3U5SA

Selenium substituted human augmenter of liver regeneration
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
SMRTQQKRDTKFREDUPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPUEEUAEDLRKRLARNHPDTRTRAAFTQWLUHLHNEVNRKLGKPDFDUSKVDERWRDGWKDGSUD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title (77)Se enrichment of proteins expands the biological NMR toolbox.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 41
structure length 126
sequence length 126
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u5sA01
3U2MA 4E0HA 3GWNA 3R7CA 3U5SA 1OQCA 3GWLA 2HJ3A 3LLKA 1JRAA 3W4YA 3TK0A 3O55A 3LLIA 1JR8A 3U2LA 4LDKA 3TD7A 3MBGA 4E0IA
chains in the Genus database with same CATH superfamily
4EUKB 2ZXWC 4HEAJ 1ZHXA 4CJOA 2Q3TA 2P6VA 2XM4A 1K04A 2WZFA 3C8GB 3LNRA 4I3MA 3R7CA 1VYKA 1Z5ZA 3HKKA 3QVZA 1IW7F 3FHDA 2B0HA 1DOWA 2HMQA 1ZVZA 1LE2A 1Q0GA 4MVUA 1Y6DA 2KSFA 1G4US 3HJCA 3KPHA 4EBKA 2P61A 4XPYA 3I5QA 1RMVA 1NBBA 1G5ZA 1M2OA 2W4MA 3DKAA 5DQZA 4CSAC 1XZQA 4OIOF 2QLAA 1OW8A 3SEOA 3X2QC 2QNLA 3A11A 1V74B 3U2LA 3FOPA 4U5FE 3JYYA 1V4AA 1I4YA 2CW0F 1H7IA 1J8MF 3PMRA 4FWVA 4J32B 1WWPA 3EZHA 4B6IA 2LK4A 4G0HA 1L7CA 4E7SA 5B3SC 4OD4A 4OD5A 1FR0A 1MMAA 1RKEA 3KH2A 3QTHA 5F28E 3JT1A 3HNKA 4IB4A 3RW0A 5JVEA 1UFBA 3HNJA 1OKKD 1OXKA 2OEXA 5JLIA 4NQFA 1GGQA 1AEPA 4IGGA 1SR2A 2QE9A 4JJGA 4KNWA 3ZDLA 4CIPA 2L6GA 3LS0A 2WVNA 1BR1A 2KJGA 1LPEA 3EGXA 1C02A 2XS8A 4JVSA 4ULWA 2Q4FA 1KNYA 5KYWA 1D0XA 2YWAA 4JC7A 2Z15A 3TQOA 3EHNA 2A69F 2FGYA 4ULVA 2Y39A 5BQGA 2EPNA 1AVOB 2J0XA 1FAPB 1E83A 1OW7A 5JP7A 3GANA 4YT4A 4YT8A 1AUEA 3FOOA 5L0GA 2Q9AA 4U5BE 3EZIA 2R03A 1EKYA 1E86A 3N24A 3NMKA 1QLEC 2R05A 5B1BC 3M15A 3H2VA 3K33A 4YL0A 1O87A 1RJ9A 4YL1A 2BC5A 3SXMA 3RFYA 4PJJA 3JSEO 1U0BB 4YK5A 1HE9A 1LVKA 3GEIA 1F1MA 3L8JA 2EIMC 5CI8A 3RIPA 1VTMP 1WGWA 2AP3A 2UUHA 2IXOA 2R7OA 3LLKA 1PCXA 2DGJA 2LSEA 4JJFA 1OR3A 2P1AA 2A0UA 3DXJF 5CIVA 1M2VB 1GM5A 2XLVA 2ZD9A 3ECSA 2OG2A 4KNVA 1MQVA 3T6BA 3V5XA 1B68A 3RQEA 3OWTA 2J45A 3E70C 4HFFB 4KI2A 3ZSUA 3EFOA 3SXYA 2HV6A 2G62A 3RF3A 3I4UA 2R7WA 2A6HF 1BR4A 1O3UA 5L0DA 3ZIBA 1WN0A 3CEXA 1VOMA 2O9XA 4IWBA 4JKVA 4CSAA 3C63A 4JTCB 3UNGC 1U6HA 3V7OA 3LAYA 3S0XA 2HSQA 1RKEB 2IBFA 2KK1A 2JD3A 3RKOF 3WAQA 2HV7A 3GM2A 2HUJA 1A41A 1LS4A 1LE4A 2OCCC 2R7QA 3B9QA 3O6XA 4MW8A 4U9DA 1M56C 2KW3C 4N6CA 2CNWA 1LS1A 2NSFA 2YZSA 3C8GA 4MVZA 4EKWA 1LI7A 1ST6A 3NMJA 3EGXB 2WZLA 1D1AA 2CCYA 