3U5PA

Crystal structure of the complex of trim33 phd-bromo and h3(1-28)k9me3k14ack18ack23ac histone peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
188
Chain Sequence
DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 56
structure length 188
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5pA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5pA01
5HJCA 5IGKA 5FH8A 2N9GA 4QSRA 4BHWA 3MHSA 4AP4A 5KH3A 2E6SA 5D3SA 2VJEA 5ACYA 2MA6A 2LQ6A 4A49A 4I7DA 4ZUXU 1WEMA 3O35A 4TT4A 1WENA 4UIYA 5EP7A 5CUGA 3FL2A 4LADB 2L5EA 2ECGA 4N3WA 3MQMA 4QC3A 5II1A 2LXPC 2YREA 5DLXA 3DQVR 5E9LA 5L99A 2K16A 5AD3A 2ECNA 4Z6IA 2YEKA 4YY4A 2JMDA 3LQJA 4NQNA 4FJCA 3K2JA 2L80A 5EPBA 1N72A 4NUCA 4L58A 2YHNA 3RPGC 5HFRA 2OO1A 5A85A 5TABA 4O75A 5DFCA 5A5NA 3U5JA 5LVRA 4PPEA 5CS8A 2K17A 4YAXA 2LDRA 5C8GA 4UI9B 4YADA 5HRVA 2K1JA 5KTUA 4A9LA 4IR5A 5EICA 4CFLA 2I50A 4QR3A 2KFTA 4FLPA 3GV4A 4GB0A 4YYMA 5HQ6A 4HBYA 5A5SA 5C13A 4TQNA 5ENGA 4FO9A 4UP5A 3UV2A 2K4DA 5DW1A 4IR4A 2RSDA 5JG6A 2LGKA 4A9OA 4DONA 4S3OB 5FG4A 5DKDA 2RNWA 5FH7A 4NR6A 4TT2A 4NR5A 5C4QA 5E9IA 5IBNA 5KH7A 3UV5A 3IU5A 2M1RA 4IR3A 5BT4A 1WEVA 4O7EA 3V43A 3JVJA 2R10A 5DYXA 4NYVA 2LGVA 2YW5A 1X0JA 4NUEA 4ALHA 1WEOA 5TDRA 3U5MA 5CRMA 5II2A 2G45A 4CUUA 5TB6A 2KWKA 4MEPA 4X3GA 3Q2EA 3N9MA 5EWWA 4J0SA 2RNYA 5ENFA 2XB1A 3VK6A 4NYXA 4YH4A 2R0VA 4MR4A 4O77A 5HEMA 4LRGA 4WA6A 4TU6A 5L97A 3DPLR 4NRCA 4P5OB 5DKHA 1WILA 3AQAA 5EWDA 5FE8A 5G4SA 4XI1A 2LGGA 4UP0A 2LN0A 5F5ZA 1WIMA 4UYDA 5CQ7A 5F1HA 4UYHA 2YT5A 4LYIA 5I3LA 5H1UA 2KE1A 5C85A 4L7XA 3M63A 5CUBA 5HENA 4BW1A 1JM4B 5D25A 4QY4A 4YYKA 4LR6A 3UVXA 3ASLA 5HQ5A 4GNGA 4MR5A 5CY9A 4BBQA 3FKMX 5A81A 4BW4A 5CUCA 5E0RA 5CQ4A 2IDAA 4XUAA 5DFDA 3EB6A 2UZGA 4QEVA 2ECIA 4QSQA 4J0RA 1EQFA 4QSPA 1U6GB 5FERA 2E7NA 5AD2A 2KTBB 5CU8A 5FBXA 3MHHA 3N9PA 5TDWA 3HMEA 3I2DA 4TU4A 5LKZA 4MVTA 2EGPA 4N4GA 2Y1MA 3N9NA 5TRBA 4YY6A 3EB5A 2MD8C 4WZ0A 4UIXA 5D1MB 4V3KC 2YU4A 5ETDA 2E7OA 4E96A 2L5UA 5LJ2A 4LZ2A 2CSYA 5EA1A 2BAYA 4B86C 5LVQA 2RNXA 5LUUA 2VNFA 2R0SA 3KNVA 3JVLA 4LKAA 4UIZA 3M62A 4HXRA 5EM3A 5FE4A 4NUDA 5FG5A 4LC2A 2JRJA 5FE2A 4PTBA 3O33A 5A5RA 4ALGA 4RVRA 4O64A 5FE9A 1F62A 2F6NA 1WEPA 3GL6A 4NQMA 5HM0A 4TZ8A 1HYJA 2DVVA 2L85A 3P1CA 5CQ8A 5D3NA 5EWCA 2PUYA 3QZTA 2HYED 4HBXA 1F68A 4HXKA 4QNSA 2KIZA 4F52B 4J1PA 4QEUA 5L8UA 3QZVA 4AVXA 4LYSA 5D3RA 5FE3A 1WFKA 2HDPA 5D3HA 4ZDTA 5I1QA 5EV9A 5DKAA 4C66A 4YYJA 4Q6FA 2D8SA 4O7FA 5FFWA 2C2VS 3UV4A 2VJEB 4CUPA 3Q2FA 2CSZA 1G25A 2H0DB 5LJ0A 5D3TA 3LQHA 2L0BA 2RS9B 2OXQC 5CUEA 2L84A 2Y43A 4YBMA 4UYGA 1JM7B 1MM3A 2MIQA 4QYDA 3L1XA 2DWWA 4QBMA 3P1DA 5F62A 4Z6HA 3C5KA 4IC3A 4HBWA 4YK0A 4NXJA 5F1LA 5KTXA 3C6WA 2AN6A 3MXFA 3SOXA 2JMJA 5DLZA 5HCLA 3MB4A 4F3IA 2QJ0A 5F2PA 2VPBA 4N4HA 2YYNA 4MENA 4NR7A 4AKNA 2H0DA 4TKPB 1FBVA 2VPDA 3MULA 5CUDA 3ZPV1 2VJFB 5D0CA 5A5QA 4NR9A 2CT2A 5COIA 4UYFA 3U5KA 5D24A 2H60A 4YBSA 5ETBA 5FE0A 5EWVA 3HCSA 3N9OA 5L98A 5LKXA 5CZGA 5H85A 4YH3A 2RO1A 4Q0OA 3KV5A 4C9ZA 4QF2A 4TZ2A 5E7DA 5IGLA 4O70A 1MM2A 4W4UA 4CUQA 1WEWA 4YYIA 1T1HA 2M85A 2OSSA 5D3JA 1WESA 5KO4A 2YQLA 2Y1NA 4FIPA 4AUQB 5EPRA 3ZTGA 3SOUA 2QICA 3ZVYA 2ECJA 5I86A 4FK5A 4HXOA 4UITA 3ZVZB 5C11A 3N9QA 4HXMA 5FH6A 2QIZA 4NRBA 5ENJA 3HMFA 1X4IA 5HRXA 2NAAA 5D7XA 5ENEA 5C89A 2KGIA 5DKCA 5B78A 2YHOA 4HXNA 4X2IA 3RTRB 2G6QA 5B79A 4IOOA 2XEUA 4PCIA 3KQIA 5EVAA 3P1FA 2E6RA 4QSTA 5KH9A 5F61A 5FE1A 4YBTA 5D3PA 4Q0NA 4YYHA 1ZS5A 4YYGA 3S91A 1E4UA 1JSPB 3GG3A 4TYLA 4I7BA 3UVYA 3HMHA 5CRZA 3O70A 3ONIA 4O78A 3U5LA 3RCWA 1Z60A 2MT5A 2PNXA 5H9MA 4ZW1A 3SVGA 3ZPVE 5EPSA 3ZYUA 4A9FA 3QZSA 2YYRA 5JWMA 2MUMA 2YDWA 4NYWA 2CKLB 1ZBDB 4LZSA 3ZYQA 4Z93A 4CURA 4O72A 4LYWA 4QB3A 4MSXA 5K29A 1JOCA 1WEEA 1Z2QA 5D3LA 4AYCB 2DKWA 2G4AA 4NR4A 5I83A 4PS5A 3PHDA 5CQTA 4OGJA 2VPGA 4WZ2A 4Z1QA 5FEYA 5FB0A 1BORA 5F25A 4LDFA 5CPEA 4A9MA 5DYAA 4BW3A 3N9LA 4NR8A 1WUGA 2RI7A 2VP7A 4MEOA 5LKUA 4IR6A 5I7YA 2LRIC 4MEQA 4OUFA 5ENIA 3L1ZB 5I89A 5CQ6A 5F36A 1X4JA 5DFBA 5E9YA 2M6MA 4QEWA 5ENCA 1V87A 5A7CA 4ZQLA 2I7KA 4BW2A 3DAIA 4NN2A 5IIDA 4R7EA 1VD4A 5E3DA 5D1KB 4NRAA 2ECWA 5KHMA 4N4IA 2KU3A 1LDJB 5HQ7A 5DYUA 2DVQA 4QUUA 5FB1A 5A5PA 5H1TA 5C7NA 4ZC9A 4PY6A 5C87A 1WGMA 4A4CA 4O76A 4QUTA 5E9MA 3IHPA 5CUAA 5CQ5A 5L96A 4XY9A 5CTLA 4UIUA 5J0DA 2CKLA 4A9KA 4QSXA 5I40A 4UIWA 1E6IA 5EQ1A 1N87A 4CL9A 2EA6A 5EWHA 3S92A 5J3XA 3P5OA 2YURA 5DYCA 3HCUA 2WP2A 4YYNA 3SVHA 4A4BA 4O7AA 2JMIA 2G43A 1WEQA 4HXPA 2OUOA 4GNDA 4QSUA 2LSPB 5ENBA 3U5NA 5EI4A 2KWOA 5FG6A 4V3LC 5DY7A 5EYAF 5B8DA 4LK9A 3NXBA 5AITA 4J3IA 1K2FA 3PURA 2FSAA 5E74A 5FE5A 2F6JA 3IU6A 3JVMA 4N4FA 2DX8A 4Z1SA 4HBVA 3O7AA 5CQ3A 5HFQA 5BT5A 5L8TA 3RPGB 3G0JA 5FE7A 5E9VA 2YEMA 4UYEA 5IGNA 1IYMA 5LJ1A 2EODA 5B77A 2R0YA 5E9KA 3HCTA 4QSVA 2DVRA 4A9NA 2WP1A 5G0FA 4QSWA 5KTWA 4GPJA 5A83A 5HLSA 3O37A 4O7CA 4YATA 5G4RA 2FUUA 2VPEA 3HTKC 2LXHC 5EISA 4MR3A 4HXSA 3PUQA 3MB3A 2MNYA 3O36A 4QC1A 5E3GA 5DX4A 1FP0A 2ECTA 5BT3A 1DVPA 1WEUA 2D82A 2GRCA 3LRQA 5I88A 3SOWA 4CCGX 4GNFA 5IGMA 5CGPA 4QR4A 1VYXA 1HYIA 4I7CA 5IG6A 4TS8A 3T6RA 1VFYA 4O7BA 4YYDA 5CP5A 2LV9A 1JM7A 4YC9A 2YQDA 4IORA 5CQAA 4CFKA 2VJFA 4TTEA 4CUSA 2KWJA 4CLBA 5A5OA 3P1EA 3MUKA 4LZRA 2D9EA 5FFVA 5AMEA 5HELA 1LDKC 4QF3A 2YQMA 5TCMA 5FDZA 5F3AA 2YW8A 3T7LA 4QSSA 2F42A 4S3OC 5HRWA 2MJVB 4Y03A 5A82A 5LKTA 2YSMA 5FE6A 4XYAA 5D26A 3NG2A 3D7CA 3U5OA 4KV1A 5DW2A 5E73A 4MR6A 3KV6A 3O34A 5F63A 4OGIA 4LLBA 5KU3A 1X4UA 2NXBA 5ENHA 4A9HA 3UW9A 2KYUA 4QR5A 2KR4A 4HXLA 2YSJA 2KWNA 2KGGA 2MA5A 1CHCA 4A9JA 4WZ3B 3AADA 5CFWA 4O71A 5F60A 2KREA 2M3HA 3M99A 5DINA 4CUTA 1WE9A 3LQIA 2YUCA 4LJNA 4A0CD 1RMDA 5B75A 4CA1A 1XWHA 2MD7B 5B76A 5TBNA 4TT6A 5EU1A 4A9IA 3L11A 4R2YA 2DVSA 4UIVA 5I80A 4PKLA 4C67A 2L75A 3U5PA 2L43A 5D1LB 2YELA 4UYFB 5EGUA 1Z6UA 3I3JA 4BJXA 5EK9A 2ZETC 2ECVA 3UVDA 5LCWB 3JVKA 3SVFA 4O74A 4NS5A 4AYCA 5G04B 5G05B 2LGLA 2I8NA 4A9EA 4QYLA 2E3KA 4WHWA 4IC2A 4R8PK 4IOQA 3TLPA 3ZNIA 4WIVA 4QZSA 5I29A 4PCEA 5AMFA 4GNEA 3LXJA 4KCXA 5AIUA 4YABA 3UVWA 2MNZA 4XUBA 5I7XA 4KV4A 5H1VA 3LJWA 5JI8A 4XY8A 2RFJA 2C2LA 3DWYA 5DBMA 2DATA 4B7YC 5FFYA 3SHBA 4WHUA 1WUMA 3G0LA 2FUIA
