O62A 5B8DA 5J0DA 4O7CA 4NUCA 1WE9A 1E4UA 4UYHA 4CUPA 2JMDA 5C7NA 5JG6A 3ZTGA 4QSVA 5F36A 4LC2A 4Z93A 4MEQA 3ERRA 4NS5A 5FE6A 5AD2A 2L85A 4ALGA 5HFQA 4TT6A 5DX4A 3MHHA 3DAIA 2MUMA 5CUDA 4A9MA 5BT3A 5I88A 4O7FA 4QUTA 3SVHA 1X4UA 2YDWA 3LDYA 2H0DB 5HENA 5E9LA 2WP1A 4NRBA 3V43A 5EI4A 3HTKC 5H1UA 2EGMA 2ECVA 5TRBA 2C2LA 2KWOA 2LGKA 4QSQA 5CQ6A 1LDKC 2YYNA 4C67A 1X0JA 3NG2A 5D3JA 4QQ4A 5FE2A 2EA6A 1F68A 4O75A 5IGKA 4YYMA 4HXNA 3UVYA 4C9ZA 2RNYA 5D3LA 4WZ0A 4TZ2A 3FEHA 4IR4A 4J0RA 4E96A 2YHOA 3DPLR 2K16A 4HXMA 3RPGC 5I80A 2ECWA 4C66A 4IC3A 5E73A 1VD4A 1JM4B 2L80A 5CY9A 3N9OA 4KCXA 5CQ4A 5EWDA 2LGVA 4O71A 5DYXA 2ECTA 4FK5A 4FO9A 1HYIA 4YYGA 4BJXA 1K2FA 4BW4A 4TTEA 5I89A 4F52B 5SVIA 2QIZA 5FB1A 5F25A 4IOQA 3C6WA 4L7XA 2YSJA 5E9VA 4A9HA 5I83A 5HELA 3PURA 4NR7A 2DJAA 1Z6UA 4A49A 2Y1MA 3ZPVE 2KKYA 4QSSA 4NXJA 4Q0NA 3N9NA 1ZKRA 2RNWA 3N9LA 4H9DA 4QF2A 1WEQA 4NQMA 4YYDA 2RR4A 2B0OE 5D26A 4N4IA 5EV9A 4HBWA 2OO1A 4QZSA 5FFVA 5AD3A 5C13A 4XUAA 3VKHA 3AQAA 4Z6HA 2JMJA 2IDAA 4X2IA 5F60A 5HFRA 3UVXA 5LUUA 4QSPA 5FE3A 2D9EA 2DX8A 2LGGA 3LQIA 5FE1A 5FE4A 2RO1A 2MJVB 5CUCA 5IG6A 4CLBA 2KGGA 5DKHA 5LJ0A 4XI1A 3G0JA 3RTRB 5A81A 5CZGA 3TLPA 5C89A 4QSXA 2R0SA 5ENFA 4UIUA 2MKEA 4QSRA 5LJ2A 1Z60A 2YW5A 2QICA 3N9MA 2L5EA 5B76A 2EJNA 5D3TA 4A9KA 5B79A 4QSUA 4MENA 4O78A 5A5RA 2P57A 5CU8A 5KU3A 3ZPV1 3M7KA 3Q2FA 3LVRE 4CUUA 4ZQLA 4UYGA 4O7BA 4QSWA 5F63A 2EODA 3PUQA 3U5PA 4HXOA 5EGUA 3MXFA 2L5UA 5A85A 1WEOA 4MEOA 3FAOA 4YC9A 2CKLA 2LSPB 4BW3A 4HXPA 2E6SA 5ENGA 2CT2A 5FG5A 5HQ6A 4UIWA 2AN6A 2RFJA 4UYFA 1JM7A 3IU5A 5DYUA 4UIYA 4YYHA 4GNFA 4CL9A 4OGCA 5G4RA 4PPEA 5HRWA 5TCMA 5IGNA 3P1CA 5CQ7A 5D7XA 2G6QA 4CFKA 2G43A 2OUOA 4I7DA 3HCSA 5L98A 2FFWA 3O33A 5EP7A 3U5LA 4YY4A 4WA6A 5CUGA 3EB6A 4YADA 2RS9B 4HBXA 5F1HA 4PCIA 1T1HA 5ENCA 3IHPA 4UI9B 2KYUA 2YELA 1WESA 3DQVR 4A9NA 4WHUA 3KDEC 5CQ3A 4QBMA 5K3QA 5E9YA 2MD7B 4OGEA 1PUOA 4LZSA 4Y03A 5CP5A 5KTXA 4YABA 1WEPA 3SUBA 2YEKA 4OUFA 2XOCA 5AIUA 5I1QA 2D8SA 4NRCA 5FFWA 4DONA 2ECGA 5FEYA 4MR3A 5ETDA 5HQ7A 2VJEA 3GG3A 4X3GA 4AYCB 4QC3A 2CSVA 2LGLA 3SVFA 5F2PA 3VK6A 5DKCA 1MBMA 2UZGA 4GB0A 4QB3A 4R2YA 5KHMA 4A9FA 4XYAA 5D0CA 2DVQA 3U5NA 3HCUA 2VNFA 2Y1NA 5FG6A 4N4HA 3UW9A 5B78A 3JVJA 3ZNIA 2L84A 1HYJA 3E2DA 1Z2QA 4HBVA 3MDBC 4O76A 4NUDA 2H0DA 2MA5A 5D24A 2YUCA 3AADA 3I3JA 2PNXA 2L0BA 5AMEA 2Y43A 4IOOA 4MSXA 2I8NA 4LR6A 3JVMA 4YBMA 4IORA 5B75A 3GL6A 2ECNA 5EYAF 1WGMA 5IBNA 5DFBA 5L8UA 4GPJA 3MB3A 5HJCA 4BW1A 1X4IA 3O7AA 3T9KA 2YVRA 5C4QA 4NR4A 4XUBA 5FE9A 2C2VS 5A5NA 2DKWA 4NYXA 5LKZA 3ZVYA 2R10A 5A7CA 4YH4A 4LRGA 5FH8A 5L8TA 3M99A 4S3OB 4IC2A 5D3HA 4B7YC 5CTLA 3U5KA 4CUQA 2G4AA 5CQAA 4N4FA 4QSTA 5HEMA 5I40A 1G25A 3D1BA 5EISA 1WENA 4TS8A 4CUSA 4LLBA 2VPGA 2KREA 5IIDA 4LYIA 2FUUA 5ACYA 5E9IA 2E3KA 4PKLA 2JRJA 2M6MA 4LDFA 2LAUA 2VPBA 2YW8A 4KV1A 5G4SA 2MNZA 4CA1A 2KWJA 2E61A 3HCTA 4MVTA 3P1DA 4F3IA 2KWKA 5CFWA 3O35A 3ASLA 3JUEA 5EPSA 2JM3A 3L11A 5HQ5A 4O72A 3MB4A 4HXKA 4O7EA 4L58A 4MR5A 3HMHA 5EPBA 4GNEA 4NN2A 5JWMA 4UP0A 4XY9A 3O37A 4UYDA 5A5QA 4YYNA 5IGLA 4Z1SA 2M1RA 5LCWB 2L7PA 4UIZA 2CRRA 5HCLA 4TT4A 5TABA 1VFYA
chains in the Genus database with same CATH topology
4AP4A 4PS5A 3SOWA 5CGPA 1EQFA 2NAAA 3S91A 4TU4A 2RNXA 5B77A 5FDZA 2WP2A 4CURA 3LQJA 5TB6A 2FUIA 4YBTA 5CPEA 5DW1A 4CUTA 5A82A 3ONIA 1X4JA 3KV6A 4ZDTA 5F1LA 4ZUXU 4ZW1A 5DYCA 3QZTA 5I7YA 2JMIA 2OSSA 3D7CA 4LYSA 4QYDA 2K4DA 3MQMA 4GNGA 5E3GA 5CUBA 2D82A 2KU3A 5KTWA 4YY6A 4W4UA 3O34A 5FFYA 5E74A 5BT5A 3JVLA 3RCWA 2VP7A 1N72A 4RVRA 4UP5A 4XY8A 2LXPC 5TDWA 2DVSA 5COIA 1JOCA 3O70A 5CS8A 3L1ZB 4LADB 3G0LA 2I50A 3KV5A 3FKMX 4LZ2A 4NQNA 3UVDA 2VJFA 3N9QA 4IR3A 4I7BA 2YREA 4MR4A 1WUGA 5EA1A 5HRXA 4YATA 4QC1A 4O74A 1F62A 4LJNA 5LVQA 5KH9A 5F62A 1MM3A 3ZVZB 4AUQB 1WFKA 4LK9A 3U5OA 5I3LA 2KTBB 5FG4A 4TKPB 4QEWA 1CHCA 4BW2A 4Z6IA 3ZYQA 4R8PK 5E3DA 3MUKA 2KFTA 4MEPA 2CKLB 4NR6A 3SOUA 3P1EA 5CRMA 4Q6FA 4A9OA 4IR5A 3MHSA 2GRCA 4UYFB 5G04B 1FBVA 4J1PA 5I29A 3L1XA 1BORA 4WZ3B 5EVAA 5ENJA 2ECIA 4BBQA 1WEEA 1JM7B 1WEUA 2LQ6A 1WEWA 3LQHA 5DBMA 1FP0A 5EWCA 4YBSA 5BT4A 2XEUA 2R0VA 4YYJA 3U5JA 2BAYA 5G0FA 4MR6A 2YHNA 4O7AA 4ALHA 2I7KA 4A9EA 2DWWA 5F61A 4NR9A 1DVPA 1ZS5A 2OXQC 4O64A 5LKUA 5DLXA 5TDRA 5A5OA 4UIXA 5EWHA 2YU4A 5HRVA 2MT5A 5C8GA 5DINA 5DFCA 5DYAA 4Z1QA 5C87A 5TBNA 4UITA 2VJEB 1JSPB 2EGPA 3U5MA 2CSYA 2YT5A 3JVKA 4WZ2A 1U6GB 5EQ1A 2DVRA 4N4GA 4YYIA 5A83A 5A5PA 5D3PA 2VPDA 5C85A 4O70A 5K29A 4QYLA 1ZBDB 5DFDA 