3U5SA

Selenium substituted human augmenter of liver regeneration
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
SMRTQQKRDTKFREDUPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPUEEUAEDLRKRLARNHPDTRTRAAFTQWLUHLHNEVNRKLGKPDFDUSKVDERWRDGWKDGSUD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (77)Se enrichment of proteins expands the biological NMR toolbox.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase ALR
total genus 41
structure length 126
sequence length 126
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u5sA01
3W4YA 1OQCA 4E0IA 4E0HA 3U2MA 2HJ3A 3GWLA 3LLIA 4LDKA 3R7CA 3TK0A 1JRAA 3GWNA 3MBGA 3O55A 1JR8A 3U5SA 3TD7A 3LLKA 3U2LA
chains in the Genus database with same CATH superfamily
4R32A 1Z5ZA 3KMIA 2H7BA 3L0IA 4J32B 1VYKA 5COGA 4WGZA 3M79A 2HSBA 1LI7A 3GEEA 3Q7LA 4YT8A 2WB7A 4JTCB 2EINC 3UNGC 1K04A 2MWQA 4JIOA 3EGDB 4K0DA 3LNRA 3RYLA 3NYMA 4GQHA 2NPUA 3RVZA 4O79A 3EGXB 2XLEA 4JURI 2P7VA 3CEXA 4P9FA 1CPRA 4Q7CA 4MW3A 3RQEA 2RSEB 3DD7A 4C3EA 2AWCA 1N1CA 2J8WA 4JW1A 2MHRA 4XQ1A 3S0XA 2XLMA 3M4CA 1Z7Qc 4EBKA 5FCLA 1QPUA 2J7PA 4QI0A 2NUTA 3O6XA 4N4WA 3NMKA 1ZHTA 2QTVA 1UG7A 2ZXRA 1SMYF 3GWNA 1QKRA 3NYJA 1MQVA 3C8GB 2LFFA 1OR3A 4I44A 4BEJA 3H2UA 2H7VC 2XLWA 4ONSA 2LQGA 2Y3BA 4O6MA 4PJLA 4CS8C 4CS9C 3NRHA 3W8HA 1ZW3A 2EIKC 2EIJC 1QZXA 1BR1A 2P1AA 3AOUA 1XWJA 2WZLA 3Q7GA 3IQ5A 1FR0A 3I5QA 1LS1A 1ZU4A 2EILC 4FAPB 3JT1A 4PACA 3T6BA 3MYFA 2PF4E 1TQGA 2D4UA 4EBJA 2BL2A 2KNHA 2YL1A 3EG9A 3GM3A 3HNKA 2WVOA 3IEEA 3LLKA 4NTFA 4XEFA 4AE4A 4I3MA 4PJNA 2J9VA 4PFPA 4U5CE 3SZRA 3HLZA 2LP4A 1T6IA 3G4XA 3RF3A 4ULVA 1MNDA 5KYYB 1M2OA 3V5ZA 5F5HA 1D1CA 1YDIA 256BA 2XXAA 4Q4ZF 1FTSA 3U0CA 4MVQA 2OU6A 4JEAA 3DM5A 3UMHA 3JYYA 2R7QA 4YT4A 2ICWG 3G50A 4UDVA 3CAXA 3TD7A 2PFDA 2YLDA 4NC3A 5JP7A 2HFIA 1PD1A 3S29A 4JC7A 4JZAA 5HV9A 3HNLA 2HSQA 1OW6A 5L0DA 3KYIA 2IXNA 3AG1C 3O10A 4JJFA 3SYNA 1QQ3A 3DWWA 4YWQA 2ZXPA 1WOLA 2L81A 5L0HA 4H4KC 1HW1A 2G3KA 3QVYA 3L34A 2WZGA 1ZHWA 1Z3IX 3FAPB 1ORJA 3Q6NA 5E3AA 1TWCA 1H6GA 2IOQA 2OJED 3LEVA 1YLMA 2DGJA 2EIMC 3WAQA 1LPEA 4EUKB 4DVYP 1Z23A 4U5BE 4YL3A 4OIPF 4QDLA 1TFKB 3EQLF 3K1IA 4U5FE 3POVA 2FFHA 1T5OA 4ULWA 1BR2A 3U2LA 4P6IC 4G7ZF 2EPKX 1LI5A 2H8AA 3ZQYA 1NZEA 2KYHA 4WABA 2PNOA 2Q9CA 4C3DA 1RCPA 5DS6A 2TMVP 2R7TA 3KPHA 2IM8A 1WTYA 2OKUA 3QW0A 1D1AA 1C03A 4CSAA 3T4RA 1S7ZA 1LE4A 3EZHA 3ZTZA 2YZSA 3DXJF 3M15A 2OOCA 3QTHA 3RKOF 3NKEA 4JE9A 5JT4A 