3U5SA

Selenium substituted human augmenter of liver regeneration
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
b'SMRTQQKRDTKFREDUPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPUEEUAEDLRKRLARNHPDTRTRAAFTQWLUHLHNEVNRKLGKPDFDUSKVDERWRDGWKDGSUD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title (77)Se enrichment of proteins expands the biological NMR toolbox.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 41
structure length 126
sequence length 126
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u5sA01
1JR8A 3TK0A 4E0HA 3U2MA 2HJ3A 3R7CA 1JRAA 3MBGA 3W4YA 1OQCA 3LLIA 3LLKA 3GWLA 3U2LA 4LDKA 3GWNA 3O55A 3TD7A 4E0IA 3U5SA
chains in the Genus database with same CATH superfamily
2EPOA 3Q6NA 2A0BA 4JE9A 1KU2A 3H2VA 4MVZA 2EINC 1OCZC 1GGQA 3B0PA 3EHMA 3HNIA 5JSLA 4U5HA 4YWQA 2R7VA 5B3IA 2WVQA 4IAOA 1NU9C 5L0HA 5JS5A 2Y3HA 4U5DE 4CS7A 3QW0A 3FDQA 1SMYF 1YVIA 2ZPAA 3AJMA 3GEIA 4XLNF 4JEAA 1MQVA 2G3VA 3V5XA 4DVYP 1G5ZA 4P9TA 4MTOA 1D1CA 4OIOF 3LLKA 2BC5A 4JTDB 3H65A 3W8HA 2C03A 4DRJB 2J45A 2HV6A 3SP1A 3E9VA 3ZC4A 3KKBA 4CBEA 2DYRC 4GQHA 1I5NA 4B6IA 3BEHA 4D4NA 1BZ4A 5JRAA 4U5BE 5HV9A 5T1DB 3ABLC 5KYWB 1NG1A 4FX5A 4C3EA 1V74B 4JTAB 5EK0A 5DQZA 1Q0KA 5EGYA 5F28E 3ABMC 2C04A 3MLGA 4MVSA 4AK9A 1Z3IX 3LEVA 3DJUB 1QZXA 4CS8C 1S05A 2LP4A 3FHDA 1GM5A 5DS5A 3DM5A 2ZD9A 3DJNB 3HKKA 2P7VA 4GEHA 4MVRA 3GORA 3SEOA 4YT4A 3FXHA 4JZAA 1E85A 3I4UA 2D4UA 3AG1C 3ZWIA 2GA0A 1E2XA 3QVYA 4BPMA 4XLPF 3W8IA 4MVMA 4R32A 1NU7D 4FAPB 1ORSC 3U5SA 2EIJC 4EBKA 1ORYA 3B0UX 2Q9BA 3C8GB 1OW7A 4DXWA 3E70C 3MYFA 3ZDLA 2R7WA 2PP4A 1LIHA 2XL6A 3C8ZA 3C62A 3K1IC 3QMKA 4YJWA 3U2MA 3DMDA 2HJ3A 4LLCA 3V5YA 4EKWA 2G62A 2HZ8A 4MTGA 1XWJA 1Q0DA 2Q3TA 2YRFA 1OXBA 3BRJA 3RKOF 1Z23A 3RH3A 4Z9IA 1NLXA 3RIPA 4ZLDA 4X0RA 3W4YA 3ECSA 1AVOB 2YL7A 1BR2A 2CW0F 2L9JA 2XM0A 2YVKA 1JOGA 1OW6A 1T9KA 1VLSA 2DI3A 1ZZPA 5D92A 1ST6A 2KW3C 4ER9A 5DS6A 2J9VA 2J0XA 2OEVA 1OCOC 4YK5A 1FMVA 3X2QC 3NMJA 1RKEA 4BG0A 3DAGA 2V26A 5EHHA 1A7VA 4O6NA 3EG9B 3I5PA 2A69F 1RCPA 3B9QA 3KPHA 4P6IC 4J7YA 1WASA 2E87A 3EJNA 2HMZA 2VH3A 4QI0A 3NMKA 1LE2A 2H7BA 1IZMA 3DE9A 1GQAA 3PHF2 3SYNA 1OQCA 1WOLA 4RBNA 4CS9C 3S90A 3K6BA 4JVSA 1LKXA 1T5OA 1NFOA 2WZGA 4U5CE 1M6TA 4N6CA 3M15A 3EH1A 1MNEA 3VM6A 3EPVA 3FAJA 2GFHA 3CAXA 1O5HA 2OJQA 3F46A 4IRUA 1W2WA 2J9BA 3EGXB 3RYLA 5COMA 3EGDA 3IQ6A 1Z6AA 3GEEA 3S29A 2ETSA 1GS9A 4Q7CA 3S84A 2MYSA 3O39A 2XRHA 2XLEA 