chains in the Genus database with same CATH superfamily
5HJCA 5IGKA 5FH8A 2N9GA 4QSRA 4BHWA 3MHSA 4AP4A 5KH3A 2E6SA 5D3SA 2VJEA 5ACYA 2MA6A 2LQ6A 4A49A 4I7DA 3FJUB 2L7PA 4ZUXU 1WEMA 3O35A 4TT4A 1WENA 4UIYA 5EP7A 5CUGA 2JUNA 3FL2A 2L5EA 2ECGA 4LADB 4N3WA 3MQMA 4QC3A 5II1A 2LXPC 2YREA 5DLXA 3DQVR 5E9LA 5L99A 2K16A 5AD3A 4AKGA 2ECNA 4Z6IA 3O47A 2YEKA 4YY4A 2JMDA 3LQJA 4NQNA 4FJCA 3K2JA 2L80A 5EPBA 1N72A 4NUCA 4L58A 2YHNA 3RPGC 5HFRA 2OO1A 5A85A 5TABA 4O75A 5DFCA 5A5NA 3U5JA 5LVRA 4PPEA 5CS8A 2K17A 4YAXA 4AKIA 5C8GA 2LDRA 4UI9B 4YADA 5HRVA 2K1JA 5KTUA 4A9LA 4IR5A 5EICA 4CFLA 2I50A 4QR3A 2KFTA 4FLPA 3GV4A 4GB0A 4YYMA 5HQ6A 4HBYA 5A5SA 5C13A 4TQNA 5ENGA 4FO9A 4UP5A 3UV2A 2K4DA 5DW1A 4IR4A 2RSDA 5K3QA 5JG6A 2LGKA 4A9OA 4DONA 4S3OB 5FG4A 5DKDA 2RNWA 5FH7A 4NR6A 4TT2A 4NR5A 5C4QA 5E9IA 5IBNA 2CRWA 5KH7A 3UV5A 3IU5A 2M1RA 4IR3A 2FFWA 5BT4A 1WEVA 4O7EA 2M13A 3JVJA 3V43A 2R10A 5DYXA 4NYVA 2LGVA 2YW5A 1X0JA 4NUEA 4ALHA 1WEOA 5TDRA 3U5MA 5CRMA 4F1PA 2B0OE 5II2A 2G45A 4CUUA 5TB6A 2KWKA 4MEPA 3MDBC 4X3GA 3Q2EA 3N9MA 5EWWA 4J0SA 2RNYA 5ENFA 2XB1A 3VK6A 4NYXA 4YH4A 2R0VA 4MR4A 4O77A 5HEMA 4LRGA 4WA6A 4TU6A 5L97A 3DPLR 4NRCA 4P5OB 5DKHA 1WILA 3AQAA 5EWDA 5FE8A 5G4SA 4XI1A 2LGGA 3LDYA 4UP0A 2LN0A 5F5ZA 1WIMA 4UYDA 5CQ7A 5F1HA 3Q1DA 4UYHA 2YT5A 4LYIA 5I3LA 5H1UA 2KE1A 5C85A 4L7XA 3M63A 5CUBA 5HENA 4BW1A 1JM4B 5D25A 4QY4A 4YYKA 4LR6A 3UVXA 3ASLA 5HQ5A 4GNGA 4MR5A 5CY9A 4BBQA 3FKMX 5A81A 2EXUA 4BW4A 5CUCA 5E0RA 5CQ4A 2IDAA 4XUAA 5DFDA 3EB6A 2UZGA 4QEVA 2ECIA 4QSQA 4J0RA 1EQFA 4QSPA 1U6GB 5FERA 1PUOA 2E7NA 5AD2A 2KTBB 5CU8A 5FBXA 3MHHA 3N9PA 5TDWA 5SVIA 3HMEA 3I2DA 4TU4A 5LKZA 4MVTA 2EGPA 4N4GA 2Y1MA 3N9NA 5TRBA 4YY6A 3EB5A 3KDEC 4Z0OA 2MD8C 4WZ0A 4UIXA 3FEHA 5D1MB 4V3KC 2YU4A 2FD4A 5ETDA 1ZKRA 2DJAA 2E7OA 4E96A 2L5UA 5LJ2A 4LZ2A 2CSYA 5EA1A 2BAYA 4B86C 5LVQA 2RNXA 5LUUA 2VNFA 2R0SA 3KNVA 3JVLA 4LKAA 4UIZA 3M62A 4HXRA 5EM3A 5FE4A 4NUDA 5FG5A 4LC2A 2JRJA 5FE2A 3FANA 4PTBA 3O33A 5A5RA 4ALGA 4RVRA 4O64A 5FE9A 1F62A 2F6NA 1WEPA 2P57A 3GL6A 4NQMA 5HM0A 4TZ8A 1HYJA 2DVVA 2L85A 3P1CA 5CQ8A 5D3NA 5EWCA 2PUYA 3QZTA 2HYED 4HBXA 1F68A 3M7KA 4HXKA 4QNSA 2KIZA 4F52B 4J1PA 4QEUA 5L8UA 3SUBA 3QZVA 4AVXA 4Z0RA 4LYSA 5D3RA 5FE3A 1WFKA 2HDPA 5D3HA 4ZDTA 5I1QA 5EV9A 5DKAA 4C66A 4YYJA 2XOCA 4Q6FA 2D8SA 4H9DA 4O7FA 5FFWA 2C2VS 3UV4A 2VJEB 1MBMA 4CUPA 3Q2FA 2CSZA 2IQJA 1G25A 2H0DB 5LJ0A 5D3TA 3LQHA 2L0BA 2RS9B 2OXQC 5CUEA 2L84A 2CRRA 2Y43A 4YBMA 4UYGA 1JM7B 1MM3A 2MIQA 4QYDA 3L1XA 2DWWA 4QBMA 3P1DA 5F62A 4Z6HA 3C5KA 4IC3A 4HBWA 4YK0A 4NXJA 5F1LA 3LVQE 5KTXA 3C6WA 2AN6A 3MXFA 3SOXA 2JMJA 5DLZA 5HCLA 3MB4A 4F3IA 2QJ0A 5F2PA 2VPBA 4N4HA 2YYNA 4MENA 4OGCA 4NR7A 4AKNA 2H0DA 4TKPB 1FBVA 2VPDA 3MULA 5CUDA 3LVRE 2VJFB 5D0CA 5A5QA 3ZPV1 4NR9A 2CT2A 5COIA 4UYFA 3U5KA 5D24A 2H60A 4YBSA 5ETBA 5FE0A 5EWVA 2E61A 3HCSA 3N9OA 5L98A 5LKXA 5CZGA 5H85A 4YH3A 2RO1A 4Q0OA 2CSVA 3KV5A 4QF2A 4TZ2A 5E7DA 5IGLA 4O70A 4C9ZA 1MM2A 3DDTA 4W4UA 4CUQA 1WEWA 4YYIA 1T1HA 2M85A 2OSSA 5D3JA 1WESA 5KO4A 2YQLA 2Y1NA 4FIPA 4AUQB 5EPRA 3ZTGA 3SOUA 2QICA 3ZVYA 2ECJA 5I86A 4FK5A 3ERRA 4HXOA 4UITA 3ZVZB 5C11A 5SVYA 3N9QA 4HXMA 5FH6A 2QIZA 4NRBA 4QQ4A 5ENJA 3HMFA 1X4IA 5HRXA 2NAAA 5D7XA 5ENEA 5C89A 2KGIA 5DKCA 5B78A 2YHOA 4HXNA 4X2IA 3RTRB 2G6QA 5B79A 4IOOA 2XEUA 4PCIA 3KQIA 5EVAA 3P1FA 2E6RA 4QSTA 5KH9A 5F61A 5FE1A 4YBTA 5D3PA 4Q0NA 2CONA 4YYHA 1ZS5A 4YYGA 3S91A 1E4UA 1JSPB 3GG3A 4TYLA 4I7BA 2XOZA 3UVYA 3HMHA 5CRZA 3O70A 3ONIA 4O78A 3U5LA 3RCWA 1Z60A 2MT5A 2PNXA 5H9MA 4ZW1A 3SVGA 3ZPVE 5EPSA 3ZYUA 4A9FA 3QZSA 2YYRA 5JWMA 2MUMA 5SVXA 2YDWA 4NYWA 3E2DA 2CKLB 1ZBDB 4LZSA 3ZYQA 4Z93A 4CURA 4O72A 4LYWA 4QB3A 4MSXA 2LAUA 5K29A 2KKXA 1JOCA 1WEEA 1Z2QA 5D3LA 4AYCB 2DKWA 2G4AA 4NR4A 5I83A 4PS5A 3PHDA 5CQTA 4OGJA 2VPGA 4WZ2A 4Z1QA 3VKHA 5FEYA 5FB0A 1BORA 5F25A 4LDFA 5CPEA 4A9MA 5DYAA 4BW3A 3N9LA 4NR8A 1WUGA 2RI7A 2VP7A 4MEOA 5LKUA 4IR6A 5I7YA 2LRIC 4MEQA 4OUFA 5ENIA 2D8UA 3L1ZB 5I89A 5CQ6A 5F36A 1X4JA 5DFBA 5E9YA 2M6MA 4QEWA 5ENCA 1V87A 5A7CA 4ZQLA 2I7KA 4BW2A 3DAIA 4NN2A 5IIDA 4R7EA 1VD4A 5E3DA 5D1KB 4NRAA 2ECWA 5KHMA 4N4IA 2DSMA 1LDJB 5HQ7A 2KU3A 5DYUA 2DVQA 4QUUA 5FB1A 5A5PA 5H1TA 5C7NA 4ZC9A 4PY6A 5C87A 1WGMA 4A4CA 4O76A 4QUTA 5E9MA 3IHPA 5CUAA 5CQ5A 3VKGA 5L96A 4XY9A 5CTLA 4UIUA 5J0DA 2CKLA 4A9KA 2RR4A 4QSXA 5I40A 4UIWA 1E6IA 3D1DA 5EQ1A 1N87A 4CL9A 2EA6A 5EWHA 3S92A 5J3XA 3P5OA 2YURA 5DYCA 3HCUA 2WP2A 4YYNA 3SVHA 4A4BA 4O7AA 1DCQA 2JMIA 2G43A 1WEQA 4HXPA 2OUOA 4GNDA 4QSUA 2LSPB 3DWDA 5ENBA 3U5NA 5EI4A 2KWOA 5FG6A 4V3LC 2EJNA 5DY7A 2KKYA 5EYAF 5B8DA 4LK9A 3NXBA 5AITA 4J3IA 1K2FA 3PURA 2FSAA 5E74A 5FE5A 2F6JA 3IU6A 3JVMA 4N4FA 2DX8A 4Z1SA 4HBVA 3O7AA 5CQ3A 5HFQA 5BT5A 5L8TA 3LJUX 3RPGB 3G0JA 5FE7A 5E9VA 2YEMA 4UYEA 5IGNA 2JM3A 5LJ1A 1IYMA 2XOYA 2EODA 4O62A 5B77A 2R0YA 5E9KA 3HCTA 4QSVA 2DVRA 4A9NA 2WP1A 5G0FA 4QSWA 3T9KA 5KTWA 4GPJA 5A83A 5HLSA 3O37A 4O7CA 4YATA 5G4RA 2FUUA 2VPEA 3HTKC 2LXHC 5EISA 4MR3A 4HXSA 3PUQA 3MB3A 2MNYA 2EGMA 3O36A 4QC1A 5E3GA 5DX4A 1FP0A 2ECTA 5BT3A 1DVPA 1WEUA 2D82A 2GRCA 3LRQA 5I88A 3SOWA 4CCGX 3PLWA 4GNFA 5IGMA 5CGPA 4QR4A 1VYXA 1HYIA 