4XTKA 4D4XA 3LLIA 2B0HA 1H9TA 2OEXA 3OEOA 4LLCA 3RFYA 4ER9A 2Y3GA 3FOOA 4W8PA 5T3TA 3LEOA 1Z6AA 1MNEA 4AL1A 1FAPB 4YL0A 5L0CA 5KYWB 1L7CA 3EJNA 1E84A 3C18A 3I5PA 5B1AC 1ORSC 4MVSA 2HS5A 5L0FA 1Q0GA 2EPMX 3TOMA 5KYUB 3W8IA 3FOPA 2R7WA 2X51A 1GS9A 2G62A 3VAYA 4F4BA 4CSAC 1LIHA 3ZIBA 3MLGA 2QY9A 1HE9A 4NY3A 4LDKA 3NKDA 4XEVA 2LD6A 1OKKA 2L6FA 3IQCA 3K33A 3TQOA 5L0IA 1WATA 1PV3A 2J0WA 2Y3DA 4MS2A 1MMGA 1T6UA 2XS8A 4X0RA 4Q5SF 2L6HA 5B3IA 2F22A 3R2PA 2UUHA 2V26A 1G4US 2JD3A 2PP4A 3CQZA 3H65A 5BQGA 5B3SC 4EWCA 1A7VA 5DLJA 2O9XA 3EH1A 3F47A 1HMDA 4E17A 2Q7RA 2GDCA 1T6QA 5F5FA 1OW7A 2XSEA 4OINF 5L3VA 2L9JA 4KBLA 3TULA 2XLVA 2J9WA 3ECSA 2FGYA 4DOZA 1VYIA 3L1MA 4QI2A 1I4YA 2IYLD 3JRTA 3SXYA 3C63A 1U6HA 2YKZA 4HFFB 3VRCA 1D1BA 1APCA 2I15A 3L8IA 4D4NA 4NTBA 4U5HA 3C8ZA 3L8JA 2HJMA 1TWGA 2IBFA 2Q9BA 2EPNA 3RVYA 5BQHA 4IGGA 4E7ZA 3ZTMA 3FVYA 2HV6A 3JSZA 2JPUA 2Y69C 3NMIA 3GEHA 4MTOA 3EFOA 3JSEO 4HFKB 1CGNA 1EI7A 5EK0A 1I4ZA 3TJ5A 2XM0A 5COMA 1HE1A 4FWVA 1OQCA 4MVMA 1RKEB 4CS8A 3ZWIA 2KSFA 1QSPA 4LACB 3TK0A 5TJ5E 4CDVA 3MBGA 3LUTB 3JTLO 4N06A 3QMKA 1OCRC 1KU2A 1QLEC 3IQ6A 3Q6MA 5GPGB 3WHNA 1ORYA 4CS7A 5KYXB 3W4YA 1YAUO 2A0BA 3DMDA 4BG0A 4BJ6A 5A6KA 4PJMA 5A6BD 4K7BA 1OW8A 4OD4A 2Q3TA 4OIRF 3W2WA 3WODF 2EPOA 2ETSA 2YL3A 4YK5A 3U8PA 4IRUA 1U0BB 1KTMA 1ZYRF 2VCBA 4DVZA 4CX9A 2FAPB 3E9VA 4IB4A 3A11A 1KNYA 2AVKA 4PK4A 3ZQVA 2NSGA 2XLHA 4DXWA 4XLPF 4B6IA 2NUPB 4AX2A 5L3QA 3MX3A 4JCZA 5A6AA 5JLIA 1RJ9B 3DJUB 3OA1A 1IW7F 1IZMA 1OCCC 3JCUQ 2A6HF 1VOMA 4W8KA 4PJJA 3AJMA 1VTMP 4G0HA 3N2ZB 3HNJA 1TKNA 2VC9A 1NBBA 1WN0A 3O39A 4NQFA 2ZPAA 4U9DA 5E3CA 5K0IA 1VMAA 1S05A 2GWWA 2I8BA 3QZCA 3AQBA 2YLIA 2XLOA 4GEHA 2CYDA 4IAQA 4IWBA 3HTKC 3EGXA 1RKCA 3E70C 4XPXA 1M2VA 2VCCA 4O6YA 3U5SA 4G78A 4YJWA 4ZLDA 1G5ZA 3EPVA 2Q00A 2R7RA 2V3CC 2QNLA 2QUPA 2WL8A 1BR4A 3UMKA 2HJ3A 2A68F 1YA7O 2UUIA 3N24A 4U5GA 4RD9A 5F28E 3T6JA 4C7OB 3AGTA 3EHMA 1TFOB 1G4WR 2R7OA 3CSKA 4U5DE 5CI9A 4JCHA 4MVUA 2R7UA 1C17M 4BEMJ 2Q4FA 3DKAA 3R7CA 1YYXA 1E2XA 1ST6A 5DS4A 1OXBA 3SNHA 3IPMO 5D91A 3C8GA 1YZCA 4BJ5A 3HNIA 1FMVA 1NFOA 2VASA 4WGYA 3B29A 2OQMA 2W4MA 3RQGA 4EBBA 1U89A 2J9UA 2VB6A 1OCZC 3T6GB 3MYIA 1M6TA 1O5HA 4U5EE 3GWLA 2A1DD 3FAJA 3GANA 4MQ9F 2HKVA 2WVNA 5IY5C 4AL0A 5CIVA 4A2NB 3UGPA 2CCYA 2CDQA 3CZ6A 2XRHA 2R7VA 2NSFA 1NLXA 1VK5A 1OKKD 1B68A 1JPJA 3EGDA 1EA8A 1AVOB 4CIPA 3J06A 2KQ9A 2PX3A 4OIOF 3WG7C 4CDYA 5KYYA 1JR8A 3DE8A 3VF0A 1BZ4A 3AG3C 