3U5PA

Crystal structure of the complex of trim33 phd-bromo and h3(1-28)k9me3k14ack18ack23ac histone peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
188
Chain Sequence
DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 56
structure length 188
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5pA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5pA01
4YYNA 4R8PK 3N9QA 5F1HA 4ALGA 2YSMA 2R0SA 4OGIA 2HDPA 5EPBA 4HBWA 5HENA 4V3LC 5A7CA 4PKLA 4A0CD 4YYIA 3LQJA 2EGPA 2RFJA 1JM7B 1Z2QA 5FE0A 4LLBA 4A9EA 1FBVA 4O7CA 4V3KC 1ZS5A 5LUUA 3U5PA 2MA5A 3UVDA 4C66A 5FE7A 4NRCA 2Y1MA 3MHHA 5FE5A 5FG6A 5LKTA 2JMJA 4AUQB 4LYIA 4FJCA 5TBNA 2RO1A 5D3NA 5HQ5A 3HTKC 2VP7A 4MVTA 3VK6A 4Y03A 1MM2A 5E3DA 5FH8A 4YABA 4HXMA 5E9MA 5D1KB 4Q0OA 3T6RA 4HXSA 5DKCA 5TDWA 4HBVA 1K2FA 5EV9A 3P1DA 4N4IA 3O70A 5IGNA 1WENA 4XI1A 1HYIA 5I89A 5IG6A 5I86A 3AQAA 1X0JA 3MB3A 5JWMA 1WIMA 4MR3A 1CHCA 4X2IA 5ENBA 3ZPV1 4QNSA 5LCWB 4MEPA 4RVRA 5FE8A 2M3HA 3S92A 3I3JA 2LXPC 2M6MA 4I7BA 4L58A 3Q2EA 4N3WA 2JMIA 4TKPB 4A9NA 2CSYA 3QZVA 2LN0A 4IOQA 5D7XA 4F3IA 3L11A 2H60A 4NR6A 4QY4A 1V87A 1IYMA 2DX8A 3M63A 4ZDTA 5JG6A 5HQ6A 3KV5A 4GNDA 5CFWA 2YW8A 2DWWA 4BBQA 3JVMA 2L5EA 3UV2A 4ALHA 1HYJA 5DFBA 3KQIA 4A9JA 2VPEA 5B78A 4YYDA 5EYAF 1F62A 5FE4A 4QEWA 4A9HA 5IBNA 4NYVA 2CSZA 5EWCA 2L84A 4WHUA 5CP5A 5CUEA 4PPEA 5JI8A 5F63A 4CURA 3G0LA 5I29A 4O75A 5LVRA 5E9LA 1WEEA 5DY7A 3JVLA 2LSPB 3U5MA 3O37A 4A9KA 2L80A 2VJEB 5CQAA 2OUOA 3D7CA 3U5LA 4LZRA 4NXJA 5G4RA 4A9OA 3UVXA 4AKNA 5F61A 4KCXA 5CS8A 2JRJA 5HFQA 5HFRA 3RPGC 5HLSA 4R7EA 5II2A 2E7NA 5IGKA 4HXRA 4XYAA 5LJ0A 5CU8A 2UZGA 4TT6A 2YEKA 5EK9A 5DKHA 4TU4A 5D24A 1WE9A 3LXJA 4PY6A 4Q6FA 5BT4A 5E0RA 4YH4A 5C4QA 3SVFA 4J3IA 5FH6A 5G04B 5B8DA 2C2VS 4ZUXU 3QZSA 3RTRB 4UIZA 4I7DA 2H0DA 1DVPA 4YYHA 4MEOA 1VYXA 3LRQA 4YYMA 4B86C 2RNWA 3DWYA 4GNGA 1JM7A 5B79A 3N9NA 4NRAA 2ZETC 4UITA 2VJFB 2YQLA 3PUQA 1E4UA 2VJEA 4ZC9A 5L99A 5FFYA 4R2YA 5KO4A 3QZTA 4MR4A 4A9IA 5D3RA 3NXBA 4YC9A 5HRWA 2WP2A 4CA1A 5CQ6A 4LR6A 4ZQLA 3DQVR 3O34A 2YDWA 5FE3A 2LRIC 3N9OA 3U5OA 5I88A 4TQNA 2YHNA 5L98A 1T1HA 4WIVA 2KYUA 2VPDA 4N4FA 5AD3A 4LADB 2R0VA 4UIXA 5KU3A 4Z1SA 1X4IA 5DYCA 5ENCA 2R0YA 5L8UA 3GL6A 3V43A 2FSAA 5F5ZA 5EWVA 4QSTA 1U6GB 2KWKA 5CUGA 5A5RA 2G6QA 2L43A 4J1PA 5II1A 5HCLA 4FK5A 2GRCA 4F52B 4AYCA 5EISA 4CUPA 4C9ZA 4BW1A 3UVWA 5C87A 4LKAA 5H85A 3O36A 1ZBDB 2HYED 4NQNA 5L96A 2L5UA 5CY9A 4UP0A 2MD8C 5B76A 5TCMA 3UV4A 4QSXA 5ETBA 5KTUA 5EPRA 2YREA 4TT4A 5DW1A 2K1JA 4J0RA 4LDFA 4N4HA 4Q0NA 4Z1QA 2YQMA 4A4BA 3T7LA 4IR3A 1WEUA 4MR6A 5DFDA 4AVXA 4NUEA 2KREA 4PCEA 4IC2A 5FE6A 4QEVA 5B77A 2MUMA 4LZ2A 5ETDA 4NR8A 2ECTA 5TABA 4BJXA 2LQ6A 3P1FA 5EI4A 5A82A 4ZW1A 3ONIA 5CTLA 4QSUA 2DVSA 5FFWA 2OSSA 4TT2A 4YYGA 4QEUA 5C7NA 4S3OC 4HXNA 5C8GA 4AP4A 5KH3A 2NAAA 4QSVA 2LV9A 3U5KA 4QSSA 4CUSA 3SVHA 3ZNIA 4LYSA 4WZ3B 4LC2A 5HQ7A 3N9MA 1LDJB 4YK0A 2F6JA 5ENJA 2EA6A 5DYAA 1N72A 4CUTA 4A9FA 3TLPA 2M85A 5L8TA 4YATA 2D9EA 4IORA 3S91A 4XY9A 4FO9A 5CQTA 2KGGA 4P5OB 5EWDA 5FDZA 5G0FA 1LDKC 5I7XA 5E74A 5E7DA 5I7YA 2VPGA 5F25A 2MD7B 4OUFA 3IU5A 5COIA 2DKWA 1JOCA 5FH7A 2YHOA 1Z6UA 5CRZA 2KWOA 3FKMX 3G0JA 2C2LA 2LXHC 1WEMA 4GPJA 5FE1A 5FFVA 3M62A 2F42A 5FG4A 3O33A 2R10A 1Z60A 4WZ0A 4BW3A 2Y43A 4HBXA 4TYLA 5FE2A 4UIYA 4FIPA 4HXLA 5D3HA 4O7FA 5HELA 4YBMA 2DVVA 4PS5A 5TB6A 1JM4B 4O72A 4O71A 5DX4A 2M1RA 5B75A 2PNXA 2KWNA 4O74A 2D82A 4TZ8A 4O78A 2LDRA 2VJFA 5I1QA 4QF2A 4NR4A 2I50A 3P1EA 2JMDA 3SVGA 4KV4A 1WUGA 2OXQC 5CQ3A 4BW4A 2RSDA 5KHMA 5BT3A 4NRBA 2YW5A 4YAXA 4WA6A 3GV4A 4A9MA 3ZYUA 4NYWA 4UIVA 5CZGA 4B7YC 4UYEA 4NS5A 4CUQA 5AD2A 1BORA 2L85A 4NYXA 5C11A 5LJ1A 4QSRA 2G45A 5FB0A 5LKZA 5A5PA 4OGJA 4UYDA 2RI7A 4QR4A 3EB5A 4LJNA 2MNYA 3PURA 4NR5A 5F62A 2NXBA 3SOUA 4CCGX 4XY8A 1G25A 1WUMA 4Z6HA 3MULA 2MJVB 4WHWA 2ECJA 4CUUA 5I40A 4FLPA 2YU4A 5C85A 2XB1A 3O35A 5HEMA 4HBYA 1X4JA 4N4GA 5H1TA 3FL2A 5CQ4A 5CUBA 5J3XA 4O7AA 5I3LA 5C13A 4QUTA 5H1UA 1VFYA 4LK9A 3RCWA 3M99A 4WZ2A 5FEYA 3SOXA 2E3KA 5EICA 4TTEA 4CL9A 2YT5A 2YYNA 3HMFA 4QC3A 5DBMA 3P1CA 5E9YA 3GG3A 4C67A 5DKAA 5EPSA 5A5OA 2KGIA 4QSPA 4UIWA 5CGPA 4NUDA 2QIZA 5E3GA 5H9MA 3DAIA 4UYGA 2LGVA 4QYLA 3C6WA 2MT5A 3DPLR 5DYXA 5CUAA 2MNZA 3L1XA 3K2JA 5LKUA 4HXOA 5D3TA 2RNYA 5K29A 5EWHA 3RPGB 2CKLB 4UIUA 3ASLA 2KTBB 4YADA 5EVAA 1F68A 4UYFB 1WEWA 4J0SA 2KWJA 2OO1A 5HRVA 5EQ1A 5KH7A 1XWHA 4GNEA 3N9PA 2LGGA 4IR4A 4A9LA 5LKXA 4S3OB 3SHBA 2LGLA 4KV1A 2EODA 1JSPB 2KIZA 4QUUA 2YYRA 4LYWA 4E96A 3HMEA 5CQ7A 5DYUA 3IU6A 4A49A 5D0CA 5DLXA 5AMEA 1RMDA 3ZTGA 1WEPA 1WFKA 2YELA 5AIUA 3UVYA 2RNXA 4YBTA 3Q2FA 3U5NA 1WILA 2YUCA 5AMFA 3MHSA 2FUUA 4QBMA 3ZVYA 4TZ2A 2L0BA 5CUCA 4PCIA 2YSJA 4QC1A 5D3SA 2K4DA 2L75A 2I7KA 5DINA 4BHWA 4CLBA 2YEMA 5FE9A 3L1ZB 4CFLA 4X3GA 4L7XA 2ECNA 3LQIA 3KNVA 5ENIA 4W4UA 5EGUA 4UYFA 4XUBA 4CFKA 5C89A 2YURA 3IHPA 5EA1A 5EP7A 5A83A 2F6NA 5BT5A 5J0DA 3LQHA 5FG5A 5HRXA 2CKLA 2ECIA 3ZYQA 4LZSA 2DVRA 5LJ2A 3P5OA 3AADA 5A5NA 2I8NA 2K17A 4I7CA 4YH3A 5E9IA 3C5KA 5D1MB 4O64A 5D3PA 4NN2A 2E6RA 5ENHA 5DKDA 1N87A 4PTBA 4QR5A 5L97A 3O7AA 5LVQA 4TS8A 4GNFA 3MXFA 3ZVZB 3MUKA 2G43A 4AYCB 5E9KA 2QJ0A 5EU1A 2H0DB 3MB4A 4QZSA 5D25A 5DLZA 4IR6A 2AN6A 1WEOA 4NQMA 2WP1A 5KH9A 4O76A 5F3AA 5ENEA 3LJWA 4QYDA 1X4UA 3N9LA 5IGLA 1WEQA 5DFCA 5KTWA 2MIQA 1FP0A 2DVQA 4HXKA 2KR4A 5F1LA 1MM3A 2QICA 4HXPA 4MR5A 5FB1A 5D1LB 2FUIA 4QF3A 2YQDA 4BW2A 2KU3A 5CQ8A 5FBXA 3UW9A 5CRMA 2K16A 2IDAA 5TDRA 2N9GA 2KFTA 4O7EA 5EWWA 3ZPVE 4MEQA 5E9VA 5A81A 4QB3A 2RS9B 4QSWA 1WEVA 2VPBA 3HCTA 4IC3A 4QR3A 5I80A 5A5SA 2E6SA 4NUCA 5G05B 5ENGA 5HJCA 5IIDA 1VD4A 5AITA 5HM0A 3HCUA 2G4AA 5CQ5A 3UV5A 4MENA 4XUAA 4Z6IA 1WGMA 1WESA 4O70A 4YBSA 4LRGA 5H1VA 2VNFA 2ECGA 5CPEA 4TU6A 5EM3A 4YYKA 2LGKA 5IGMA 3KV6A 5D3JA 5ENFA 2KE1A 4MSXA 4UP5A 5F36A 4YY4A 4Z93A 4NR7A 3I2DA 5TRBA 2MA6A 3EB6A 4O77A 5DW2A 4QSQA 4GB0A 1EQFA 3JVKA 4DONA 2DATA 4NR9A 4YYJA 2BAYA 5I83A 5F2PA 5E73A 3NG2A 4O7BA 5A5QA 5G4SA 4YY6A 2Y1NA 5A85A 5F60A 3SOWA 3HMHA 4IOOA 2PUYA 4UI9B 5D26A 3JVJA 4IR5A 3HCSA 3MQMA 2ECWA 1E6IA 2CT2A 5CUDA 5ACYA 2E7OA 5KTXA 2XEUA 4UYHA 2ECVA 4A4CA 5FERA 2D8SA 3PHDA 3U5JA 5D3LA