3K66A 5T3WA 1XZPA 3RVYA 2NUPA 3S27A 4CX9A 4DOZA 4CIPA 2XSEA 1EQ1A 1HE1A 1YARO 2L6HA 1V54C 5L0DA 2R7OA 1YJGA 4JJGA 3EH2A 3I5QA 4G7ZF 2P0NA 4PJJA 3ZVRA 2EPLX 1Z63A 2IOQA 3HNLA 4P9FA 4KI2A 5COFA 4NQFA 2Z15A 3Q7LA 1HW1A 4DBQA 4PR9A 5B3SC 4E17A 4JW1A 1J8MF 1OCRC 3DXJF 2VCBA 1G8XA 5D91A 1A7EA 2HS5A 3B29A 3EFOB 1NBBA 1H6GA 2B0HA 1LM3B 1TWAA 2BE5F 4NY3A 4CIHA 4K7BA 3V7OA 2OJED 1YYJA 1NZEA 3IEEA 2GAQA 1V55C 2LD6A 4BJ1A 1AUEA 1LI7A 1VYIA 1PD0A 2IXMA 1PV3A 2XLWA 3LS0A 3Q6MA 3N24A 4J30B 2AWCA 4E18A 4YL3A 4CJOA 1Y4CA 4E7SA 4PJLA 3J06A 1VLTA 1D0ZA 4G7OF 2XL8A 3Q7GA 3MBGA 3HTKC 2RSEB 2YL0A 3RF3A 2HUJA 4JRZA 5L0FA 2VCCA 1BDJB 2YWAA 2YL1A 1UG7A 3ZQYA 3ZG1A 1SR2A 2XLDA 3VAYA 3DZAA 3ZIBA 5A6KA 5BQHA 4CS8A 2H7VC 3CQZA 4MVQA 4W8KA 3S9OA 5JUAA 3WODF 4AE4A 2XLMA 3HJCA 2Y3DA 1TFKB 2NSGA 4PK4A 2WZFA 1U0BB 1E83A 1YA9A 4PFOA 4ULVA 1WGWA 2L6FA 2HKVA 3W2VA 3US6A 2LFDA 3GM1A 2EPMX 1JR8A 3RW0A 4M63A 3ABKC 2YLIA 2W4MA 4C7OA 5A6BD 2X0CA 3K1IA 1OR3A 1YLMA 2YL3A 3R7CA 2OEXA 5FZTA 4U5GA 2P61A 4YN0B 1MMNA 4CJGA 1N1CA 2MHRA 1QPUA 2M64A 2QNLA 5L0CA 5JT4A 3B0VC 5F5HA 4N4WA 2VCAA 4K1OA 3RFYA 2Q4FA 5KYXA 3JYYA 1AEPA 1T6QA 4BEMJ 5KYYB 4C3DA 3O55A 5L0IA 1L7CA 4HFFB 3NYMA 1ZHXA 2CNWD 2QY9A 1R5ID 2XS1A 3EZHA 4BJTA 4WABA 3QTHA 3ASOC 4U5EE 5AGFA 1VYKA 5E3CA 2LFFA 3FVYA 2EPKX 1VOMA 5AC4A 3HLZA 3SNHA 1M2VA 3NRHA 5DVWA 2WVOA 1LVKA 4JCHA 4OIRF 5A6JA 1D0YA 1Q0GA 4G7HF 4O6YA 5T3TA 1EKYA 4PJMA 2Q00A 1FFTC 2YEVA 1CGME 1RJ9B 4LERA 3OEOA 5A6BA 1MNDA 1K40A 3SXZA 2HSQA 2QLAA 2NUTA 5KYNA 1K04A 3VRCA 4CDAA 3VF0A 4CS9A 2Q9AA 2KSFA 4U9DA 1OKKD 3V5ZA 1OR2A 2PFDA 3VYWA 3N0TA 2WL8A 1RKEB 1M56C 3C7JA 1TR2A 2CDQA 3K1HA 4MQ9F 2ICWG 3LUTB 1D1BA 1IW7F 2YLDA 4WGYA 2HV7A 2R7QA 3L8IA 2HFIA 2KGOA 2Y3GA 3TK0A 3TOMA 4I3MA 3RQGA 2CNWA 1HE9A 2FAPB 4WJ0A 1BR1A 5COGA 2XM4A 4EBBA 3T6GB 2RD9A 3LEOA 1RMVA 2GWWA 3F47A 3PMRA 4GYTA 3OWTA 4EBJA 2EILC 3JT1A 3KMIA 4JURI 2EIMC 4LACB 5GPGB 1EI7A 1FAPB 3B71A 2WB7A 4NTAA 4HEAJ 5TJ5E 2PX0A 2IXNA 1ZHWA 2EPNA 2VB6A 3UMKA 1LE4A 5DS4A 2P1AA 3GEHA 3NG1A 4CSAA 4JTCB 1J8YF 2MWQA 3H2UA 4IB4A 1ZVZA 3EGDB 4FESA 3U8PA 2XLVA 2ZXPA 3UGOA 1WWPA 3U3FA 3TD7A 1LPEA 3K33A 2VC9A 3G50A 2AVKA 1JPJA 2HSBA 4K0DA 5B1BC 2NUPB 1WN0A 2PX3A 2JX0A 1OKKA 3ZTZA 4E0HA 4YL1A 1ORJA 2Q9CA 4U5FE 1ZYRF 1V4AA 4OIPF 2R7XA 5L3QA 1CPQA 4MNDA 1ZHYA 2A0UA 2O9XA 2YZSA 2CCYA 3KYIA 1O87A 2IM8A 5KYUA 3TQOA 1YA7O 2KNHA 2BL2A 2UUIA 2UUHA 3UNGC 4CSAC 3L34A 3T6JA 3RQEA 3IQCA 