5A69A 1MMDA 3FDQA 2XXAB 5L0GA 4KI2A 1LKXA 3GM2A 3K66A 3FMSA 3K1HA 3KH2A 5AGFA 3ATPA 3JZ0A 2KGOA 2DI3A 1CPQA 1SYQA 2PBEA 1TR2A 1DOWA 2RD9A 2VCAA 3K6BA 3LNMB 2NUTB 4KNVA 4DRIB 4G7HF 5L0JA 1Q0MA 3AQCA 5E33A 3US6A 2J46A 1PD0A 4FESA 4JRZA 2Y39A 3S28A 4MVRA 4LDQA 5KYNA 2XLDA 4J7TA 4Z9JA 1JPNA 1WGWA 3EH2A 2IXPA 2WVQA 3PHF2 5EGYA 1OR2A 4YL1A 4E0HA 3EZIA 4XPYA 3PDMP 3GORA 3IHUA 3V5XA 5T3WA 3MFNA 2GA0A 4E7SA 2E87A 2IXOA 2P6VA 5JRAA 1PCXA 1HW2A 4JVSA 3RH3A 3ASOC 4O7GA 2LFDA 4MVZA 3EG9B 3ZVRA 4C3BA 5EHHA 4AE4B 1E85A 1O3UA 1VLSA 2DYSC 4PR9A 4WJ0A 1D0ZA 4LERA 4YN0B 1FFHA 1TWAA 1H7IA 3TJ6A 2ASRA 1K40A 2EPLX 3RIPA 1Q0KA 4CJOA 1V55C 3N0TA 3HJCA 4HEAJ 1M56C 2HUJA 1OCOC 4OD5A 4E0IA 4ZLCA 4EHPA 1ZVZA 2J0XA 1T9KA 3H2VA 2XL6A 3DZAA 3U9JA 2BE5F 2YRFA 1ZHZA 2L6GA 3DE9A 4DRHB 3VM6A 2Z15A 1YYJA 3K7DA 2OG2A 2J7PD 2L7AA 2QLAA 1E83A 1ZHYA 2A69F 3GEIA 2HMZA 1NU9C 1E86A 2HMQA 1VB5A 1YZAA 1LM3B 4XEKA 5A6BA 3VYWA 1HY5A 1LS4A 3HKKA 4IJJA 2YHSA 3M4BA 5DVWA 4CBEA 2LK4A 2YQYA 3SXZA 3DAGA 4G7OF 1HMOA 3DI5A 4XWJA 2MYSA 3RQFA 5T1DB 2BC5A 3FXHA 3EHNA 1ZW2A 1UFBA 4J30B 3U3BA 5DQZA 1Z63A 4JTAB 2KC3A 3NDBB 4KNWA 2A0UA 3ZSUA 2XM4A 4BJ5C 4E18A 3S90A 4OIQF 1XZPA 1NSGB 3JRMO 1J8YF 3LJBA 1MMNA 4DRJB 1JAFA 4JKVA 4O6NA 5AC4A 1XZQA 3O55A 5JSLA 1Q0DA 2NG1A 2LIGA 2W45A 2YEVA 3ABKC 3KKBA 2M64A 4AK9A 3PMRA 1A7EA 3RW0A 4BJTA 4EIYA 1H9GA 1SF8A 3T9OA 2ZXOA 1WWPA 3X1OA 4I1MA 4JEBA 1NFNA 1CGOA 4JJGA 1SR2A 1NG1A 4MVOA 1QVXA 2A6EF 1SZIA 3LESA 4GYTA 4U9EA 3NG1A 4M63A 2VH3A 3G4ZA 3QW1A 2GFHA 2R7XA 3IQTA 1O87A 1YJGA 2H7OA 3QVZA 1V54C 1F1MA 4CS9A 1TWHA 1V74B 3ZG1A 3U2MA 5KYWA 1Y4CA 2C03A 3ABLC 4MTFA 1J8MF 3U3FA 3X2QC 1RXQA 4Z9HA 4A4AA 2HV7A 3K1IC 3S84A 3UMIA 2R9RB 2AP3A 5KYUA 4HE8D 5COFA 2R7SA 1ZU5A 3AGUA 3NMJA 3EFOB 3B0VC 2KW3C 3SXMA 4JTDB 2R03A 2ZD9A 3AG4C 3SEOA 4BPMA 2R02A 4PFOA 5CI8A 3V7OA 3C7JA 2CNWD 2AU5A 3LS1A 5JVEA 1Q0FA 3UGOA 1FFTC 2ZXWC 4ANJA 4NCQA 2R25A 2W4BA 4J7YA 3B71A 4IAOA 1BBHA 4IARA 5FZTA 4YT5A 2OEVA 3OWTA 1Y6DA 2B0JA 1LE2A 2DB4A 2LSEA 1FMWA 2XL8A 3ITFA 3M1CB 3GODA 4BJ1A 4MW8A 1RMVA 1ZHXA 4CDAA 3U9MA 3FHDA 1R5ID 5AC5A 3TOLA 3ZC4A 5BUOA 1EKYA 1CGME 1FNTc 4MNDA 5JS5A 4LLEA 1R4TA 2OJQA 3ASNC 1GM5A 3GM1A 3UR3C 2LCHA 1YVIA 3W2VA 4RDAA 4NTAA 2G3VA 3S9OA 4CJGA 4XLNF 3B9QA 1D0YA 3S27A 2CNWA 2IXMA 1JOGA 2AWYA 2W9YA 1GQAA 1M57C 1LVKA 2DYRC 3A9CA 3LAYA 1YA9A 3PCVA 1L3PA 3BEHA 4KC9A 4MTGA 1K05A 2YLGA 4N6HA 1VLTA 4BJ6C 1GGQA 5BQIA 2GAQA 3B0PA 1DOVA 