chains in the Genus database with same CATH superfamily
4YYNA 4R8PK 3N9QA 5F1HA 4ALGA 2YSMA 2R0SA 4OGIA 2HDPA 5EPBA 4HBWA 5HENA 3O47A 4V3LC 5A7CA 4PKLA 4A0CD 4YYIA 3LQJA 2EGPA 2RFJA 1JM7B 1Z2QA 4AKIA 3JUEA 5FE0A 4LLBA 4A9EA 1FBVA 4O7CA 2FFWA 3LVRE 4V3KC 1ZS5A 5LUUA 3U5PA 2MA5A 3UVDA 4C66A 5FE7A 4NRCA 2Y1MA 3MHHA 5FE5A 5FG6A 5LKTA 2JMJA 4AUQB 4LYIA 4FJCA 5TBNA 2RO1A 5SVIA 5D3NA 5HQ5A 3T9KA 3HTKC 2VP7A 4MVTA 3VK6A 4Y03A 1MM2A 5E3DA 5FH8A 4YABA 4HXMA 5E9MA 3E2DA 5D1KB 4Q0OA 3T6RA 4HXSA 5DKCA 5TDWA 4HBVA 1K2FA 5EV9A 3P1DA 4N4IA 3O70A 5IGNA 1WENA 4XI1A 1HYIA 5I89A 5IG6A 5I86A 3AQAA 1X0JA 3MB3A 5JWMA 3M7KA 1WIMA 4MR3A 1CHCA 4X2IA 5ENBA 3ZPV1 4QNSA 2KKYA 5LCWB 4MEPA 4RVRA 5FE8A 2M3HA 3S92A 3I3JA 2LXPC 2M6MA 4I7BA 4L58A 3Q2EA 4N3WA 2JMIA 4TKPB 4A9NA 2CSYA 3QZVA 2LN0A 4QQ4A 4IOQA 5D7XA 4F3IA 3L11A 2H60A 4NR6A 4QY4A 1V87A 1IYMA 2DX8A 3M63A 4O62A 4ZDTA 5JG6A 5HQ6A 3KV5A 4GNDA 5CFWA 2YW8A 2DWWA 4BBQA 3JVMA 2JM3A 2L5EA 3UV2A 4ALHA 1HYJA 5DFBA 3KQIA 4A9JA 2VPEA 5B78A 4YYDA 5EYAF 1F62A 5FE4A 4QEWA 4A9HA 5IBNA 5SVIB 4NYVA 2CSZA 5EWCA 2L84A 4WHUA 5CP5A 5CUEA 4PPEA 5JI8A 5F63A 4CURA 3G0LA 5I29A 4O75A 5LVRA 5E9LA 1WEEA 5DY7A 2DSMA 3JVLA 2LSPB 3U5MA 3DDTA 3O37A 4A9KA 2L80A 2VJEB 5CQAA 2L7PA 2OUOA 3D7CA 3U5LA 4LZRA 4NXJA 5G4RA 3M62A 4A9OA 3LDYA 3UVXA 4AKNA 5F61A 4KCXA 5CS8A 2JRJA 5HFQA 5HFRA 3RPGC 5HLSA 4R7EA 5II2A 2E7NA 5IGKA 4HXRA 4XYAA 5LJ0A 5CU8A 2KKXA 2UZGA 4TT6A 2YEKA 5EK9A 5DKHA 4TU4A 5D24A 1WE9A 3LXJA 4PY6A 4Q6FA 5BT4A 5E0RA 4YH4A 5C4QA 3SVFA 4J3IA 5FH6A 2P57A 5G04B 5B8DA 2C2VS 4ZUXU 3QZSA 3RTRB 4UIZA 4I7DA 2H0DA 1DVPA 4YYHA 4MEOA 1VYXA 3LRQA 4YYMA 4B86C 2RNWA 3DWYA 4GNGA 1JM7A 5B79A 3N9NA 4NRAA 2ZETC 4UITA 4AKGA 2VJFB 2YQLA 3PUQA 1E4UA 2OWAA 2VJEA 5K3QA 4ZC9A 5L99A 5FFYA 4R2YA 5KO4A 3QZTA 4MR4A 4A9IA 5D3RA 3NXBA 4YC9A 5HRWA 2WP2A 4CA1A 5CQ6A 4LR6A 4ZQLA 3DQVR 3O34A 2YDWA 5FE3A 2LRIC 3N9OA 3U5OA 5I88A 4TQNA 2YHNA 5L98A 1T1HA 4WIVA 3ERRA 2KYUA 2VPDA 4N4FA 5AD3A 4LADB 1PUOA 2XOZA 2R0VA 4UIXA 5KU3A 4Z1SA 1X4IA 5DYCA 5ENCA 2R0YA 5L8UA 3GL6A 3V43A 2FSAA 5F5ZA 5EWVA 4QSTA 1U6GB 2KWKA 5CUGA 5A5RA 2G6QA 2L43A 4J1PA 5II1A 5HCLA 4FK5A 2GRCA 4F52B 4AYCA 5EISA 4CUPA 4C9ZA 4BW1A 3UVWA 5C87A 4LKAA 5H85A 3O36A 1ZBDB 2HYED 4NQNA 5L96A 2L5UA 5CY9A 4UP0A 2MD8C 5B76A 5TCMA 3UV4A 4QSXA 5ETBA 5KTUA 5EPRA 2YREA 4TT4A 5DW1A 2K1JA 4J0RA 4LDFA 4N4HA 4Q0NA 4Z1QA 2YQMA 4A4BA 3T7LA 4IR3A 1WEUA 4MR6A 5DFDA 4AVXA 4NUEA 2KREA 4PCEA 4IC2A 5FE6A 4QEVA 5B77A 2MUMA 2CONA 4LZ2A 5ETDA 4NR8A 2ECTA 5TABA 4BJXA 2LQ6A 3FJUB 3P1FA 5EI4A 5A82A 4ZW1A 3ONIA 5CTLA 4QSUA 2DVSA 5FFWA 2OSSA 4TT2A 4YYGA 4QEUA 5C7NA 4S3OC 4HXNA 5C8GA 4AP4A 5KH3A 2NAAA 4QSVA 2LV9A 3FM8C 3U5KA 4QSSA 4CUSA 2XOCA 3SVHA 3ZNIA 4LYSA 4WZ3B 2LAUA 4LC2A 5HQ7A 3N9MA 2E61A 1LDJB 4YK0A 2F6JA 5ENJA 2EA6A 5DYAA 1N72A 4CUTA 4A9FA 3PLWA 3TLPA 2M85A 5L8TA 4YATA 2D9EA 4IORA 3S91A 4XY9A 4FO9A 5CQTA 2KGGA 4P5OB 5EWDA 5FDZA 5G0FA 1LDKC 5I7XA 5E74A 5E7DA 5I7YA 2VPGA 5F25A 2MD7B 4OUFA 3IU5A 5COIA 2DKWA 1JOCA 2IQJA 5FH7A 2YHOA 1Z6UA 5CRZA 2KWOA 3FKMX 3G0JA 1MBMA 2C2LA 1WEMA 4GPJA 5FE1A 5FFVA 2LXHC 2F42A 5FG4A 3O33A 2R10A 1Z60A 3LJUX 4BW3A 4WZ0A 2Y43A 4HBXA 4TYLA 5FE2A 4UIYA 4FIPA 4HXLA 5D3HA 4O7FA 5HELA 4YBMA 2DVVA 4PS5A 5TB6A 1JM4B 4O72A 3FAOA 4O71A 5DX4A 2M1RA 5B75A 2PNXA 5SVXA 5SVYA 3D1BA 2KWNA 4O74A 2D82A 4TZ8A 4O78A 2LDRA 2VJFA 5I1QA 2D8UA 4QF2A 4NR4A 2I50A 3P1EA 2JMDA 3SVGA 2CRWA 4KV4A 1WUGA 2OXQC 5CQ3A 4BW4A 2RSDA 5KHMA 5BT3A 4NRBA 2YW5A 4YAXA 4WA6A 3GV4A 4A9MA 3ZYUA 4NYWA 4UIVA 5CZGA 4B7YC 4UYEA 4NS5A 4CUQA 5AD2A 1BORA 2L85A 4NYXA 2EXUA 5C11A 5LJ1A 4QSRA 2G45A 5FB0A 5LKZA 5A5PA 4OGJA 4UYDA 2RI7A 4QR4A 3EB5A 4LJNA 2CSVA 2MNYA 3PURA 4NR5A 5F62A 2NXBA 3SOUA 4CCGX 4XY8A 1G25A 1WUMA 4Z6HA 4Z0OA 3MULA 2MJVB 4WHWA 2ECJA 4CUUA 5I40A 4FLPA 2YU4A 5C85A 2XB1A 3O35A 5HEMA 4HBYA 1X4JA 4N4GA 5H1TA 3FL2A 5CQ4A 5CUBA 5J3XA 4O7AA 3VKHA 5I3LA 5C13A 4QUTA 5H1UA 1VFYA 3FEHA 3RCWA 3M99A 4LK9A 4WZ2A 5FEYA 2XOYA 3SOXA 2E3KA 5EICA 4TTEA 4CL9A 2YT5A 2YYNA 3HMFA 4QC3A 5DBMA 3P1CA 5E9YA 3GG3A 4C67A 5DKAA 5EPSA 5A5OA 2KGIA 2EJNA 4QSPA 4UIWA 5CGPA 4NUDA 2QIZA 5E3GA 5H9MA 3DAIA 4UYGA 2LGVA 4QYLA 3C6WA 2MT5A 3DPLR 5DYXA 5CUAA 2MNZA 3L1XA 3K2JA 4OGEA 5LKUA 4HXOA 3KDEC 5D3TA 2RNYA 5K29A 5EWHA 3RPGB 2CKLB 4UIUA 3ASLA 4OGCA 2KTBB 4YADA 5EVAA 1F68A 4UYFB 1WEWA 4J0SA 2KWJA 2OO1A 4H9DA 5HRVA 5EQ1A 5KH7A 1XWHA 4GNEA 3N9PA 2LGGA 2M13A 4IR4A 4A9LA 5LKXA 2YVRA 4S3OB 2LGLA 4KV1A 2EODA 3SHBA 1JSPB 2KIZA 4QUUA 2YYRA 4LYWA 4E96A 3HMEA 5CQ7A 5DYUA 3IU6A 4A49A 5D0CA 5DLXA 5AMEA 1RMDA 3ZTGA 1WEPA 1WFKA 3FANA 2YELA 5AIUA 3UVYA 2RNXA 3MDBC 4YBTA 1ZKRA 3Q2FA 3U5NA 1WILA 2DJAA 5AMFA 2YUCA 3MHSA 2FUUA 4QBMA 3ZVYA 4TZ2A 2L0BA 5CUCA 2JUNA 4PCIA 2EGMA 2YSJA 4QC1A 5D3SA 2K4DA 2L75A 2I7KA 5DINA 4BHWA 4CLBA 3DWDA 2YEMA 5FE9A 3L1ZB 4CFLA 4X3GA 4L7XA 4Z0RA 2ECNA 3LQIA 3KNVA 5ENIA 4W4UA 5EGUA 4UYFA 4XUBA 4CFKA 5C89A 2YURA 3IHPA 5EA1A 5EP7A 5A83A 2F6NA 5BT5A 5J0DA 3LQHA 5FG5A 5HRXA 2CKLA 2ECIA 3ZYQA 4LZSA 2DVRA 5LJ2A 3P5OA 3AADA 5A5NA 2I8NA 2K17A 4I7CA 4YH3A 5E9IA 3C5KA 5D1MB 4O64A 5D3PA 4NN2A 2E6RA 5ENHA 4AI6A 5DKDA 1N87A 4PTBA 