2WL8A 2Y69C 3MLGA 4JIOA 3W4YA 5HSWA 4K0DA 4NTFA 1HMDA 2OJED 4O6YA 5KYWB 2C03A 1BBHA 2PNOA 4ONSA 5B1AC 4DVYP 4I1OB 1JMWA 1JR8A 4BJTA 4ZLCA 3MX3A 1HY5A 1S7ZA 4C3DA 2EPKX 4U5EE 1TFKB 2NPUA 4MTGA 3GM1A 3NG1A 3NYJA 2YL7A 2J9BA 4EWCA 2OQMA 4E18A 3FXHA 3U8PA 1TR2A 4BJ5C 3CAXA 4JCZA 3SXZA 2G3KA 1RJ9B 4D4XA 1OW6A 3SNHA 3PHF2 3U0CA 1TFOB 1TKNA 2A0BA 3X1OA 2EIJC 4JTAB 4BEMJ 1CGME 1S05A 4K1OA 4JEAA 4RBNA 4E17A 3LEVA 1NSGB 2CGEA 3US6A 1EQ1A 2DYRC 3G4XA 2QTVA 3C8ZA 4J7TA 2M4EA 1ORYA 2XL8A 4KC9A 4G7OF 4CX9A 4XEKA 3M4CA 3U3FA 1Y4CA 3TD7A 2GFHA 3TJ5A 4RD9A 4DOZA 1C17M 4WABA 2YL3A 4P9FA 2D4UA 3G4ZA 3OA1A 4OIPF 4JURI 2MYSA 5KYNA 3NDBB 1TWGA 3SXKA 3WG7C 1TWHA 2Y3HA 3JRTA 1CPRA 1Q0MA 4BJ6C 4YT2A 5COFA 3H65A 2HS5A 1ZW2A 2WB7A 1BZ4A 1NG1A 3ASNC 5DLJA 2XRHA 3KMIA 5CI9A 4CDAA 3KYJA 3U8VA 1E85A 4MNDA 4Z9JA 3ZG1A 3RYLA 2IM8A 3KKBA 4H4KC 3AQBA 4LERA 2L6FA 3K1IC 2YKZA 3C7JA 4XEVA 4XTKA 5KYUA 2VB6A 3U9JA 1M2VA 2R25A 4X0RA 5FZTA 4OINF 1D1CA 4P9TA 1H6GA 4MW3A 3B29A 4EBBA 4MQ9F 1QKRA 5A6BA 1FTSA 3K7DA 4EHPA 5A69A 1RXQA 3ZTZA 4DRHB 2J7PD 4JCHA 3ZQVA 5BUOA 4Q5SF 1BDJB 3HLZA 3R2PA 3LJBA 2YLIA 3MFNA 4CBEA 4HFKB 5AGFA 2A68F 5JUAA 1ZHTA 1OR2A 3DM5A 3H2UA 2EPLX 2BL2A 4NC3A 1Q0FA 1W2WA 4JW1A 2P0NA 2PX0A 5TJ5E 1YJGA 4BPMA 3LS1A 1E2XA 1T6IA 2XLMA 3EPVA 2AWCA 2JX0A 1T6QA 4MTOA 4BJ5A 3M79A 1NZEA 2R7SA 2VCAA 5COGA 3Q7GA 5E33A 1JOGA 2M64A 4YL3A 5JRAA 4NTAA 3TJ6A 2L7AA 4YJWA 2OEVA 4N6HA 1UG7A 3B0PA 1JPJA 3N2ZB 1HW2A 3ABKC 2VCCA 1RKCA 1SF8A 1YAUO 2AVKA 1J8YF 2KNHA 3B71A 2WVOA 1YLMA 2LIGA 3KYIA 5DVWA 4AK9A 1XWJA 2FAPB 3AG3C 3MBGA 1EA8A 3K66A 2CDQA 2PBEA 4NCQA 2YRFA 4QDLA 4G7HF 4ANJA 4U9EA 2YL1A 1D1BA 1LKXA 2A6EF 3GWNA 4MS2A 1OKKA 4I1MA 1QQ3A 4F4BA 2VC9A 3ZQYA 2W45A 3L8IA 3B0UX 4BJ6A 4U5HA 2KQ9A 2R02A 4OIQF 3U3BA 1YA7O 1R4TA 3DAGA 3TK0A 1ORJA 5KYUB 2MHRA 1K40A 4CS8C 2R7TA 4DBRA 4O7GA 4OIRF 4BJ1A 3M4BA 3UR3C 5E3CA 5JSLA 1NU7D 1QVXA 3OEOA 2KC3A 2LQGA 2XM0A 4CS7A 2IOQA 2Y3GA 3AG1C 1Z23A 1TWAA 4PACA 3AQCA 4EBJA 3B0VC 2ZXOA 2NUPB 3DAFA 1FFHA 3NRHA 2LD6A 3DD7A 2C04A 1Z3IX 5JS5A 2XXAB 2HZ8A 1Q0KA 5JT4A 2GA0A 3JSZA 3E9VA 1LIHA 1PD1A 3TOLA 4E0HA 2R7VA 2LFFA 3DJNB 4DRIB 2L6HA 4XLNF 3S27A 1WTYA 4XPWA 3EGDB 2WVQA 2ZXRA 1RCPA 3DE9A 5D91A 5COMA 3FVYA 3HNIA 4ER9A 4XPXA 2HSBA 1V54C 1H9GA 2R9RB 1OCCC 1SZIA 3RQGA 3EQLF 1BR2A 5L0FA 3NMIA 1JAFA 1V55C 2QY9A 2BE5F 3AGTA 3AOUA 3CZ6A 1YVIA 1T6UA 2B0JA 1G8XA 1VYIA 4PJMA 1YZAA 2PF4E 1FMWA 2XSEA 3IPMO 2PFDA 3L34A 