1T01A 3I4UA 2YVKA 3DJNB 4CIHA 4N6CA 3U8VA 1V4AA 1A0BA 3NYLA 1WASA 2D5RB 4P9TA 4DBQA 1EQ1A 3JYHA 2YL7A 1AEPA 1MMAA 2XL4A 4Z9IA 4L6RA 1C02A 1M2VB 2XS1A 3C62A 3LS0A 1A41A 2JX0A 2YL0A 2YWAA 3ABMC 2WZFA 3AG2C 3BRJA 4H54A 1RKEA 1AUEA 5DS5A 2R05A 5A6JA 3SXKA 5DQTA 1NU7D 2P61A 2PX0A 4EKWA 2Q9AA 4C7OA 4RBNA 3SP1A 1D0XA 3B0UX 2HZ8A 2C04A 3KYJA 2KK1A 4FX5A 1OXKA 2M4EA 3V5YA 5KYXA 2X0CA 1ZZPA 3KL4A 2P0NA 2J9BA 5D92A 3ZDLA 2KJGA 1W2WA 3C8GD 1A7DA 1BDJB 5B1BC 3DAFA 1JRAA 5JUAA 2Y3HA 2J45A 1YARO 2OCCC 2CW0F 4I1OB 4DBRA 1G8XA 3DM9B 4LDRA 4YT2A 4DJ9A 5HSWA 4K1OA 1I5NA 5E2QA 3F46A 2NUPA 1JMWA 1RJ9A 2CGEA 2QE9A 4XPWA
chains in the Genus database with same CATH topology
3W4YA 1OQCA 4E0IA 4E0HA 3U2MA 2HJ3A 3GWLA 3LLIA 4LDKA 3R7CA 3TK0A 1JRAA 3GWNA 3MBGA 3O55A 1JR8A 3U5SA 3TD7A 3LLKA 3U2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4Y A;  1OQC A;  4E0I A;  4E0H A;  3U2M A;  2HJ3 A;  3GWL A;  3LLI A;  4LDK A;  3R7C A;  3TK0 A;  1JRA A;  3GWN A;  3MBG A;  3O55 A;  1JR8 A;  3U5S A;  3TD7 A;  3LLK A;  3U2L A; 
#chains in the Genus database with same CATH topology
 4R32 A;  1Z5Z A;  3KMI A;  2H7B A;  3L0I A;  4J32 B;  1VYK A;  5COG A;  4WGZ A;  3M79 A;  2HSB A;  1LI7 A;  3GEE A;  3Q7L A;  4YT8 A;  2WB7 A;  4JTC B;  2EIN C;  3UNG C;  1K04 A;  2MWQ A;  4JIO A;  3EGD B;  4K0D A;  3LNR A;  3RYL A;  3NYM A;  4GQH A;  2NPU A;  3RVZ A;  4O79 A;  3EGX B;  2XLE A;  4JUR I;  2P7V A;  3CEX A;  4P9F A;  1CPR A;  4Q7C A;  4MW3 A;  3RQE A;  2RSE B;  3DD7 A;  4C3E A;  2AWC A;  1N1C A;  2J8W A;  4JW1 A;  2MHR A;  4XQ1 A;  3S0X A;  2XLM A;  3M4C A;  1Z7Q c;  4EBK A;  5FCL A;  1QPU A;  2J7P A;  4QI0 A;  2NUT A;  3O6X A;  4N4W A;  3NMK A;  1ZHT A;  2QTV A;  1UG7 A;  2ZXR A;  1SMY F;  3GWN A;  1QKR A;  3NYJ A;  1MQV A;  3C8G B;  2LFF A;  1OR3 A;  4I44 A;  4BEJ A;  3H2U A;  2H7V C;  2XLW A;  4ONS A;  2LQG A;  2Y3B A;  4O6M A;  4PJL A;  4CS8 C;  4CS9 C;  3NRH A;  3W8H A;  1ZW3 A;  2EIK C;  2EIJ C;  1QZX A;  1BR1 A;  2P1A A;  3AOU A;  1XWJ A;  2WZL A;  3Q7G A;  3IQ5 A;  1FR0 A;  3I5Q A;  1LS1 A;  1ZU4 A;  2EIL C;  4FAP B;  3JT1 A;  4PAC A;  3T6B A;  3MYF A;  2PF4 E;  1TQG A;  2D4U A;  4EBJ A;  2BL2 A;  2KNH A;  2YL1 A;  3EG9 A;  3GM3 A;  3HNK A;  2WVO A;  3IEE A;  3LLK A;  4NTF A;  4XEF A;  4AE4 A;  4I3M A;  4PJN A;  2J9V A;  4PFP A;  4U5C E;  3SZR A;  3HLZ A;  2LP4 A;  1T6I A;  3G4X A;  3RF3 A;  4ULV A;  1MND A;  5KYY B;  1M2O A;  