4QR5A 5L97A 3O7AA 5LVQA 4TS8A 4GNFA 3MXFA 3ZVZB 3MUKA 2CRRA 2G43A 5E9KA 2QJ0A 4AYCB 5EU1A 2H0DB 3MB4A 4QZSA 5D25A 5DLZA 4IR6A 2AN6A 1WEOA 2B0OE 4NQMA 2WP1A 5KH9A 4O76A 3H7HA 5F3AA 5ENEA 3LJWA 4QYDA 1X4UA 3N9LA 5IGLA 4F1PA 1WEQA 5DFCA 5KTWA 2MIQA 1FP0A 2DVQA 4HXKA 2KR4A 5F1LA 1MM3A 2QICA 4HXPA 4MR5A 5FB1A 5D1LB 2FUIA 4QF3A 2YQDA 4BW2A 2KU3A 5CQ8A 5FBXA 3UW9A 5CRMA 2K16A 2IDAA 5TDRA 2N9GA 2KFTA 4O7EA 5EWWA 3LVQE 4MEQA 3ZPVE 5E9VA 5A81A 4QB3A 2RS9B 4QSWA 1WEVA 2VPBA 3HCTA 4IC3A 4QR3A 5I80A 5A5SA 2E6SA 4NUCA 5G05B 5ENGA 5HJCA 2FD4A 5IIDA 1VD4A 5AITA 5HM0A 3HCUA 2G4AA 5CQ5A 3UV5A 4MENA 4XUAA 4Z6IA 1WGMA 1WESA 4O70A 4YBSA 4LRGA 5H1VA 2VNFA 2ECGA 5CPEA 4TU6A 5EM3A 4YYKA 2LGKA 5IGMA 3KV6A 5D3JA 5ENFA 2KE1A 3SUBA 4MSXA 4UP5A 5F36A 4YY4A 4Z93A 4NR7A 3Q1DA 3I2DA 5TRBA 2MA6A 3EB6A 4O77A 5DW2A 4QSQA 4GB0A 1EQFA 3JVKA 4DONA 2DATA 4NR9A 4YYJA 2BAYA 3VKGA 5I83A 5F2PA 5E73A 3NG2A 4O7BA 5A5QA 5G4SA 4YY6A 2Y1NA 5A85A 5F60A 3SOWA 3HMHA 4IOOA 2PUYA 4UI9B 5D26A 3JVJA 2MKEA 4IR5A 3D1DA 2XP0A 3HCSA 3MQMA 2ECWA 1E6IA 2CT2A 5CUDA 5ACYA 1DCQA 2E7OA 5KTXA 2XEUA 4UYHA 4AKHA 2ECVA 2RR4A 2D8SA 4A4CA 5FERA 3PHDA 3U5JA 5D3LA
chains in the Genus database with same CATH topology
4YYNA 4R8PK 3N9QA 5F1HA 4ALGA 2YSMA 2R0SA 4OGIA 2HDPA 5EPBA 4HBWA 5HENA 4V3LC 5A7CA 4PKLA 4A0CD 4YYIA 3LQJA 2EGPA 2RFJA 1JM7B 1Z2QA 5FE0A 4LLBA 4A9EA 1FBVA 4O7CA 4V3KC 1ZS5A 5LUUA 3U5PA 2MA5A 3UVDA 4C66A 5FE7A 4NRCA 2Y1MA 3MHHA 5FE5A 5FG6A 5LKTA 2JMJA 4AUQB 4LYIA 4FJCA 5TBNA 2RO1A 5D3NA 5HQ5A 3HTKC 2VP7A 4MVTA 3VK6A 4Y03A 1MM2A 5E3DA 5FH8A 4YABA 4HXMA 5E9MA 5D1KB 4Q0OA 3T6RA 4HXSA 5DKCA 5TDWA 4HBVA 1K2FA 5EV9A 3P1DA 4N4IA 3O70A 5IGNA 1WENA 4XI1A 1HYIA 5I89A 5IG6A 5I86A 3AQAA 1X0JA 3MB3A 5JWMA 1WIMA 4MR3A 1CHCA 4X2IA 5ENBA 3ZPV1 4QNSA 5LCWB 4MEPA 4RVRA 5FE8A 2M3HA 3S92A 3I3JA 2LXPC 2M6MA 4I7BA 4L58A 3Q2EA 4N3WA 2JMIA 4TKPB 4A9NA 2CSYA 3QZVA 2LN0A 4IOQA 5D7XA 4F3IA 3L11A 2H60A 4NR6A 4QY4A 1V87A 1IYMA 2DX8A 3M63A 4ZDTA 5JG6A 5HQ6A 3KV5A 4GNDA 5CFWA 2YW8A 2DWWA 4BBQA 3JVMA 2L5EA 3UV2A 4ALHA 1HYJA 5DFBA 3KQIA 4A9JA 2VPEA 5B78A 4YYDA 5EYAF 1F62A 5FE4A 4QEWA 4A9HA 5IBNA 4NYVA 2CSZA 5EWCA 2L84A 4WHUA 5CP5A 5CUEA 4PPEA 5JI8A 5F63A 4CURA 3G0LA 5I29A 4O75A 5LVRA 5E9LA 1WEEA 5DY7A 3JVLA 2LSPB 3U5MA 3O37A 4A9KA 2L80A 2VJEB 5CQAA 2OUOA 3D7CA 3U5LA 4LZRA 4NXJA 5G4RA 4A9OA 3UVXA 4AKNA 5F61A 4KCXA 5CS8A 2JRJA 5HFQA 5HFRA 3RPGC 5HLSA 4R7EA 5II2A 2E7NA 5IGKA 4HXRA 4XYAA 5LJ0A 5CU8A 2UZGA 4TT6A 2YEKA 5EK9A 5DKHA 4TU4A 5D24A 1WE9A 3LXJA 4PY6A 4Q6FA 5BT4A 5E0RA 4YH4A 5C4QA 3SVFA 4J3IA 5FH6A 5G04B 5B8DA 2C2VS 4ZUXU 3QZSA 3RTRB 4UIZA 4I7DA 2H0DA 1DVPA 4YYHA 4MEOA 1VYXA 3LRQA 4YYMA 4B86C 2RNWA 3DWYA 4GNGA 1JM7A 5B79A 3N9NA 4NRAA 2ZETC 4UITA 2VJFB 2YQLA 3PUQA 1E4UA 2VJEA 4ZC9A 5L99A 5FFYA 4R2YA 5KO4A 3QZTA 4MR4A 4A9IA 5D3RA 3NXBA 4YC9A 5HRWA 2WP2A 4CA1A 5CQ6A 4LR6A 4ZQLA 3DQVR 3O34A 2YDWA 5FE3A 2LRIC 3N9OA 3U5OA 5I88A 4TQNA 2YHNA 5L98A 1T1HA 4WIVA 2KYUA 2VPDA 4N4FA 5AD3A 4LADB 2R0VA 4UIXA 5KU3A 4Z1SA 1X4IA 5DYCA 5ENCA 2R0YA 5L8UA 3GL6A 3V43A 2FSAA 5F5ZA 5EWVA 4QSTA 1U6GB 2KWKA 5CUGA 5A5RA 2G6QA 2L43A 4J1PA 5II1A 5HCLA 4FK5A 2GRCA 4F52B 4AYCA 5EISA 4CUPA 4C9ZA 4BW1A 3UVWA 5C87A 4LKAA 5H85A 3O36A 1ZBDB 2HYED 4NQNA 5L96A 2L5UA 5CY9A 4UP0A 2MD8C 5B76A 5TCMA 3UV4A 4QSXA 5ETBA 5KTUA 5EPRA 2YREA 4TT4A 5DW1A 2K1JA 4J0RA 4LDFA 4N4HA 4Q0NA 4Z1QA 2YQMA 4A4BA 3T7LA 4IR3A 1WEUA 4MR6A 5DFDA 4AVXA 4NUEA 2KREA 4PCEA 4IC2A 5FE6A 4QEVA 5B77A 2MUMA 4LZ2A 5ETDA 4NR8A 2ECTA 5TABA 4BJXA 2LQ6A 3P1FA 5EI4A 5A82A 4ZW1A 3ONIA 5CTLA 4QSUA 2DVSA 5FFWA 2OSSA 4TT2A 4YYGA 4QEUA 5C7NA 4S3OC 4HXNA 5C8GA 4AP4A 5KH3A 2NAAA 4QSVA 2LV9A 3U5KA 4QSSA 4CUSA 3SVHA 3ZNIA 4LYSA 4WZ3B 4LC2A 5HQ7A 3N9MA 1LDJB 4YK0A 2F6JA 5ENJA 2EA6A 5DYAA 1N72A 4CUTA 4A9FA 3TLPA 2M85A 5L8TA 4YATA 2D9EA 4IORA 3S91A 4XY9A 4FO9A 5CQTA 2KGGA 4P5OB 5EWDA 5FDZA 5G0FA 1LDKC 5I7XA 5E74A 5E7DA 5I7YA 2VPGA 5F25A 2MD7B 4OUFA 3IU5A 5COIA 2DKWA 1JOCA 5FH7A 2YHOA 1Z6UA 5CRZA 2KWOA 3FKMX 3G0JA 2C2LA 2LXHC 1WEMA 4GPJA 5FE1A 5FFVA 3M62A 2F42A 5FG4A 3O33A 2R10A 1Z60A 4WZ0A 4BW3A 2Y43A 4HBXA 4TYLA 5FE2A 4UIYA 4FIPA 4HXLA 5D3HA 4O7FA 5HELA 4YBMA 2DVVA 4PS5A 5TB6A 1JM4B 4O72A 4O71A 5DX4A 2M1RA 5B75A 2PNXA 2KWNA 4O74A 2D82A 4TZ8A 4O78A 2LDRA 2VJFA 5I1QA 4QF2A 4NR4A 2I50A 3P1EA 2JMDA 3SVGA 4KV4A 1WUGA 2OXQC 5CQ3A 4BW4A 2RSDA 5KHMA 5BT3A 4NRBA 2YW5A 4YAXA 4WA6A 3GV4A 4A9MA 3ZYUA 4NYWA 4UIVA 5CZGA 4B7YC 4UYEA 4NS5A 4CUQA 5AD2A 1BORA 2L85A 4NYXA 5C11A 5LJ1A 4QSRA 2G45A 5FB0A 5LKZA 5A5PA 4OGJA 4UYDA 2RI7A 4QR4A 3EB5A 4LJNA 2MNYA 3PURA 4NR5A 5F62A 2NXBA 3SOUA 4CCGX 4XY8A 1G25A 1WUMA 4Z6HA 3MULA 2MJVB 4WHWA 2ECJA 4CUUA 5I40A 4FLPA 2YU4A 5C85A 2XB1A 3O35A 5HEMA 4HBYA 1X4JA 4N4GA 5H1TA 3FL2A 5CQ4A 5CUBA 5J3XA 4O7AA 5I3LA 5C13A 4QUTA 5H1UA 1VFYA 4LK9A 3RCWA 3M99A 4WZ2A 5FEYA 3SOXA 2E3KA 5EICA 4TTEA 4CL9A 2YT5A 2YYNA 3HMFA 4QC3A 5DBMA 3P1CA 5E9YA 3GG3A 4C67A 5DKAA 5EPSA 5A5OA 2KGIA 4QSPA 4UIWA 5CGPA 4NUDA 2QIZA 5E3GA 5H9MA 3DAIA 4UYGA 2LGVA 4QYLA 3C6WA 2MT5A 3DPLR 5DYXA 5CUAA 2MNZA 3L1XA 3K2JA 5LKUA 4HXOA 5D3TA 2RNYA 5K29A 5EWHA 3RPGB 2CKLB 4UIUA 3ASLA 2KTBB 4YADA 5EVAA 1F68A 4UYFB 1WEWA 4J0SA 2KWJA 2OO1A 5HRVA 5EQ1A 5KH7A 1XWHA 4GNEA 3N9PA 2LGGA 4IR4A 4A9LA 5LKXA 4S3OB 3SHBA 2LGLA 4KV1A 2EODA 1JSPB 2KIZA 4QUUA 2YYRA 4LYWA 4E96A 3HMEA 5CQ7A 5DYUA 3IU6A 4A49A 5D0CA 5DLXA 5AMEA 1RMDA 3ZTGA 1WEPA 1WFKA 2YELA 5AIUA 3UVYA 2RNXA 4YBTA 3Q2FA 3U5NA 1WILA 2YUCA 5AMFA 3MHSA 2FUUA 4QBMA 3ZVYA 4TZ2A 2L0BA 5CUCA 4PCIA 2YSJA 4QC1A 5D3SA 2K4DA 2L75A 2I7KA 5DINA 4BHWA 4CLBA 2YEMA 5FE9A 3L1ZB 4CFLA 4X3GA 4L7XA 2ECNA 3LQIA 3KNVA 