2HYED 2KGIA 4QEVA 3T7LA 5E7DA 4WHWA 5E9MA 4O77A 4P5OB 5G05B 4YAXA 4NYVA 2MIQA 5H1TA 2E7OA 3HMFA 3RPGB 5F5ZA 5ETBA 5DKAA 1WEVA 2K17A 4LZRA 5H1VA 2F6JA 4N3WA 3C5KA 5II1A 2ZETC 5KH3A 4ZC9A 1RMDA 4I7CA 3UV5A 5D3RA 3SVGA 4S3OC 5EK9A 5ENEA 2E6RA 4LKAA 4FJCA 4A4CA 4HXSA 5FB0A 5KTUA 2DVVA 5LKXA 4A0CD 2E7NA 4TT2A 3N9PA 5L99A 5D25A 2L75A 2YQLA 2YSMA 4TZ8A 3QZSA 5CUAA 4J0SA 5L96A 2CSZA 5CRZA 4UIVA 4GNDA 4NRAA 5FERA 4HBYA 5EM3A 3SOXA 1N87A 3K2JA 3UV2A 3SHBA 5CUEA 4A9IA 4QNSA 5D1LB 4AVXA 5D1MB 4TU6A 2M85A 3P1FA 4QEUA 4PCEA 5DY7A 3ZYUA 5H85A 4NUEA 2NXBA 2FSAA 1WEMA 3LRQA 3I2DA 3GV4A 5KH7A 2RI7A 3MULA 3P5OA 4AKNA 4LYWA 3EB5A 5E0RA 4PY6A 3FL2A 1V87A 2YEMA 1WUMA 4TQNA 3T6RA 3LXJA 5AMFA 3M62A 5ENIA 5DLZA 4IR6A 5E9KA 5ENBA 5DKDA 2LXHC 3QZVA 2HDPA 2M3HA 2VPEA 1WIMA 5EICA 5CQ5A 5EPRA 4NR5A 4UYEA 4QR5A 2MNYA 4OGJA 5FH6A 2YQMA 5FE0A 5LVRA 2MA6A 5LKTA 1VYXA 1IYMA 3DWYA 5CQTA 5II2A 2N9GA 5I7XA 2RSDA 1XWHA 4WIVA 5KO4A 1E6IA 4HXLA 2L43A 2YQDA 3HMEA 4Q0OA 5IGMA 5JI8A 2H60A 1LDJB 5EU1A 3UVWA 3NXBA 5FE5A 5ENHA 5J3XA 2KIZA 3O36A 2G45A 2YYRA 4BHWA 2KWNA 5LJ1A 4A9LA 2XB1A 4YYKA 2LV9A 5D3SA 4V3LC 2ECJA 4QR4A 3KQIA 4QUUA 5I86A 2F6NA 4FLPA 5CQ8A 5HM0A 2KE1A 3KNVA 5AITA 4AYCA 3IU6A 2LN0A 4NR8A 5FBXA 5L97A 3UV4A 4HXRA 5FH7A 5EWWA 4J3IA 2YURA 5D1KB 5EWVA 3Q2EA 3LJWA 5HLSA 4A4BA 1WILA 4QR3A 2VJFB 1MM2A 3M63A 4B86C 4YH3A 4FIPA 2LRIC 5D3NA 2LDRA 2KR4A 2QJ0A 2DATA 5F3AA 5H9MA 4TYLA 2F42A 4PTBA 4NYWA 4OGIA 4CCGX 3S92A 3PHDA 2PUYA 2MD8C 5C11A 5FE8A 4QF3A 2R0YA 4CFLA 2K1JA 4QY4A 4YK0A 5FE7A 4R7EA 5A5SA 4KV4A 5DW2A 4V3KC 4A9JA 5B8DA 5J0DA 4O7CA 4NUCA 1WE9A 1E4UA 4UYHA 4CUPA 2JMDA 5C7NA 5JG6A 3ZTGA 4QSVA 5F36A 4LC2A 4Z93A 4MEQA 4NS5A 5FE6A 5AD2A 2L85A 4ALGA 5HFQA 4TT6A 5DX4A 3MHHA 3DAIA 2MUMA 5CUDA 4A9MA 5BT3A 5I88A 4O7FA 4QUTA 3SVHA 1X4UA 2YDWA 2H0DB 5HENA 5E9LA 2WP1A 4NRBA 3V43A 5EI4A 3HTKC 5H1UA 2ECVA 5TRBA 2C2LA 2KWOA 2LGKA 4QSQA 5CQ6A 1LDKC 2YYNA 4C67A 1X0JA 3NG2A 5D3JA 5FE2A 2EA6A 1F68A 4O75A 5IGKA 4YYMA 4HXNA 3UVYA 4C9ZA 2RNYA 5D3LA 4WZ0A 4TZ2A 4IR4A 4J0RA 4E96A 2YHOA 3DPLR 2K16A 4HXMA 3RPGC 5I80A 2ECWA 4C66A 4IC3A 5E73A 1VD4A 1JM4B 2L80A 5CY9A 3N9OA 4KCXA 5CQ4A 5EWDA 2LGVA 4O71A 5DYXA 2ECTA 4FK5A 4FO9A 1HYIA 4YYGA 4BJXA 1K2FA 4BW4A 4TTEA 5I89A 4F52B 2QIZA 5FB1A 5F25A 4IOQA 3C6WA 4L7XA 2YSJA 5E9VA 4A9HA 5I83A 5HELA 3PURA 4NR7A 4A49A 1Z6UA 2Y1MA 3ZPVE 4QSSA 4NXJA 4Q0NA 3N9NA 2RNWA 3N9LA 4QF2A 1WEQA 4NQMA 4YYDA 5D26A 4N4IA 5EV9A 4HBWA 2OO1A 4QZSA 5FFVA 5AD3A 5C13A 4XUAA 3AQAA 4Z6HA 2JMJA 2IDAA 4X2IA 5F60A 5HFRA 3UVXA 5LUUA 4QSPA 5FE3A 2D9EA 2DX8A 2LGGA 3LQIA 5FE1A 5FE4A 2RO1A 2MJVB 5CUCA 5IG6A 4CLBA 2KGGA 5DKHA 5LJ0A 4XI1A 3G0JA 3RTRB 5A81A 5CZGA 3TLPA 5C89A 4QSXA 2R0SA 5ENFA 4UIUA 4QSRA 5LJ2A 1Z60A 2YW5A 2QICA 3N9MA 2L5EA 5B76A 5D3TA 4A9KA 5B79A 4QSUA 4MENA 4O78A 5A5RA 5CU8A 5KU3A 3ZPV1 3Q2FA 4CUUA 4ZQLA 4UYGA 4O7BA 4QSWA 5F63A 2EODA 3PUQA 3U5PA 4HXOA 5EGUA 3MXFA 2L5UA 5A85A 1WEOA 4MEOA 4YC9A 2CKLA 2LSPB 4BW3A 4HXPA 2E6SA 5ENGA 2CT2A 5FG5A 5HQ6A 4UIWA 2AN6A 2RFJA 4UYFA 1JM7A 3IU5A 5DYUA 4UIYA 4YYHA 4GNFA 4CL9A 5G4RA 4PPEA 5HRWA 5TCMA 5IGNA 3P1CA 5CQ7A 5D7XA 2G6QA 4CFKA 2G43A 2OUOA 4I7DA 3HCSA 5L98A 3O33A 5EP7A 3U5LA 4YY4A 4WA6A 5CUGA 3EB6A 4YADA 2RS9B 4HBXA 5F1HA 4PCIA 1T1HA 5ENCA 3IHPA 4UI9B 2KYUA 2YELA 1WESA 3DQVR 4A9NA 4WHUA 5CQ3A 4QBMA 5E9YA 2MD7B 4LZSA 4Y03A 5CP5A 5KTXA 4YABA 1WEPA 2YEKA 4OUFA 5AIUA 5I1QA 2D8SA 4NRCA 5FFWA 4DONA 2ECGA 5FEYA 4MR3A 5ETDA 5HQ7A 2VJEA 3GG3A 4X3GA 4AYCB 4QC3A 2LGLA 3SVFA 5F2PA 3VK6A 5DKCA 2UZGA 4GB0A 4QB3A 4R2YA 5KHMA 4A9FA 4XYAA 5D0CA 2DVQA 3U5NA 3HCUA 2VNFA 2Y1NA 5FG6A 4N4HA 3UW9A 5B78A 3JVJA 3ZNIA 2L84A 1HYJA 1Z2QA 4HBVA 4O76A 4NUDA 2H0DA 2MA5A 5D24A 2YUCA 3AADA 3I3JA 2PNXA 2L0BA 5AMEA 2Y43A 4IOOA 4MSXA 2I8NA 4LR6A 3JVMA 4YBMA 4IORA 5B75A 3GL6A 2ECNA 5EYAF 1WGMA 5IBNA 5DFBA 5L8UA 4GPJA 3MB3A 5HJCA 4BW1A 1X4IA 3O7AA 5C4QA 4NR4A 4XUBA 5FE9A 2C2VS 5A5NA 2DKWA 4NYXA 5LKZA 3ZVYA 2R10A 5A7CA 4YH4A 4LRGA 5FH8A 5L8TA 3M99A 4S3OB 4IC2A 5D3HA 4B7YC 5CTLA 3U5KA 4CUQA 2G4AA 5CQAA 4N4FA 4QSTA 5HEMA 5I40A 1G25A 5EISA 1WENA 4TS8A 4CUSA 4LLBA 2VPGA 2KREA 5IIDA 4LYIA 2FUUA 5ACYA 5E9IA 2E3KA 4PKLA 2JRJA 2M6MA 4LDFA 2VPBA 2YW8A 4KV1A 5G4SA 2MNZA 4CA1A 2KWJA 3HCTA 4MVTA 3P1DA 4F3IA 2KWKA 5CFWA 3O35A 3ASLA 5EPSA 3L11A 5HQ5A 4O72A 3MB4A 4HXKA 4O7EA 4L58A 4MR5A 3HMHA 5EPBA 4GNEA 4NN2A 5JWMA 4UP0A 4XY9A 3O37A 4UYDA 5A5QA 4YYNA 5IGLA 4Z1SA 2M1RA 5LCWB 4UIZA 5TABA 5HCLA 4TT4A 1VFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 A;  4PS5 A;  3SOW A;  5CGP A;  1EQF A;  2NAA A;  3S91 A;  4TU4 A;  2RNX A;  5B77 A;  5FDZ A;  2WP2 A;  4CUR A;  3LQJ A;  5TB6 A;  2FUI A;  4YBT A;  5CPE A;  5DW1 A;  4CUT A;  5A82 A;  3ONI A;  1X4J A;  3KV6 A;  4ZDT A;  5F1L A;  4ZUX U;  4ZW1 A;  5DYC A;  3QZT A;  5I7Y A;  2JMI A;  2OSS A;  3D7C A;  4LYS A;  4QYD A;  2K4D A;  3MQM A;  4GNG A;  5E3G A;  5CUB A;  2D82 A;  2KU3 A;  5KTW A;  4YY6 A;  4W4U A;  3O34 A;  5FFY A;  5E74 A;  5BT5 A;  3JVL A;  3RCW A;  2VP7 A;  1N72 A;  4RVR A;  4UP5 A;  4XY8 A;  2LXP C;  5TDW A;  2DVS A;  5COI A;  1JOC A;  3O70 A;  5CS8 A;  3L1Z B;  4LAD B;  3G0L A;  2I50 A;  3KV5 A;  3FKM X;  4LZ2 A;  4NQN A;  3UVD A;  2VJF A;  3N9Q A;  4IR3 A;  4I7B A;  2YRE A;  4MR4 A;  1WUG A;  5EA1 A;  5HRX A;  4YAT A;  4QC1 A;  4O74 A;  1F62 A;  4LJN A;  5LVQ A;  5KH9 A;  5F62 A;  1MM3 A;  3ZVZ B;  4AUQ B;  1WFK A;  4LK9 A;  3U5O A;  5I3L A;  2KTB B;  5FG4 A;  4TKP B;  4QEW A;  1CHC A;  4BW2 A;  4Z6I A;  3ZYQ A;  4R8P K;  5E3D A;  3MUK A;  2KFT A;  4MEP A;  2CKL B;  4NR6 A;  3SOU A;  3P1E A;  5CRM A;  4Q6F A;  4A9O A;  4IR5 A;  3MHS A;  2GRC A;  4UYF B;  5G04 B;  1FBV A;  4J1P A;  5I29 A;  3L1X A;  1BOR A;  4WZ3 B;  5EVA A;  5ENJ A;  2ECI A;  4BBQ A;  1WEE A;  1JM7 B;  1WEU A;  2LQ6 A;  1WEW A;  3LQH A;  5DBM A;  1FP0 A;  5EWC A;  4YBS A;  5BT4 A;  2XEU A;  2R0V A;  4YYJ A;  3U5J A;  2BAY A;  5G0F A;  4MR6 A;  2YHN A;  4O7A A;  4ALH A;  2I7K A;  4A9E A;  2DWW A;  5F61 A;  4NR9 A;  1DVP A;  1ZS5 A;  2OXQ C;  4O64 A;  5LKU A;  5DLX A;  5TDR A;  5A5O A;  4UIX A;  5EWH A;  2YU4 A;  5HRV A;  2MT5 A;  5C8G A;  5DIN A;  5DFC A;  5DYA A;  4Z1Q A;  5C87 A;  5TBN A;  4UIT A;  2VJE B;  1JSP B;  2EGP A;  3U5M A;  2CSY A;  2YT5 A;  3JVK A;  4WZ2 A;  1U6G B;  5EQ1 A;  2DVR A;  4N4G A;  4YYI A;  5A83 A;  5A5P A;  5D3P A;  2VPD A;  5C85 A;  4O70 A;  5K29 A;  4QYL A;  1ZBD B;  5DFD A;  2HYE D;  2KGI A;  4QEV A;  3T7L A;  5E7D A;  4WHW A;  5E9M A;  4O77 A;  4P5O B;  5G05 B;  4YAX A;  4NYV A;  2MIQ A;  5H1T A;  2E7O A;  3HMF A;  3RPG B;  5F5Z A;  5ETB A;  5DKA A;  1WEV A;  2K17 A;  4LZR A;  5H1V A;  2F6J A;  4N3W A;  3C5K A;  5II1 A;  2ZET C;  5KH3 A;  4ZC9 A;  1RMD A;  4I7C A;  3UV5 A;  5D3R A;  3SVG A;  4S3O C;  5EK9 A;  5ENE A;  2E6R A;  4LKA A;  4FJC A;  4A4C A;  4HXS A;  5FB0 A;  5KTU A;  2DVV A;  5LKX A;  4A0C D;  2E7N A;  4TT2 A;  3N9P A;  5L99 A;  5D25 A;  2L75 A;  2YQL A;  2YSM A;  4TZ8 A;  3QZS A;  5CUA A;  4J0S A;  5L96 A;  2CSZ A;  5CRZ A;  4UIV A;  4GND A;  4NRA A;  5FER A;  4HBY A;  5EM3 A;  3SOX A;  1N87 A;  3K2J A;  3UV2 A;  3SHB A;  5CUE A;  4A9I A;  4QNS A;  5D1L B;  4AVX A;  5D1M B;  4TU6 A;  2M85 A;  3P1F A;  4QEU A;  4PCE A;  5DY7 A;  3ZYU A;  5H85 A;  4NUE A;  2NXB A;  2FSA A;  1WEM A;  3LRQ A;  3I2D A;  3GV4 A;  5KH7 A;  2RI7 A;  3MUL A;  3P5O A;  4AKN A;  4LYW A;  3EB5 A;  5E0R A;  4PY6 A;  3FL2 A;  1V87 A;  2YEM A;  1WUM A;  4TQN A;  3T6R A;  3LXJ A;  5AMF A;  3M62 A;  5ENI A;  5DLZ A;  4IR6 A;  5E9K A;  5ENB A;  5DKD A;  2LXH C;  3QZV A;  2HDP A;  2M3H A;  2VPE A;  1WIM A;  5EIC A;  5CQ5 A;  5EPR A;  4NR5 A;  4UYE A;  4QR5 A;  2MNY A;  4OGJ A;  5FH6 A;  2YQM A;  5FE0 A;  5LVR A;  2MA6 A;  5LKT A;  1VYX A;  1IYM A;  3DWY A;  5CQT A;  5II2 A;  2N9G A;  5I7X A;  2RSD A;  1XWH A;  4WIV A;  5KO4 A;  1E6I A;  4HXL A;  2L43 A;  2YQD A;  3HME A;  4Q0O A;  5IGM A;  5JI8 A;  2H60 A;  1LDJ B;  5EU1 A;  3UVW A;  3NXB A;  5FE5 A;  5ENH A;  5J3X A;  2KIZ A;  3O36 A;  2G45 A;  2YYR A;  4BHW A;  2KWN A;  5LJ1 A;  4A9L A;  2XB1 A;  4YYK A;  2LV9 A;  5D3S A;  4V3L C;  2ECJ A;  4QR4 A;  3KQI A;  4QUU A;  5I86 A;  2F6N A;  4FLP A;  5CQ8 A;  5HM0 A;  2KE1 A;  3KNV A;  5AIT A;  4AYC A;  3IU6 A;  2LN0 A;  4NR8 A;  5FBX A;  5L97 A;  3UV4 A;  4HXR A;  5FH7 A;  5EWW A;  4J3I A;  2YUR A;  5D1K B;  5EWV A;  3Q2E A;  3LJW A;  5HLS A;  4A4B A;  1WIL A;  4QR3 A;  2VJF B;  1MM2 A;  3M63 A;  4B86 C;  4YH3 A;  4FIP A;  2LRI C;  5D3N A;  2LDR A;  2KR4 A;  2QJ0 A;  2DAT A;  5F3A A;  5H9M A;  4TYL A;  2F42 A;  4PTB A;  4NYW A;  4OGI A;  4CCG X;  3S92 A;  3PHD A;  2PUY A;  2MD8 C;  5C11 A;  5FE8 A;  4QF3 A;  2R0Y A;  4CFL A;  2K1J A;  4QY4 A;  4YK0 A;  5FE7 A;  4R7E A;  5A5S A;  4KV4 A;  5DW2 A;  4V3K C;  4A9J A;  5B8D A;  5J0D A;  4O7C A;  4NUC A;  1WE9 A;  1E4U A;  4UYH A;  4CUP A;  2JMD A;  5C7N A;  5JG6 A;  3ZTG A;  4QSV