4I7CA 5IG6A 4TS8A 3T6RA 1VFYA 4O7BA 3FAOA 4YYDA 5CP5A 2LV9A 4AKHA 4OGEA 1JM7A 4YC9A 2YQDA 4IORA 5CQAA 4CFKA 2VJFA 4TTEA 4CUSA 2KWJA 4CLBA 5A5OA 3P1EA 3MUKA 4LZRA 2D9EA 5FFVA 5AMEA 5HELA 1LDKC 2YVRA 2YQMA 4QF3A 5TCMA 5FDZA 5F3AA 2YW8A 3T7LA 4QSSA 2F42A 4S3OC 5HRWA 2MJVB 4Y03A 5A82A 5LKTA 2XP0A 2YSMA 5FE6A 4XYAA 5D26A 3NG2A 3D7CA 3U5OA 4KV1A 5DW2A 5E73A 4MR6A 3KV6A 3O34A 5F63A 4OGIA 4LLBA 5KU3A 1X4UA 2NXBA 5ENHA 4A9HA 3UW9A 2KYUA 4QR5A 2KR4A 4HXLA 2YSJA 2KWNA 2KGGA 4AI6A 2MA5A 1CHCA 4A9JA 4WZ3B 3AADA 5CFWA 4O71A 5F60A 2KREA 2M3HA 3M99A 5DINA 4CUTA 1WE9A 3LQIA 2YUCA 4LJNA 4A0CD 1RMDA 5B75A 4CA1A 1XWHA 2MD7B 5B76A 5TBNA 4TT6A 5EU1A 4A9IA 3L11A 4R2YA 2DVSA 4UIVA 5I80A 4PKLA 4C67A 2L75A 2OWAA 3FM8C 5SVIB 3U5PA 2L43A 5D1LB 2YELA 4UYFB 5EGUA 1Z6UA 3I3JA 4BJXA 5EK9A 2ZETC 2ECVA 3UVDA 3JUEA 5LCWB 3JVKA 3SVFA 4O74A 4NS5A 4AYCA 5G04B 5G05B 2LGLA 2I8NA 3H7HA 4A9EA 4QYLA 2E3KA 4WHWA 4IC2A 4R8PK 3D1BA 4IOQA 3TLPA 3ZNIA 4WIVA 4QZSA 5I29A 4PCEA 5AMFA 4GNEA 3LXJA 4KCXA 5AIUA 4YABA 3UVWA 2MNZA 4XUBA 5I7XA 2MKEA 4KV4A 5H1VA 3LJWA 5JI8A 4XY8A 2RFJA 2C2LA 3DWYA 5DBMA 2DATA 4B7YC 5FFYA 3SHBA 4WHUA 1WUMA 3G0LA 2FUIA
chains in the Genus database with same CATH topology
5HJCA 5IGKA 5FH8A 2N9GA 4QSRA 4BHWA 3MHSA 4AP4A 5KH3A 2E6SA 5D3SA 2VJEA 5ACYA 2MA6A 2LQ6A 4A49A 4I7DA 4ZUXU 1WEMA 3O35A 4TT4A 1WENA 4UIYA 5EP7A 5CUGA 3FL2A 4LADB 2L5EA 2ECGA 4N3WA 3MQMA 4QC3A 5II1A 2LXPC 2YREA 5DLXA 3DQVR 5E9LA 5L99A 2K16A 5AD3A 2ECNA 4Z6IA 2YEKA 4YY4A 2JMDA 3LQJA 4NQNA 4FJCA 3K2JA 2L80A 5EPBA 1N72A 4NUCA 4L58A 2YHNA 3RPGC 5HFRA 2OO1A 5A85A 5TABA 4O75A 5DFCA 5A5NA 3U5JA 5LVRA 4PPEA 5CS8A 2K17A 4YAXA 2LDRA 5C8GA 4UI9B 4YADA 5HRVA 2K1JA 5KTUA 4A9LA 4IR5A 5EICA 4CFLA 2I50A 4QR3A 2KFTA 4FLPA 3GV4A 4GB0A 4YYMA 5HQ6A 4HBYA 5A5SA 5C13A 4TQNA 5ENGA 4FO9A 4UP5A 3UV2A 2K4DA 5DW1A 4IR4A 2RSDA 5JG6A 2LGKA 4A9OA 4DONA 4S3OB 5FG4A 5DKDA 2RNWA 5FH7A 4NR6A 4TT2A 4NR5A 5C4QA 5E9IA 5IBNA 5KH7A 3UV5A 3IU5A 2M1RA 4IR3A 5BT4A 1WEVA 4O7EA 3V43A 3JVJA 2R10A 5DYXA 4NYVA 2LGVA 2YW5A 1X0JA 4NUEA 4ALHA 1WEOA 5TDRA 3U5MA 5CRMA 5II2A 2G45A 4CUUA 5TB6A 2KWKA 4MEPA 4X3GA 3Q2EA 3N9MA 5EWWA 4J0SA 2RNYA 5ENFA 2XB1A 3VK6A 4NYXA 4YH4A 2R0VA 4MR4A 4O77A 5HEMA 4LRGA 4WA6A 4TU6A 5L97A 3DPLR 4NRCA 4P5OB 5DKHA 1WILA 3AQAA 5EWDA 5FE8A 5G4SA 4XI1A 2LGGA 4UP0A 2LN0A 5F5ZA 1WIMA 4UYDA 5CQ7A 5F1HA 4UYHA 2YT5A 4LYIA 5I3LA 5H1UA 2KE1A 5C85A 4L7XA 3M63A 5CUBA 5HENA 4BW1A 1JM4B 5D25A 4QY4A 4YYKA 4LR6A 3UVXA 3ASLA 5HQ5A 4GNGA 4MR5A 5CY9A 4BBQA 3FKMX 5A81A 4BW4A 5CUCA 5E0RA 5CQ4A 2IDAA 4XUAA 5DFDA 3EB6A 2UZGA 4QEVA 2ECIA 4QSQA 4J0RA 1EQFA 4QSPA 1U6GB 5FERA 2E7NA 5AD2A 2KTBB 5CU8A 5FBXA 3MHHA 3N9PA 5TDWA 3HMEA 3I2DA 4TU4A 5LKZA 4MVTA 2EGPA 4N4GA 2Y1MA 3N9NA 5TRBA 4YY6A 3EB5A 2MD8C 4WZ0A 4UIXA 5D1MB 4V3KC 2YU4A 5ETDA 2E7OA 4E96A 2L5UA 5LJ2A 4LZ2A 2CSYA 5EA1A 2BAYA 4B86C 5LVQA 2RNXA 5LUUA 2VNFA 2R0SA 3KNVA 3JVLA 4LKAA 4UIZA 3M62A 4HXRA 5EM3A 5FE4A 4NUDA 5FG5A 4LC2A 2JRJA 5FE2A 4PTBA 3O33A 5A5RA 4ALGA 4RVRA 4O64A 5FE9A 1F62A 2F6NA 1WEPA 3GL6A 4NQMA 5HM0A 4TZ8A 1HYJA 2DVVA 2L85A 3P1CA 5CQ8A 5D3NA 5EWCA 2PUYA 3QZTA 2HYED 4HBXA 1F68A 4HXKA 4QNSA 2KIZA 4F52B 4J1PA 4QEUA 5L8UA 3QZVA 4AVXA 4LYSA 5D3RA 5FE3A 1WFKA 2HDPA 5D3HA 4ZDTA 5I1QA 5EV9A 5DKAA 4C66A 4YYJA 4Q6FA 2D8SA 4O7FA 5FFWA 2C2VS 3UV4A 2VJEB 4CUPA 3Q2FA 2CSZA 1G25A 2H0DB 5LJ0A 5D3TA 3LQHA 2L0BA 2RS9B 2OXQC 5CUEA 2L84A 2Y43A 4YBMA 4UYGA 1JM7B 1MM3A 2MIQA 4QYDA 3L1XA 2DWWA 4QBMA 3P1DA 5F62A 4Z6HA 3C5KA 4IC3A 4HBWA 4YK0A 4NXJA 5F1LA 5KTXA 3C6WA 2AN6A 3MXFA 3SOXA 2JMJA 5DLZA 5HCLA 3MB4A 4F3IA 2QJ0A 5F2PA 2VPBA 4N4HA 2YYNA 4MENA 4NR7A 4AKNA 2H0DA 4TKPB 1FBVA 2VPDA 3MULA 5CUDA 3ZPV1 2VJFB 5D0CA 5A5QA 4NR9A 2CT2A 5COIA 4UYFA 3U5KA 5D24A 2H60A 4YBSA 5ETBA 5FE0A 5EWVA 3HCSA 3N9OA 5L98A 5LKXA 5CZGA 5H85A 4YH3A 2RO1A 4Q0OA 3KV5A 4C9ZA 4QF2A 4TZ2A 5E7DA 5IGLA 4O70A 1MM2A 4W4UA 4CUQA 1WEWA 4YYIA 1T1HA 2M85A 2OSSA 5D3JA 1WESA 5KO4A 2YQLA 2Y1NA 4FIPA 4AUQB 5EPRA 3ZTGA 3SOUA 2QICA 3ZVYA 2ECJA 5I86A 4FK5A 4HXOA 4UITA 3ZVZB 5C11A 3N9QA 4HXMA 5FH6A 2QIZA 4NRBA 5ENJA 3HMFA 1X4IA 5HRXA 2NAAA 5D7XA 5ENEA 5C89A 2KGIA 5DKCA 5B78A 2YHOA 4HXNA 4X2IA 3RTRB 2G6QA 5B79A 4IOOA 2XEUA 4PCIA 3KQIA 5EVAA 3P1FA 2E6RA 4QSTA 5KH9A 5F61A 5FE1A 4YBTA 5D3PA 4Q0NA 4YYHA 1ZS5A 4YYGA 3S91A 1E4UA 1JSPB 3GG3A 4TYLA 4I7BA 3UVYA 3HMHA 5CRZA 3O70A 3ONIA 4O78A 3U5LA 3RCWA 1Z60A 2MT5A 2PNXA 5H9MA 4ZW1A 3SVGA 3ZPVE 5EPSA 3ZYUA 4A9FA 3QZSA 2YYRA 5JWMA 2MUMA 2YDWA 4NYWA 2CKLB 1ZBDB 4LZSA 3ZYQA 4Z93A 4CURA 4O72A 4LYWA 4QB3A 4MSXA 5K29A 1JOCA 1WEEA 1Z2QA 5D3LA 4AYCB 2DKWA 2G4AA 4NR4A 5I83A 4PS5A 3PHDA 5CQTA 4OGJA 2VPGA 4WZ2A 4Z1QA 5FEYA 5FB0A 1BORA 5F25A 4LDFA 5CPEA 4A9MA 5DYAA 4BW3A 3N9LA 4NR8A 1WUGA 2RI7A 2VP7A 4MEOA 5LKUA 4IR6A 5I7YA 2LRIC 4MEQA 4OUFA 5ENIA 3L1ZB 5I89A 5CQ6A 5F36A 1X4JA 5DFBA 5E9YA 2M6MA 4QEWA 5ENCA 1V87A 5A7CA 4ZQLA 2I7KA 4BW2A 3DAIA 4NN2A 5IIDA 4R7EA 1VD4A 5E3DA 5D1KB 4NRAA 2ECWA 5KHMA 4N4IA 2KU3A 1LDJB 5HQ7A 5DYUA 2DVQA 4QUUA 5FB1A 5A5PA 5H1TA 5C7NA 4ZC9A 4PY6A 5C87A 1WGMA 4A4CA 4O76A 4QUTA 5E9MA 3IHPA 5CUAA 5CQ5A 5L96A 4XY9A 5CTLA 4UIUA 5J0DA 2CKLA 4A9KA 4QSXA 5I40A 4UIWA 1E6IA 5EQ1A 1N87A 4CL9A 2EA6A 5EWHA 3S92A 5J3XA 3P5OA 2YURA 5DYCA 3HCUA 2WP2A 4YYNA 3SVHA 4A4BA 4O7AA 2JMIA 2G43A 1WEQA 4HXPA 2OUOA 4GNDA 4QSUA 2LSPB 5ENBA 3U5NA 5EI4A 2KWOA 5FG6A 4V3LC 5DY7A 5EYAF 5B8DA 4LK9A 3NXBA 5AITA 4J3IA 1K2FA 3PURA 2FSAA 5E74A 5FE5A 2F6JA 3IU6A 3JVMA 4N4FA 2DX8A 4Z1SA 4HBVA 3O7AA 5CQ3A 5HFQA 5BT5A 5L8TA 3RPGB 3G0JA 5FE7A 5E9VA 2YEMA 4UYEA 5IGNA 1IYMA 5LJ1A 2EODA 5B77A 2R0YA 5E9KA 3HCTA 4QSVA 2DVRA 4A9NA 2WP1A 5G0FA 