5ENIA 4W4UA 5EGUA 4UYFA 4XUBA 4CFKA 5C89A 2YURA 3IHPA 5EA1A 5EP7A 5A83A 2F6NA 5BT5A 5J0DA 3LQHA 5FG5A 5HRXA 2CKLA 2ECIA 3ZYQA 4LZSA 2DVRA 5LJ2A 3P5OA 3AADA 5A5NA 2I8NA 2K17A 4I7CA 4YH3A 5E9IA 3C5KA 5D1MB 4O64A 5D3PA 4NN2A 2E6RA 5ENHA 5DKDA 1N87A 4PTBA 4QR5A 5L97A 3O7AA 5LVQA 4TS8A 4GNFA 3MXFA 3ZVZB 3MUKA 2G43A 4AYCB 5E9KA 2QJ0A 5EU1A 2H0DB 3MB4A 4QZSA 5D25A 5DLZA 4IR6A 2AN6A 1WEOA 4NQMA 2WP1A 5KH9A 4O76A 5F3AA 5ENEA 3LJWA 4QYDA 1X4UA 3N9LA 5IGLA 1WEQA 5DFCA 5KTWA 2MIQA 1FP0A 2DVQA 4HXKA 2KR4A 5F1LA 1MM3A 2QICA 4HXPA 4MR5A 5FB1A 5D1LB 2FUIA 4QF3A 2YQDA 4BW2A 2KU3A 5CQ8A 5FBXA 3UW9A 5CRMA 2K16A 2IDAA 5TDRA 2N9GA 2KFTA 4O7EA 5EWWA 3ZPVE 4MEQA 5E9VA 5A81A 4QB3A 2RS9B 4QSWA 1WEVA 2VPBA 3HCTA 4IC3A 4QR3A 5I80A 5A5SA 2E6SA 4NUCA 5G05B 5ENGA 5HJCA 5IIDA 1VD4A 5AITA 5HM0A 3HCUA 2G4AA 5CQ5A 3UV5A 4MENA 4XUAA 4Z6IA 1WGMA 1WESA 4O70A 4YBSA 4LRGA 5H1VA 2VNFA 2ECGA 5CPEA 4TU6A 5EM3A 4YYKA 2LGKA 5IGMA 3KV6A 5D3JA 5ENFA 2KE1A 4MSXA 4UP5A 5F36A 4YY4A 4Z93A 4NR7A 3I2DA 5TRBA 2MA6A 3EB6A 4O77A 5DW2A 4QSQA 4GB0A 1EQFA 3JVKA 4DONA 2DATA 4NR9A 4YYJA 2BAYA 5I83A 5F2PA 5E73A 3NG2A 4O7BA 5A5QA 5G4SA 4YY6A 2Y1NA 5A85A 5F60A 3SOWA 3HMHA 4IOOA 2PUYA 4UI9B 5D26A 3JVJA 4IR5A 3HCSA 3MQMA 2ECWA 1E6IA 2CT2A 5CUDA 5ACYA 2E7OA 5KTXA 2XEUA 4UYHA 2ECVA 4A4CA 5FERA 2D8SA 3PHDA 3U5JA 5D3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYN A;  4R8P K;  3N9Q A;  5F1H A;  4ALG A;  2YSM A;  2R0S A;  4OGI A;  2HDP A;  5EPB A;  4HBW A;  5HEN A;  4V3L C;  5A7C A;  4PKL A;  4A0C D;  4YYI A;  3LQJ A;  2EGP A;  2RFJ A;  1JM7 B;  1Z2Q A;  5FE0 A;  4LLB A;  4A9E A;  1FBV A;  4O7C A;  4V3K C;  1ZS5 A;  5LUU A;  3U5P A;  2MA5 A;  3UVD A;  4C66 A;  5FE7 A;  4NRC A;  2Y1M A;  3MHH A;  5FE5 A;  5FG6 A;  5LKT A;  2JMJ A;  4AUQ B;  4LYI A;  4FJC A;  5TBN A;  2RO1 A;  5D3N A;  5HQ5 A;  3HTK C;  2VP7 A;  4MVT A;  3VK6 A;  4Y03 A;  1MM2 A;  5E3D A;  5FH8 A;  4YAB A;  4HXM A;  5E9M A;  5D1K B;  4Q0O A;  3T6R A;  4HXS A;  5DKC A;  5TDW A;  4HBV A;  1K2F A;  5EV9 A;  3P1D A;  4N4I A;  3O70 A;  5IGN A;  1WEN A;  4XI1 A;  1HYI A;  5I89 A;  5IG6 A;  5I86 A;  3AQA A;  1X0J A;  3MB3 A;  5JWM A;  1WIM A;  4MR3 A;  1CHC A;  4X2I A;  5ENB A;  3ZPV 1;  4QNS A;  5LCW B;  4MEP A;  4RVR A;  5FE8 A;  2M3H A;  3S92 A;  3I3J A;  2LXP C;  2M6M A;  4I7B A;  4L58 A;  3Q2E A;  4N3W A;  2JMI A;  4TKP B;  4A9N A;  2CSY A;  3QZV A;  2LN0 A;  4IOQ A;  5D7X A;  4F3I A;  3L11 A;  2H60 A;  4NR6 A;  4QY4 A;  1V87 A;  1IYM A;  2DX8 A;  3M63 A;  4ZDT A;  5JG6 A;  5HQ6 A;  3KV5 A;  4GND A;  5CFW A;  2YW8 A;  2DWW A;  4BBQ A;  3JVM A;  2L5E A;  3UV2 A;  4ALH A;  1HYJ A;  5DFB A;  3KQI A;  4A9J A;  2VPE A;  5B78 A;  4YYD A;  5EYA F;  1F62 A;  5FE4 A;  4QEW A;  4A9H A;  5IBN A;  4NYV A;  2CSZ A;  5EWC A;  2L84 A;  4WHU A;  5CP5 A;  5CUE A;  4PPE A;  5JI8 A;  5F63 A;  4CUR A;  3G0L A;  5I29 A;  4O75 A;  5LVR A;  5E9L A;  1WEE A;  5DY7 A;  3JVL A;  2LSP B;  3U5M A;  3O37 A;  4A9K A;  2L80 A;  2VJE B;  5CQA A;  2OUO A;  3D7C A;  3U5L A;  4LZR A;  4NXJ A;  5G4R A;  4A9O A;  3UVX A;  4AKN A;  5F61 A;  4KCX A;  5CS8 A;  2JRJ A;  5HFQ A;  5HFR A;  3RPG C;  5HLS A;  4R7E A;  5II2 A;  2E7N A;  5IGK A;  4HXR A;  4XYA A;  5LJ0 A;  5CU8 A;  2UZG A;  4TT6 A;  2YEK A;  5EK9 A;  5DKH A;  4TU4 A;  5D24 A;  1WE9 A;  3LXJ A;  4PY6 A;  4Q6F A;  5BT4 A;  5E0R A;  4YH4 A;  5C4Q A;  3SVF A;  4J3I A;  5FH6 A;  5G04 B;  5B8D A;  2C2V S;  4ZUX U;  3QZS A;  3RTR B;  4UIZ A;  4I7D A;  2H0D A;  1DVP A;  4YYH A;  4MEO A;  1VYX A;  3LRQ A;  4YYM A;  4B86 C;  2RNW A;  3DWY A;  4GNG A;  1JM7 A;  5B79 A;  3N9N A;  4NRA A;  2ZET C;  4UIT A;  2VJF B;  2YQL A;  3PUQ A;  1E4U A;  2VJE A;  4ZC9 A;  5L99 A;  5FFY A;  4R2Y A;  5KO4 A;  3QZT A;  4MR4 A;  4A9I A;  5D3R A;  3NXB A;  4YC9 A;  5HRW A;  2WP2 A;  4CA1 A;  5CQ6 A;  4LR6 A;  4ZQL A;  3DQV R;  3O34 A;  2YDW A;  5FE3 A;  2LRI C;  3N9O A;  3U5O A;  5I88 A;  4TQN A;  2YHN A;  5L98 A;  1T1H A;  4WIV A;  2KYU A;  2VPD A;  4N4F A;  5AD3 A;  4LAD B;  2R0V A;  4UIX A;  5KU3 A;  4Z1S A;  1X4I A;  5DYC A;  5ENC A;  2R0Y A;  5L8U A;  3GL6 A;  3V43 A;  2FSA A;  5F5Z A;  5EWV A;  4QST A;  1U6G B;  2KWK A;  5CUG A;  5A5R A;  2G6Q A;  2L43 A;  4J1P A;  5II1 A;  5HCL A;  4FK5 A;  2GRC A;  4F52 B;  4AYC A;  5EIS A;  4CUP A;  4C9Z A;  4BW1 A;  3UVW A;  5C87 A;  4LKA A;  5H85 A;  3O36 A;  1ZBD B;  2HYE D;  4NQN A;  5L96 A;  2L5U A;  5CY9 A;  4UP0 A;  2MD8 C;  5B76 A;  5TCM A;  3UV4 A;  4QSX A;  5ETB A;  5KTU A;  5EPR A;  2YRE A;  4TT4 A;  5DW1 A;  2K1J A;  4J0R A;  4LDF A;  4N4H A;  4Q0N A;  4Z1Q A;  2YQM A;  4A4B A;  3T7L A;  4IR3 A;  1WEU A;  4MR6 A;  5DFD A;  4AVX A;  4NUE A;  2KRE A;  4PCE A;  4IC2 A;  5FE6 A;  4QEV A;  5B77 A;  2MUM A;  4LZ2 A;  5ETD A;  4NR8 A;  2ECT A;  5TAB A;  4BJX A;  2LQ6 A;  3P1F A;  5EI4 A;  5A82 A;  4ZW1 A;  3ONI A;  5CTL A;  4QSU A;  2DVS A;  5FFW A;  2OSS A;  4TT2 A;  4YYG A;  4QEU A;  5C7N A;  4S3O C;  4HXN A;  5C8G A;  4AP4 A;  5KH3 A;  2NAA A;  4QSV A;  2LV9 A;  3U5K A;  4QSS A;  4CUS A;  3SVH A;  3ZNI A;  4LYS A;  4WZ3 B;  4LC2 A;  5HQ7 A;  3N9M A;  1LDJ B;  4YK0 A;  2F6J A;  5ENJ A;  2EA6 A;  5DYA A;  1N72 A;  4CUT A;  4A9F A;  3TLP A;  2M85 A;  5L8T A;  4YAT A;  2D9E A;  4IOR A;  3S91 A;  4XY9 A;  4FO9 A;  5CQT A;  2KGG A;  4P5O B;  5EWD A;  5FDZ A;  5G0F A;  1LDK C;  5I7X A;  5E74 A;  5E7D A;  5I7Y A;  2VPG A;  5F25 A;  2MD7 B;  4OUF A;  3IU5 A;  5COI A;  2DKW A;  1JOC A;  5FH7 A;  2YHO A;  1Z6U A;  5CRZ A;  2KWO A;  3FKM X;  3G0J A;  2C2L A;  2LXH C;  1WEM A;  4GPJ A;  5FE1 A;  5FFV A;  