3QW1A 3UGPA 1C17M 2VASA 2W45A 3NKEA 3CEXA 1TQGA 4XEVA 2J9UA 3EZIA 4RD9A 3WHNA 1VK5A 1MMAA 2JD3A 1JMWA 3ATPA 4NC3A 2DGJA 2J8WA 4G0HA 2F22A 3M1CB 4AX2A 3DE8A 2R25A 1LS1A 1DOVA 5DQTA 3TULA 4XEFA 4XEKA 5JP7A 2J7PD 4EWCA 4DJ9A 3M4CA 5F5FA 2ZXWC 3DAFA 4LDRA 3PDMP 4MW3A 2R7RA 1QVXA 3MYIA 4JKVA 3U9JA 1D0XA 3SZRA 4HE8D 4OIQF 2J9WA 1RKCA 4JIOA 4YT5A 1JRAA 1TFOB 2XXAA 2NPUA 2XS8A 2AU5A 4KNWA 2HJMA 3LAYA 1Q0FA 1ZW3A 4G78A 4N6HA 5L0GA 1H9TA 3A9CA 4RDAA 4AE4B 3SXYA 1PCXA 4DVZA 3AGUA 3O10A 3RVZA 1YZCA 2G3KA 5BUOA 1YDIA 2YKZA 5AC5A 3S0XA 1VTMP 2TMVP 3G4ZA 4E0IA 4Q5SF 1OCCC 3U0CA 2J0WA 1SYQA 2R02A 1Q0MA 2A68F 4PJNA 5DLJA 4DRHB 2R7TA 3RQFA 3JYHA 4C7OB 1C03A 3TJ5A 2OKUA 3ZQVA 2CGEA 4ZLCA 5L3VA 1H7IA 2B0JA 4JEBA 4LLEA 2Y3BA 4N06A 4MW8A 2WZLA 4O79A 1LI5A 4XTKA 3POVA 3NYJA 2J7PA 2L81A 2YHSA 4BEJA 1HMDA 2OOCA 4KBLA 5A6AA 1KNYA 4FWVA 4XPYA 2P6VA 4IAQA 3FOOA 1QQ3A 3KYJA 4HFKB 4QDLA 1JPNA 1TWCA 4MS2A 2J46A 1G4WR 2XLOA 1F1MA 5KYXB 4JC7A 4DRIB 1I4ZA 4W8PA 2QE9A 5A69A 4I1OB 5HSWA 1APCA 3FAPB 4H54A 4CDVA 2NSFA 4MTFA 2IBFA 1FMWA 2R7UA 2I15A 3AQBA 4I44A 3QZCA 3IQTA 4L6RA 4BJ6A 3ZTMA 1PD1A 3JZ0A 3C8GD 2DYSC 1ZU4A 1FR0A 1OW8A 3U9MA 5FCLA 4AL0A 2I8BA 2R9RB 3ASNC 5JVEA 1FNTc 1M2VB 2AWYA 3HNJA 2AP3A 1ZU5A 1SF8A 3AG3C 3LESA 3ZSUA 4A2NB 1TWHA 1G4US 3O6XA 3X1OA 4A4AA 5BQIA 5KYWA 4PACA 2YLGA 3L0IA 1CGOA 4KC9A 4YT8A 1WATA 4KNVA 3IPMO 1YZAA 3GODA 3TJ6A 3T4RA 4XWJA 1T6IA 2IYLD 3LNRA 1VMAA 3QVZA 2NUTB 2LK4A 4U9EA 5BQGA 1BBHA 5CIVA 3M79A 1HW2A 2KYHA 2LQGA 4BJ6C 3GWLA 4O6MA 5E2QA 1OXKA 4ONSA 3UMHA 4LDKA 1DOWA 1ZHZA 2R03A 3LNMB 4XQ1A 3DWWA 5KYYA 2R05A 4MVUA 2L7AA 1MMDA 2IXPA 2LIGA 3AG4C 1HY5A 3TOLA 1VB5A 3FMSA 1ZHTA 1U6HA 3AG2C 1QLEC 2OU6A 1TKNA 2LCHA 4Z9HA 5E33A 3LJBA 3L8JA 3JRMO 5CI8A 4O7GA 1HMOA 3IQ5A 2FFHA 4YT2A 4WGZA 3WAQA 2NG1A 3C8GA 4QI2A 4IJJA 3CZ6A 3DI5A 3GM2A 2PF4E 3UR3C 1D1AA 3KH2A 3KL4A 4J7TA 2Y39A 4NTFA 1M57C 4DBRA 1FTSA 5B1AC 1M2OA 2KJGA 2X51A 2YQYA 3C18A 2QUPA 3JTLO 4IGGA 1CGNA 1RJ9A 1YYXA 3LLIA 1H9GA 5IY5C 2HMQA 5CI9A 1O3UA 1T01A 1A41A 2PNOA 3MFNA 4Q4ZF 2A6EF 4OINF 3HNKA 4E7ZA 2R7SA 3U2LA 2ASRA 1A0BA 2XL4A 3DM9B 2A6HF 3W2WA 3NMIA 2XLHA 3EQLF 3JRTA 4I1MA 3G4XA 1BR4A 1MMGA 3FOPA 3ITFA 3C63A 3SXKA 3PCVA 4BJ5A 1SZIA 3S28A 3U3BA 256BA 3NYLA 5JLIA 3SXMA 4UDVA 2EIKC 1CPRA 2KC3A 4LDQA 3UMIA 3AQCA 4JCZA 4OD5A 2A1DD 2KQ9A 5KYUB 3EG9A 2FGYA 3NDBB 4D4XA 4XPWA 3DD7A 4F4BA 2IXOA 1QSPA 1C02A 3GANA 4NTBA 1A7DA 1NSGB 1WTYA 3AGTA 3M4BA 