4QSWA 5KTWA 4GPJA 5A83A 5HLSA 3O37A 4O7CA 4YATA 5G4RA 2FUUA 2VPEA 3HTKC 2LXHC 5EISA 4MR3A 4HXSA 3PUQA 3MB3A 2MNYA 3O36A 4QC1A 5E3GA 5DX4A 1FP0A 2ECTA 5BT3A 1DVPA 1WEUA 2D82A 2GRCA 3LRQA 5I88A 3SOWA 4CCGX 4GNFA 5IGMA 5CGPA 4QR4A 1VYXA 1HYIA 4I7CA 5IG6A 4TS8A 3T6RA 1VFYA 4O7BA 4YYDA 5CP5A 2LV9A 1JM7A 4YC9A 2YQDA 4IORA 5CQAA 4CFKA 2VJFA 4TTEA 4CUSA 2KWJA 4CLBA 5A5OA 3P1EA 3MUKA 4LZRA 2D9EA 5FFVA 5AMEA 5HELA 1LDKC 4QF3A 2YQMA 5TCMA 5FDZA 5F3AA 2YW8A 3T7LA 4QSSA 2F42A 4S3OC 5HRWA 2MJVB 4Y03A 5A82A 5LKTA 2YSMA 5FE6A 4XYAA 5D26A 3NG2A 3D7CA 3U5OA 4KV1A 5DW2A 5E73A 4MR6A 3KV6A 3O34A 5F63A 4OGIA 4LLBA 5KU3A 1X4UA 2NXBA 5ENHA 4A9HA 3UW9A 2KYUA 4QR5A 2KR4A 4HXLA 2YSJA 2KWNA 2KGGA 2MA5A 1CHCA 4A9JA 4WZ3B 3AADA 5CFWA 4O71A 5F60A 2KREA 2M3HA 3M99A 5DINA 4CUTA 1WE9A 3LQIA 2YUCA 4LJNA 4A0CD 1RMDA 5B75A 4CA1A 1XWHA 2MD7B 5B76A 5TBNA 4TT6A 5EU1A 4A9IA 3L11A 4R2YA 2DVSA 4UIVA 5I80A 4PKLA 4C67A 2L75A 3U5PA 2L43A 5D1LB 2YELA 4UYFB 5EGUA 1Z6UA 3I3JA 4BJXA 5EK9A 2ZETC 2ECVA 3UVDA 5LCWB 3JVKA 3SVFA 4O74A 4NS5A 4AYCA 5G04B 5G05B 2LGLA 2I8NA 4A9EA 4QYLA 2E3KA 4WHWA 4IC2A 4R8PK 4IOQA 3TLPA 3ZNIA 4WIVA 4QZSA 5I29A 4PCEA 5AMFA 4GNEA 3LXJA 4KCXA 5AIUA 4YABA 3UVWA 2MNZA 4XUBA 5I7XA 4KV4A 5H1VA 3LJWA 5JI8A 4XY8A 2RFJA 2C2LA 3DWYA 5DBMA 2DATA 4B7YC 5FFYA 3SHBA 4WHUA 1WUMA 3G0LA 2FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HJC A;  5IGK A;  5FH8 A;  2N9G A;  4QSR A;  4BHW A;  3MHS A;  4AP4 A;  5KH3 A;  2E6S A;  5D3S A;  2VJE A;  5ACY A;  2MA6 A;  2LQ6 A;  4A49 A;  4I7D A;  4ZUX U;  1WEM A;  3O35 A;  4TT4 A;  1WEN A;  4UIY A;  5EP7 A;  5CUG A;  3FL2 A;  4LAD B;  2L5E A;  2ECG A;  4N3W A;  3MQM A;  4QC3 A;  5II1 A;  2LXP C;  2YRE A;  5DLX A;  3DQV R;  5E9L A;  5L99 A;  2K16 A;  5AD3 A;  2ECN A;  4Z6I A;  2YEK A;  4YY4 A;  2JMD A;  3LQJ A;  4NQN A;  4FJC A;  3K2J A;  2L80 A;  5EPB A;  1N72 A;  4NUC A;  4L58 A;  2YHN A;  3RPG C;  5HFR A;  2OO1 A;  5A85 A;  5TAB A;  4O75 A;  5DFC A;  5A5N A;  3U5J A;  5LVR A;  4PPE A;  5CS8 A;  2K17 A;  4YAX A;  2LDR A;  5C8G A;  4UI9 B;  4YAD A;  5HRV A;  2K1J A;  5KTU A;  4A9L A;  4IR5 A;  5EIC A;  4CFL A;  2I50 A;  4QR3 A;  2KFT A;  4FLP A;  3GV4 A;  4GB0 A;  4YYM A;  5HQ6 A;  4HBY A;  5A5S A;  5C13 A;  4TQN A;  5ENG A;  4FO9 A;  4UP5 A;  3UV2 A;  2K4D A;  5DW1 A;  4IR4 A;  2RSD A;  5JG6 A;  2LGK A;  4A9O A;  4DON A;  4S3O B;  5FG4 A;  5DKD A;  2RNW A;  5FH7 A;  4NR6 A;  4TT2 A;  4NR5 A;  5C4Q A;  5E9I A;  5IBN A;  5KH7 A;  3UV5 A;  3IU5 A;  2M1R A;  4IR3 A;  5BT4 A;  1WEV A;  4O7E A;  3V43 A;  3JVJ A;  2R10 A;  5DYX A;  4NYV A;  2LGV A;  2YW5 A;  1X0J A;  4NUE A;  4ALH A;  1WEO A;  5TDR A;  3U5M A;  5CRM A;  5II2 A;  2G45 A;  4CUU A;  5TB6 A;  2KWK A;  4MEP A;  4X3G A;  3Q2E A;  3N9M A;  5EWW A;  4J0S A;  2RNY A;  5ENF A;  2XB1 A;  3VK6 A;  4NYX A;  4YH4 A;  2R0V A;  4MR4 A;  4O77 A;  5HEM A;  4LRG A;  4WA6 A;  4TU6 A;  5L97 A;  3DPL R;  4NRC A;  4P5O B;  5DKH A;  1WIL A;  3AQA A;  5EWD A;  5FE8 A;  5G4S A;  4XI1 A;  2LGG A;  4UP0 A;  2LN0 A;  5F5Z A;  1WIM A;  4UYD A;  5CQ7 A;  5F1H A;  4UYH A;  2YT5 A;  4LYI A;  5I3L A;  5H1U A;  2KE1 A;  5C85 A;  4L7X A;  3M63 A;  5CUB A;  5HEN A;  4BW1 A;  1JM4 B;  5D25 A;  4QY4 A;  4YYK A;  4LR6 A;  3UVX A;  3ASL A;  5HQ5 A;  4GNG A;  4MR5 A;  5CY9 A;  4BBQ A;  3FKM X;  5A81 A;  4BW4 A;  5CUC A;  5E0R A;  5CQ4 A;  2IDA A;  4XUA A;  5DFD A;  3EB6 A;  2UZG A;  4QEV A;  2ECI A;  4QSQ A;  4J0R A;  1EQF A;  4QSP A;  1U6G B;  5FER A;  2E7N A;  5AD2 A;  2KTB B;  5CU8 A;  5FBX A;  3MHH A;  3N9P A;  5TDW A;  3HME A;  3I2D A;  4TU4 A;  5LKZ A;  4MVT A;  2EGP A;  4N4G A;  2Y1M A;  3N9N A;  5TRB A;  4YY6 A;  3EB5 A;  2MD8 C;  4WZ0 A;  4UIX A;  5D1M B;  4V3K C;  2YU4 A;  5ETD A;  2E7O A;  4E96 A;  2L5U A;  5LJ2 A;  4LZ2 A;  2CSY A;  5EA1 A;  2BAY A;  4B86 C;  5LVQ A;  2RNX A;  5LUU A;  2VNF A;  2R0S A;  3KNV A;  3JVL A;  4LKA A;  4UIZ A;  3M62 A;  4HXR A;  5EM3 A;  5FE4 A;  4NUD A;  5FG5 A;  4LC2 A;  2JRJ A;  5FE2 A;  4PTB A;  3O33 A;  5A5R A;  4ALG A;  4RVR A;  4O64 A;  5FE9 A;  1F62 A;  2F6N A;  1WEP A;  3GL6 A;  4NQM A;  5HM0 A;  4TZ8 A;  1HYJ A;  2DVV A;  2L85 A;  3P1C A;  5CQ8 A;  5D3N A;  5EWC A;  2PUY A;  3QZT A;  2HYE D;  4HBX A;  1F68 A;  4HXK A;  4QNS A;  2KIZ A;  4F52 B;  4J1P A;  4QEU A;  5L8U A;  3QZV A;  4AVX A;  4LYS A;  5D3R A;  5FE3 A;  1WFK A;  2HDP A;  5D3H A;  4ZDT A;  5I1Q A;  5EV9 A;  5DKA A;  4C66 A;  4YYJ A;  4Q6F A;  2D8S A;  4O7F A;  5FFW A;  2C2V S;  3UV4 A;  2VJE B;  4CUP A;  3Q2F A;  2CSZ A;  1G25 A;  2H0D B;  5LJ0 A;  5D3T A;  3LQH A;  2L0B A;  2RS9 B;  2OXQ C;  5CUE A;  2L84 A;  2Y43 A;  4YBM A;  4UYG A;  1JM7 B;  1MM3 A;  2MIQ A;  4QYD A;  3L1X A;  2DWW A;  4QBM A;  3P1D A;  5F62 A;  4Z6H A;  3C5K A;  4IC3 A;  4HBW A;  4YK0 A;  4NXJ A;  5F1L A;  5KTX A;  3C6W A;  2AN6 A;  3MXF A;  3SOX A;  2JMJ A;  5DLZ A;  5HCL A;  3MB4 A;  4F3I A;  2QJ0 A;  5F2P A;  2VPB A;  4N4H A;  2YYN A;  4MEN A;  4NR7 A;  4AKN A;  2H0D A;  4TKP B;  1FBV A;  2VPD A;  3MUL A;  5CUD A;  3ZPV 1;  2VJF B;  5D0C A;  5A5Q A;  4NR9 A;  2CT2 A;  5COI A;  4UYF A;  3U5K A;  5D24 A;  2H60 A;  4YBS A;  5ETB A;  5FE0 A;  5EWV A;  3HCS A;  3N9O A;  5L98 A;  5LKX A;  5CZG A;  5H85 A;  4YH3 A;  2RO1 A;  4Q0O A;  3KV5 A;  4C9Z A;  4QF2 A;  4TZ2 A;  5E7D A;  5IGL A;  4O70 A;  1MM2 A;  4W4U A;  4CUQ A;  1WEW A;  4YYI A;  1T1H A;  2M85 A;  2OSS A;  5D3J A;  1WES A;  5KO4 A;  2YQL A;  2Y1N A;  4FIP A;  4AUQ B;  5EPR A;  3ZTG A;  3SOU A;  2QIC A;  3ZVY A;  2ECJ A;  5I86 A;  4FK5 A;  4HXO A;  4UIT A;  3ZVZ B;  5C11 A;  