3M62 A;  2F42 A;  5FG4 A;  3O33 A;  2R10 A;  1Z60 A;  4WZ0 A;  4BW3 A;  2Y43 A;  4HBX A;  4TYL A;  5FE2 A;  4UIY A;  4FIP A;  4HXL A;  5D3H A;  4O7F A;  5HEL A;  4YBM A;  2DVV A;  4PS5 A;  5TB6 A;  1JM4 B;  4O72 A;  4O71 A;  5DX4 A;  2M1R A;  5B75 A;  2PNX A;  2KWN A;  4O74 A;  2D82 A;  4TZ8 A;  4O78 A;  2LDR A;  2VJF A;  5I1Q A;  4QF2 A;  4NR4 A;  2I50 A;  3P1E A;  2JMD A;  3SVG A;  4KV4 A;  1WUG A;  2OXQ C;  5CQ3 A;  4BW4 A;  2RSD A;  5KHM A;  5BT3 A;  4NRB A;  2YW5 A;  4YAX A;  4WA6 A;  3GV4 A;  4A9M A;  3ZYU A;  4NYW A;  4UIV A;  5CZG A;  4B7Y C;  4UYE A;  4NS5 A;  4CUQ A;  5AD2 A;  1BOR A;  2L85 A;  4NYX A;  5C11 A;  5LJ1 A;  4QSR A;  2G45 A;  5FB0 A;  5LKZ A;  5A5P A;  4OGJ A;  4UYD A;  2RI7 A;  4QR4 A;  3EB5 A;  4LJN A;  2MNY A;  3PUR A;  4NR5 A;  5F62 A;  2NXB A;  3SOU A;  4CCG X;  4XY8 A;  1G25 A;  1WUM A;  4Z6H A;  3MUL A;  2MJV B;  4WHW A;  2ECJ A;  4CUU A;  5I40 A;  4FLP A;  2YU4 A;  5C85 A;  2XB1 A;  3O35 A;  5HEM A;  4HBY A;  1X4J A;  4N4G A;  5H1T A;  3FL2 A;  5CQ4 A;  5CUB A;  5J3X A;  4O7A A;  5I3L A;  5C13 A;  4QUT A;  5H1U A;  1VFY A;  4LK9 A;  3RCW A;  3M99 A;  4WZ2 A;  5FEY A;  3SOX A;  2E3K A;  5EIC A;  4TTE A;  4CL9 A;  2YT5 A;  2YYN A;  3HMF A;  4QC3 A;  5DBM A;  3P1C A;  5E9Y A;  3GG3 A;  4C67 A;  5DKA A;  5EPS A;  5A5O A;  2KGI A;  4QSP A;  4UIW A;  5CGP A;  4NUD A;  2QIZ A;  5E3G A;  5H9M A;  3DAI A;  4UYG A;  2LGV A;  4QYL A;  3C6W A;  2MT5 A;  3DPL R;  5DYX A;  5CUA A;  2MNZ A;  3L1X A;  3K2J A;  5LKU A;  4HXO A;  5D3T A;  2RNY A;  5K29 A;  5EWH A;  3RPG B;  2CKL B;  4UIU A;  3ASL A;  2KTB B;  4YAD A;  5EVA A;  1F68 A;  4UYF B;  1WEW A;  4J0S A;  2KWJ A;  2OO1 A;  5HRV A;  5EQ1 A;  5KH7 A;  1XWH A;  4GNE A;  3N9P A;  2LGG A;  4IR4 A;  4A9L A;  5LKX A;  4S3O B;  3SHB A;  2LGL A;  4KV1 A;  2EOD A;  1JSP B;  2KIZ A;  4QUU A;  2YYR A;  4LYW A;  4E96 A;  3HME A;  5CQ7 A;  5DYU A;  3IU6 A;  4A49 A;  5D0C A;  5DLX A;  5AME A;  1RMD A;  3ZTG A;  1WEP A;  1WFK A;  2YEL A;  5AIU A;  3UVY A;  2RNX A;  4YBT A;  3Q2F A;  3U5N A;  1WIL A;  2YUC A;  5AMF A;  3MHS A;  2FUU A;  4QBM A;  3ZVY A;  4TZ2 A;  2L0B A;  5CUC A;  4PCI A;  2YSJ A;  4QC1 A;  5D3S A;  2K4D A;  2L75 A;  2I7K A;  5DIN A;  4BHW A;  4CLB A;  2YEM A;  5FE9 A;  3L1Z B;  4CFL A;  4X3G A;  4L7X A;  2ECN A;  3LQI A;  3KNV A;  5ENI A;  4W4U A;  5EGU A;  4UYF A;  4XUB A;  4CFK A;  5C89 A;  2YUR A;  3IHP A;  5EA1 A;  5EP7 A;  5A83 A;  2F6N A;  5BT5 A;  5J0D A;  3LQH A;  5FG5 A;  5HRX A;  2CKL A;  2ECI A;  3ZYQ A;  4LZS A;  2DVR A;  5LJ2 A;  3P5O A;  3AAD A;  5A5N A;  2I8N A;  2K17 A;  4I7C A;  4YH3 A;  5E9I A;  3C5K A;  5D1M B;  4O64 A;  5D3P A;  4NN2 A;  2E6R A;  5ENH A;  5DKD A;  1N87 A;  4PTB A;  4QR5 A;  5L97 A;  3O7A A;  5LVQ A;  4TS8 A;  4GNF A;  3MXF A;  3ZVZ B;  3MUK A;  2G43 A;  4AYC B;  5E9K A;  2QJ0 A;  5EU1 A;  2H0D B;  3MB4 A;  4QZS A;  5D25 A;  5DLZ A;  4IR6 A;  2AN6 A;  1WEO A;  4NQM A;  2WP1 A;  5KH9 A;  4O76 A;  5F3A A;  5ENE A;  3LJW A;  4QYD A;  1X4U A;  3N9L A;  5IGL A;  1WEQ A;  5DFC A;  5KTW A;  2MIQ A;  1FP0 A;  2DVQ A;  4HXK A;  2KR4 A;  5F1L A;  1MM3 A;  2QIC A;  4HXP A;  4MR5 A;  5FB1 A;  5D1L B;  2FUI A;  4QF3 A;  2YQD A;  4BW2 A;  2KU3 A;  5CQ8 A;  5FBX A;  3UW9 A;  5CRM A;  2K16 A;  2IDA A;  5TDR A;  2N9G A;  2KFT A;  4O7E A;  5EWW A;  3ZPV E;  4MEQ A;  5E9V A;  5A81 A;  4QB3 A;  2RS9 B;  4QSW A;  1WEV A;  2VPB A;  3HCT A;  4IC3 A;  4QR3 A;  5I80 A;  5A5S A;  2E6S A;  4NUC A;  5G05 B;  5ENG A;  5HJC A;  5IID A;  1VD4 A;  5AIT A;  5HM0 A;  3HCU A;  2G4A A;  5CQ5 A;  3UV5 A;  4MEN A;  4XUA A;  4Z6I A;  1WGM A;  1WES A;  4O70 A;  4YBS A;  4LRG A;  5H1V A;  2VNF A;  2ECG A;  5CPE A;  4TU6 A;  5EM3 A;  4YYK A;  2LGK A;  5IGM A;  3KV6 A;  5D3J A;  5ENF A;  2KE1 A;  4MSX A;  4UP5 A;  5F36 A;  4YY4 A;  4Z93 A;  4NR7 A;  3I2D A;  5TRB A;  2MA6 A;  3EB6 A;  4O77 A;  5DW2 A;  4QSQ A;  4GB0 A;  1EQF A;  3JVK A;  4DON A;  2DAT A;  4NR9 A;  4YYJ A;  2BAY A;  5I83 A;  5F2P A;  5E73 A;  3NG2 A;  4O7B A;  5A5Q A;  5G4S A;  4YY6 A;  2Y1N A;  5A85 A;  5F60 A;  3SOW A;  3HMH A;  4IOO A;  2PUY A;  4UI9 B;  5D26 A;  3JVJ A;  4IR5 A;  3HCS A;  3MQM A;  2ECW A;  1E6I A;  2CT2 A;  5CUD A;  5ACY A;  2E7O A;  5KTX A;  2XEU A;  4UYH A;  2ECV A;  4A4C A;  5FER A;  2D8S A;  3PHD A;  3U5J A;  5D3L A; 
#chains in the Genus database with same CATH topology
 4YYN A;  4R8P K;  3N9Q A;  5F1H A;  4ALG A;  2YSM A;  2R0S A;  4OGI A;  2HDP A;  5EPB A;  4HBW A;  5HEN A;  3O47 A;  4V3L C;  5A7C A;  4PKL A;  4A0C D;  4YYI A;  3LQJ A;  2EGP A;  2RFJ A;  1JM7 B;  1Z2Q A;  4AKI A;  3JUE A;  5FE0 A;  4LLB A;  4A9E A;  1FBV A;  4O7C A;  2FFW A;  3LVR E;  4V3K C;  1ZS5 A;  5LUU A;  3U5P A;  2MA5 A;  3UVD A;  4C66 A;  5FE7 A;  4NRC A;  2Y1M A;  3MHH A;  5FE5 A;  5FG6 A;  5LKT A;  2JMJ A;  4AUQ B;  4LYI A;  4FJC A;  5TBN A;  2RO1 A;  5SVI A;  5D3N A;  5HQ5 A;  3T9K A;  3HTK C;  2VP7 A;  4MVT A;  3VK6 A;  4Y03 A;  1MM2 A;  5E3D A;  5FH8 A;  4YAB A;  4HXM A;  5E9M A;  3E2D A;  5D1K B;  4Q0O A;  3T6R A;  4HXS A;  5DKC A;  5TDW A;  4HBV A;  1K2F A;  5EV9 A;  3P1D A;  4N4I A;  3O70 A;  5IGN A;  1WEN A;  4XI1 A;  1HYI A;  5I89 A;  5IG6 A;  5I86 A;  3AQA A;  1X0J A;  3MB3 A;  5JWM A;  3M7K A;  1WIM A;  4MR3 A;  1CHC A;  4X2I A;  5ENB A;  3ZPV 1;  4QNS A;  2KKY A;  5LCW B;  4MEP A;  4RVR A;  5FE8 A;  2M3H A;  3S92 A;  3I3J A;  2LXP C;  2M6M A;  4I7B A;  4L58 A;  3Q2E A;  4N3W A;  2JMI A;  4TKP B;  4A9N A;  2CSY A;  3QZV A;  2LN0 A;  4QQ4 A;  4IOQ A;  5D7X A;  4F3I A;  3L11 A;  2H60 A;  4NR6 A;  