A;  5F36 A;  4LC2 A;  4Z93 A;  4MEQ A;  4NS5 A;  5FE6 A;  5AD2 A;  2L85 A;  4ALG A;  5HFQ A;  4TT6 A;  5DX4 A;  3MHH A;  3DAI A;  2MUM A;  5CUD A;  4A9M A;  5BT3 A;  5I88 A;  4O7F A;  4QUT A;  3SVH A;  1X4U A;  2YDW A;  2H0D B;  5HEN A;  5E9L A;  2WP1 A;  4NRB A;  3V43 A;  5EI4 A;  3HTK C;  5H1U A;  2ECV A;  5TRB A;  2C2L A;  2KWO A;  2LGK A;  4QSQ A;  5CQ6 A;  1LDK C;  2YYN A;  4C67 A;  1X0J A;  3NG2 A;  5D3J A;  5FE2 A;  2EA6 A;  1F68 A;  4O75 A;  5IGK A;  4YYM A;  4HXN A;  3UVY A;  4C9Z A;  2RNY A;  5D3L A;  4WZ0 A;  4TZ2 A;  4IR4 A;  4J0R A;  4E96 A;  2YHO A;  3DPL R;  2K16 A;  4HXM A;  3RPG C;  5I80 A;  2ECW A;  4C66 A;  4IC3 A;  5E73 A;  1VD4 A;  1JM4 B;  2L80 A;  5CY9 A;  3N9O A;  4KCX A;  5CQ4 A;  5EWD A;  2LGV A;  4O71 A;  5DYX A;  2ECT A;  4FK5 A;  4FO9 A;  1HYI A;  4YYG A;  4BJX A;  1K2F A;  4BW4 A;  4TTE A;  5I89 A;  4F52 B;  2QIZ A;  5FB1 A;  5F25 A;  4IOQ A;  3C6W A;  4L7X A;  2YSJ A;  5E9V A;  4A9H A;  5I83 A;  5HEL A;  3PUR A;  4NR7 A;  4A49 A;  1Z6U A;  2Y1M A;  3ZPV E;  4QSS A;  4NXJ A;  4Q0N A;  3N9N A;  2RNW A;  3N9L A;  4QF2 A;  1WEQ A;  4NQM A;  4YYD A;  5D26 A;  4N4I A;  5EV9 A;  4HBW A;  2OO1 A;  4QZS A;  5FFV A;  5AD3 A;  5C13 A;  4XUA A;  3AQA A;  4Z6H A;  2JMJ A;  2IDA A;  4X2I A;  5F60 A;  5HFR A;  3UVX A;  5LUU A;  4QSP A;  5FE3 A;  2D9E A;  2DX8 A;  2LGG A;  3LQI A;  5FE1 A;  5FE4 A;  2RO1 A;  2MJV B;  5CUC A;  5IG6 A;  4CLB A;  2KGG A;  5DKH A;  5LJ0 A;  4XI1 A;  3G0J A;  3RTR B;  5A81 A;  5CZG A;  3TLP A;  5C89 A;  4QSX A;  2R0S A;  5ENF A;  4UIU A;  4QSR A;  5LJ2 A;  1Z60 A;  2YW5 A;  2QIC A;  3N9M A;  2L5E A;  5B76 A;  5D3T A;  4A9K A;  5B79 A;  4QSU A;  4MEN A;  4O78 A;  5A5R A;  5CU8 A;  5KU3 A;  3ZPV 1;  3Q2F A;  4CUU A;  4ZQL A;  4UYG A;  4O7B A;  4QSW A;  5F63 A;  2EOD A;  3PUQ A;  3U5P A;  4HXO A;  5EGU A;  3MXF A;  2L5U A;  5A85 A;  1WEO A;  4MEO A;  4YC9 A;  2CKL A;  2LSP B;  4BW3 A;  4HXP A;  2E6S A;  5ENG A;  2CT2 A;  5FG5 A;  5HQ6 A;  4UIW A;  2AN6 A;  2RFJ A;  4UYF A;  1JM7 A;  3IU5 A;  5DYU A;  4UIY A;  4YYH A;  4GNF A;  4CL9 A;  5G4R A;  4PPE A;  5HRW A;  5TCM A;  5IGN A;  3P1C A;  5CQ7 A;  5D7X A;  2G6Q A;  4CFK A;  2G43 A;  2OUO A;  4I7D A;  3HCS A;  5L98 A;  3O33 A;  5EP7 A;  3U5L A;  4YY4 A;  4WA6 A;  5CUG A;  3EB6 A;  4YAD A;  2RS9 B;  4HBX A;  5F1H A;  4PCI A;  1T1H A;  5ENC A;  3IHP A;  4UI9 B;  2KYU A;  2YEL A;  1WES A;  3DQV R;  4A9N A;  4WHU A;  5CQ3 A;  4QBM A;  5E9Y A;  2MD7 B;  4LZS A;  4Y03 A;  5CP5 A;  5KTX A;  4YAB A;  1WEP A;  2YEK A;  4OUF A;  5AIU A;  5I1Q A;  2D8S A;  4NRC A;  5FFW A;  4DON A;  2ECG A;  5FEY A;  4MR3 A;  5ETD A;  5HQ7 A;  2VJE A;  3GG3 A;  4X3G A;  4AYC B;  4QC3 A;  2LGL A;  3SVF A;  5F2P A;  3VK6 A;  5DKC A;  2UZG A;  4GB0 A;  4QB3 A;  4R2Y A;  5KHM A;  4A9F A;  4XYA A;  5D0C A;  2DVQ A;  3U5N A;  3HCU A;  2VNF A;  2Y1N A;  5FG6 A;  4N4H A;  3UW9 A;  5B78 A;  3JVJ A;  3ZNI A;  2L84 A;  1HYJ A;  1Z2Q A;  4HBV A;  4O76 A;  4NUD A;  2H0D A;  2MA5 A;  5D24 A;  2YUC A;  3AAD A;  3I3J A;  2PNX A;  2L0B A;  5AME A;  2Y43 A;  4IOO A;  4MSX A;  2I8N A;  4LR6 A;  3JVM A;  4YBM A;  4IOR A;  5B75 A;  3GL6 A;  2ECN A;  5EYA F;  1WGM A;  5IBN A;  5DFB A;  5L8U A;  4GPJ A;  3MB3 A;  5HJC A;  4BW1 A;  1X4I A;  3O7A A;  5C4Q A;  4NR4 A;  4XUB A;  5FE9 A;  2C2V S;  5A5N A;  2DKW A;  4NYX A;  5LKZ A;  3ZVY A;  2R10 A;  5A7C A;  4YH4 A;  4LRG A;  5FH8 A;  5L8T A;  3M99 A;  4S3O B;  4IC2 A;  5D3H A;  4B7Y C;  5CTL A;  3U5K A;  4CUQ A;  2G4A A;  5CQA A;  4N4F A;  4QST A;  5HEM A;  5I40 A;  1G25 A;  5EIS A;  1WEN A;  4TS8 A;  4CUS A;  4LLB A;  2VPG A;  2KRE A;  5IID A;  4LYI A;  2FUU A;  5ACY A;  5E9I A;  2E3K A;  4PKL A;  2JRJ A;  2M6M A;  4LDF A;  2VPB A;  2YW8 A;  4KV1 A;  5G4S A;  2MNZ A;  4CA1 A;  2KWJ A;  3HCT A;  4MVT A;  3P1D A;  4F3I A;  2KWK A;  5CFW A;  3O35 A;  3ASL A;  5EPS A;  3L11 A;  5HQ5 A;  4O72 A;  3MB4 A;  4HXK A;  4O7E A;  4L58 A;  4MR5 A;  3HMH A;  5EPB A;  4GNE A;  4NN2 A;  5JWM A;  4UP0 A;  4XY9 A;  3O37 A;  4UYD A;  5A5Q A;  4YYN A;  5IGL A;  4Z1S A;  2M1R A;  5LCW B;  4UIZ A;  5TAB A;  5HCL A;  4TT4 A;  1VFY A; 
#chains in the Genus database with same CATH topology