4I44A 4N4WA 4AL0A 5HV9A 1D0YA 3RQFA 1FFTC 2XLHA 4YN0B 4C3EA 3ATPA 1G4WR 3W8HA 2GDCA 3EH2A 3EG9B 3VRCA 1YDIA 1ZW3A 2HJ3A 2XL4A 1HMOA 1WOLA 3JRMO 4XWJA 2DI3A 1VMAA 3LESA 1VB5A 4PK4A 4W8KA 1OCRC 1ZZPA 2ASRA 4GEHA 4QI2A 1A7EA 1ZHWA 2J9WA 3AJMA 3CSKA 3O55A 1MMNA 5F5FA 2AWYA 5L0CA 5L0IA 4YWQA 3S28A 1GQAA 1A0BA 5KYYB 4NTBA 5GPGB 4RDAA 3LUTB 2V26A 1LI5A 1YZCA 2EINC 3DM9B 3T6JA 3WHNA 5L3QA 2R7XA 4R32A 2PX3A 2J9UA 3ABLC 3LNMB 3IHUA 2YL0A 4GQHA 4CJGA 4LLEA 1ZU5A 5KYXB 4ZLDA 3AG2C 1OQCA 4NY3A 4Q4ZF 1KTMA 2YHSA 4MVRA 4LLCA 3GWLA 4AE4A 1H9TA 1E84A 2XS1A 2ICWG 2KGOA 3Q6MA 4G78A 3SZRA 1JRAA 1PV3A 3ZTMA 2HKVA 1U89A 2OJQA 5DQTA 3M1CB 1MMDA 1VLSA 1I4ZA 2XLOA 2NG1A 4J30B 3ZVRA 1N1CA 2OKUA 4W8PA 1QPUA 4DRJB 4A2NB 3I5PA 3GM3A 4LDKA 2UUIA 1ORSC 2NUTA 3POVA 4XEFA 3GORA 5AC4A 256BA 5DS6A 2NUPA 5L0HA 2DYSC 5EHHA 3S84A 2XXAA 4JTDB 3FDQA 3DE8A 2IYLD 4LDQA 4O6NA 2J8WA 2YVKA 3RVZA 5A6KA 1MMGA 2LCHA 1OCOC 1M6TA 2EPOA 3BEHA 3ITFA 1T01A 3JTLO 3NKEA 2V3CC 1ZU4A 3EGDA 2VCBA 5E2QA 2X51A 3SYNA 4CDVA 3UGPA 3UMKA 4U5GA 3UGOA 3F46A 2GAQA 1LM3B 2X0CA 1Z63A 3NYMA 3C62A 3QW1A 4O79A 3DI5A 5F5HA 4C7OA 1MNDA 3U9MA 1R5ID 2QUPA 2GWWA 3EHMA 4QI0A 1Q0DA 4IJJA 2I8BA 2VASA 1CPQA 3L1MA 2IXMA 4XQ1A 4YT5A 2YLDA 3UMHA 4CS9C 4CIHA 1ZHYA 2J7PA 3KL4A 1OCZC 3O39A 1ZHZA 3DWWA 5B3IA 5L0JA 1SYQA 1OXBA 2RSEB 2XLDA 2H7BA 3N0TA 3Q6NA 4H54A 3SP1A 3V5YA 4CDYA 3U2MA 3ZWIA 1CGNA 1APCA 2J9VA 4WGYA 1CGOA 1T5OA 1L3PA 1K05A 2H8AA 5E3AA 4AE4B 3LEOA 2YLGA 1QSPA 3FMSA 3V5ZA 1YARO 4DBQA 4Z9HA 2R7RA 2CYDA 3EG9A 4BG0A 4EIYA 5FCLA 2E87A 2L9JA 2RD9A 3ASOC 2NSGA 3EH1A 1WASA 3CQZA 3JYHA 4BEJA 4MTFA 3WODF 3VYWA 2MWQA 3AG4C 2PP4A 3TULA 2EIKC 3JZ0A 4PR9A 3RH3A 5T3TA 4JE9A 4A4AA 1YYJA 2A1DD 2NUTB 3K1IA 5DS5A 4Z9IA 5KYYA 4JRZA 1SMYF 2Q00A 3HNLA 3ZC4A 1M57C 2W4BA 5EGYA 1NLXA 3A9CA 3C18A 2JPUA 5D92A 2XLEA 5K0IA 5EK0A 3J06A 4PJLA 3JCUQ 3IQ6A 4JZAA 3W2WA 1DOVA 3IEEA 2ZPAA 2ZXPA 4FAPB 1JPNA 5IY5C 5KYXA 5T3WA 2CNWD 1TQGA 3C8GD 4E7ZA 2TMVP 1FMVA 2H7OA 3RVYA 1C03A 2DB4A 4FESA 1TWCA 1T9KA 4MVMA 4C7OB 2F22A 5AC5A 1O5HA 5T1DB 1NFNA 1XZPA 3TOMA 2XL6A 3IQCA 1ZYRF 3VM6A 3HTKC 1VLTA 2IXNA 3S9OA 2OU6A 2ETSA 2EPMX 4WJ0A 4JEBA 3T4RA 4XLPF 1VK5A 4L6RA 2HFIA 3BRJA 3GEEA 2FFHA 4D4NA 3AGUA 1QZXA 4PFPA 2Q7RA 2OOCA 1HW1A 3PDMP 4U5CE 4CS9A 1WATA 5BQIA 3S29A 1PD0A 2Y3BA 3NKDA 3NYLA 1A7DA 2D5RB 4LACB 3W2VA 4DVZA 2WZGA 2J46A 1YA9A 3QMKA 2Q9CA 3DJUB 4MVOA 2LFDA 3GODA 1D0ZA 2L81A 1NFOA 2LP4A 3ABMC 3Q7LA 