4QY4 A;  1V87 A;  1IYM A;  2DX8 A;  3M63 A;  4O62 A;  4ZDT A;  5JG6 A;  5HQ6 A;  3KV5 A;  4GND A;  5CFW A;  2YW8 A;  2DWW A;  4BBQ A;  3JVM A;  2JM3 A;  2L5E A;  3UV2 A;  4ALH A;  1HYJ A;  5DFB A;  3KQI A;  4A9J A;  2VPE A;  5B78 A;  4YYD A;  5EYA F;  1F62 A;  5FE4 A;  4QEW A;  4A9H A;  5IBN A;  5SVI B;  4NYV A;  2CSZ A;  5EWC A;  2L84 A;  4WHU A;  5CP5 A;  5CUE A;  4PPE A;  5JI8 A;  5F63 A;  4CUR A;  3G0L A;  5I29 A;  4O75 A;  5LVR A;  5E9L A;  1WEE A;  5DY7 A;  2DSM A;  3JVL A;  2LSP B;  3U5M A;  3DDT A;  3O37 A;  4A9K A;  2L80 A;  2VJE B;  5CQA A;  2L7P A;  2OUO A;  3D7C A;  3U5L A;  4LZR A;  4NXJ A;  5G4R A;  3M62 A;  4A9O A;  3LDY A;  3UVX A;  4AKN A;  5F61 A;  4KCX A;  5CS8 A;  2JRJ A;  5HFQ A;  5HFR A;  3RPG C;  5HLS A;  4R7E A;  5II2 A;  2E7N A;  5IGK A;  4HXR A;  4XYA A;  5LJ0 A;  5CU8 A;  2KKX A;  2UZG A;  4TT6 A;  2YEK A;  5EK9 A;  5DKH A;  4TU4 A;  5D24 A;  1WE9 A;  3LXJ A;  4PY6 A;  4Q6F A;  5BT4 A;  5E0R A;  4YH4 A;  5C4Q A;  3SVF A;  4J3I A;  5FH6 A;  2P57 A;  5G04 B;  5B8D A;  2C2V S;  4ZUX U;  3QZS A;  3RTR B;  4UIZ A;  4I7D A;  2H0D A;  1DVP A;  4YYH A;  4MEO A;  1VYX A;  3LRQ A;  4YYM A;  4B86 C;  2RNW A;  3DWY A;  4GNG A;  1JM7 A;  5B79 A;  3N9N A;  4NRA A;  2ZET C;  4UIT A;  4AKG A;  2VJF B;  2YQL A;  3PUQ A;  1E4U A;  2OWA A;  2VJE A;  5K3Q A;  4ZC9 A;  5L99 A;  5FFY A;  4R2Y A;  5KO4 A;  3QZT A;  4MR4 A;  4A9I A;  5D3R A;  3NXB A;  4YC9 A;  5HRW A;  2WP2 A;  4CA1 A;  5CQ6 A;  4LR6 A;  4ZQL A;  3DQV R;  3O34 A;  2YDW A;  5FE3 A;  2LRI C;  3N9O A;  3U5O A;  5I88 A;  4TQN A;  2YHN A;  5L98 A;  1T1H A;  4WIV A;  3ERR A;  2KYU A;  2VPD A;  4N4F A;  5AD3 A;  4LAD B;  1PUO A;  2XOZ A;  2R0V A;  4UIX A;  5KU3 A;  4Z1S A;  1X4I A;  5DYC A;  5ENC A;  2R0Y A;  5L8U A;  3GL6 A;  3V43 A;  2FSA A;  5F5Z A;  5EWV A;  4QST A;  1U6G B;  2KWK A;  5CUG A;  5A5R A;  2G6Q A;  2L43 A;  4J1P A;  5II1 A;  5HCL A;  4FK5 A;  2GRC A;  4F52 B;  4AYC A;  5EIS A;  4CUP A;  4C9Z A;  4BW1 A;  3UVW A;  5C87 A;  4LKA A;  5H85 A;  3O36 A;  1ZBD B;  2HYE D;  4NQN A;  5L96 A;  2L5U A;  5CY9 A;  4UP0 A;  2MD8 C;  5B76 A;  5TCM A;  3UV4 A;  4QSX A;  5ETB A;  5KTU A;  5EPR A;  2YRE A;  4TT4 A;  5DW1 A;  2K1J A;  4J0R A;  4LDF A;  4N4H A;  4Q0N A;  4Z1Q A;  2YQM A;  4A4B A;  3T7L A;  4IR3 A;  1WEU A;  4MR6 A;  5DFD A;  4AVX A;  4NUE A;  2KRE A;  4PCE A;  4IC2 A;  5FE6 A;  4QEV A;  5B77 A;  2MUM A;  2CON A;  4LZ2 A;  5ETD A;  4NR8 A;  2ECT A;  5TAB A;  4BJX A;  2LQ6 A;  3FJU B;  3P1F A;  5EI4 A;  5A82 A;  4ZW1 A;  3ONI A;  5CTL A;  4QSU A;  2DVS A;  5FFW A;  2OSS A;  4TT2 A;  4YYG A;  4QEU A;  5C7N A;  4S3O C;  4HXN A;  5C8G A;  4AP4 A;  5KH3 A;  2NAA A;  4QSV A;  2LV9 A;  3FM8 C;  3U5K A;  4QSS A;  4CUS A;  2XOC A;  3SVH A;  3ZNI A;  4LYS A;  4WZ3 B;  2LAU A;  4LC2 A;  5HQ7 A;  3N9M A;  2E61 A;  1LDJ B;  4YK0 A;  2F6J A;  5ENJ A;  2EA6 A;  5DYA A;  1N72 A;  4CUT A;  4A9F A;  3PLW A;  3TLP A;  2M85 A;  5L8T A;  4YAT A;  2D9E A;  4IOR A;  3S91 A;  4XY9 A;  4FO9 A;  5CQT A;  2KGG A;  4P5O B;  5EWD A;  5FDZ A;  5G0F A;  1LDK C;  5I7X A;  5E74 A;  5E7D A;  5I7Y A;  2VPG A;  5F25 A;  2MD7 B;  4OUF A;  3IU5 A;  5COI A;  2DKW A;  1JOC A;  2IQJ A;  5FH7 A;  2YHO A;  1Z6U A;  5CRZ A;  2KWO A;  3FKM X;  3G0J A;  1MBM A;  2C2L A;  1WEM A;  4GPJ A;  5FE1 A;  5FFV A;  2LXH C;  2F42 A;  5FG4 A;  3O33 A;  2R10 A;  1Z60 A;  3LJU X;  4BW3 A;  4WZ0 A;  2Y43 A;  4HBX A;  4TYL A;  5FE2 A;  4UIY A;  4FIP A;  4HXL A;  5D3H A;  4O7F A;  5HEL A;  4YBM A;  2DVV A;  4PS5 A;  5TB6 A;  1JM4 B;  4O72 A;  3FAO A;  4O71 A;  5DX4 A;  2M1R A;  5B75 A;  2PNX A;  5SVX A;  5SVY A;  3D1B A;  2KWN A;  4O74 A;  2D82 A;  4TZ8 A;  4O78 A;  2LDR A;  2VJF A;  5I1Q A;  2D8U A;  4QF2 A;  4NR4 A;  2I50 A;  3P1E A;  2JMD A;  3SVG A;  2CRW A;  4KV4 A;  1WUG A;  2OXQ C;  5CQ3 A;  4BW4 A;  2RSD A;  5KHM A;  5BT3 A;  4NRB A;  2YW5 A;  4YAX A;  4WA6 A;  3GV4 A;  4A9M A;  3ZYU A;  4NYW A;  4UIV A;  5CZG A;  4B7Y C;  4UYE A;  4NS5 A;  4CUQ A;  5AD2 A;  1BOR A;  2L85 A;  4NYX A;  2EXU A;  5C11 A;  5LJ1 A;  4QSR A;  2G45 A;  5FB0 A;  5LKZ A;  5A5P A;  4OGJ A;  4UYD A;  2RI7 A;  4QR4 A;  3EB5 A;  4LJN A;  2CSV A;  2MNY A;  3PUR A;  4NR5 A;  5F62 A;  2NXB A;  3SOU A;  4CCG X;  4XY8 A;  1G25 A;  1WUM A;  4Z6H A;  4Z0O A;  3MUL A;  2MJV B;  4WHW A;  2ECJ A;  4CUU A;  5I40 A;  4FLP A;  2YU4 A;  5C85 A;  2XB1 A;  3O35 A;  5HEM A;  4HBY A;  1X4J A;  4N4G A;  5H1T A;  3FL2 A;  5CQ4 A;  5CUB A;  5J3X A;  4O7A A;  3VKH A;  5I3L A;  5C13 A;  4QUT A;  5H1U A;  1VFY A;  3FEH A;  3RCW A;  3M99 A;  4LK9 A;  4WZ2 A;  5FEY A;  2XOY A;  3SOX A;  2E3K A;  5EIC A;  4TTE A;  4CL9 A;  2YT5 A;  2YYN A;  3HMF A;  4QC3 A;  5DBM A;  3P1C A;  5E9Y A;  3GG3 A;  4C67 A;  5DKA A;  5EPS A;  5A5O A;  2KGI A;  2EJN A;  4QSP A;  4UIW A;  5CGP A;  4NUD A;  2QIZ A;  5E3G A;  5H9M A;  3DAI A;  4UYG A;  2LGV A;  4QYL A;  3C6W A;  2MT5 A;  3DPL R;  5DYX A;  5CUA A;  2MNZ A;  3L1X A;  3K2J A;  4OGE A;  5LKU A;  4HXO A;  3KDE C;  5D3T A;  2RNY A;  5K29 A;  5EWH A;  3RPG B;  2CKL B;  4UIU A;  3ASL A;  4OGC A;  2KTB B;  4YAD A;  5EVA A;  1F68 A;  4UYF B;  1WEW A;  4J0S A;  2KWJ A;  2OO1 A;  4H9D A;  5HRV A;  5EQ1 A;  5KH7 A;  1XWH A;  4GNE A;  3N9P A;  2LGG A;  2M13 A;  4IR4 A;  4A9L A;  5LKX A;  2YVR A;  4S3O B;  2LGL A;  4KV1 A;  2EOD A;  3SHB A;  1JSP B;  2KIZ A;  4QUU A;  2YYR A;  4LYW A;  4E96 A;  3HME A;  5CQ7 A;  5DYU A;  3IU6 A;  4A49 A;  5D0C A;  5DLX A;  5AME A;  1RMD A;  3ZTG A;  1WEP A;  1WFK A;  3FAN A;  2YEL A;  5AIU A;  3UVY A;  2RNX A;  