 4AP4 A;  4PS5 A;  3SOW A;  5CGP A;  1EQF A;  2NAA A;  3S91 A;  2KKX A;  4TU4 A;  2RNX A;  5B77 A;  4AI6 A;  5FDZ A;  2WP2 A;  4CUR A;  3LQJ A;  5TB6 A;  5SVI B;  2FUI A;  4YBT A;  5CPE A;  5DW1 A;  4CUT A;  5A82 A;  3ONI A;  1X4J A;  3KV6 A;  4ZDT A;  5F1L A;  4ZUX U;  2XOZ A;  3VKG A;  4ZW1 A;  5DYC A;  3QZT A;  5I7Y A;  2JMI A;  2OSS A;  3D7C A;  4LYS A;  4QYD A;  2K4D A;  3MQM A;  3DDT A;  4GNG A;  5E3G A;  5CUB A;  2D82 A;  2KU3 A;  5KTW A;  4YY6 A;  4W4U A;  3O34 A;  5FFY A;  5E74 A;  5BT5 A;  3JVL A;  3RCW A;  2VP7 A;  1N72 A;  4RVR A;  4UP5 A;  4XY8 A;  2LXP C;  5TDW A;  2DVS A;  5COI A;  1JOC A;  3O70 A;  5CS8 A;  3L1Z B;  4LAD B;  3G0L A;  2I50 A;  3KV5 A;  3FKM X;  4LZ2 A;  4NQN A;  3UVD A;  2VJF A;  3N9Q A;  4IR3 A;  4I7B A;  2YRE A;  4MR4 A;  1WUG A;  5EA1 A;  5HRX A;  4YAT A;  4QC1 A;  4O74 A;  1F62 A;  4LJN A;  5LVQ A;  5KH9 A;  5F62 A;  1MM3 A;  2D8U A;  3ZVZ B;  3FJU B;  1WFK A;  4LK9 A;  4AUQ B;  3U5O A;  5I3L A;  2KTB B;  5FG4 A;  4TKP B;  4QEW A;  1CHC A;  4BW2 A;  4Z6I A;  3ZYQ A;  4R8P K;  5E3D A;  3MUK A;  2KFT A;  4MEP A;  2CKL B;  4NR6 A;  3SOU A;  3P1E A;  5CRM A;  2XP0 A;  4Q6F A;  4A9O A;  4IR5 A;  3MHS A;  2GRC A;  4UYF B;  5G04 B;  1FBV A;  4J1P A;  5I29 A;  3L1X A;  1BOR A;  4WZ3 B;  5EVA A;  5ENJ A;  2ECI A;  4BBQ A;  1WEE A;  1JM7 B;  1WEU A;  2LQ6 A;  1WEW A;  3FAN A;  3LQH A;  5DBM A;  1FP0 A;  2EXU A;  5EWC A;  4YBS A;  5BT4 A;  2XEU A;  2R0V A;  4AKG A;  4YYJ A;  3U5J A;  2BAY A;  3Q1D A;  5G0F A;  4MR6 A;  2YHN A;  4O7A A;  4ALH A;  2I7K A;  4A9E A;  2DWW A;  5F61 A;  4NR9 A;  1DVP A;  1ZS5 A;  2OXQ C;  4O64 A;  5LKU A;  5DLX A;  5TDR A;  5A5O A;  4UIX A;  5EWH A;  2YU4 A;  5HRV A;  2MT5 A;  5C8G A;  5DIN A;  5DFC A;  5DYA A;  4Z1Q A;  5C87 A;  5TBN A;  4UIT A;  2VJE B;  1JSP B;  2EGP A;  3U5M A;  2CSY A;  2YT5 A;  3JVK A;  4WZ2 A;  1U6G B;  5EQ1 A;  2DVR A;  4N4G A;  4YYI A;  5A83 A;  5A5P A;  5D3P A;  2VPD A;  5C85 A;  4O70 A;  5K29 A;  4QYL A;  1ZBD B;  5DFD A;  2HYE D;  2KGI A;  4QEV A;  3T7L A;  5E7D A;  4WHW A;  5E9M A;  4O77 A;  3D1D A;  4P5O B;  5G05 B;  4YAX A;  4NYV A;  2MIQ A;  3DWD A;  5H1T A;  1DCQ A;  2E7O A;  3HMF A;  2XOY A;  3RPG B;  5F5Z A;  5ETB A;  5DKA A;  1WEV A;  2K17 A;  2JUN A;  4LZR A;  5H1V A;  3O47 A;  2F6J A;  4N3W A;  3C5K A;  5II1 A;  2ZET C;  5KH3 A;  4ZC9 A;  1RMD A;  4I7C A;  3UV5 A;  5D3R A;  3SVG A;  4S3O C;  5EK9 A;  5SVY A;  5ENE A;  2E6R A;  4LKA A;  4FJC A;  4A4C A;  4HXS A;  5SVX A;  5FB0 A;  5KTU A;  2DVV A;  5LKX A;  4Z0O A;  4A0C D;  2E7N A;  4TT2 A;  3N9P A;  2CRW A;  5L99 A;  5D25 A;  2L75 A;  2YQL A;  2YSM A;  4TZ8 A;  3QZS A;  5CUA A;  4AKH A;  4J0S A;  5L96 A;  2CSZ A;  5CRZ A;  2CON A;  4UIV A;  4GND A;  4NRA A;  5FER A;  4HBY A;  5EM3 A;  3LJU X;  3SOX A;  1N87 A;  3K2J A;  2IQJ A;  3UV2 A;  3SHB A;  5CUE A;  4A9I A;  4QNS A;  5D1L B;  4AVX A;  5D1M B;  4TU6 A;  2M85 A;  3P1F A;  4QEU A;  4PCE A;  5DY7 A;  3ZYU A;  5H85 A;  4NUE A;  2NXB A;  2FSA A;  1WEM A;  3LRQ A;  4Z0R A;  3I2D A;  3GV4 A;  5KH7 A;  2RI7 A;  3MUL A;  3P5O A;  4AKN A;  4LYW A;  2DSM A;  3EB5 A;  5E0R A;  4PY6 A;  3FL2 A;  1V87 A;  2YEM A;  1WUM A;  4TQN A;  3T6R A;  3LXJ A;  5AMF A;  3M62 A;  5ENI A;  5DLZ A;  4IR6 A;  5E9K A;  5ENB A;  5DKD A;  2LXH C;  3QZV A;  2HDP A;  2M3H A;  2VPE A;  1WIM A;  5EIC A;  2OWA A;  5CQ5 A;  5EPR A;  4NR5 A;  4UYE A;  4QR5 A;  2MNY A;  4OGJ A;  5FH6 A;  2YQM A;  5FE0 A;  5LVR A;  2MA6 A;  5LKT A;  1VYX A;  1IYM A;  3DWY A;  5CQT A;  5II2 A;  2N9G A;  5I7X A;  2RSD A;  1XWH A;  4WIV A;  5KO4 A;  1E6I A;  4HXL A;  2L43 A;  2YQD A;  3HME A;  4Q0O A;  5IGM A;  5JI8 A;  2H60 A;  1LDJ B;  5EU1 A;  3UVW A;  3NXB A;  5FE5 A;  5ENH A;  5J3X A;  3LVQ E;  2KIZ A;  3O36 A;  4AKI A;  3FM8 C;  2G45 A;  2YYR A;  4BHW A;  2KWN A;  5LJ1 A;  4A9L A;  2XB1 A;  4YYK A;  2LV9 A;  5D3S A;  4V3L C;  2ECJ A;  4QR4 A;  3KQI A;  4QUU A;  5I86 A;  2F6N A;  4FLP A;  5CQ8 A;  5HM0 A;  2KE1 A;  3KNV A;  5AIT A;  4AYC A;  3IU6 A;  2LN0 A;  4NR8 A;  5FBX A;  5L97 A;  3UV4 A;  4HXR A;  5FH7 A;  5EWW A;  4J3I A;  2YUR A;  5D1K B;  5EWV A;  3Q2E A;  3LJW A;  5HLS A;  4A4B A;  1WIL A;  4QR3 A;  2VJF B;  1MM2 A;  3M63 A;  4B86 C;  4YH3 A;  4FIP A;  2LRI C;  5D3N A;  2LDR A;  2KR4 A;  2M13 A;  2QJ0 A;  2DAT A;  5F3A A;  3H7H A;  2FD4 A;  5H9M A;  4TYL A;  2F42 A;  4PTB A;  4NYW A;  4OGI A;  4CCG X;  4F1P A;  3S92 A;  3PHD A;  2PUY A;  2MD8 C;  3PLW A;  5C11 A;  5FE8 A;  4QF3 A;  2R0Y A;  4CFL A;  2K1J A;  4QY4 A;  4YK0 A;  5FE7 A;  4R7E A;  5A5S A;  4KV4 A;  5DW2 A;  4V3K C;  4A9J A;  4O62 A;  5B8D A;  5J0D