3VAYA 4AX2A 5BQHA 4DJ9A 2YQYA 2AU5A 1FNTc 4UDVA 5A6AA 4Q7CA 3LLIA 4DXWA 3FAJA 4FX5A 1GS9A 1MNEA 4J7YA 5L3VA 1EI7A 4PJNA 1I5NA 4U5DE 5DS4A 4IAQA 3T6GB 3F47A 4CS8A 4GYTA 3QVYA 4WGZA 3S90A 4O6MA 2Y3DA 3IQTA 4K7BA 4MVSA 2HJMA 4LDRA 2IXPA 3UMIA 3VF0A 3PCVA 4M63A 4PFOA 2R7UA 3MYFA 2VH3A 2J0WA 3U5SA 4C3BA 3W8IA 1KU2A 1HE1A 1Z7Qc 1IZMA 2Q9BA 4P6IC 4MVQA 2XLWA 4N06A 2G3VA 4KBLA 2YEVA 3EJNA 5A6JA 1NU9C 3QW0A 1Z6AA 2H7VC 2W9YA 3QZCA 4G7ZF 2HMZA 3EFOB 3K1HA 3G50A 2EILC 3K6BA 4IARA 3DMDA 4HE8D 2I15A 3O10A 4IRUA 1YYXA 3IQ5A 3DZAA 2P7VA 5A6BD 3GEHA 3L0IA 3MYIA 4AL1A 3FAPB 2KYHA 4E0IA 4IAOA 1A7VA 3T9OA
chains in the Genus database with same CATH topology
3U2MA 4E0HA 3GWNA 3R7CA 3U5SA 1OQCA 3GWLA 2HJ3A 3LLKA 1JRAA 3W4YA 3TK0A 3O55A 3LLIA 1JR8A 3U2LA 4LDKA 3TD7A 3MBGA 4E0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2M A;  4E0H A;  3GWN A;  3R7C A;  3U5S A;  1OQC A;  3GWL A;  2HJ3 A;  3LLK A;  1JRA A;  3W4Y A;  3TK0 A;  3O55 A;  3LLI A;  1JR8 A;  3U2L A;  4LDK A;  3TD7 A;  3MBG A;  4E0I A; 
#chains in the Genus database with same CATH topology
 4EUK B;  2ZXW C;  4HEA J;  1ZHX A;  4CJO A;  2Q3T A;  2P6V A;  2XM4 A;  1K04 A;  2WZF A;  3C8G B;  3LNR A;  4I3M A;  3R7C A;  1VYK A;  1Z5Z A;  3HKK A;  3QVZ A;  1IW7 F;  3FHD A;  2B0H A;  1DOW A;  2HMQ A;  1ZVZ A;  1LE2 A;  1Q0G A;  4MVU A;  1Y6D A;  2KSF A;  1G4U S;  3HJC A;  3KPH A;  4EBK A;  2P61 A;  4XPY A;  3I5Q A;  1RMV A;  1NBB A;  1G5Z A;  1M2O A;  2W4M A;  3DKA A;  5DQZ A;  4CSA C;  1XZQ A;  4OIO F;  2QLA A;  1OW8 A;  3SEO A;  3X2Q C;  2QNL A;  3A11 A;  1V74 B;  3U2L A;  3FOP A;  4U5F E;  3JYY A;  1V4A A;  1I4Y A;  2CW0 F;  1H7I A;  1J8M F;  3PMR A;  4FWV A;  4J32 B;  1WWP A;  3EZH A;  4B6I A;  2LK4 A;  4G0H A;  1L7C A;  4E7S A;  5B3S C;  4OD4 A;  4OD5 A;  1FR0 A;  1MMA A;  1RKE A;  3KH2 A;  3QTH A;  5F28 E;  3JT1 A;  3HNK A;  4IB4 A;  3RW0 A;  5JVE A;  1UFB A;  3HNJ A;  1OKK D;  1OXK A;  2OEX A;  5JLI A;  4NQF A;  1GGQ A;  1AEP A;  4IGG A;  1SR2 A;  2QE9 A;  4JJG A;  4KNW A;  3ZDL A;  4CIP A;  2L6G A;  3LS0 A;  2WVN A;  1BR1 A;  2KJG A;  1LPE A;  3EGX A;  1C02 A;  2XS8 A;  4JVS A;  4ULW A;  2Q4F A;  1KNY A;  5KYW A;  1D0X A;  2YWA A;  4JC7 A;  2Z15 A;  3TQO A;  3EHN A;  2A69 F;  2FGY A;  4ULV A;  2Y39 A;  5BQG A;  2EPN A;  1AVO B;  2J0X A;  1FAP B;  1E83 A;  1OW7 A;  5JP7 A;  3GAN A;  4YT4 A;  4YT8 A;  1AUE A;  3FOO A;  5L0G A;  2Q9A A;  4U5B