3N9Q A;  4HXM A;  5FH6 A;  2QIZ A;  4NRB A;  5ENJ A;  3HMF A;  1X4I A;  5HRX A;  2NAA A;  5D7X A;  5ENE A;  5C89 A;  2KGI A;  5DKC A;  5B78 A;  2YHO A;  4HXN A;  4X2I A;  3RTR B;  2G6Q A;  5B79 A;  4IOO A;  2XEU A;  4PCI A;  3KQI A;  5EVA A;  3P1F A;  2E6R A;  4QST A;  5KH9 A;  5F61 A;  5FE1 A;  4YBT A;  5D3P A;  4Q0N A;  4YYH A;  1ZS5 A;  4YYG A;  3S91 A;  1E4U A;  1JSP B;  3GG3 A;  4TYL A;  4I7B A;  3UVY A;  3HMH A;  5CRZ A;  3O70 A;  3ONI A;  4O78 A;  3U5L A;  3RCW A;  1Z60 A;  2MT5 A;  2PNX A;  5H9M A;  4ZW1 A;  3SVG A;  3ZPV E;  5EPS A;  3ZYU A;  4A9F A;  3QZS A;  2YYR A;  5JWM A;  2MUM A;  2YDW A;  4NYW A;  2CKL B;  1ZBD B;  4LZS A;  3ZYQ A;  4Z93 A;  4CUR A;  4O72 A;  4LYW A;  4QB3 A;  4MSX A;  5K29 A;  1JOC A;  1WEE A;  1Z2Q A;  5D3L A;  4AYC B;  2DKW A;  2G4A A;  4NR4 A;  5I83 A;  4PS5 A;  3PHD A;  5CQT A;  4OGJ A;  2VPG A;  4WZ2 A;  4Z1Q A;  5FEY A;  5FB0 A;  1BOR A;  5F25 A;  4LDF A;  5CPE A;  4A9M A;  5DYA A;  4BW3 A;  3N9L A;  4NR8 A;  1WUG A;  2RI7 A;  2VP7 A;  4MEO A;  5LKU A;  4IR6 A;  5I7Y A;  2LRI C;  4MEQ A;  4OUF A;  5ENI A;  3L1Z B;  5I89 A;  5CQ6 A;  5F36 A;  1X4J A;  5DFB A;  5E9Y A;  2M6M A;  4QEW A;  5ENC A;  1V87 A;  5A7C A;  4ZQL A;  2I7K A;  4BW2 A;  3DAI A;  4NN2 A;  5IID A;  4R7E A;  1VD4 A;  5E3D A;  5D1K B;  4NRA A;  2ECW A;  5KHM A;  4N4I A;  2KU3 A;  1LDJ B;  5HQ7 A;  5DYU A;  2DVQ A;  4QUU A;  5FB1 A;  5A5P A;  5H1T A;  5C7N A;  4ZC9 A;  4PY6 A;  5C87 A;  1WGM A;  4A4C A;  4O76 A;  4QUT A;  5E9M A;  3IHP A;  5CUA A;  5CQ5 A;  5L96 A;  4XY9 A;  5CTL A;  4UIU A;  5J0D A;  2CKL A;  4A9K A;  4QSX A;  5I40 A;  4UIW A;  1E6I A;  5EQ1 A;  1N87 A;  4CL9 A;  2EA6 A;  5EWH A;  3S92 A;  5J3X A;  3P5O A;  2YUR A;  5DYC A;  3HCU A;  2WP2 A;  4YYN A;  3SVH A;  4A4B A;  4O7A A;  2JMI A;  2G43 A;  1WEQ A;  4HXP A;  2OUO A;  4GND A;  4QSU A;  2LSP B;  5ENB A;  3U5N A;  5EI4 A;  2KWO A;  5FG6 A;  4V3L C;  5DY7 A;  5EYA F;  5B8D A;  4LK9 A;  3NXB A;  5AIT A;  4J3I A;  1K2F A;  3PUR A;  2FSA A;  5E74 A;  5FE5 A;  2F6J A;  3IU6 A;  3JVM A;  4N4F A;  2DX8 A;  4Z1S A;  4HBV A;  3O7A A;  5CQ3 A;  5HFQ A;  5BT5 A;  5L8T A;  3RPG B;  3G0J A;  5FE7 A;  5E9V A;  2YEM A;  4UYE A;  5IGN A;  1IYM A;  5LJ1 A;  2EOD A;  5B77 A;  2R0Y A;  5E9K A;  3HCT A;  4QSV A;  2DVR A;  4A9N A;  2WP1 A;  5G0F A;  4QSW A;  5KTW A;  4GPJ A;  5A83 A;  5HLS A;  3O37 A;  4O7C A;  4YAT A;  5G4R A;  2FUU A;  2VPE A;  3HTK C;  2LXH C;  5EIS A;  4MR3 A;  4HXS A;  3PUQ A;  3MB3 A;  2MNY A;  3O36 A;  4QC1 A;  5E3G A;  5DX4 A;  1FP0 A;  2ECT A;  5BT3 A;  1DVP A;  1WEU A;  2D82 A;  2GRC A;  3LRQ A;  5I88 A;  3SOW A;  4CCG X;  4GNF A;  5IGM A;  5CGP A;  4QR4 A;  1VYX A;  1HYI A;  4I7C A;  5IG6 A;  4TS8 A;  3T6R A;  1VFY A;  4O7B A;  4YYD A;  5CP5 A;  2LV9 A;  1JM7 A;  4YC9 A;  2YQD A;  4IOR A;  5CQA A;  4CFK A;  2VJF A;  4TTE A;  4CUS A;  2KWJ A;  4CLB A;  5A5O A;  3P1E A;  3MUK A;  4LZR A;  2D9E A;  5FFV A;  5AME A;  5HEL A;  1LDK C;  4QF3 A;  2YQM A;  5TCM A;  5FDZ A;  5F3A A;  2YW8 A;  3T7L A;  4QSS A;  2F42 A;  4S3O C;  5HRW A;  2MJV B;  4Y03 A;  5A82 A;  5LKT A;  2YSM A;  5FE6 A;  4XYA A;  5D26 A;  3NG2 A;  3D7C A;  3U5O A;  4KV1 A;  5DW2 A;  5E73 A;  4MR6 A;  3KV6 A;  3O34 A;  5F63 A;  4OGI A;  4LLB A;  5KU3 A;  1X4U A;  2NXB A;  5ENH A;  4A9H A;  3UW9 A;  2KYU A;  4QR5 A;  2KR4 A;  4HXL A;  2YSJ A;  2KWN A;  2KGG A;  2MA5 A;  1CHC A;  4A9J A;  4WZ3 B;  3AAD A;  5CFW A;  4O71 A;  5F60 A;  2KRE A;  2M3H A;  3M99 A;  5DIN A;  4CUT A;  1WE9 A;  3LQI A;  2YUC A;  4LJN A;  4A0C D;  1RMD A;  5B75 A;  4CA1 A;  1XWH A;  2MD7 B;  5B76 A;  5TBN A;  4TT6 A;  5EU1 A;  4A9I A;  3L11 A;  4R2Y A;  2DVS A;  4UIV A;  5I80 A;  4PKL A;  4C67 A;  2L75 A;  3U5P A;  2L43 A;  5D1L B;  2YEL A;  4UYF B;  5EGU A;  1Z6U A;  3I3J A;  4BJX A;  5EK9 A;  2ZET C;  2ECV A;  3UVD A;  5LCW B;  3JVK A;  3SVF A;  4O74 A;  4NS5 A;  4AYC A;  5G04 B;  5G05 B;  2LGL A;  2I8N A;  4A9E A;  4QYL A;  2E3K A;  4WHW A;  4IC2 A;  4R8P K;  4IOQ A;  3TLP A;  3ZNI A;  4WIV A;  4QZS A;  5I29 A;  4PCE A;  5AMF A;  4GNE A;  3LXJ A;  4KCX A;  5AIU A;  4YAB A;  3UVW A;  2MNZ A;  4XUB A;  5I7X A;  4KV4 A;  5H1V A;  3LJW A;  5JI8 A;  4XY8 A;  2RFJ A;  2C2L A;  3DWY A;  5DBM A;  2DAT A;  4B7Y C;  5FFY A;  3SHB A;  4WHU A;  1WUM A;  3G0L A;  2FUI A; 
#chains in the Genus database with same CATH topology
 5HJC A;  5IGK A;  5FH8 A;  2N9G A;  4QSR A;  4BHW A;  3MHS A;  4AP4 A;  5KH3 A;  2E6S A;  5D3S A;  2VJE A;  5ACY A;  2MA6 A;  2LQ6 A;  4A49 A;  4I7D A;  3FJU B;  2L7P A;  4ZUX U;  1WEM A;  3O35 A;  4TT4 A;  1WEN A;  4UIY A;  5EP7 A;  5CUG A;  2JUN A;  3FL2 A;  2L5E A;  2ECG A;  4LAD B;  4N3W A;  3MQM A;  4QC3 A;  5II1 A;  2LXP C;  2YRE A;  5DLX A;  3DQV R;  5E9L A;  5L99 A;  2K16 A;  5AD3 A;  4AKG A;  2ECN A;  4Z6I A;  3O47 A;  2YEK A;  4YY4 A;  2JMD A;  3LQJ A;  4NQN A;  4FJC A;  3K2J A;  2L80 A;  5EPB A;  1N72 A;  4NUC A;  4L58 A;  2YHN A;  3RPG C;  5HFR A;  2OO1 A;  5A85 A;  5TAB A;  4O75 A;  5DFC A;  5A5N A;  3U5J A;  5LVR A;  4PPE A;  5CS8 A;  2K17 A;  4YAX A;  4AKI A;  5C8G A;  2LDR A;  4UI9 B;  4YAD A;  5HRV A;  2K1J A;  5KTU A;  4A9L A;  4IR5 A;  5EIC A;  4CFL A;  2I50 A;  4QR3 A;  2KFT A;  4FLP A;  3GV4 A;  4GB0 A;  4YYM A;  5HQ6 A;  4HBY A;  5A5S A;  5C13 A;  4TQN A;  5ENG A;  4FO9 A;  4UP5 A;  3UV2 A;  2K4D A;  5DW1 A;  4IR4 A;  2RSD A;  5K3Q A;  5JG6 A;  2LGK A;  4A9O A;  4DON A;  4S3O B;  5FG4 A;  5DKD A;  2RNW A;  5FH7 A;  4NR6 A;  4TT2 A;  4NR5 A;  5C4Q A;  5E9I A;  5IBN A;  2CRW A;  5KH7 A;  3UV5 A;  