4C3BA 4JJFA 5K0IA 2CYDA 1R4TA 2Y69C 4NCQA 1S7ZA 3T6BA 2M4EA 1LS4A 2W9YA 1TWGA 3JSEO 4CDYA 4BJ5C 3MX3A 2OCCC 2D5RB 1E86A 3EHNA 3EGXA 4PFPA 2H8AA 5L0JA 3AOUA 3JCUQ 2WVNA 3JSZA 4EHPA 1KTMA 3GM3A 3T9OA 2W4BA 4IARA 4AL1A 4EIYA 1E84A 2V3CC 1EA8A 2OQMA 1L3PA 1Y6DA 2XXAB 3LS1A 2LSEA 3OA1A 2KK1A 5E3AA 1NFNA 3K7DA 3IHUA 2Q7RA 3WG7C 2OG2A 3N2ZB 2H7OA 2JPUA 1I4YA 1QKRA 3CSKA 3L1MA 4J32B 1RXQA 4MVOA 1K05A 1UFBA 2GDCA 1YAUO 1B68A 2L6GA 2ZXOA 3DKAA 1Z7Qc 1XZQA 4IWBA 4ULWA 2PBEA 1JAFA 1T6UA 1ZW2A 4ANJA 4EUKB 2DB4A 3A11A 2ZXRA 4XPXA 1FFHA 2QTVA 4OD4A 4YL0A 3GWNA 4Z9JA 1U89A 3NKDA 3EFOA 3R2PA 1Z5ZA 4H4KC 3U8VA
chains in the Genus database with same CATH topology
1JR8A 3TK0A 4E0HA 3U2MA 2HJ3A 3R7CA 1JRAA 3MBGA 3W4YA 1OQCA 3LLIA 3LLKA 3GWLA 3U2LA 4LDKA 3GWNA 3O55A 3TD7A 4E0IA 3U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR8 A;  3TK0 A;  4E0H A;  3U2M A;  2HJ3 A;  3R7C A;  1JRA A;  3MBG A;  3W4Y A;  1OQC A;  3LLI A;  3LLK A;  3GWL A;  3U2L A;  4LDK A;  3GWN A;  3O55 A;  3TD7 A;  4E0I A;  3U5S A; 
#chains in the Genus database with same CATH topology
 2EPO A;  3Q6N A;  2A0B A;  4JE9 A;  1KU2 A;  3H2V A;  4MVZ A;  2EIN C;  1OCZ C;  1GGQ A;  3B0P A;  3EHM A;  3HNI A;  5JSL A;  4U5H A;  4YWQ A;  2R7V A;  5B3I A;  2WVQ A;  4IAO A;  1NU9 C;  5L0H A;  5JS5 A;  2Y3H A;  4U5D E;  4CS7 A;  3QW0 A;  3FDQ A;  1SMY F;  1YVI A;  2ZPA A;  3AJM A;  3GEI A;  4XLN F;  4JEA A;  1MQV A;  2G3V A;  3V5X A;  4DVY P;  1G5Z A;  4P9T A;  4MTO A;  1D1C A;  4OIO F;  3LLK A;  2BC5 A;  4JTD B;  3H65 A;  3W8H A;  2C03 A;  4DRJ B;  2J45 A;  2HV6 A;  3SP1 A;  3E9V A;  3ZC4 A;  3KKB A;  4CBE A;  2DYR C;  4GQH A;  1I5N A;  4B6I A;  3BEH A;  4D4N A;  1BZ4 A;  5JRA A;  4U5B E;  5HV9 A;  5T1D B;  3ABL C;  5KYW B;  1NG1 A;  4FX5 A;  4C3E A;  1V74 B;  4JTA B;  5EK0 A;  5DQZ A;  1Q0K A;  5EGY A;  5F28 E;  3ABM C;  2C04 A;  3MLG A;  4MVS A;  4AK9 A;  1Z3I X;  3LEV A;  3DJU B;  1QZX A;  4CS8 C;  1S05 A;  2LP4 A;  3FHD A;  1GM5 A;  5DS5 A;  3DM5 A;  2ZD9 A;  3DJN B;  3HKK A;  2P7V A;  4GEH A;  4MVR A;  3GOR A;  3SEO A;  4YT4 A;  3FXH A;  4JZA A;  1E85 A;  3I4U A;  2D4U A;  3AG1 C;  3ZWI A;  2GA0 A;  1E2X A;  3QVY A;  4BPM A;  4XLP F;  3W8I A;  4MVM A;  4R32 A;  1NU7 D;  4FAP B;  1ORS C;  3U5S A;  2EIJ C;  4EBK A;  1ORY A;  3B0U X;  2Q9B A;  3C8G B;  1OW7 A;  4DXW A;  3E70 C;  3MYF A;  3ZDL A;  2R7W A;  2PP4 A;  1LIH A;  2XL6 A;  3C8Z A;  3C62 