A;  4O7C A;  4NUC A;  1WE9 A;  1E4U A;  4UYH A;  4CUP A;  2JMD A;  5C7N A;  5JG6 A;  3ZTG A;  4QSV A;  5F36 A;  4LC2 A;  4Z93 A;  4MEQ A;  3ERR A;  4NS5 A;  5FE6 A;  5AD2 A;  2L85 A;  4ALG A;  5HFQ A;  4TT6 A;  5DX4 A;  3MHH A;  3DAI A;  2MUM A;  5CUD A;  4A9M A;  5BT3 A;  5I88 A;  4O7F A;  4QUT A;  3SVH A;  1X4U A;  2YDW A;  3LDY A;  2H0D B;  5HEN A;  5E9L A;  2WP1 A;  4NRB A;  3V43 A;  5EI4 A;  3HTK C;  5H1U A;  2EGM A;  2ECV A;  5TRB A;  2C2L A;  2KWO A;  2LGK A;  4QSQ A;  5CQ6 A;  1LDK C;  2YYN A;  4C67 A;  1X0J A;  3NG2 A;  5D3J A;  4QQ4 A;  5FE2 A;  2EA6 A;  1F68 A;  4O75 A;  5IGK A;  4YYM A;  4HXN A;  3UVY A;  4C9Z A;  2RNY A;  5D3L A;  4WZ0 A;  4TZ2 A;  3FEH A;  4IR4 A;  4J0R A;  4E96 A;  2YHO A;  3DPL R;  2K16 A;  4HXM A;  3RPG C;  5I80 A;  2ECW A;  4C66 A;  4IC3 A;  5E73 A;  1VD4 A;  1JM4 B;  2L80 A;  5CY9 A;  3N9O A;  4KCX A;  5CQ4 A;  5EWD A;  2LGV A;  4O71 A;  5DYX A;  2ECT A;  4FK5 A;  4FO9 A;  1HYI A;  4YYG A;  4BJX A;  1K2F A;  4BW4 A;  4TTE A;  5I89 A;  4F52 B;  5SVI A;  2QIZ A;  5FB1 A;  5F25 A;  4IOQ A;  3C6W A;  4L7X A;  2YSJ A;  5E9V A;  4A9H A;  5I83 A;  5HEL A;  3PUR A;  4NR7 A;  2DJA A;  1Z6U A;  4A49 A;  2Y1M A;  3ZPV E;  2KKY A;  4QSS A;  4NXJ A;  4Q0N A;  3N9N A;  1ZKR A;  2RNW A;  3N9L A;  4H9D A;  4QF2 A;  1WEQ A;  4NQM A;  4YYD A;  2RR4 A;  2B0O E;  5D26 A;  4N4I A;  5EV9 A;  4HBW A;  2OO1 A;  4QZS A;  5FFV A;  5AD3 A;  5C13 A;  4XUA A;  3VKH A;  3AQA A;  4Z6H A;  2JMJ A;  2IDA A;  4X2I A;  5F60 A;  5HFR A;  3UVX A;  5LUU A;  4QSP A;  5FE3 A;  2D9E A;  2DX8 A;  2LGG A;  3LQI A;  5FE1 A;  5FE4 A;  2RO1 A;  2MJV B;  5CUC A;  5IG6 A;  4CLB A;  2KGG A;  5DKH A;  5LJ0 A;  4XI1 A;  3G0J A;  3RTR B;  5A81 A;  5CZG A;  3TLP A;  5C89 A;  4QSX A;  2R0S A;  5ENF A;  4UIU A;  2MKE A;  4QSR A;  5LJ2 A;  1Z60 A;  2YW5 A;  2QIC A;  3N9M A;  2L5E A;  5B76 A;  2EJN A;  5D3T A;  4A9K A;  5B79 A;  4QSU A;  4MEN A;  4O78 A;  5A5R A;  2P57 A;  5CU8 A;  5KU3 A;  3ZPV 1;  3M7K A;  3Q2F A;  3LVR E;  4CUU A;  4ZQL A;  4UYG A;  4O7B A;  4QSW A;  5F63 A;  2EOD A;  3PUQ A;  3U5P A;  4HXO A;  5EGU A;  3MXF A;  2L5U A;  5A85 A;  1WEO A;  4MEO A;  3FAO A;  4YC9 A;  2CKL A;  2LSP B;  4BW3 A;  4HXP A;  2E6S A;  5ENG A;  2CT2 A;  5FG5 A;  5HQ6 A;  4UIW A;  2AN6 A;  2RFJ A;  4UYF A;  1JM7 A;  3IU5 A;  5DYU A;  4UIY A;  4YYH A;  4GNF A;  4CL9 A;  4OGC A;  5G4R A;  4PPE A;  5HRW A;  5TCM A;  5IGN A;  3P1C A;  5CQ7 A;  5D7X A;  2G6Q A;  4CFK A;  2G43 A;  2OUO A;  4I7D A;  3HCS A;  5L98 A;  2FFW A;  3O33 A;  5EP7 A;  3U5L A;  4YY4 A;  4WA6 A;  5CUG A;  3EB6 A;  4YAD A;  2RS9 B;  4HBX A;  5F1H A;  4PCI A;  1T1H A;  5ENC A;  3IHP A;  4UI9 B;  2KYU A;  2YEL A;  1WES A;  3DQV R;  4A9N A;  4WHU A;  3KDE C;  5CQ3 A;  4QBM A;  5K3Q A;  5E9Y A;  2MD7 B;  4OGE A;  1PUO A;  4LZS A;  4Y03 A;  5CP5 A;  5KTX A;  4YAB A;  1WEP A;  3SUB A;  2YEK A;  4OUF A;  2XOC A;  5AIU A;  5I1Q A;  2D8S A;  4NRC A;  5FFW A;  4DON A;  2ECG A;  5FEY A;  4MR3 A;  5ETD A;  5HQ7 A;  2VJE A;  3GG3 A;  4X3G A;  4AYC B;  4QC3 A;  2CSV A;  2LGL A;  3SVF A;  5F2P A;  3VK6 A;  5DKC A;  1MBM A;  2UZG A;  4GB0 A;  4QB3 A;  4R2Y A;  5KHM A;  4A9F A;  4XYA A;  5D0C A;  2DVQ A;  3U5N A;  3HCU A;  2VNF A;  2Y1N A;  5FG6 A;  4N4H A;  3UW9 A;  5B78 A;  3JVJ A;  3ZNI A;  2L84 A;  1HYJ A;  3E2D A;  1Z2Q A;  4HBV A;  3MDB C;  4O76 A;  4NUD A;  2H0D A;  2MA5 A;  5D24 A;  2YUC A;  3AAD A;  3I3J A;  2PNX A;  2L0B A;  5AME A;  2Y43 A;  4IOO A;  4MSX A;  2I8N A;  4LR6 A;  3JVM A;  4YBM A;  4IOR A;  5B75 A;  3GL6 A;  2ECN A;  5EYA F;  1WGM A;  5IBN A;  5DFB A;  5L8U A;  4GPJ A;  3MB3 A;  5HJC A;  4BW1 A;  1X4I A;  3O7A A;  3T9K A;  2YVR A;  5C4Q A;  4NR4 A;  4XUB A;  5FE9 A;  2C2V S;  5A5N A;  2DKW A;  4NYX A;  5LKZ A;  3ZVY A;  2R10 A;  5A7C A;  4YH4 A;  4LRG A;  5FH8 A;  5L8T A;  3M99 A;  4S3O B;  4IC2 A;  5D3H A;  4B7Y C;  5CTL A;  3U5K A;  4CUQ A;  2G4A A;  5CQA A;  4N4F A;  4QST A;  5HEM A;  5I40 A;  1G25 A;  3D1B A;  5EIS A;  1WEN A;  4TS8 A;  4CUS A;  4LLB A;  2VPG A;  2KRE A;  5IID A;  4LYI A;  2FUU A;  5ACY A;  5E9I A;  2E3K A;  4PKL A;  2JRJ A;  2M6M A;  4LDF A;  2LAU A;  2VPB A;  2YW8 A;  4KV1 A;  5G4S A;  2MNZ A;  4CA1 A;  2KWJ A;  2E61 A;  3HCT A;  4MVT A;  3P1D A;  4F3I A;  2KWK A;  5CFW A;  3O35 A;  3ASL A;  3JUE A;  5EPS A;  2JM3 A;  3L11 A;  5HQ5 A;  4O72 A;  3MB4 A;  4HXK A;  4O7E A;  4L58 A;  4MR5 A;  3HMH A;  5EPB A;  4GNE A;  4NN2 A;  5JWM A;  4UP0 A;  4XY9 A;  3O37 A;  4UYD A;  5A5Q A;  4YYN A;  5IGL A;  4Z1S A;  2M1R A;  5LCW B;  2L7P A;  4UIZ A;  2CRR A;  5HCL A;  4TT4 A;  5TAB A;  1VFY A; 