3MDB C;  4YBT A;  1ZKR A;  3Q2F A;  3U5N A;  1WIL A;  2DJA A;  5AMF A;  2YUC A;  3MHS A;  2FUU A;  4QBM A;  3ZVY A;  4TZ2 A;  2L0B A;  5CUC A;  2JUN A;  4PCI A;  2EGM A;  2YSJ A;  4QC1 A;  5D3S A;  2K4D A;  2L75 A;  2I7K A;  5DIN A;  4BHW A;  4CLB A;  3DWD A;  2YEM A;  5FE9 A;  3L1Z B;  4CFL A;  4X3G A;  4L7X A;  4Z0R A;  2ECN A;  3LQI A;  3KNV A;  5ENI A;  4W4U A;  5EGU A;  4UYF A;  4XUB A;  4CFK A;  5C89 A;  2YUR A;  3IHP A;  5EA1 A;  5EP7 A;  5A83 A;  2F6N A;  5BT5 A;  5J0D A;  3LQH A;  5FG5 A;  5HRX A;  2CKL A;  2ECI A;  3ZYQ A;  4LZS A;  2DVR A;  5LJ2 A;  3P5O A;  3AAD A;  5A5N A;  2I8N A;  2K17 A;  4I7C A;  4YH3 A;  5E9I A;  3C5K A;  5D1M B;  4O64 A;  5D3P A;  4NN2 A;  2E6R A;  5ENH A;  4AI6 A;  5DKD A;  1N87 A;  4PTB A;  4QR5 A;  5L97 A;  3O7A A;  5LVQ A;  4TS8 A;  4GNF A;  3MXF A;  3ZVZ B;  3MUK A;  2CRR A;  2G43 A;  5E9K A;  2QJ0 A;  4AYC B;  5EU1 A;  2H0D B;  3MB4 A;  4QZS A;  5D25 A;  5DLZ A;  4IR6 A;  2AN6 A;  1WEO A;  2B0O E;  4NQM A;  2WP1 A;  5KH9 A;  4O76 A;  3H7H A;  5F3A A;  5ENE A;  3LJW A;  4QYD A;  1X4U A;  3N9L A;  5IGL A;  4F1P A;  1WEQ A;  5DFC A;  5KTW A;  2MIQ A;  1FP0 A;  2DVQ A;  4HXK A;  2KR4 A;  5F1L A;  1MM3 A;  2QIC A;  4HXP A;  4MR5 A;  5FB1 A;  5D1L B;  2FUI A;  4QF3 A;  2YQD A;  4BW2 A;  2KU3 A;  5CQ8 A;  5FBX A;  3UW9 A;  5CRM A;  2K16 A;  2IDA A;  5TDR A;  2N9G A;  2KFT A;  4O7E A;  5EWW A;  3LVQ E;  4MEQ A;  3ZPV E;  5E9V A;  5A81 A;  4QB3 A;  2RS9 B;  4QSW A;  1WEV A;  2VPB A;  3HCT A;  4IC3 A;  4QR3 A;  5I80 A;  5A5S A;  2E6S A;  4NUC A;  5G05 B;  5ENG A;  5HJC A;  2FD4 A;  5IID A;  1VD4 A;  5AIT A;  5HM0 A;  3HCU A;  2G4A A;  5CQ5 A;  3UV5 A;  4MEN A;  4XUA A;  4Z6I A;  1WGM A;  1WES A;  4O70 A;  4YBS A;  4LRG A;  5H1V A;  2VNF A;  2ECG A;  5CPE A;  4TU6 A;  5EM3 A;  4YYK A;  2LGK A;  5IGM A;  3KV6 A;  5D3J A;  5ENF A;  2KE1 A;  3SUB A;  4MSX A;  4UP5 A;  5F36 A;  4YY4 A;  4Z93 A;  4NR7 A;  3Q1D A;  3I2D A;  5TRB A;  2MA6 A;  3EB6 A;  4O77 A;  5DW2 A;  4QSQ A;  4GB0 A;  1EQF A;  3JVK A;  4DON A;  2DAT A;  4NR9 A;  4YYJ A;  2BAY A;  3VKG A;  5I83 A;  5F2P A;  5E73 A;  3NG2 A;  4O7B A;  5A5Q A;  5G4S A;  4YY6 A;  2Y1N A;  5A85 A;  5F60 A;  3SOW A;  3HMH A;  4IOO A;  2PUY A;  4UI9 B;  5D26 A;  3JVJ A;  2MKE A;  4IR5 A;  3D1D A;  2XP0 A;  3HCS A;  3MQM A;  2ECW A;  1E6I A;  2CT2 A;  5CUD A;  5ACY A;  1DCQ A;  2E7O A;  5KTX A;  2XEU A;  4UYH A;  4AKH A;  2ECV A;  2RR4 A;  2D8S A;  4A4C A;  5FER A;  3PHD A;  3U5J A;  5D3L A; 
#chains in the Genus database with same CATH homology
 4YYN A;  4R8P K;  3N9Q A;  5F1H A;  4ALG A;  2YSM A;  2R0S A;  4OGI A;  2HDP A;  5EPB A;  4HBW A;  5HEN A;  4V3L C;  5A7C A;  4PKL A;  4A0C D;  4YYI A;  3LQJ A;  2EGP A;  2RFJ A;  1JM7 B;  1Z2Q A;  5FE0 A;  4LLB A;  4A9E A;  1FBV A;  4O7C A;  4V3K C;  1ZS5 A;  5LUU A;  3U5P A;  2MA5 A;  3UVD A;  4C66 A;  5FE7 A;  4NRC A;  2Y1M A;  3MHH A;  5FE5 A;  5FG6 A;  5LKT A;  2JMJ A;  4AUQ B;  4LYI A;  4FJC A;  5TBN A;  2RO1 A;  5D3N A;  5HQ5 A;  3HTK C;  2VP7 A;  4MVT A;  3VK6 A;  4Y03 A;  1MM2 A;  5E3D A;  5FH8 A;  4YAB A;  4HXM A;  5E9M A;  5D1K B;  4Q0O A;  3T6R A;  4HXS A;  5DKC A;  5TDW A;  4HBV A;  1K2F A;  5EV9 A;  3P1D A;  4N4I A;  3O70 A;  5IGN A;  1WEN A;  4XI1 A;  1HYI A;  5I89 A;  5IG6 A;  5I86 A;  3AQA A;  1X0J A;  3MB3 A;  5JWM A;  1WIM A;  4MR3 A;  1CHC A;  4X2I A;  5ENB A;  3ZPV 1;  4QNS A;  5LCW B;  4MEP A;  4RVR A;  5FE8 A;  2M3H A;  3S92 A;  3I3J A;  2LXP C;  2M6M A;  4I7B A;  4L58 A;  3Q2E A;  4N3W A;  2JMI A;  4TKP B;  4A9N A;  2CSY A;  3QZV A;  2LN0 A;  4IOQ A;  5D7X A;  4F3I A;  3L11 A;  2H60 A;  4NR6 A;  4QY4 A;  1V87 A;  1IYM A;  2DX8 A;  3M63 A;  4ZDT A;  5JG6 A;  5HQ6 A;  3KV5 A;  4GND A;  5CFW A;  2YW8 A;  2DWW A;  4BBQ A;  3JVM A;  2L5E A;  3UV2 A;  4ALH A;  1HYJ A;  5DFB A;  3KQI A;  4A9J A;  2VPE A;  5B78 A;  4YYD A;  5EYA F;  1F62 A;  5FE4 A;  4QEW A;  4A9H A;  5IBN A;  4NYV A;  2CSZ A;  5EWC A;  2L84 A;  4WHU A;  5CP5 A;  5CUE A;  4PPE A;  5JI8 A;  5F63 A;  4CUR A;  3G0L A;  5I29 A;  4O75 A;  5LVR A;  5E9L A;  1WEE A;  5DY7 A;  3JVL A;  2LSP B;  3U5M A;  3O37 A;  4A9K A;  2L80 A;  2VJE B;  5CQA A;  2OUO A;  3D7C A;  3U5L A;  4LZR A;  4NXJ A;  5G4R A;  4A9O A;  3UVX A;  4AKN A;  5F61 A;  4KCX A;  5CS8 A;  2JRJ A;  5HFQ A;  5HFR A;  3RPG C;  5HLS A;  4R7E A;  5II2 A;  2E7N A;  5IGK A;  4HXR A;  4XYA A;  5LJ0 A;  5CU8 A;  2UZG A;  4TT6 A;  2YEK A;  5EK9 A;  5DKH A;  4TU4 A;  5D24 A;  1WE9 A;  3LXJ A;  4PY6 A;  4Q6F A;  5BT4 A;  5E0R A;  4YH4 A;  5C4Q A;  3SVF A;  4J3I A;  5FH6 A;  5G04 B;  5B8D A;  2C2V S;  4ZUX U;  3QZS A;  3RTR B;  4UIZ A;  4I7D A;  2H0D A;  1DVP A;  4YYH A;  4MEO A;  1VYX A;  3LRQ A;  4YYM A;  4B86 C;  2RNW A;  3DWY A;  4GNG A;  1JM7 A;  5B79 A;  3N9N A;  4NRA A;  2ZET C;  4UIT A;  2VJF B;  2YQL A;  3PUQ A;  1E4U A;  2VJE A;  4ZC9 A;  5L99 A;  5FFY A;  4R2Y A;  5KO4 A;  3QZT A;  4MR4 A;  4A9I A;  5D3R A;  3NXB A;  4YC9 A;  5HRW A;  2WP2 A;  4CA1 A;  5CQ6 A;  4LR6 A;  4ZQL A;  3DQV R;  3O34 A;  2YDW A;  5FE3 A;  2LRI C;  3N9O A;  3U5O A;  5I88 A;  4TQN A;  2YHN A;  5L98 A;  1T1H A;  4WIV A;  2KYU A;  2VPD A;  4N4F A;  5AD3 A;  4LAD B;  2R0V A;  4UIX A;  5KU3 A;  4Z1S A;  1X4I A;  5DYC A;  5ENC A;  2R0Y A;  5L8U A;  3GL6 A;  3V43 A;  2FSA A;  5F5Z A;  5EWV A;  4QST A;  1U6G B;  2KWK A;  5CUG A;  5A5R A;  2G6Q A;  2L43 A;  4J1P A;  5II1 A;  5HCL A;  4FK5 A;  2GRC A;  4F52 B;  4AYC A;  5EIS A;  4CUP A;  4C9Z A;  4BW1 A;  3UVW A;  5C87 A;  4LKA A;  5H85 A;  3O36 A;  1ZBD B;  2HYE D;  4NQN