A;  3K1I C;  3QMK A;  4YJW A;  3U2M A;  3DMD A;  2HJ3 A;  4LLC A;  3V5Y A;  4EKW A;  2G62 A;  2HZ8 A;  4MTG A;  1XWJ A;  1Q0D A;  2Q3T A;  2YRF A;  1OXB A;  3BRJ A;  3RKO F;  1Z23 A;  3RH3 A;  4Z9I A;  1NLX A;  3RIP A;  4ZLD A;  4X0R A;  3W4Y A;  3ECS A;  1AVO B;  2YL7 A;  1BR2 A;  2CW0 F;  2L9J A;  2XM0 A;  2YVK A;  1JOG A;  1OW6 A;  1T9K A;  1VLS A;  2DI3 A;  1ZZP A;  5D92 A;  1ST6 A;  2KW3 C;  4ER9 A;  5DS6 A;  2J9V A;  2J0X A;  2OEV A;  1OCO C;  4YK5 A;  1FMV A;  3X2Q C;  3NMJ A;  1RKE A;  4BG0 A;  3DAG A;  2V26 A;  5EHH A;  1A7V A;  4O6N A;  3EG9 B;  3I5P A;  2A69 F;  1RCP A;  3B9Q A;  3KPH A;  4P6I C;  4J7Y A;  1WAS A;  2E87 A;  3EJN A;  2HMZ A;  2VH3 A;  4QI0 A;  3NMK A;  1LE2 A;  2H7B A;  1IZM A;  3DE9 A;  1GQA A;  3PHF 2;  3SYN A;  1OQC A;  1WOL A;  4RBN A;  4CS9 C;  3S90 A;  3K6B A;  4JVS A;  1LKX A;  1T5O A;  1NFO A;  2WZG A;  4U5C E;  1M6T A;  4N6C A;  3M15 A;  3EH1 A;  1MNE A;  3VM6 A;  3EPV A;  3FAJ A;  2GFH A;  3CAX A;  1O5H A;  2OJQ A;  3F46 A;  4IRU A;  1W2W A;  2J9B A;  3EGX B;  3RYL A;  5COM A;  3EGD A;  3IQ6 A;  1Z6A A;  3GEE A;  3S29 A;  2ETS A;  1GS9 A;  4Q7C A;  3S84 A;  2MYS A;  3O39 A;  2XRH A;  2XLE A;  3K66 A;  5T3W A;  1XZP A;  3RVY A;  2NUP A;  3S27 A;  4CX9 A;  4DOZ A;  4CIP A;  2XSE A;  1EQ1 A;  1HE1 A;  1YAR O;  2L6H A;  1V54 C;  5L0D A;  2R7O A;  1YJG A;  4JJG A;  3EH2 A;  3I5Q A;  4G7Z F;  2P0N A;  4PJJ A;  3ZVR A;  2EPL X;  1Z63 A;  2IOQ A;  3HNL A;  4P9F A;  4KI2 A;  5COF A;  4NQF A;  2Z15 A;  3Q7L A;  1HW1 A;  4DBQ A;  4PR9 A;  5B3S C;  4E17 A;  4JW1 A;  1J8M F;  1OCR C;  3DXJ F;  2VCB A;  1G8X A;  5D91 A;  1A7E A;  2HS5 A;  3B29 A;  3EFO B;  1NBB A;  1H6G A;  2B0H A;  1LM3 B;  1TWA A;  2BE5 F;  4NY3 A;  4CIH A;  4K7B A;  3V7O A;  2OJE D;  1YYJ A;  1NZE A;  3IEE A;  2GAQ A;  1V55 C;  2LD6 A;  4BJ1 A;  1AUE A;  1LI7 A;  1VYI A;  1PD0 A;  2IXM A;  1PV3 A;  2XLW A;  3LS0 A;  3Q6M A;  3N24 A;  4J30 B;  2AWC A;  4E18 A;  4YL3 A;  4CJO A;  1Y4C A;  4E7S A;  4PJL A;  3J06 A;  1VLT A;  1D0Z A;  4G7O F;  2XL8 A;  3Q7G A;  3MBG A;  3HTK C;  2RSE B;  2YL0 A;  3RF3 A;  2HUJ A;  4JRZ A;  5L0F A;  2VCC A;  1BDJ B;  2YWA A;  2YL1 A;  1UG7 A;  3ZQY A;  3ZG1 A;  1SR2 A;  2XLD A;  3VAY A;  3DZA A;  3ZIB A;  5A6K A;  5BQH A;  4CS8 A;  2H7V C;  3CQZ A;  4MVQ A;  4W8K A;  3S9O A;  5JUA A;  3WOD F;  4AE4 A;  2XLM A;  3HJC A;  2Y3D A;  1TFK B;  2NSG A;  4PK4 A;  2WZF A;  