#chains in the Genus database with same CATH homology
 4AP4 A;  4PS5 A;  3SOW A;  5CGP A;  1EQF A;  2NAA A;  3S91 A;  4TU4 A;  2RNX A;  5B77 A;  5FDZ A;  2WP2 A;  4CUR A;  3LQJ A;  5TB6 A;  2FUI A;  4YBT A;  5CPE A;  5DW1 A;  4CUT A;  5A82 A;  3ONI A;  1X4J A;  3KV6 A;  4ZDT A;  5F1L A;  4ZUX U;  4ZW1 A;  5DYC A;  3QZT A;  5I7Y A;  2JMI A;  2OSS A;  3D7C A;  4LYS A;  4QYD A;  2K4D A;  3MQM A;  4GNG A;  5E3G A;  5CUB A;  2D82 A;  2KU3 A;  5KTW A;  4YY6 A;  4W4U A;  3O34 A;  5FFY A;  5E74 A;  5BT5 A;  3JVL A;  3RCW A;  2VP7 A;  1N72 A;  4RVR A;  4UP5 A;  4XY8 A;  2LXP C;  5TDW A;  2DVS A;  5COI A;  1JOC A;  3O70 A;  5CS8 A;  3L1Z B;  4LAD B;  3G0L A;  2I50 A;  3KV5 A;  3FKM X;  4LZ2 A;  4NQN A;  3UVD A;  2VJF A;  3N9Q A;  4IR3 A;  4I7B A;  2YRE A;  4MR4 A;  1WUG A;  5EA1 A;  5HRX A;  4YAT A;  4QC1 A;  4O74 A;  1F62 A;  4LJN A;  5LVQ A;  5KH9 A;  5F62 A;  1MM3 A;  3ZVZ B;  4AUQ B;  1WFK A;  4LK9 A;  3U5O A;  5I3L A;  2KTB B;  5FG4 A;  4TKP B;  4QEW A;  1CHC A;  4BW2 A;  4Z6I A;  3ZYQ A;  4R8P K;  5E3D A;  3MUK A;  2KFT A;  4MEP A;  2CKL B;  4NR6 A;  3SOU A;  3P1E A;  5CRM A;  4Q6F A;  4A9O A;  4IR5 A;  3MHS A;  2GRC A;  4UYF B;  5G04 B;  1FBV A;  4J1P A;  5I29 A;  3L1X A;  1BOR A;  4WZ3 B;  5EVA A;  5ENJ A;  2ECI A;  4BBQ A;  1WEE A;  1JM7 B;  1WEU A;  2LQ6 A;  1WEW A;  3LQH A;  5DBM A;  1FP0 A;  5EWC A;  4YBS A;  5BT4 A;  2XEU A;  2R0V A;  4YYJ A;  3U5J A;  2BAY A;  5G0F A;  4MR6 A;  2YHN A;  4O7A A;  4ALH A;  2I7K A;  4A9E A;  2DWW A;  5F61 A;  4NR9 A;  1DVP A;  1ZS5 A;  2OXQ C;  4O64 A;  5LKU A;  5DLX A;  5TDR A;  5A5O A;  4UIX A;  5EWH A;  2YU4 A;  5HRV A;  2MT5 A;  5C8G A;  5DIN A;  5DFC A;  5DYA A;  4Z1Q A;  5C87 A;  5TBN A;  4UIT A;  2VJE B;  1JSP B;  2EGP A;  3U5M A;  2CSY A;  2YT5 A;  3JVK A;  4WZ2 A;  1U6G B;  5EQ1 A;  2DVR A;  4N4G A;  4YYI A;  5A83 A;  5A5P A;  5D3P A;  2VPD A;  5C85 A;  4O70 A;  5K29 A;  4QYL A;  1ZBD B;  5DFD A;  2HYE D;  2KGI A;  4QEV A;  3T7L A;  5E7D A;  4WHW A;  5E9M A;  4O77 A;  4P5O B;  5G05 B;  4YAX A;  4NYV A;  2MIQ A;  5H1T A;  2E7O A;  3HMF A;  3RPG B;  5F5Z A;  5ETB A;  5DKA A;  1WEV A;  2K17 A;  4LZR A;  5H1V A;  2F6J A;  4N3W A;  3C5K A;  5II1 A;  2ZET C;  5KH3 A;  4ZC9 A;  1RMD A;  4I7C A;  3UV5 A;  5D3R A;  3SVG A;  4S3O C;  5EK9 A;  5ENE A;  2E6R A;  4LKA A;  4FJC A;  4A4C A;  4HXS A;  5FB0 A;  5KTU A;  2DVV A;  5LKX A;  4A0C D;  2E7N A;  4TT2 A;  3N9P A;  5L99 A;  5D25 A;  2L75 A;  2YQL A;  2YSM A;  4TZ8 A;  3QZS A;  5CUA A;  4J0S A;  5L96 A;  2CSZ A;  5CRZ A;  4UIV A;  4GND A;  4NRA A;  5FER A;  4HBY A;  5EM3 A;  3SOX A;  1N87 A;  3K2J A;  3UV2 A;  3SHB A;  5CUE A;  4A9I A;  4QNS A;  5D1L B;  4AVX A;  5D1M B;  4TU6 A;  2M85 A;  3P1F A;  4QEU A;  4PCE A;  5DY7 A;  3ZYU A;  5H85 A;  4NUE A;  2NXB A;  2FSA A;  1WEM A;  3LRQ A;  3I2D A;  3GV4 A;  5KH7 A;  2RI7 A;  3MUL A;  3P5O A;  4AKN A;  4LYW A;  3EB5 A;  5E0R A;  4PY6 A;  3FL2 A;  1V87 A;  2YEM A;  1WUM A;  4TQN A;  3T6R A;  3LXJ A;  5AMF A;  3M62 A;  5ENI A;  5DLZ A;  4IR6 A;  5E9K A;  5ENB A;  5DKD A;  2LXH C;  3QZV A;  2HDP A;  2M3H A;  2VPE A;  1WIM A;  5EIC A;  5CQ5 A;  5EPR A;  4NR5 A;  4UYE A;  4QR5 A;  2MNY A;  4OGJ A;  5FH6 A;  2YQM A;  5FE0 A;  5LVR A;  2MA6 A;  5LKT A;  1VYX A;  1IYM A;  3DWY A;  5CQT A;  5II2 A;  2N9G A;  5I7X A;  2RSD A;  1XWH A;  4WIV A;  5KO4 A;  1E6I A;  4HXL A;  2L43 A;  2YQD A;  3HME A;  4Q0O A;  5IGM A;  5JI8 A;  2H60 A;  1LDJ B;  5EU1 A;  3UVW A;  3NXB A;  5FE5 A;  5ENH A;  5J3X A;  2KIZ A;  3O36 A;  2G45 A;  2YYR A;  4BHW A;  2KWN A;  5LJ1 A;  4A9L A;  2XB1 A;  4YYK A;  2LV9 A;  5D3S A;  4V3L C;  2ECJ A;  4QR4 A;  3KQI A;  4QUU A;  5I86 A;  2F6N A;  4FLP A;  5CQ8 A;  5HM0 A;  2KE1 A;  3KNV A;  5AIT A;  4AYC A;  3IU6 A;  2LN0 A;  4NR8 A;  5FBX A;  5L97 A;  3UV4 A;  4HXR A;  5FH7 A;  5EWW A;  4J3I A;  2YUR A;  5D1K B;  5EWV A;  3Q2E A;  3LJW A;  5HLS A;  4A4B A;  1WIL A;  4QR3 A;  2VJF B;  1MM2 A;  3M63 A;  4B86 C;  4YH3 A;  4FIP A;  2LRI C;  5D3N A;  2LDR A;  2KR4 A;  2QJ0 A;  2DAT A;  5F3A A;  5H9M A;  4TYL A;  2F42 A;  4PTB A;  4NYW A;  4OGI A;  4CCG X;  3S92 A;  3PHD A;  2PUY A;  2MD8 C;  5C11 A;  5FE8 A;  4QF3 A;  2R0Y A;  