E;  3EZI A;  2R03 A;  1EKY A;  1E86 A;  3N24 A;  3NMK A;  1QLE C;  2R05 A;  5B1B C;  3M15 A;  3H2V A;  3K33 A;  4YL0 A;  1O87 A;  1RJ9 A;  4YL1 A;  2BC5 A;  3SXM A;  3RFY A;  4PJJ A;  3JSE O;  1U0B B;  4YK5 A;  1HE9 A;  1LVK A;  3GEI A;  1F1M A;  3L8J A;  2EIM C;  5CI8 A;  3RIP A;  1VTM P;  1WGW A;  2AP3 A;  2UUH A;  2IXO A;  2R7O A;  3LLK A;  1PCX A;  2DGJ A;  2LSE A;  4JJF A;  1OR3 A;  2P1A A;  2A0U A;  3DXJ F;  5CIV A;  1M2V B;  1GM5 A;  2XLV A;  2ZD9 A;  3ECS A;  2OG2 A;  4KNV A;  1MQV A;  3T6B A;  3V5X A;  1B68 A;  3RQE A;  3OWT A;  2J45 A;  3E70 C;  4HFF B;  4KI2 A;  3ZSU A;  3EFO A;  3SXY A;  2HV6 A;  2G62 A;  3RF3 A;  3I4U A;  2R7W A;  2A6H F;  1BR4 A;  1O3U A;  5L0D A;  3ZIB A;  1WN0 A;  3CEX A;  1VOM A;  2O9X A;  4IWB A;  4JKV A;  4CSA A;  3C63 A;  4JTC B;  3UNG C;  1U6H A;  3V7O A;  3LAY A;  3S0X A;  2HSQ A;  1RKE B;  2IBF A;  2KK1 A;  2JD3 A;  3RKO F;  3WAQ A;  2HV7 A;  3GM2 A;  2HUJ A;  1A41 A;  1LS4 A;  1LE4 A;  2OCC C;  2R7Q A;  3B9Q A;  3O6X A;  4MW8 A;  4U9D A;  1M56 C;  2KW3 C;  4N6C A;  2CNW A;  1LS1 A;  2NSF A;  2YZS A;  3C8G A;  4MVZ A;  4EKW A;  1LI7 A;  1ST6 A;  3NMJ A;  3EGX B;  2WZL A;  1D1A A;  2CCY A;  2WL8 A;  2Y69 C;  3MLG A;  4JIO A;  3W4Y A;  5HSW A;  4K0D A;  4NTF A;  1HMD A;  2OJE D;  4O6Y A;  5KYW B;  2C03 A;  1BBH A;  2PNO A;  4ONS A;  5B1A C;  4DVY P;  4I1O B;  1JMW A;  1JR8 A;  4BJT A;  4ZLC A;  3MX3 A;  1HY5 A;  1S7Z A;  4C3D A;  2EPK X;  4U5E E;  1TFK B;  2NPU A;  4MTG A;  3GM1 A;  3NG1 A;  3NYJ A;  2YL7 A;  2J9B A;  4EWC A;  2OQM A;  4E18 A;  3FXH A;  3U8P A;  1TR2 A;  4BJ5 C;  3CAX A;  4JCZ A;  3SXZ A;  2G3K A;  1RJ9 B;  4D4X A;  1OW6 A;  3SNH A;  3PHF 2;  3U0C A;  1TFO B;  1TKN A;  2A0B A;  3X1O A;  2EIJ C;  4JTA B;  4BEM J;  1CGM E;  1S05 A;  4K1O A;  4JEA A;  4RBN A;  4E17 A;  3LEV A;  1NSG B;  2CGE A;  3US6 A;  1EQ1 A;  2DYR C;  3G4X A;  2QTV A;  3C8Z A;  4J7T A;  2M4E A;  1ORY A;  2XL8 A;  4KC9 A;  4G7O F;  4CX9 A;  4XEK A;  3M4C A;  3U3F A;  1Y4C A;  3TD7 A;  2GFH A;  3TJ5 A;  4RD9 A;  4DOZ A;  1C17 M;  4WAB A;  2YL3 A;  4P9F A;  2D4U A;  3G4Z A;  3OA1 A;  4OIP F;  4JUR I;  2MYS A;  5KYN A;  3NDB B;  1TWG A;  3SXK A;  3WG7 C;  1TWH A;  2Y3H A;  3JRT A;  1CPR A;  1Q0M A;  4BJ6 C;  4YT2 A;  5COF A;  3H65 A;  2HS5 A;  1ZW2 A;  2WB7 A;  1BZ4 A;  1NG1 A;  3ASN C;  5DLJ A;  2XRH A;  3KMI A;  5CI9 A;  4CDA A;  3KYJ A;  3U8V A;  1E85 A;  4MND A;  