3IU5 A;  2M1R A;  4IR3 A;  2FFW A;  5BT4 A;  1WEV A;  4O7E A;  2M13 A;  3JVJ A;  3V43 A;  2R10 A;  5DYX A;  4NYV A;  2LGV A;  2YW5 A;  1X0J A;  4NUE A;  4ALH A;  1WEO A;  5TDR A;  3U5M A;  5CRM A;  4F1P A;  2B0O E;  5II2 A;  2G45 A;  4CUU A;  5TB6 A;  2KWK A;  4MEP A;  3MDB C;  4X3G A;  3Q2E A;  3N9M A;  5EWW A;  4J0S A;  2RNY A;  5ENF A;  2XB1 A;  3VK6 A;  4NYX A;  4YH4 A;  2R0V A;  4MR4 A;  4O77 A;  5HEM A;  4LRG A;  4WA6 A;  4TU6 A;  5L97 A;  3DPL R;  4NRC A;  4P5O B;  5DKH A;  1WIL A;  3AQA A;  5EWD A;  5FE8 A;  5G4S A;  4XI1 A;  2LGG A;  3LDY A;  4UP0 A;  2LN0 A;  5F5Z A;  1WIM A;  4UYD A;  5CQ7 A;  5F1H A;  3Q1D A;  4UYH A;  2YT5 A;  4LYI A;  5I3L A;  5H1U A;  2KE1 A;  5C85 A;  4L7X A;  3M63 A;  5CUB A;  5HEN A;  4BW1 A;  1JM4 B;  5D25 A;  4QY4 A;  4YYK A;  4LR6 A;  3UVX A;  3ASL A;  5HQ5 A;  4GNG A;  4MR5 A;  5CY9 A;  4BBQ A;  3FKM X;  5A81 A;  2EXU A;  4BW4 A;  5CUC A;  5E0R A;  5CQ4 A;  2IDA A;  4XUA A;  5DFD A;  3EB6 A;  2UZG A;  4QEV A;  2ECI A;  4QSQ A;  4J0R A;  1EQF A;  4QSP A;  1U6G B;  5FER A;  1PUO A;  2E7N A;  5AD2 A;  2KTB B;  5CU8 A;  5FBX A;  3MHH A;  3N9P A;  5TDW A;  5SVI A;  3HME A;  3I2D A;  4TU4 A;  5LKZ A;  4MVT A;  2EGP A;  4N4G A;  2Y1M A;  3N9N A;  5TRB A;  4YY6 A;  3EB5 A;  3KDE C;  4Z0O A;  2MD8 C;  4WZ0 A;  4UIX A;  3FEH A;  5D1M B;  4V3K C;  2YU4 A;  2FD4 A;  5ETD A;  1ZKR A;  2DJA A;  2E7O A;  4E96 A;  2L5U A;  5LJ2 A;  4LZ2 A;  2CSY A;  5EA1 A;  2BAY A;  4B86 C;  5LVQ A;  2RNX A;  5LUU A;  2VNF A;  2R0S A;  3KNV A;  3JVL A;  4LKA A;  4UIZ A;  3M62 A;  4HXR A;  5EM3 A;  5FE4 A;  4NUD A;  5FG5 A;  4LC2 A;  2JRJ A;  5FE2 A;  3FAN A;  4PTB A;  3O33 A;  5A5R A;  4ALG A;  4RVR A;  4O64 A;  5FE9 A;  1F62 A;  2F6N A;  1WEP A;  2P57 A;  3GL6 A;  4NQM A;  5HM0 A;  4TZ8 A;  1HYJ A;  2DVV A;  2L85 A;  3P1C A;  5CQ8 A;  5D3N A;  5EWC A;  2PUY A;  3QZT A;  2HYE D;  4HBX A;  1F68 A;  3M7K A;  4HXK A;  4QNS A;  2KIZ A;  4F52 B;  4J1P A;  4QEU A;  5L8U A;  3SUB A;  3QZV A;  4AVX A;  4Z0R A;  4LYS A;  5D3R A;  5FE3 A;  1WFK A;  2HDP A;  5D3H A;  4ZDT A;  5I1Q A;  5EV9 A;  5DKA A;  4C66 A;  4YYJ A;  2XOC A;  4Q6F A;  2D8S A;  4H9D A;  4O7F A;  5FFW A;  2C2V S;  3UV4 A;  2VJE B;  1MBM A;  4CUP A;  3Q2F A;  2CSZ A;  2IQJ A;  1G25 A;  2H0D B;  5LJ0 A;  5D3T A;  3LQH A;  2L0B A;  2RS9 B;  2OXQ C;  5CUE A;  2L84 A;  2CRR A;  2Y43 A;  4YBM A;  4UYG A;  1JM7 B;  1MM3 A;  2MIQ A;  4QYD A;  3L1X A;  2DWW A;  4QBM A;  3P1D A;  5F62 A;  4Z6H A;  3C5K A;  4IC3 A;  4HBW A;  4YK0 A;  4NXJ A;  5F1L A;  3LVQ E;  5KTX A;  3C6W A;  2AN6 A;  3MXF A;  3SOX A;  2JMJ A;  5DLZ A;  5HCL A;  3MB4 A;  4F3I A;  2QJ0 A;  5F2P A;  2VPB A;  4N4H A;  2YYN A;  4MEN A;  4OGC A;  4NR7 A;  4AKN A;  2H0D A;  4TKP B;  1FBV A;  2VPD A;  3MUL A;  5CUD A;  3LVR E;  2VJF B;  5D0C A;  5A5Q A;  3ZPV 1;  4NR9 A;  2CT2 A;  5COI A;  4UYF A;  3U5K A;  5D24 A;  2H60 A;  4YBS A;  5ETB A;  5FE0 A;  5EWV A;  2E61 A;  3HCS A;  3N9O A;  5L98 A;  5LKX A;  5CZG A;  5H85 A;  4YH3 A;  2RO1 A;  4Q0O A;  2CSV A;  3KV5 A;  4QF2 A;  4TZ2 A;  5E7D A;  5IGL A;  4O70 A;  4C9Z A;  1MM2 A;  3DDT A;  4W4U A;  4CUQ A;  1WEW A;  4YYI A;  1T1H A;  2M85 A;  2OSS A;  5D3J A;  1WES A;  5KO4 A;  2YQL A;  2Y1N A;  4FIP A;  4AUQ B;  5EPR A;  3ZTG A;  3SOU A;  2QIC A;  3ZVY A;  2ECJ A;  5I86 A;  4FK5 A;  3ERR A;  4HXO A;  4UIT A;  3ZVZ B;  5C11 A;  5SVY A;  3N9Q A;  4HXM A;  5FH6 A;  2QIZ A;  4NRB A;  4QQ4 A;  5ENJ A;  3HMF A;  1X4I A;  5HRX A;  2NAA A;  5D7X A;  5ENE A;  5C89 A;  2KGI A;  5DKC A;  5B78 A;  2YHO A;  4HXN A;  4X2I A;  3RTR B;  2G6Q A;  5B79 A;  4IOO A;  2XEU A;  4PCI A;  3KQI A;  5EVA A;  3P1F A;  2E6R A;  4QST A;  5KH9 A;  5F61 A;  5FE1 A;  4YBT A;  5D3P A;  4Q0N A;  2CON A;  4YYH A;  1ZS5 A;  4YYG A;  3S91 A;  1E4U A;  1JSP B;  3GG3 A;  4TYL A;  4I7B A;  2XOZ A;  3UVY A;  3HMH A;  5CRZ A;  3O70 A;  3ONI A;  4O78 A;  3U5L A;  3RCW A;  1Z60 A;  2MT5 A;  2PNX A;  5H9M A;  4ZW1 A;  3SVG A;  3ZPV E;  5EPS A;  3ZYU A;  4A9F A;  3QZS A;  2YYR A;  5JWM A;  2MUM A;  5SVX A;  2YDW A;  4NYW A;  3E2D A;  2CKL B;  1ZBD B;  4LZS A;  3ZYQ A;  4Z93 A;  4CUR A;  4O72 A;  4LYW A;  4QB3 A;  4MSX A;  2LAU A;  5K29 A;  2KKX A;  1JOC A;  1WEE A;  1Z2Q A;  5D3L A;  4AYC B;  2DKW A;  2G4A A;  4NR4 A;  5I83 A;  4PS5 A;  3PHD A;  5CQT A;  4OGJ A;  2VPG A;  4WZ2 A;  4Z1Q A;  3VKH A;  5FEY A;  5FB0 A;  1BOR A;  5F25 A;  4LDF A;  5CPE A;  4A9M A;  5DYA A;  4BW3 A;  3N9L A;  4NR8 A;  1WUG A;  2RI7 A;  2VP7 A;  4MEO A;  5LKU A;  4IR6 A;  5I7Y A;  2LRI C;  4MEQ A;  4OUF A;  5ENI A;  2D8U A;  3L1Z B;  5I89 A;  5CQ6 A;  5F36 A;  1X4J A;  5DFB A;  5E9Y A;  2M6M A;  4QEW A;  5ENC A;  1V87 A;  5A7C A;  4ZQL A;  2I7K A;  4BW2 A;  3DAI A;  4NN2 A;  5IID A;  4R7E A;  1VD4 A;  5E3D A;  5D1K B;  4NRA A;  2ECW A;  5KHM A;  4N4I A;  2DSM A;  1LDJ B;  5HQ7 A;  2KU3 A;  5DYU A;  2DVQ A;  4QUU A;  5FB1 A;  5A5P A;  5H1T A;  5C7N A;  4ZC9 A;  4PY6 A;  5C87 A;  1WGM A;  4A4C A;  4O76 A;  4QUT A;  5E9M A;  3IHP A;  5CUA A;  5CQ5 A;  3VKG A;  5L96 A;  4XY9 A;  5CTL A;  4UIU A;  5J0D A;  2CKL A;  4A9K A;  2RR4 A;  4QSX A;  5I40 A;  4UIW A;  1E6I A;  3D1D A;  5EQ1 A;  1N87 A;  4CL9 A;  2EA6 A;  5EWH A;  3S92 A;  5J3X A;  3P5O A;  2YUR A;  5DYC A;  3HCU A;  2WP2 A;  4YYN A;  3SVH A;  4A4B A;  4O7A A;  1DCQ A;  2JMI A;  2G43 A;  1WEQ A;  4HXP A;  2OUO A;  4GND A;  4QSU A;  2LSP B;  3DWD A;  5ENB A;  3U5N A;  5EI4 A;  2KWO A;  5FG6 A;  4V3L C;  2EJN A;  5DY7 A;  2KKY A;  5EYA F;  5B8D A;  4LK9 A;  3NXB A;  5AIT A;  4J3I A;  1K2F A;  