A;  5L96 A;  2L5U A;  5CY9 A;  4UP0 A;  2MD8 C;  5B76 A;  5TCM A;  3UV4 A;  4QSX A;  5ETB A;  5KTU A;  5EPR A;  2YRE A;  4TT4 A;  5DW1 A;  2K1J A;  4J0R A;  4LDF A;  4N4H A;  4Q0N A;  4Z1Q A;  2YQM A;  4A4B A;  3T7L A;  4IR3 A;  1WEU A;  4MR6 A;  5DFD A;  4AVX A;  4NUE A;  2KRE A;  4PCE A;  4IC2 A;  5FE6 A;  4QEV A;  5B77 A;  2MUM A;  4LZ2 A;  5ETD A;  4NR8 A;  2ECT A;  5TAB A;  4BJX A;  2LQ6 A;  3P1F A;  5EI4 A;  5A82 A;  4ZW1 A;  3ONI A;  5CTL A;  4QSU A;  2DVS A;  5FFW A;  2OSS A;  4TT2 A;  4YYG A;  4QEU A;  5C7N A;  4S3O C;  4HXN A;  5C8G A;  4AP4 A;  5KH3 A;  2NAA A;  4QSV A;  2LV9 A;  3U5K A;  4QSS A;  4CUS A;  3SVH A;  3ZNI A;  4LYS A;  4WZ3 B;  4LC2 A;  5HQ7 A;  3N9M A;  1LDJ B;  4YK0 A;  2F6J A;  5ENJ A;  2EA6 A;  5DYA A;  1N72 A;  4CUT A;  4A9F A;  3TLP A;  2M85 A;  5L8T A;  4YAT A;  2D9E A;  4IOR A;  3S91 A;  4XY9 A;  4FO9 A;  5CQT A;  2KGG A;  4P5O B;  5EWD A;  5FDZ A;  5G0F A;  1LDK C;  5I7X A;  5E74 A;  5E7D A;  5I7Y A;  2VPG A;  5F25 A;  2MD7 B;  4OUF A;  3IU5 A;  5COI A;  2DKW A;  1JOC A;  5FH7 A;  2YHO A;  1Z6U A;  5CRZ A;  2KWO A;  3FKM X;  3G0J A;  2C2L A;  2LXH C;  1WEM A;  4GPJ A;  5FE1 A;  5FFV A;  3M62 A;  2F42 A;  5FG4 A;  3O33 A;  2R10 A;  1Z60 A;  4WZ0 A;  4BW3 A;  2Y43 A;  4HBX A;  4TYL A;  5FE2 A;  4UIY A;  4FIP A;  4HXL A;  5D3H A;  4O7F A;  5HEL A;  4YBM A;  2DVV A;  4PS5 A;  5TB6 A;  1JM4 B;  4O72 A;  4O71 A;  5DX4 A;  2M1R A;  5B75 A;  2PNX A;  2KWN A;  4O74 A;  2D82 A;  4TZ8 A;  4O78 A;  2LDR A;  2VJF A;  5I1Q A;  4QF2 A;  4NR4 A;  2I50 A;  3P1E A;  2JMD A;  3SVG A;  4KV4 A;  1WUG A;  2OXQ C;  5CQ3 A;  4BW4 A;  2RSD A;  5KHM A;  5BT3 A;  4NRB A;  2YW5 A;  4YAX A;  4WA6 A;  3GV4 A;  4A9M A;  3ZYU A;  4NYW A;  4UIV A;  5CZG A;  4B7Y C;  4UYE A;  4NS5 A;  4CUQ A;  5AD2 A;  1BOR A;  2L85 A;  4NYX A;  5C11 A;  5LJ1 A;  4QSR A;  2G45 A;  5FB0 A;  5LKZ A;  5A5P A;  4OGJ A;  4UYD A;  2RI7 A;  4QR4 A;  3EB5 A;  4LJN A;  2MNY A;  3PUR A;  4NR5 A;  5F62 A;  2NXB A;  3SOU A;  4CCG X;  4XY8 A;  1G25 A;  1WUM A;  4Z6H A;  3MUL A;  2MJV B;  4WHW A;  2ECJ A;  4CUU A;  5I40 A;  4FLP A;  2YU4 A;  5C85 A;  2XB1 A;  3O35 A;  5HEM A;  4HBY A;  1X4J A;  4N4G A;  5H1T A;  3FL2 A;  5CQ4 A;  5CUB A;  5J3X A;  4O7A A;  5I3L A;  5C13 A;  4QUT A;  5H1U A;  1VFY A;  4LK9 A;  3RCW A;  3M99 A;  4WZ2 A;  5FEY A;  3SOX A;  2E3K A;  5EIC A;  4TTE A;  4CL9 A;  2YT5 A;  2YYN A;  3HMF A;  4QC3 A;  5DBM A;  3P1C A;  5E9Y A;  3GG3 A;  4C67 A;  5DKA A;  5EPS A;  5A5O A;  2KGI A;  4QSP A;  4UIW A;  5CGP A;  4NUD A;  2QIZ A;  5E3G A;  5H9M A;  3DAI A;  4UYG A;  2LGV A;  4QYL A;  3C6W A;  2MT5 A;  3DPL R;  5DYX A;  5CUA A;  2MNZ A;  3L1X A;  3K2J A;  5LKU A;  4HXO A;  5D3T A;  2RNY A;  5K29 A;  5EWH A;  3RPG B;  2CKL B;  4UIU A;  3ASL A;  2KTB B;  4YAD A;  5EVA A;  1F68 A;  4UYF B;  1WEW A;  4J0S A;  2KWJ A;  2OO1 A;  5HRV A;  5EQ1 A;  5KH7 A;  1XWH A;  4GNE A;  3N9P A;  2LGG A;  4IR4 A;  4A9L A;  5LKX A;  4S3O B;  3SHB A;  2LGL A;  4KV1 A;  2EOD A;  1JSP B;  2KIZ A;  4QUU A;  2YYR A;  4LYW A;  4E96 A;  3HME A;  5CQ7 A;  5DYU A;  3IU6 A;  4A49 A;  5D0C A;  5DLX A;  5AME A;  1RMD A;  3ZTG A;  1WEP A;  1WFK A;  2YEL A;  5AIU A;  3UVY A;  2RNX A;  4YBT A;  3Q2F A;  3U5N A;  1WIL A;  2YUC A;  5AMF A;  3MHS A;  2FUU A;  4QBM A;  3ZVY A;  4TZ2 A;  2L0B A;  5CUC A;  4PCI A;  2YSJ A;  4QC1 A;  5D3S A;  2K4D A;  2L75 A;  2I7K A;  5DIN A;  4BHW A;  4CLB A;  2YEM A;  5FE9 A;  3L1Z B;  4CFL A;  4X3G A;  4L7X A;  2ECN A;  3LQI A;  3KNV A;  5ENI A;  4W4U A;  5EGU A;  4UYF A;  4XUB A;  4CFK A;  5C89 A;  2YUR A;  3IHP A;  5EA1 A;  5EP7 A;  5A83 A;  2F6N A;  5BT5 A;  5J0D A;  3LQH A;  5FG5 A;  5HRX A;  2CKL A;  2ECI A;  3ZYQ A;  4LZS A;  2DVR A;  5LJ2 A;  3P5O A;  3AAD A;  5A5N A;  2I8N A;  2K17 A;  4I7C A;  4YH3 A;  5E9I A;  3C5K A;  5D1M B;  4O64 A;  5D3P A;  4NN2 A;  2E6R A;  5ENH A;  5DKD A;  1N87 A;  4PTB A;  4QR5 A;  5L97 A;  3O7A A;  5LVQ A;  4TS8 A;  4GNF A;  3MXF A;  3ZVZ B;  3MUK A;  2G43 A;  4AYC B;  5E9K A;  2QJ0 A;  5EU1 A;  2H0D B;  3MB4 A;  4QZS A;  5D25 A;  5DLZ A;  4IR6 A;  2AN6 A;  1WEO A;  4NQM A;  2WP1 A;  5KH9 A;  4O76 A;  5F3A A;  5ENE A;  3LJW A;  4QYD A;  1X4U A;  3N9L A;  5IGL A;  1WEQ A;  5DFC A;  5KTW A;  2MIQ A;  1FP0 A;  2DVQ A;  4HXK A;  2KR4 A;  5F1L A;  1MM3 A;  2QIC A;  4HXP A;  4MR5 A;  5FB1 A;  5D1L B;  2FUI A;  4QF3 A;  2YQD A;  4BW2 A;  2KU3 A;  5CQ8 A;  5FBX A;  3UW9 A;  5CRM A;  2K16 A;  2IDA A;  5TDR A;  2N9G A;  2KFT A;  4O7E A;  5EWW A;  3ZPV E;  4MEQ A;  5E9V A;  5A81 A;  4QB3 A;  2RS9 B;  4QSW A;  1WEV A;  2VPB A;  3HCT A;  4IC3 A;  4QR3 A;  5I80 A;  5A5S A;  2E6S A;  4NUC A;  5G05 B;  5ENG A;  5HJC A;  5IID A;  1VD4 A;  5AIT A;  5HM0 A;  3HCU A;  2G4A A;  5CQ5 A;  3UV5 A;  4MEN A;  4XUA A;  4Z6I A;  1WGM A;  1WES A;  4O70 A;  4YBS A;  4LRG A;  5H1V A;  2VNF A;  2ECG A;  5CPE A;  4TU6 A;  5EM3 A;  4YYK A;  2LGK A;  5IGM A;  3KV6 A;  5D3J A;  5ENF A;  2KE1 A;  4MSX A;  4UP5 A;  5F36 A;  4YY4 A;  4Z93 A;  4NR7 A;  3I2D A;  5TRB A;  2MA6 A;  3EB6 A;  4O77 A;  5DW2 A;  4QSQ A;  4GB0 A;  1EQF A;  3JVK A;  4DON A;  2DAT A;  4NR9 A;  4YYJ A;  2BAY A;  5I83 A;  5F2P A;  5E73 A;  3NG2 A;  4O7B A;  5A5Q A;  5G4S A;  4YY6 A;  2Y1N A;  5A85 A;  5F60 A;  3SOW A;  3HMH A;  4IOO A;  2PUY A;  4UI9 B;  5D26 A;  3JVJ A;  4IR5 A;  3HCS A;  3MQM A;  2ECW A;  1E6I A;  2CT2 A;  5CUD A;  5ACY A;  2E7O A;  5KTX A;  2XEU A;  4UYH A;  2ECV A;  4A4C A;  5FER A;  2D8S A;  3PHD A;  3U5J A;  5D3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...