1U0B B;  1E83 A;  1YA9 A;  4PFO A;  4ULV A;  1WGW A;  2L6F A;  2HKV A;  3W2V A;  3US6 A;  2LFD A;  3GM1 A;  2EPM X;  1JR8 A;  3RW0 A;  4M63 A;  3ABK C;  2YLI A;  2W4M A;  4C7O A;  5A6B D;  2X0C A;  3K1I A;  1OR3 A;  1YLM A;  2YL3 A;  3R7C A;  2OEX A;  5FZT A;  4U5G A;  2P61 A;  4YN0 B;  1MMN A;  4CJG A;  1N1C A;  2MHR A;  1QPU A;  2M64 A;  2QNL A;  5L0C A;  5JT4 A;  3B0V C;  5F5H A;  4N4W A;  2VCA A;  4K1O A;  3RFY A;  2Q4F A;  5KYX A;  3JYY A;  1AEP A;  1T6Q A;  4BEM J;  5KYY B;  4C3D A;  3O55 A;  5L0I A;  1L7C A;  4HFF B;  3NYM A;  1ZHX A;  2CNW D;  2QY9 A;  1R5I D;  2XS1 A;  3EZH A;  4BJT A;  4WAB A;  3QTH A;  3ASO C;  4U5E E;  5AGF A;  1VYK A;  5E3C A;  2LFF A;  3FVY A;  2EPK X;  1VOM A;  5AC4 A;  3HLZ A;  3SNH A;  1M2V A;  3NRH A;  5DVW A;  2WVO A;  1LVK A;  4JCH A;  4OIR F;  5A6J A;  1D0Y A;  1Q0G A;  4G7H F;  4O6Y A;  5T3T A;  1EKY A;  4PJM A;  2Q00 A;  1FFT C;  2YEV A;  1CGM E;  1RJ9 B;  4LER A;  3OEO A;  5A6B A;  1MND A;  1K40 A;  3SXZ A;  2HSQ A;  2QLA A;  2NUT A;  5KYN A;  1K04 A;  3VRC A;  4CDA A;  3VF0 A;  4CS9 A;  2Q9A A;  2KSF A;  4U9D A;  1OKK D;  3V5Z A;  1OR2 A;  2PFD A;  3VYW A;  3N0T A;  2WL8 A;  1RKE B;  1M56 C;  3C7J A;  1TR2 A;  2CDQ A;  3K1H A;  4MQ9 F;  2ICW G;  3LUT B;  1D1B A;  1IW7 F;  2YLD A;  4WGY A;  2HV7 A;  2R7Q A;  3L8I A;  2HFI A;  2KGO A;  2Y3G A;  3TK0 A;  3TOM A;  4I3M A;  3RQG A;  2CNW A;  1HE9 A;  2FAP B;  4WJ0 A;  1BR1 A;  5COG A;  2XM4 A;  4EBB A;  3T6G B;  2RD9 A;  3LEO A;  1RMV A;  2GWW A;  3F47 A;  3PMR A;  4GYT A;  3OWT A;  4EBJ A;  2EIL C;  3JT1 A;  3KMI A;  4JUR I;  2EIM C;  4LAC B;  5GPG B;  1EI7 A;  1FAP B;  3B71 A;  2WB7 A;  4NTA A;  4HEA J;  5TJ5 E;  2PX0 A;  2IXN A;  1ZHW A;  2EPN A;  2VB6 A;  3UMK A;  1LE4 A;  5DS4 A;  2P1A A;  3GEH A;  3NG1 A;  4CSA A;  4JTC B;  1J8Y F;  2MWQ A;  3H2U A;  4IB4 A;  1ZVZ A;  3EGD B;  4FES A;  3U8P A;  2XLV A;  2ZXP A;  3UGO A;  1WWP A;  3U3F A;  3TD7 A;  1LPE A;  3K33 A;  2VC9 A;  3G50 A;  2AVK A;  1JPJ A;  2HSB A;  4K0D A;  5B1B C;  2NUP B;  1WN0 A;  2PX3 A;  2JX0 A;  1OKK A;  3ZTZ A;  4E0H A;  4YL1 A;  1ORJ A;  2Q9C A;  4U5F E;  1ZYR F;  1V4A A;  4OIP F;  2R7X A;  5L3Q A;  1CPQ A;  4MND A;  1ZHY A;  2A0U A;  2O9X A;  2YZS A;  2CCY A;  3KYI A;  1O87 A;  2IM8 A;  5KYU A;  3TQO A;  1YA7 O;  2KNH A;  2BL2 A;  2UUI A;  2UUH A;  3UNG C;  4CSA C;  3L34 A;  3T6J A;  3RQE A;  3IQC A;  3QW1 A;  3UGP A;  1C17 