3PUR A;  2FSA A;  5E74 A;  5FE5 A;  2F6J A;  3IU6 A;  3JVM A;  4N4F A;  2DX8 A;  4Z1S A;  4HBV A;  3O7A A;  5CQ3 A;  5HFQ A;  5BT5 A;  5L8T A;  3LJU X;  3RPG B;  3G0J A;  5FE7 A;  5E9V A;  2YEM A;  4UYE A;  5IGN A;  2JM3 A;  5LJ1 A;  1IYM A;  2XOY A;  2EOD A;  4O62 A;  5B77 A;  2R0Y A;  5E9K A;  3HCT A;  4QSV A;  2DVR A;  4A9N A;  2WP1 A;  5G0F A;  4QSW A;  3T9K A;  5KTW A;  4GPJ A;  5A83 A;  5HLS A;  3O37 A;  4O7C A;  4YAT A;  5G4R A;  2FUU A;  2VPE A;  3HTK C;  2LXH C;  5EIS A;  4MR3 A;  4HXS A;  3PUQ A;  3MB3 A;  2MNY A;  2EGM A;  3O36 A;  4QC1 A;  5E3G A;  5DX4 A;  1FP0 A;  2ECT A;  5BT3 A;  1DVP A;  1WEU A;  2D82 A;  2GRC A;  3LRQ A;  5I88 A;  3SOW A;  4CCG X;  3PLW A;  4GNF A;  5IGM A;  5CGP A;  4QR4 A;  1VYX A;  1HYI A;  4I7C A;  5IG6 A;  4TS8 A;  3T6R A;  1VFY A;  4O7B A;  3FAO A;  4YYD A;  5CP5 A;  2LV9 A;  4AKH A;  4OGE A;  1JM7 A;  4YC9 A;  2YQD A;  4IOR A;  5CQA A;  4CFK A;  2VJF A;  4TTE A;  4CUS A;  2KWJ A;  4CLB A;  5A5O A;  3P1E A;  3MUK A;  4LZR A;  2D9E A;  5FFV A;  5AME A;  5HEL A;  1LDK C;  2YVR A;  2YQM A;  4QF3 A;  5TCM A;  5FDZ A;  5F3A A;  2YW8 A;  3T7L A;  4QSS A;  2F42 A;  4S3O C;  5HRW A;  2MJV B;  4Y03 A;  5A82 A;  5LKT A;  2XP0 A;  2YSM A;  5FE6 A;  4XYA A;  5D26 A;  3NG2 A;  3D7C A;  3U5O A;  4KV1 A;  5DW2 A;  5E73 A;  4MR6 A;  3KV6 A;  3O34 A;  5F63 A;  4OGI A;  4LLB A;  5KU3 A;  1X4U A;  2NXB A;  5ENH A;  4A9H A;  3UW9 A;  2KYU A;  4QR5 A;  2KR4 A;  4HXL A;  2YSJ A;  2KWN A;  2KGG A;  4AI6 A;  2MA5 A;  1CHC A;  4A9J A;  4WZ3 B;  3AAD A;  5CFW A;  4O71 A;  5F60 A;  2KRE A;  2M3H A;  3M99 A;  5DIN A;  4CUT A;  1WE9 A;  3LQI A;  2YUC A;  4LJN A;  4A0C D;  1RMD A;  5B75 A;  4CA1 A;  1XWH A;  2MD7 B;  5B76 A;  5TBN A;  4TT6 A;  5EU1 A;  4A9I A;  3L11 A;  4R2Y A;  2DVS A;  4UIV A;  5I80 A;  4PKL A;  4C67 A;  2L75 A;  2OWA A;  3FM8 C;  5SVI B;  3U5P A;  2L43 A;  5D1L B;  2YEL A;  4UYF B;  5EGU A;  1Z6U A;  3I3J A;  4BJX A;  5EK9 A;  2ZET C;  2ECV A;  3UVD A;  3JUE A;  5LCW B;  3JVK A;  3SVF A;  4O74 A;  4NS5 A;  4AYC A;  5G04 B;  5G05 B;  2LGL A;  2I8N A;  3H7H A;  4A9E A;  4QYL A;  2E3K A;  4WHW A;  4IC2 A;  4R8P K;  3D1B A;  4IOQ A;  3TLP A;  3ZNI A;  4WIV A;  4QZS A;  5I29 A;  4PCE A;  5AMF A;  4GNE A;  3LXJ A;  4KCX A;  5AIU A;  4YAB A;  3UVW A;  2MNZ A;  4XUB A;  5I7X A;  2MKE A;  4KV4 A;  5H1V A;  3LJW A;  5JI8 A;  4XY8 A;  2RFJ A;  2C2L A;  3DWY A;  5DBM A;  2DAT A;  4B7Y C;  5FFY A;  3SHB A;  4WHU A;  1WUM A;  3G0L A;  2FUI A; 
#chains in the Genus database with same CATH homology
 5HJC A;  5IGK A;  5FH8 A;  2N9G A;  4QSR A;  4BHW A;  3MHS A;  4AP4 A;  5KH3 A;  2E6S A;  5D3S A;  2VJE A;  5ACY A;  2MA6 A;  2LQ6 A;  4A49 A;  4I7D A;  4ZUX U;  1WEM A;  3O35 A;  4TT4 A;  1WEN A;  4UIY A;  5EP7 A;  5CUG A;  3FL2 A;  4LAD B;  2L5E A;  2ECG A;  4N3W A;  3MQM A;  4QC3 A;  5II1 A;  2LXP C;  2YRE A;  5DLX A;  3DQV R;  5E9L A;  5L99 A;  2K16 A;  5AD3 A;  2ECN A;  4Z6I A;  2YEK A;  4YY4 A;  2JMD A;  3LQJ A;  4NQN A;  4FJC A;  3K2J A;  2L80 A;  5EPB A;  1N72 A;  4NUC A;  4L58 A;  2YHN A;  3RPG C;  5HFR A;  2OO1 A;  5A85 A;  5TAB A;  4O75 A;  5DFC A;  5A5N A;  3U5J A;  5LVR A;  4PPE A;  5CS8 A;  2K17 A;  4YAX A;  2LDR A;  5C8G A;  4UI9 B;  4YAD A;  5HRV A;  2K1J A;  5KTU A;  4A9L A;  4IR5 A;  5EIC A;  4CFL A;  2I50 A;  4QR3 A;  2KFT A;  4FLP A;  3GV4 A;  4GB0 A;  4YYM A;  5HQ6 A;  4HBY A;  5A5S A;  5C13 A;  4TQN A;  5ENG A;  4FO9 A;  4UP5 A;  3UV2 A;  2K4D A;  5DW1 A;  4IR4 A;  2RSD A;  5JG6 A;  2LGK A;  4A9O A;  4DON A;  4S3O B;  5FG4 A;  5DKD A;  2RNW A;  5FH7 A;  4NR6 A;  4TT2 A;  4NR5 A;  5C4Q A;  5E9I A;  5IBN A;  5KH7 A;  3UV5 A;  3IU5 A;  2M1R A;  4IR3 A;  5BT4 A;  1WEV A;  4O7E A;  3V43 A;  3JVJ A;  2R10 A;  5DYX A;  4NYV A;  2LGV A;  2YW5 A;  1X0J A;  4NUE A;  4ALH A;  1WEO A;  5TDR A;  3U5M A;  5CRM A;  5II2 A;  2G45 A;  4CUU A;  5TB6 A;  2KWK A;  4MEP A;  4X3G A;  3Q2E A;  3N9M A;  5EWW A;  4J0S A;  2RNY A;  5ENF A;  2XB1 A;  3VK6 A;  4NYX A;  4YH4 A;  2R0V A;  4MR4 A;  4O77 A;  5HEM A;  4LRG A;  4WA6 A;  4TU6 A;  5L97 A;  3DPL R;  4NRC A;  4P5O B;  5DKH A;  1WIL A;  3AQA A;  5EWD A;  5FE8 A;  5G4S A;  4XI1 A;  2LGG A;  4UP0 A;  2LN0 A;  5F5Z A;  1WIM A;  4UYD A;  5CQ7 A;  5F1H A;  4UYH A;  2YT5 A;  4LYI A;  5I3L A;  5H1U A;  2KE1 A;  5C85 A;  4L7X A;  3M63 A;  5CUB A;  5HEN A;  4BW1 A;  1JM4 B;  5D25 A;  4QY4 A;  4YYK A;  4LR6 A;  3UVX A;  3ASL A;  5HQ5 A;  4GNG A;  4MR5 A;  5CY9 A;  4BBQ A;  3FKM X;  5A81 A;  4BW4 A;  5CUC A;  5E0R A;  5CQ4 A;  2IDA A;  4XUA A;  5DFD A;  3EB6 A;  2UZG A;  4QEV A;  2ECI A;  4QSQ A;  4J0R A;  1EQF A;  4QSP A;  1U6G B;  5FER A;  2E7N A;  5AD2 A;  2KTB B;  5CU8 A;  5FBX A;  3MHH A;  3N9P A;  5TDW A;  3HME A;  3I2D A;  4TU4 A;  5LKZ A;  4MVT A;  2EGP A;  4N4G A;  2Y1M A;  3N9N A;  5TRB A;  4YY6 A;  3EB5 A;  2MD8 C;  4WZ0 A;  4UIX A;  5D1M B;  4V3K C;  2YU4 A;  5ETD A;  2E7O A;  4E96 A;  2L5U A;  5LJ2 A;  4LZ2 A;  2CSY A;  5EA1 A;  2BAY A;  4B86 C;  5LVQ A;  2RNX A;  5LUU A;  2VNF A;  2R0S A;  3KNV A;  3JVL A;  4LKA A;  4UIZ A;  3M62 A;  4HXR A;  5EM3 A;  5FE4 A;  4NUD A;  5FG5 A;  4LC2 A;  2JRJ A;  5FE2 A;  4PTB A;  3O33 A;  5A5R A;  4ALG A;  4RVR A;  4O64 A;  5FE9 A;  1F62 A;  2F6N A;  1WEP A;  3GL6 A;  4NQM A;  5HM0 A;  4TZ8 A;  1HYJ A;  2DVV A;  2L85 A;  3P1C A;  5CQ8 A;  5D3N A;  5EWC A;  2PUY A;  3QZT A;  2HYE D;  4HBX A;  1F68 A;  4HXK A;  4QNS A;  2KIZ A;  4F52 B;  4J1P A;  4QEU A;  5L8U A;  3QZV A;  4AVX A;  4LYS A;  5D3R A;  5FE3 A;  1WFK A;  2HDP A;  5D3H A;  4ZDT