3V5Z A;  5F5H A;  1D1C A;  1YDI A;  256B A;  2XXA A;  4Q4Z F;  1FTS A;  3U0C A;  4MVQ A;  2OU6 A;  4JEA A;  3DM5 A;  3UMH A;  3JYY A;  2R7Q A;  4YT4 A;  2ICW G;  3G50 A;  4UDV A;  3CAX A;  3TD7 A;  2PFD A;  2YLD A;  4NC3 A;  5JP7 A;  2HFI A;  1PD1 A;  3S29 A;  4JC7 A;  4JZA A;  5HV9 A;  3HNL A;  2HSQ A;  1OW6 A;  5L0D A;  3KYI A;  2IXN A;  3AG1 C;  3O10 A;  4JJF A;  3SYN A;  1QQ3 A;  3DWW A;  4YWQ A;  2ZXP A;  1WOL A;  2L81 A;  5L0H A;  4H4K C;  1HW1 A;  2G3K A;  3QVY A;  3L34 A;  2WZG A;  1ZHW A;  1Z3I X;  3FAP B;  1ORJ A;  3Q6N A;  5E3A A;  1TWC A;  1H6G A;  2IOQ A;  2OJE D;  3LEV A;  1YLM A;  2DGJ A;  2EIM C;  3WAQ A;  1LPE A;  4EUK B;  4DVY P;  1Z23 A;  4U5B E;  4YL3 A;  4OIP F;  4QDL A;  1TFK B;  3EQL F;  3K1I A;  4U5F E;  3POV A;  2FFH A;  1T5O A;  4ULW A;  1BR2 A;  3U2L A;  4P6I C;  4G7Z F;  2EPK X;  1LI5 A;  2H8A A;  3ZQY A;  1NZE A;  2KYH A;  4WAB A;  2PNO A;  2Q9C A;  4C3D A;  1RCP A;  5DS6 A;  2TMV P;  2R7T A;  3KPH A;  2IM8 A;  1WTY A;  2OKU A;  3QW0 A;  1D1A A;  1C03 A;  4CSA A;  3T4R A;  1S7Z A;  1LE4 A;  3EZH A;  3ZTZ A;  2YZS A;  3DXJ F;  3M15 A;  2OOC A;  3QTH A;  3RKO F;  3NKE A;  4JE9 A;  5JT4 A;  4XTK A;  4D4X A;  3LLI A;  2B0H A;  1H9T A;  2OEX A;  3OEO A;  4LLC A;  3RFY A;  4ER9 A;  2Y3G A;  3FOO A;  4W8P A;  5T3T A;  3LEO A;  1Z6A A;  1MNE A;  4AL1 A;  1FAP B;  4YL0 A;  5L0C A;  5KYW B;  1L7C A;  3EJN A;  1E84 A;  3C18 A;  3I5P A;  5B1A C;  1ORS C;  4MVS A;  2HS5 A;  5L0F A;  1Q0G A;  2EPM X;  3TOM A;  5KYU B;  3W8I A;  3FOP A;  2R7W A;  2X51 A;  1GS9 A;  2G62 A;  3VAY A;  4F4B A;  4CSA C;  1LIH A;  3ZIB A;  3MLG A;  2QY9 A;  1HE9 A;  4NY3 A;  4LDK A;  3NKD A;  4XEV A;  2LD6 A;  1OKK A;  2L6F A;  3IQC A;  3K33 A;  3TQO A;  5L0I A;  1WAT A;  1PV3 A;  2J0W A;  2Y3D A;  4MS2 A;  1MMG A;  1T6U A;  2XS8 A;  4X0R A;  4Q5S F;  2L6H A;  5B3I A;  2F22 A;  3R2P A;  2UUH A;  2V26 A;  1G4U S;  2JD3 A;  2PP4 A;  3CQZ A;  3H65 A;  5BQG A;  5B3S C;  4EWC A;  1A7V A;  5DLJ A;  2O9X A;  3EH1 A;  3F47 A;  1HMD A;  4E17 A;  2Q7R A;  2GDC A;  1T6Q A;  5F5F A;  1OW7 A;  2XSE A;  4OIN F;  5L3V A;  2L9J A;  4KBL A;  3TUL A;  2XLV A;  2J9W A;  3ECS A;  2FGY A;  4DOZ A;  1VYI A;  3L1M A;  4QI2 A;  1I4Y A;  2IYL D;  3JRT A;  3SXY A;  3C63 A;  1U6H A;  2YKZ A;  4HFF B;  3VRC A;  1D1B A;  1APC A;  2I15 A;  3L8I A;  4D4N A;  4NTB A;  4U5H A;  3C8Z A;  3L8J A;  2HJM A;  1TWG A;  2IBF A;  2Q9B