4Z9J A;  3ZG1 A;  3RYL A;  2IM8 A;  3KKB A;  4H4K C;  3AQB A;  4LER A;  2L6F A;  3K1I C;  2YKZ A;  3C7J A;  4XEV A;  4XTK A;  5KYU A;  2VB6 A;  3U9J A;  1M2V A;  2R25 A;  4X0R A;  5FZT A;  4OIN F;  1D1C A;  4P9T A;  1H6G A;  4MW3 A;  3B29 A;  4EBB A;  4MQ9 F;  1QKR A;  5A6B A;  1FTS A;  3K7D A;  4EHP A;  5A69 A;  1RXQ A;  3ZTZ A;  4DRH B;  2J7P D;  4JCH A;  3ZQV A;  5BUO A;  4Q5S F;  1BDJ B;  3HLZ A;  3R2P A;  3LJB A;  2YLI A;  3MFN A;  4CBE A;  4HFK B;  5AGF A;  2A68 F;  5JUA A;  1ZHT A;  1OR2 A;  3DM5 A;  3H2U A;  2EPL X;  2BL2 A;  4NC3 A;  1Q0F A;  1W2W A;  4JW1 A;  2P0N A;  2PX0 A;  5TJ5 E;  1YJG A;  4BPM A;  3LS1 A;  1E2X A;  1T6I A;  2XLM A;  3EPV A;  2AWC A;  2JX0 A;  1T6Q A;  4MTO A;  4BJ5 A;  3M79 A;  1NZE A;  2R7S A;  2VCA A;  5COG A;  3Q7G A;  5E33 A;  1JOG A;  2M64 A;  4YL3 A;  5JRA A;  4NTA A;  3TJ6 A;  2L7A A;  4YJW A;  2OEV A;  4N6H A;  1UG7 A;  3B0P A;  1JPJ A;  3N2Z B;  1HW2 A;  3ABK C;  2VCC A;  1RKC A;  1SF8 A;  1YAU O;  2AVK A;  1J8Y F;  2KNH A;  3B71 A;  2WVO A;  1YLM A;  2LIG A;  3KYI A;  5DVW A;  4AK9 A;  1XWJ A;  2FAP B;  3AG3 C;  3MBG A;  1EA8 A;  3K66 A;  2CDQ A;  2PBE A;  4NCQ A;  2YRF A;  4QDL A;  4G7H F;  4ANJ A;  4U9E A;  2YL1 A;  1D1B A;  1LKX A;  2A6E F;  3GWN A;  4MS2 A;  1OKK A;  4I1M A;  1QQ3 A;  4F4B A;  2VC9 A;  3ZQY A;  2W45 A;  3L8I A;  3B0U X;  4BJ6 A;  4U5H A;  2KQ9 A;  2R02 A;  4OIQ F;  3U3B A;  1YA7 O;  1R4T A;  3DAG A;  3TK0 A;  1ORJ A;  5KYU B;  2MHR A;  1K40 A;  4CS8 C;  2R7T A;  4DBR A;  4O7G A;  4OIR F;  4BJ1 A;  3M4B A;  3UR3 C;  5E3C A;  5JSL A;  1NU7 D;  1QVX A;  3OEO A;  2KC3 A;  2LQG A;  2XM0 A;  4CS7 A;  2IOQ A;  2Y3G A;  3AG1 C;  1Z23 A;  1TWA A;  4PAC A;  3AQC A;  4EBJ A;  3B0V C;  2ZXO A;  2NUP B;  3DAF A;  1FFH A;  3NRH A;  2LD6 A;  3DD7 A;  2C04 A;  1Z3I X;  5JS5 A;  2XXA B;  2HZ8 A;  1Q0K A;  5JT4 A;  2GA0 A;  3JSZ A;  3E9V A;  1LIH A;  1PD1 A;  3TOL A;  4E0H A;  2R7V A;  2LFF A;  3DJN B;  4DRI B;  2L6H A;  4XLN F;  3S27 A;  1WTY A;  4XPW A;  3EGD B;  2WVQ A;  2ZXR A;  1RCP A;  3DE9 A;  5D91 A;  5COM A;  3FVY A;  3HNI A;  4ER9 A;  4XPX A;  2HSB A;  1V54 C;  1H9G A;  2R9R B;  1OCC C;  1SZI A;  3RQG A;  3EQL F;  1BR2 A;  5L0F A;  3NMI A;  1JAF A;  1V55 C;  2QY9 A;  2BE5 F;  3AGT A;  3AOU A;  3CZ6 A;  1YVI A;  1T6U A;  2B0J A;  1G8X A;  1VYI A;  4PJM A;  1YZA A;  2PF4 E;  1FMW A;  2XSE A;  3IPM O;  2PFD A;  3L34 A;  4I44 A;  4N4W