A;  5I1Q A;  5EV9 A;  5DKA A;  4C66 A;  4YYJ A;  4Q6F A;  2D8S A;  4O7F A;  5FFW A;  2C2V S;  3UV4 A;  2VJE B;  4CUP A;  3Q2F A;  2CSZ A;  1G25 A;  2H0D B;  5LJ0 A;  5D3T A;  3LQH A;  2L0B A;  2RS9 B;  2OXQ C;  5CUE A;  2L84 A;  2Y43 A;  4YBM A;  4UYG A;  1JM7 B;  1MM3 A;  2MIQ A;  4QYD A;  3L1X A;  2DWW A;  4QBM A;  3P1D A;  5F62 A;  4Z6H A;  3C5K A;  4IC3 A;  4HBW A;  4YK0 A;  4NXJ A;  5F1L A;  5KTX A;  3C6W A;  2AN6 A;  3MXF A;  3SOX A;  2JMJ A;  5DLZ A;  5HCL A;  3MB4 A;  4F3I A;  2QJ0 A;  5F2P A;  2VPB A;  4N4H A;  2YYN A;  4MEN A;  4NR7 A;  4AKN A;  2H0D A;  4TKP B;  1FBV A;  2VPD A;  3MUL A;  5CUD A;  3ZPV 1;  2VJF B;  5D0C A;  5A5Q A;  4NR9 A;  2CT2 A;  5COI A;  4UYF A;  3U5K A;  5D24 A;  2H60 A;  4YBS A;  5ETB A;  5FE0 A;  5EWV A;  3HCS A;  3N9O A;  5L98 A;  5LKX A;  5CZG A;  5H85 A;  4YH3 A;  2RO1 A;  4Q0O A;  3KV5 A;  4C9Z A;  4QF2 A;  4TZ2 A;  5E7D A;  5IGL A;  4O70 A;  1MM2 A;  4W4U A;  4CUQ A;  1WEW A;  4YYI A;  1T1H A;  2M85 A;  2OSS A;  5D3J A;  1WES A;  5KO4 A;  2YQL A;  2Y1N A;  4FIP A;  4AUQ B;  5EPR A;  3ZTG A;  3SOU A;  2QIC A;  3ZVY A;  2ECJ A;  5I86 A;  4FK5 A;  4HXO A;  4UIT A;  3ZVZ B;  5C11 A;  3N9Q A;  4HXM A;  5FH6 A;  2QIZ A;  4NRB A;  5ENJ A;  3HMF A;  1X4I A;  5HRX A;  2NAA A;  5D7X A;  5ENE A;  5C89 A;  2KGI A;  5DKC A;  5B78 A;  2YHO A;  4HXN A;  4X2I A;  3RTR B;  2G6Q A;  5B79 A;  4IOO A;  2XEU A;  4PCI A;  3KQI A;  5EVA A;  3P1F A;  2E6R A;  4QST A;  5KH9 A;  5F61 A;  5FE1 A;  4YBT A;  5D3P A;  4Q0N A;  4YYH A;  1ZS5 A;  4YYG A;  3S91 A;  1E4U A;  1JSP B;  3GG3 A;  4TYL A;  4I7B A;  3UVY A;  3HMH A;  5CRZ A;  3O70 A;  3ONI A;  4O78 A;  3U5L A;  3RCW A;  1Z60 A;  2MT5 A;  2PNX A;  5H9M A;  4ZW1 A;  3SVG A;  3ZPV E;  5EPS A;  3ZYU A;  4A9F A;  3QZS A;  2YYR A;  5JWM A;  2MUM A;  2YDW A;  4NYW A;  2CKL B;  1ZBD B;  4LZS A;  3ZYQ A;  4Z93 A;  4CUR A;  4O72 A;  4LYW A;  4QB3 A;  4MSX A;  5K29 A;  1JOC A;  1WEE A;  1Z2Q A;  5D3L A;  4AYC B;  2DKW A;  2G4A A;  4NR4 A;  5I83 A;  4PS5 A;  3PHD A;  5CQT A;  4OGJ A;  2VPG A;  4WZ2 A;  4Z1Q A;  5FEY A;  5FB0 A;  1BOR A;  5F25 A;  4LDF A;  5CPE A;  4A9M A;  5DYA A;  4BW3 A;  3N9L A;  4NR8 A;  1WUG A;  2RI7 A;  2VP7 A;  4MEO A;  5LKU A;  4IR6 A;  5I7Y A;  2LRI C;  4MEQ A;  4OUF A;  5ENI A;  3L1Z B;  5I89 A;  5CQ6 A;  5F36 A;  1X4J A;  5DFB A;  5E9Y A;  2M6M A;  4QEW A;  5ENC A;  1V87 A;  5A7C A;  4ZQL A;  2I7K A;  4BW2 A;  3DAI A;  4NN2 A;  5IID A;  4R7E A;  1VD4 A;  5E3D A;  5D1K B;  4NRA A;  2ECW A;  5KHM A;  4N4I A;  2KU3 A;  1LDJ B;  5HQ7 A;  5DYU A;  2DVQ A;  4QUU A;  5FB1 A;  5A5P A;  5H1T A;  5C7N A;  4ZC9 A;  4PY6 A;  5C87 A;  1WGM A;  4A4C A;  4O76 A;  4QUT A;  5E9M A;  3IHP A;  5CUA A;  5CQ5 A;  5L96 A;  4XY9 A;  5CTL A;  4UIU A;  5J0D A;  2CKL A;  4A9K A;  4QSX A;  5I40 A;  4UIW A;  1E6I A;  5EQ1 A;  1N87 A;  4CL9 A;  2EA6 A;  5EWH A;  3S92 A;  5J3X A;  3P5O A;  2YUR A;  5DYC A;  3HCU A;  2WP2 A;  4YYN A;  3SVH A;  4A4B A;  4O7A A;  2JMI A;  2G43 A;  1WEQ A;  4HXP A;  2OUO A;  4GND A;  4QSU A;  2LSP B;  5ENB A;  3U5N A;  5EI4 A;  2KWO A;  5FG6 A;  4V3L C;  5DY7 A;  5EYA F;  5B8D A;  4LK9 A;  3NXB A;  5AIT A;  4J3I A;  1K2F A;  3PUR A;  2FSA A;  5E74 A;  5FE5 A;  2F6J A;  3IU6 A;  3JVM A;  4N4F A;  2DX8 A;  4Z1S A;  4HBV A;  3O7A A;  5CQ3 A;  5HFQ A;  5BT5 A;  5L8T A;  3RPG B;  3G0J A;  5FE7 A;  5E9V A;  2YEM A;  4UYE A;  5IGN A;  1IYM A;  5LJ1 A;  2EOD A;  5B77 A;  2R0Y A;  5E9K A;  3HCT A;  4QSV A;  2DVR A;  4A9N A;  2WP1 A;  5G0F A;  4QSW A;  5KTW A;  4GPJ A;  5A83 A;  5HLS A;  3O37 A;  4O7C A;  4YAT A;  5G4R A;  2FUU A;  2VPE A;  3HTK C;  2LXH C;  5EIS A;  4MR3 A;  4HXS A;  3PUQ A;  3MB3 A;  2MNY A;  3O36 A;  4QC1 A;  5E3G A;  5DX4 A;  1FP0 A;  2ECT A;  5BT3 A;  1DVP A;  1WEU A;  2D82 A;  2GRC A;  3LRQ A;  5I88 A;  3SOW A;  4CCG X;  4GNF A;  5IGM A;  5CGP A;  4QR4 A;  1VYX A;  1HYI A;  4I7C A;  5IG6 A;  4TS8 A;  3T6R A;  1VFY A;  4O7B A;  4YYD A;  5CP5 A;  2LV9 A;  1JM7 A;  4YC9 A;  2YQD A;  4IOR A;  5CQA A;  4CFK A;  2VJF A;  4TTE A;  4CUS A;  2KWJ A;  4CLB A;  5A5O A;  3P1E A;  3MUK A;  4LZR A;  2D9E A;  5FFV A;  5AME A;  5HEL A;  1LDK C;  4QF3 A;  2YQM A;  5TCM A;  5FDZ A;  5F3A A;  2YW8 A;  3T7L A;  4QSS A;  2F42 A;  4S3O C;  5HRW A;  2MJV B;  4Y03 A;  5A82 A;  5LKT A;  2YSM A;  5FE6 A;  4XYA A;  5D26 A;  3NG2 A;  3D7C A;  3U5O A;  4KV1 A;  5DW2 A;  5E73 A;  4MR6 A;  3KV6 A;  3O34 A;  5F63 A;  4OGI A;  4LLB A;  5KU3 A;  1X4U A;  2NXB A;  5ENH A;  4A9H A;  3UW9 A;  2KYU A;  4QR5 A;  2KR4 A;  4HXL A;  2YSJ A;  2KWN A;  2KGG A;  2MA5 A;  1CHC A;  4A9J A;  4WZ3 B;  3AAD A;  5CFW A;  4O71 A;  5F60 A;  2KRE A;  2M3H A;  3M99 A;  5DIN A;  4CUT A;  1WE9 A;  3LQI A;  2YUC A;  4LJN A;  4A0C D;  1RMD A;  5B75 A;  4CA1 A;  1XWH A;  2MD7 B;  5B76 A;  5TBN A;  4TT6 A;  5EU1 A;  4A9I A;  3L11 A;  4R2Y A;  2DVS A;  4UIV A;  5I80 A;  4PKL A;  4C67 A;  2L75 A;  3U5P A;  2L43 A;  5D1L B;  2YEL A;  4UYF B;  5EGU A;  1Z6U A;  3I3J A;  4BJX A;  5EK9 A;  2ZET C;  2ECV A;  3UVD A;  5LCW B;  3JVK A;  3SVF A;  4O74 A;  4NS5 A;  4AYC A;  5G04 B;  5G05 B;  2LGL A;  2I8N A;  4A9E A;  4QYL A;  2E3K A;  4WHW A;  4IC2 A;  4R8P K;  4IOQ A;  3TLP A;  3ZNI A;  4WIV A;  4QZS A;  5I29 A;  4PCE A;  5AMF A;  4GNE A;  3LXJ A;  4KCX A;  5AIU A;  4YAB A;  3UVW A;  2MNZ A;  4XUB A;  5I7X A;  4KV4 A;  5H1V A;  3LJW A;  5JI8 A;  4XY8 A;  2RFJ A;  2C2L A;  3DWY A;  5DBM A;  2DAT A;  4B7Y C;  5FFY A;  3SHB A;  4WHU A;  1WUM A;  3G0L A;  2FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...