M;  2VAS A;  2W45 A;  3NKE A;  3CEX A;  1TQG A;  4XEV A;  2J9U A;  3EZI A;  4RD9 A;  3WHN A;  1VK5 A;  1MMA A;  2JD3 A;  1JMW A;  3ATP A;  4NC3 A;  2DGJ A;  2J8W A;  4G0H A;  2F22 A;  3M1C B;  4AX2 A;  3DE8 A;  2R25 A;  1LS1 A;  1DOV A;  5DQT A;  3TUL A;  4XEF A;  4XEK A;  5JP7 A;  2J7P D;  4EWC A;  4DJ9 A;  3M4C A;  5F5F A;  2ZXW C;  3DAF A;  4LDR A;  3PDM P;  4MW3 A;  2R7R A;  1QVX A;  3MYI A;  4JKV A;  3U9J A;  1D0X A;  3SZR A;  4HE8 D;  4OIQ F;  2J9W A;  1RKC A;  4JIO A;  4YT5 A;  1JRA A;  1TFO B;  2XXA A;  2NPU A;  2XS8 A;  2AU5 A;  4KNW A;  2HJM A;  3LAY A;  1Q0F A;  1ZW3 A;  4G78 A;  4N6H A;  5L0G A;  1H9T A;  3A9C A;  4RDA A;  4AE4 B;  3SXY A;  1PCX A;  4DVZ A;  3AGU A;  3O10 A;  3RVZ A;  1YZC A;  2G3K A;  5BUO A;  1YDI A;  2YKZ A;  5AC5 A;  3S0X A;  1VTM P;  2TMV P;  3G4Z A;  4E0I A;  4Q5S F;  1OCC C;  3U0C A;  2J0W A;  1SYQ A;  2R02 A;  1Q0M A;  2A68 F;  4PJN A;  5DLJ A;  4DRH B;  2R7T A;  3RQF A;  3JYH A;  4C7O B;  1C03 A;  3TJ5 A;  2OKU A;  3ZQV A;  2CGE A;  4ZLC A;  5L3V A;  1H7I A;  2B0J A;  4JEB A;  4LLE A;  2Y3B A;  4N06 A;  4MW8 A;  2WZL A;  4O79 A;  1LI5 A;  4XTK A;  3POV A;  3NYJ A;  2J7P A;  2L81 A;  2YHS A;  4BEJ A;  1HMD A;  2OOC A;  4KBL A;  5A6A A;  1KNY A;  4FWV A;  4XPY A;  2P6V A;  4IAQ A;  3FOO A;  1QQ3 A;  3KYJ A;  4HFK B;  4QDL A;  1JPN A;  1TWC A;  4MS2 A;  2J46 A;  1G4W R;  2XLO A;  1F1M A;  5KYX B;  4JC7 A;  4DRI B;  1I4Z A;  4W8P A;  2QE9 A;  5A69 A;  4I1O B;  5HSW A;  1APC A;  3FAP B;  4H54 A;  4CDV A;  2NSF A;  4MTF A;  2IBF A;  1FMW A;  2R7U A;  2I15 A;  3AQB A;  4I44 A;  3QZC A;  3IQT A;  4L6R A;  4BJ6 A;  3ZTM A;  1PD1 A;  3JZ0 A;  3C8G D;  2DYS C;  1ZU4 A;  1FR0 A;  1OW8 A;  3U9M A;  5FCL A;  4AL0 A;  2I8B A;  2R9R B;  3ASN C;  5JVE A;  1FNT c;  1M2V B;  2AWY A;  3HNJ A;  2AP3 A;  1ZU5 A;  1SF8 A;  3AG3 C;  3LES A;  3ZSU A;  4A2N B;  1TWH A;  1G4U S;  3O6X A;  3X1O A;  4A4A A;  5BQI A;  5KYW A;  4PAC A;  2YLG A;  3L0I A;  1CGO A;  4KC9 A;  4YT8 A;  1WAT A;  4KNV A;  3IPM O;  1YZA A;  3GOD A;  3TJ6 A;  3T4R A;  4XWJ A;  1T6I A;  2IYL D;  3LNR A;  1VMA A;  3QVZ A;  2NUT B;  2LK4 A;  4U9E A;  5BQG A;  1BBH A;  5CIV A;  3M79 A;  1HW2 A;  2KYH A;  2LQG A;  4BJ6 C;  3GWL A;  4O6M A;  5E2Q A;  1OXK A;  4ONS A;  3UMH A;  4LDK A;  1DOW A;  1ZHZ A;  2R03 A;  3LNM B;  4XQ1 A;  3DWW A;  5KYY A;  2R05 A;  4MVU A;  2L7A A;  1MMD A;  2IXP A;  2LIG A;  3AG4 C;  