A;  4AL0 A;  5HV9 A;  1D0Y A;  3RQF A;  1FFT C;  2XLH A;  4YN0 B;  4C3E A;  3ATP A;  1G4W R;  3W8H A;  2GDC A;  3EH2 A;  3EG9 B;  3VRC A;  1YDI A;  1ZW3 A;  2HJ3 A;  2XL4 A;  1HMO A;  1WOL A;  3JRM O;  4XWJ A;  2DI3 A;  1VMA A;  3LES A;  1VB5 A;  4PK4 A;  4W8K A;  1OCR C;  1ZZP A;  2ASR A;  4GEH A;  4QI2 A;  1A7E A;  1ZHW A;  2J9W A;  3AJM A;  3CSK A;  3O55 A;  1MMN A;  5F5F A;  2AWY A;  5L0C A;  5L0I A;  4YWQ A;  3S28 A;  1GQA A;  1A0B A;  5KYY B;  4NTB A;  5GPG B;  4RDA A;  3LUT B;  2V26 A;  1LI5 A;  1YZC A;  2EIN C;  3DM9 B;  3T6J A;  3WHN A;  5L3Q A;  2R7X A;  4R32 A;  2PX3 A;  2J9U A;  3ABL C;  3LNM B;  3IHU A;  2YL0 A;  4GQH A;  4CJG A;  4LLE A;  1ZU5 A;  5KYX B;  4ZLD A;  3AG2 C;  1OQC A;  4NY3 A;  4Q4Z F;  1KTM A;  2YHS A;  4MVR A;  4LLC A;  3GWL A;  4AE4 A;  1H9T A;  1E84 A;  2XS1 A;  2ICW G;  2KGO A;  3Q6M A;  4G78 A;  3SZR A;  1JRA A;  1PV3 A;  3ZTM A;  2HKV A;  1U89 A;  2OJQ A;  5DQT A;  3M1C B;  1MMD A;  1VLS A;  1I4Z A;  2XLO A;  2NG1 A;  4J30 B;  3ZVR A;  1N1C A;  2OKU A;  4W8P A;  1QPU A;  4DRJ B;  4A2N B;  3I5P A;  3GM3 A;  4LDK A;  2UUI A;  1ORS C;  2NUT A;  3POV A;  4XEF A;  3GOR A;  5AC4 A;  256B A;  5DS6 A;  2NUP A;  5L0H A;  2DYS C;  5EHH A;  3S84 A;  2XXA A;  4JTD B;  3FDQ A;  3DE8 A;  2IYL D;  4LDQ A;  4O6N A;  2J8W A;  2YVK A;  3RVZ A;  5A6K A;  1MMG A;  2LCH A;  1OCO C;  1M6T A;  2EPO A;  3BEH A;  3ITF A;  1T01 A;  3JTL O;  3NKE A;  2V3C C;  1ZU4 A;  3EGD A;  2VCB A;  5E2Q A;  2X51 A;  3SYN A;  4CDV A;  3UGP A;  3UMK A;  4U5G A;  3UGO A;  3F46 A;  2GAQ A;  1LM3 B;  2X0C A;  1Z63 A;  3NYM A;  3C62 A;  3QW1 A;  4O79 A;  3DI5 A;  5F5H A;  4C7O A;  1MND A;  3U9M A;  1R5I D;  2QUP A;  2GWW A;  3EHM A;  4QI0 A;  1Q0D A;  4IJJ A;  2I8B A;  2VAS A;  1CPQ A;  3L1M A;  2IXM A;  4XQ1 A;  4YT5 A;  2YLD A;  3UMH A;  4CS9 C;  4CIH A;  1ZHY A;  2J7P A;  3KL4 A;  1OCZ C;  3O39 A;  1ZHZ A;  3DWW A;  5B3I A;  5L0J A;  1SYQ A;  1OXB A;  2RSE B;  2XLD A;  2H7B A;  3N0T A;  3Q6N A;  4H54 A;  3SP1 A;  3V5Y A;  4CDY A;  3U2M A;  3ZWI A;  1CGN A;  1APC A;  2J9V A;  4WGY A;  1CGO A;  1T5O A;  1L3P A;  1K05 A;  2H8A A;  5E3A A;  4AE4 B;  3LEO A;  2YLG A;  1QSP A;  3FMS A;  3V5Z A;  1YAR O;  4DBQ A;  4Z9H A;  2R7R A;  2CYD A;  3EG9 A;  4BG0 A;  4EIY A;  5FCL A;  2E87 A;  2L9J A;  2RD9 A;  3ASO C;  2NSG A;  3EH1 A;  1WAS A;  3CQZ A;  3JYH A;  4BEJ A;  4MTF A;  3WOD F;  3VYW A;  2MWQ A;  