A;  2EPN A;  3RVY A;  5BQH A;  4IGG A;  4E7Z A;  3ZTM A;  3FVY A;  2HV6 A;  3JSZ A;  2JPU A;  2Y69 C;  3NMI A;  3GEH A;  4MTO A;  3EFO A;  3JSE O;  4HFK B;  1CGN A;  1EI7 A;  5EK0 A;  1I4Z A;  3TJ5 A;  2XM0 A;  5COM A;  1HE1 A;  4FWV A;  1OQC A;  4MVM A;  1RKE B;  4CS8 A;  3ZWI A;  2KSF A;  1QSP A;  4LAC B;  3TK0 A;  5TJ5 E;  4CDV A;  3MBG A;  3LUT B;  3JTL O;  4N06 A;  3QMK A;  1OCR C;  1KU2 A;  1QLE C;  3IQ6 A;  3Q6M A;  5GPG B;  3WHN A;  1ORY A;  4CS7 A;  5KYX B;  3W4Y A;  1YAU O;  2A0B A;  3DMD A;  4BG0 A;  4BJ6 A;  5A6K A;  4PJM A;  5A6B D;  4K7B A;  1OW8 A;  4OD4 A;  2Q3T A;  4OIR F;  3W2W A;  3WOD F;  2EPO A;  2ETS A;  2YL3 A;  4YK5 A;  3U8P A;  4IRU A;  1U0B B;  1KTM A;  1ZYR F;  2VCB A;  4DVZ A;  4CX9 A;  2FAP B;  3E9V A;  4IB4 A;  3A11 A;  1KNY A;  2AVK A;  4PK4 A;  3ZQV A;  2NSG A;  2XLH A;  4DXW A;  4XLP F;  4B6I A;  2NUP B;  4AX2 A;  5L3Q A;  3MX3 A;  4JCZ A;  5A6A A;  5JLI A;  1RJ9 B;  3DJU B;  3OA1 A;  1IW7 F;  1IZM A;  1OCC C;  3JCU Q;  2A6H F;  1VOM A;  4W8K A;  4PJJ A;  3AJM A;  1VTM P;  4G0H A;  3N2Z B;  3HNJ A;  1TKN A;  2VC9 A;  1NBB A;  1WN0 A;  3O39 A;  4NQF A;  2ZPA A;  4U9D A;  5E3C A;  5K0I A;  1VMA A;  1S05 A;  2GWW A;  2I8B A;  3QZC A;  3AQB A;  2YLI A;  2XLO A;  4GEH A;  2CYD A;  4IAQ A;  4IWB A;  3HTK C;  3EGX A;  1RKC A;  3E70 C;  4XPX A;  1M2V A;  2VCC A;  4O6Y A;  3U5S A;  4G78 A;  4YJW A;  4ZLD A;  1G5Z A;  3EPV A;  2Q00 A;  2R7R A;  2V3C C;  2QNL A;  2QUP A;  2WL8 A;  1BR4 A;  3UMK A;  2HJ3 A;  2A68 F;  1YA7 O;  2UUI A;  3N24 A;  4U5G A;  4RD9 A;  5F28 E;  3T6J A;  4C7O B;  3AGT A;  3EHM A;  1TFO B;  1G4W R;  2R7O A;  3CSK A;  4U5D E;  5CI9 A;  4JCH A;  4MVU A;  2R7U A;  1C17 M;  4BEM J;  2Q4F A;  3DKA A;  3R7C A;  1YYX A;  1E2X A;  1ST6 A;  5DS4 A;  1OXB A;  3SNH A;  3IPM O;  5D91 A;  3C8G A;  1YZC A;  4BJ5 A;  3HNI A;  1FMV A;  1NFO A;  2VAS A;  4WGY A;  3B29 A;  2OQM A;  2W4M A;  3RQG A;  4EBB A;  1U89 A;  2J9U A;  2VB6 A;  1OCZ C;  3T6G B;  3MYI A;  1M6T A;  1O5H A;  4U5E E;  3GWL A;  2A1D D;  3FAJ A;  3GAN A;  4MQ9 F;  2HKV A;  2WVN A;  5IY5 C;  4AL0 A;  5CIV A;  4A2N B;  3UGP A;  2CCY A;  2CDQ A;  3CZ6 A;  2XRH A;  2R7V A;  2NSF A;  1NLX A;  1VK5 A;  1OKK D;  1B68 A;  1JPJ A;  3EGD A;  1EA8 A;  1AVO B;  4CIP A;  3J06 A;  2KQ9 A;  2PX3 A;  4OIO F;  3WG7 C;  4CDY A;  5KYY A;  1JR8 A;  3DE8 A;  3VF0 A;  1BZ4 A;  3AG3 C;  5A69 A;  1MMD A;  3FDQ A;  