4CFL A;  2K1J A;  4QY4 A;  4YK0 A;  5FE7 A;  4R7E A;  5A5S A;  4KV4 A;  5DW2 A;  4V3K C;  4A9J A;  5B8D A;  5J0D A;  4O7C A;  4NUC A;  1WE9 A;  1E4U A;  4UYH A;  4CUP A;  2JMD A;  5C7N A;  5JG6 A;  3ZTG A;  4QSV A;  5F36 A;  4LC2 A;  4Z93 A;  4MEQ A;  4NS5 A;  5FE6 A;  5AD2 A;  2L85 A;  4ALG A;  5HFQ A;  4TT6 A;  5DX4 A;  3MHH A;  3DAI A;  2MUM A;  5CUD A;  4A9M A;  5BT3 A;  5I88 A;  4O7F A;  4QUT A;  3SVH A;  1X4U A;  2YDW A;  2H0D B;  5HEN A;  5E9L A;  2WP1 A;  4NRB A;  3V43 A;  5EI4 A;  3HTK C;  5H1U A;  2ECV A;  5TRB A;  2C2L A;  2KWO A;  2LGK A;  4QSQ A;  5CQ6 A;  1LDK C;  2YYN A;  4C67 A;  1X0J A;  3NG2 A;  5D3J A;  5FE2 A;  2EA6 A;  1F68 A;  4O75 A;  5IGK A;  4YYM A;  4HXN A;  3UVY A;  4C9Z A;  2RNY A;  5D3L A;  4WZ0 A;  4TZ2 A;  4IR4 A;  4J0R A;  4E96 A;  2YHO A;  3DPL R;  2K16 A;  4HXM A;  3RPG C;  5I80 A;  2ECW A;  4C66 A;  4IC3 A;  5E73 A;  1VD4 A;  1JM4 B;  2L80 A;  5CY9 A;  3N9O A;  4KCX A;  5CQ4 A;  5EWD A;  2LGV A;  4O71 A;  5DYX A;  2ECT A;  4FK5 A;  4FO9 A;  1HYI A;  4YYG A;  4BJX A;  1K2F A;  4BW4 A;  4TTE A;  5I89 A;  4F52 B;  2QIZ A;  5FB1 A;  5F25 A;  4IOQ A;  3C6W A;  4L7X A;  2YSJ A;  5E9V A;  4A9H A;  5I83 A;  5HEL A;  3PUR A;  4NR7 A;  4A49 A;  1Z6U A;  2Y1M A;  3ZPV E;  4QSS A;  4NXJ A;  4Q0N A;  3N9N A;  2RNW A;  3N9L A;  4QF2 A;  1WEQ A;  4NQM A;  4YYD A;  5D26 A;  4N4I A;  5EV9 A;  4HBW A;  2OO1 A;  4QZS A;  5FFV A;  5AD3 A;  5C13 A;  4XUA A;  3AQA A;  4Z6H A;  2JMJ A;  2IDA A;  4X2I A;  5F60 A;  5HFR A;  3UVX A;  5LUU A;  4QSP A;  5FE3 A;  2D9E A;  2DX8 A;  2LGG A;  3LQI A;  5FE1 A;  5FE4 A;  2RO1 A;  2MJV B;  5CUC A;  5IG6 A;  4CLB A;  2KGG A;  5DKH A;  5LJ0 A;  4XI1 A;  3G0J A;  3RTR B;  5A81 A;  5CZG A;  3TLP A;  5C89 A;  4QSX A;  2R0S A;  5ENF A;  4UIU A;  4QSR A;  5LJ2 A;  1Z60 A;  2YW5 A;  2QIC A;  3N9M A;  2L5E A;  5B76 A;  5D3T A;  4A9K A;  5B79 A;  4QSU A;  4MEN A;  4O78 A;  5A5R A;  5CU8 A;  5KU3 A;  3ZPV 1;  3Q2F A;  4CUU A;  4ZQL A;  4UYG A;  4O7B A;  4QSW A;  5F63 A;  2EOD A;  3PUQ A;  3U5P A;  4HXO A;  5EGU A;  3MXF A;  2L5U A;  5A85 A;  1WEO A;  4MEO A;  4YC9 A;  2CKL A;  2LSP B;  4BW3 A;  4HXP A;  2E6S A;  5ENG A;  2CT2 A;  5FG5 A;  5HQ6 A;  4UIW A;  2AN6 A;  2RFJ A;  4UYF A;  1JM7 A;  3IU5 A;  5DYU A;  4UIY A;  4YYH A;  4GNF A;  4CL9 A;  5G4R A;  4PPE A;  5HRW A;  5TCM A;  5IGN A;  3P1C A;  5CQ7 A;  5D7X A;  2G6Q A;  4CFK A;  2G43 A;  2OUO A;  4I7D A;  3HCS A;  5L98 A;  3O33 A;  5EP7 A;  3U5L A;  4YY4 A;  4WA6 A;  5CUG A;  3EB6 A;  4YAD A;  2RS9 B;  4HBX A;  5F1H A;  4PCI A;  1T1H A;  5ENC A;  3IHP A;  4UI9 B;  2KYU A;  2YEL A;  1WES A;  3DQV R;  4A9N A;  4WHU A;  5CQ3 A;  4QBM A;  5E9Y A;  2MD7 B;  4LZS A;  4Y03 A;  5CP5 A;  5KTX A;  4YAB A;  1WEP A;  2YEK A;  4OUF A;  5AIU A;  5I1Q A;  2D8S A;  4NRC A;  5FFW A;  4DON A;  2ECG A;  5FEY A;  4MR3 A;  5ETD A;  5HQ7 A;  2VJE A;  3GG3 A;  4X3G A;  4AYC B;  4QC3 A;  2LGL A;  3SVF A;  5F2P A;  3VK6 A;  5DKC A;  2UZG A;  4GB0 A;  4QB3 A;  4R2Y A;  5KHM A;  4A9F A;  4XYA A;  5D0C A;  2DVQ A;  3U5N A;  3HCU A;  2VNF A;  2Y1N A;  5FG6 A;  4N4H A;  3UW9 A;  5B78 A;  3JVJ A;  3ZNI A;  2L84 A;  1HYJ A;  1Z2Q A;  4HBV A;  4O76 A;  4NUD A;  2H0D A;  2MA5 A;  5D24 A;  2YUC A;  3AAD A;  3I3J A;  2PNX A;  2L0B A;  5AME A;  2Y43 A;  4IOO A;  4MSX A;  2I8N A;  4LR6 A;  3JVM A;  4YBM A;  4IOR A;  5B75 A;  3GL6 A;  2ECN A;  5EYA F;  1WGM A;  5IBN A;  5DFB A;  5L8U A;  4GPJ A;  3MB3 A;  5HJC A;  4BW1 A;  1X4I A;  3O7A A;  5C4Q A;  4NR4 A;  4XUB A;  5FE9 A;  2C2V S;  5A5N A;  2DKW A;  4NYX A;  5LKZ A;  3ZVY A;  2R10 A;  5A7C A;  4YH4 A;  4LRG A;  5FH8 A;  5L8T A;  3M99 A;  4S3O B;  4IC2 A;  5D3H A;  4B7Y C;  5CTL A;  3U5K A;  4CUQ A;  2G4A A;  5CQA A;  4N4F A;  4QST A;  5HEM A;  5I40 A;  1G25 A;  5EIS A;  1WEN A;  4TS8 A;  4CUS A;  4LLB A;  2VPG A;  2KRE A;  5IID A;  4LYI A;  2FUU A;  5ACY A;  5E9I A;  2E3K A;  4PKL A;  2JRJ A;  2M6M A;  4LDF A;  2VPB A;  2YW8 A;  4KV1 A;  5G4S A;  2MNZ A;  4CA1 A;  2KWJ A;  3HCT A;  4MVT A;  3P1D A;  4F3I A;  2KWK A;  5CFW A;  3O35 A;  3ASL A;  5EPS A;  3L11 A;  5HQ5 A;  4O72 A;  3MB4 A;  4HXK A;  4O7E A;  4L58 A;  4MR5 A;  3HMH A;  5EPB A;  4GNE A;  4NN2 A;  5JWM A;  4UP0 A;  4XY9 A;  3O37 A;  4UYD A;  5A5Q A;  4YYN A;  5IGL A;  4Z1S A;  2M1R A;  5LCW B;  4UIZ A;  5TAB A;  5HCL A;  4TT4 A;  1VFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...