3AG4 C;  2PP4 A;  3TUL A;  2EIK C;  3JZ0 A;  4PR9 A;  3RH3 A;  5T3T A;  4JE9 A;  4A4A A;  1YYJ A;  2A1D D;  2NUT B;  3K1I A;  5DS5 A;  4Z9I A;  5KYY A;  4JRZ A;  1SMY F;  2Q00 A;  3HNL A;  3ZC4 A;  1M57 C;  2W4B A;  5EGY A;  1NLX A;  3A9C A;  3C18 A;  2JPU A;  5D92 A;  2XLE A;  5K0I A;  5EK0 A;  3J06 A;  4PJL A;  3JCU Q;  3IQ6 A;  4JZA A;  3W2W A;  1DOV A;  3IEE A;  2ZPA A;  2ZXP A;  4FAP B;  1JPN A;  5IY5 C;  5KYX A;  5T3W A;  2CNW D;  1TQG A;  3C8G D;  4E7Z A;  2TMV P;  1FMV A;  2H7O A;  3RVY A;  1C03 A;  2DB4 A;  4FES A;  1TWC A;  1T9K A;  4MVM A;  4C7O B;  2F22 A;  5AC5 A;  1O5H A;  5T1D B;  1NFN A;  1XZP A;  3TOM A;  2XL6 A;  3IQC A;  1ZYR F;  3VM6 A;  3HTK C;  1VLT A;  2IXN A;  3S9O A;  2OU6 A;  2ETS A;  2EPM X;  4WJ0 A;  4JEB A;  3T4R A;  4XLP F;  1VK5 A;  4L6R A;  2HFI A;  3BRJ A;  3GEE A;  2FFH A;  4D4N A;  3AGU A;  1QZX A;  4PFP A;  2Q7R A;  2OOC A;  1HW1 A;  3PDM P;  4U5C E;  4CS9 A;  1WAT A;  5BQI A;  3S29 A;  1PD0 A;  2Y3B A;  3NKD A;  3NYL A;  1A7D A;  2D5R B;  4LAC B;  3W2V A;  4DVZ A;  2WZG A;  2J46 A;  1YA9 A;  3QMK A;  2Q9C A;  3DJU B;  4MVO A;  2LFD A;  3GOD A;  1D0Z A;  2L81 A;  1NFO A;  2LP4 A;  3ABM C;  3Q7L A;  3VAY A;  4AX2 A;  5BQH A;  4DJ9 A;  2YQY A;  2AU5 A;  1FNT c;  4UDV A;  5A6A A;  4Q7C A;  3LLI A;  4DXW A;  3FAJ A;  4FX5 A;  1GS9 A;  1MNE A;  4J7Y A;  5L3V A;  1EI7 A;  4PJN A;  1I5N A;  4U5D E;  5DS4 A;  4IAQ A;  3T6G B;  3F47 A;  4CS8 A;  4GYT A;  3QVY A;  4WGZ A;  3S90 A;  4O6M A;  2Y3D A;  3IQT A;  4K7B A;  4MVS A;  2HJM A;  4LDR A;  2IXP A;  3UMI A;  3VF0 A;  3PCV A;  4M63 A;  4PFO A;  2R7U A;  3MYF A;  2VH3 A;  2J0W A;  3U5S A;  4C3B A;  3W8I A;  1KU2 A;  1HE1 A;  1Z7Q c;  1IZM A;  2Q9B A;  4P6I C;  4MVQ A;  2XLW A;  4N06 A;  2G3V A;  4KBL A;  2YEV A;  3EJN A;  5A6J A;  1NU9 C;  3QW0 A;  1Z6A A;  2H7V C;  2W9Y A;  3QZC A;  4G7Z F;  2HMZ A;  3EFO B;  3K1H A;  3G50 A;  2EIL C;  3K6B A;  4IAR A;  3DMD A;  4HE8 D;  2I15 A;  3O10 A;  4IRU A;  1YYX A;  3IQ5 A;  3DZA A;  2P7V A;  5A6B D;  3GEH A;  3L0I A;  3MYI A;  4AL1 A;  3FAP B;  2KYH A;  4E0I A;  4IAO A;  1A7V A;  3T9O A; 
#chains in the Genus database with same CATH homology
 3U2M A;  4E0H A;  3GWN A;  3R7C A;  3U5S A;  1OQC A;  3GWL A;  2HJ3 A;  3LLK A;  1JRA A;  3W4Y A;  3TK0 A;  3O55 A;  3LLI A;  1JR8 A;  3U2L A;  4LDK A;  3TD7 A;  3MBG A;  4E0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...