2XXA B;  5L0G A;  4KI2 A;  1LKX A;  3GM2 A;  3K66 A;  3FMS A;  3K1H A;  3KH2 A;  5AGF A;  3ATP A;  3JZ0 A;  2KGO A;  2DI3 A;  1CPQ A;  1SYQ A;  2PBE A;  1TR2 A;  1DOW A;  2RD9 A;  2VCA A;  3K6B A;  3LNM B;  2NUT B;  4KNV A;  4DRI B;  4G7H F;  5L0J A;  1Q0M A;  3AQC A;  5E33 A;  3US6 A;  2J46 A;  1PD0 A;  4FES A;  4JRZ A;  2Y39 A;  3S28 A;  4MVR A;  4LDQ A;  5KYN A;  2XLD A;  4J7T A;  4Z9J A;  1JPN A;  1WGW A;  3EH2 A;  2IXP A;  2WVQ A;  3PHF 2;  5EGY A;  1OR2 A;  4YL1 A;  4E0H A;  3EZI A;  4XPY A;  3PDM P;  3GOR A;  3IHU A;  3V5X A;  5T3W A;  3MFN A;  2GA0 A;  4E7S A;  2E87 A;  2IXO A;  2P6V A;  5JRA A;  1PCX A;  1HW2 A;  4JVS A;  3RH3 A;  3ASO C;  4O7G A;  2LFD A;  4MVZ A;  3EG9 B;  3ZVR A;  4C3B A;  5EHH A;  4AE4 B;  1E85 A;  1O3U A;  1VLS A;  2DYS C;  4PR9 A;  4WJ0 A;  1D0Z A;  4LER A;  4YN0 B;  1FFH A;  1TWA A;  1H7I A;  3TJ6 A;  2ASR A;  1K40 A;  2EPL X;  3RIP A;  1Q0K A;  4CJO A;  1V55 C;  3N0T A;  3HJC A;  4HEA J;  1M56 C;  2HUJ A;  1OCO C;  4OD5 A;  4E0I A;  4ZLC A;  4EHP A;  1ZVZ A;  2J0X A;  1T9K A;  3H2V A;  2XL6 A;  3DZA A;  3U9J A;  2BE5 F;  2YRF A;  1ZHZ A;  2L6G A;  3DE9 A;  4DRH B;  3VM6 A;  2Z15 A;  1YYJ A;  3K7D A;  2OG2 A;  2J7P D;  2L7A A;  2QLA A;  1E83 A;  1ZHY A;  2A69 F;  3GEI A;  2HMZ A;  1NU9 C;  1E86 A;  2HMQ A;  1VB5 A;  1YZA A;  1LM3 B;  4XEK A;  5A6B A;  3VYW A;  1HY5 A;  1LS4 A;  3HKK A;  4IJJ A;  2YHS A;  3M4B A;  5DVW A;  4CBE A;  2LK4 A;  2YQY A;  3SXZ A;  3DAG A;  4G7O F;  1HMO A;  3DI5 A;  4XWJ A;  2MYS A;  3RQF A;  5T1D B;  2BC5 A;  3FXH A;  3EHN A;  1ZW2 A;  1UFB A;  4J30 B;  3U3B A;  5DQZ A;  1Z63 A;  4JTA B;  2KC3 A;  3NDB B;  4KNW A;  2A0U A;  3ZSU A;  2XM4 A;  4BJ5 C;  4E18 A;  3S90 A;  4OIQ F;  1XZP A;  1NSG B;  3JRM O;  1J8Y F;  3LJB A;  1MMN A;  4DRJ B;  1JAF A;  4JKV A;  4O6N A;  5AC4 A;  1XZQ A;  3O55 A;  5JSL A;  1Q0D A;  2NG1 A;  2LIG A;  2W45 A;  2YEV A;  3ABK C;  3KKB A;  2M64 A;  4AK9 A;  3PMR A;  1A7E A;  3RW0 A;  4BJT A;  4EIY A;  1H9G A;  1SF8 A;  3T9O A;  2ZXO A;  1WWP A;  3X1O A;  4I1M A;  4JEB A;  1NFN A;  1CGO A;  4JJG A;  1SR2 A;  1NG1 A;  4MVO A;  1QVX A;  2A6E F;  1SZI A;  3LES A;  4GYT A;  4U9E A;  3NG1 A;  4M63 A;  2VH3 A;  3G4Z A;  3QW1 A;  2GFH A;  2R7X A;  3IQT A;  1O87 A;  1YJG A;  2H7O A;  3QVZ A;  1V54 C;  1F1M A;  4CS9 A;  1TWH A;  1V74 B;  3ZG1 A;  3U2M A;  5KYW A;  1Y4C A;  2C03 A;  3ABL C;  4MTF A;  1J8M F;  3U3F A;  