1HY5 A;  3TOL A;  1VB5 A;  3FMS A;  1ZHT A;  1U6H A;  3AG2 C;  1QLE C;  2OU6 A;  1TKN A;  2LCH A;  4Z9H A;  5E33 A;  3LJB A;  3L8J A;  3JRM O;  5CI8 A;  4O7G A;  1HMO A;  3IQ5 A;  2FFH A;  4YT2 A;  4WGZ A;  3WAQ A;  2NG1 A;  3C8G A;  4QI2 A;  4IJJ A;  3CZ6 A;  3DI5 A;  3GM2 A;  2PF4 E;  3UR3 C;  1D1A A;  3KH2 A;  3KL4 A;  4J7T A;  2Y39 A;  4NTF A;  1M57 C;  4DBR A;  1FTS A;  5B1A C;  1M2O A;  2KJG A;  2X51 A;  2YQY A;  3C18 A;  2QUP A;  3JTL O;  4IGG A;  1CGN A;  1RJ9 A;  1YYX A;  3LLI A;  1H9G A;  5IY5 C;  2HMQ A;  5CI9 A;  1O3U A;  1T01 A;  1A41 A;  2PNO A;  3MFN A;  4Q4Z F;  2A6E F;  4OIN F;  3HNK A;  4E7Z A;  2R7S A;  3U2L A;  2ASR A;  1A0B A;  2XL4 A;  3DM9 B;  2A6H F;  3W2W A;  3NMI A;  2XLH A;  3EQL F;  3JRT A;  4I1M A;  3G4X A;  1BR4 A;  1MMG A;  3FOP A;  3ITF A;  3C63 A;  3SXK A;  3PCV A;  4BJ5 A;  1SZI A;  3S28 A;  3U3B A;  256B A;  3NYL A;  5JLI A;  3SXM A;  4UDV A;  2EIK C;  1CPR A;  2KC3 A;  4LDQ A;  3UMI A;  3AQC A;  4JCZ A;  4OD5 A;  2A1D D;  2KQ9 A;  5KYU B;  3EG9 A;  2FGY A;  3NDB B;  4D4X A;  4XPW A;  3DD7 A;  4F4B A;  2IXO A;  1QSP A;  1C02 A;  3GAN A;  4NTB A;  1A7D A;  1NSG B;  1WTY A;  3AGT A;  3M4B A;  4C3B A;  4JJF A;  5K0I A;  2CYD A;  1R4T A;  2Y69 C;  4NCQ A;  1S7Z A;  3T6B A;  2M4E A;  1LS4 A;  2W9Y A;  1TWG A;  3JSE O;  4CDY A;  4BJ5 C;  3MX3 A;  2OCC C;  2D5R B;  1E86 A;  3EHN A;  3EGX A;  4PFP A;  2H8A A;  5L0J A;  3AOU A;  3JCU Q;  2WVN A;  3JSZ A;  4EHP A;  1KTM A;  3GM3 A;  3T9O A;  2W4B A;  4IAR A;  4AL1 A;  4EIY A;  1E84 A;  2V3C C;  1EA8 A;  2OQM A;  1L3P A;  1Y6D A;  2XXA B;  3LS1 A;  2LSE A;  3OA1 A;  2KK1 A;  5E3A A;  1NFN A;  3K7D A;  3IHU A;  2Q7R A;  3WG7 C;  2OG2 A;  3N2Z B;  2H7O A;  2JPU A;  1I4Y A;  1QKR A;  3CSK A;  3L1M A;  4J32 B;  1RXQ A;  4MVO A;  1K05 A;  1UFB A;  2GDC A;  1YAU O;  1B68 A;  2L6G A;  2ZXO A;  3DKA A;  1Z7Q c;  1XZQ A;  4IWB A;  4ULW A;  2PBE A;  1JAF A;  1T6U A;  1ZW2 A;  4ANJ A;  4EUK B;  2DB4 A;  3A11 A;  2ZXR A;  4XPX A;  1FFH A;  2QTV A;  4OD4 A;  4YL0 A;  3GWN A;  4Z9J A;  1U89 A;  3NKD A;  3EFO A;  3R2P A;  1Z5Z A;  4H4K C;  3U8V A; 
#chains in the Genus database with same CATH homology
 1JR8 A;  3TK0 A;  4E0H A;  3U2M A;  2HJ3 A;  3R7C A;  1JRA A;  3MBG A;  3W4Y A;  1OQC A;  3LLI A;  3LLK A;  3GWL A;  3U2L A;  4LDK A;  3GWN A;  3O55 A;  3TD7 A;  4E0I A;  3U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...