3X2Q C;  1RXQ A;  4Z9H A;  4A4A A;  2HV7 A;  3K1I C;  3S84 A;  3UMI A;  2R9R B;  2AP3 A;  5KYU A;  4HE8 D;  5COF A;  2R7S A;  1ZU5 A;  3AGU A;  3NMJ A;  3EFO B;  3B0V C;  2KW3 C;  3SXM A;  4JTD B;  2R03 A;  2ZD9 A;  3AG4 C;  3SEO A;  4BPM A;  2R02 A;  4PFO A;  5CI8 A;  3V7O A;  3C7J A;  2CNW D;  2AU5 A;  3LS1 A;  5JVE A;  1Q0F A;  3UGO A;  1FFT C;  2ZXW C;  4ANJ A;  4NCQ A;  2R25 A;  2W4B A;  4J7Y A;  3B71 A;  4IAO A;  1BBH A;  4IAR A;  5FZT A;  4YT5 A;  2OEV A;  3OWT A;  1Y6D A;  2B0J A;  1LE2 A;  2DB4 A;  2LSE A;  1FMW A;  2XL8 A;  3ITF A;  3M1C B;  3GOD A;  4BJ1 A;  4MW8 A;  1RMV A;  1ZHX A;  4CDA A;  3U9M A;  3FHD A;  1R5I D;  5AC5 A;  3TOL A;  3ZC4 A;  5BUO A;  1EKY A;  1CGM E;  1FNT c;  4MND A;  5JS5 A;  4LLE A;  1R4T A;  2OJQ A;  3ASN C;  1GM5 A;  3GM1 A;  3UR3 C;  2LCH A;  1YVI A;  3W2V A;  4RDA A;  4NTA A;  2G3V A;  3S9O A;  4CJG A;  4XLN F;  3B9Q A;  1D0Y A;  3S27 A;  2CNW A;  2IXM A;  1JOG A;  2AWY A;  2W9Y A;  1GQA A;  1M57 C;  1LVK A;  2DYR C;  3A9C A;  3LAY A;  1YA9 A;  3PCV A;  1L3P A;  3BEH A;  4KC9 A;  4MTG A;  1K05 A;  2YLG A;  4N6H A;  1VLT A;  4BJ6 C;  1GGQ A;  5BQI A;  2GAQ A;  3B0P A;  1DOV A;  1T01 A;  3I4U A;  2YVK A;  3DJN B;  4CIH A;  4N6C A;  3U8V A;  1V4A A;  1A0B A;  3NYL A;  1WAS A;  2D5R B;  4P9T A;  4DBQ A;  1EQ1 A;  3JYH A;  2YL7 A;  1AEP A;  1MMA A;  2XL4 A;  4Z9I A;  4L6R A;  1C02 A;  1M2V B;  2XS1 A;  3C62 A;  3LS0 A;  1A41 A;  2JX0 A;  2YL0 A;  2YWA A;  3ABM C;  2WZF A;  3AG2 C;  3BRJ A;  4H54 A;  1RKE A;  1AUE A;  5DS5 A;  2R05 A;  5A6J A;  3SXK A;  5DQT A;  1NU7 D;  2P61 A;  2PX0 A;  4EKW A;  2Q9A A;  4C7O A;  4RBN A;  3SP1 A;  1D0X A;  3B0U X;  2HZ8 A;  2C04 A;  3KYJ A;  2KK1 A;  4FX5 A;  1OXK A;  2M4E A;  3V5Y A;  5KYX A;  2X0C A;  1ZZP A;  3KL4 A;  2P0N A;  2J9B A;  5D92 A;  3ZDL A;  2KJG A;  1W2W A;  3C8G D;  1A7D A;  1BDJ B;  5B1B C;  3DAF A;  1JRA A;  5JUA A;  2Y3H A;  2J45 A;  1YAR O;  2OCC C;  2CW0 F;  4I1O B;  4DBR A;  1G8X A;  3DM9 B;  4LDR A;  4YT2 A;  4DJ9 A;  5HSW A;  4K1O A;  1I5N A;  5E2Q A;  3F46 A;  2NUP A;  1JMW A;  1RJ9 A;  2CGE A;  2QE9 A;  4XPW A; 
#chains in the Genus database with same CATH homology
 3W4Y A;  1OQC A;  4E0I A;  4E0H A;  3U2M A;  2HJ3 A;  3GWL A;  3LLI A;  4LDK A;  3R7C A;  3TK0 A;  1JRA A;  3GWN A;  3MBG A;  3O55 A;  1JR8 A;  3U5S A;  3TD7 A;  3LLK A;  3U2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...