The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
62
|
structure length |
62
|
Chain Sequence |
HNALERKRRRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
molecule keywords |
Protein max, Transcription factor E2-alpha chimera
|
publication title |
Crystal structure of the minimalist max-e47 protein chimera.
pubmed doi rcsb |
source organism |
Mus musculus
|
total genus |
24
|
structure length |
62
|
sequence length |
62
|
ec nomenclature | |
pdb deposition date | 2011-10-11 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | MYOD Basic-Helix-Loop-Helix Domain, subunit B | Helix-loop-helix DNA-binding domain |
#chains in the Genus database with same CATH superfamily 5I50 A; 2LFH A; 2YPA B; 1NLW A; 4H10 A; 5I4Z A; 3U5V A; 4F3L B; 1AN4 A; 1UKL C; 2QL2 B; 2YPB B; 1HLO A; 1MDY B; 1A0A A; 1NKP B; 4ATK A; 4ATI A; 2YPA A; 1AN2 A; 1NLW B; 3MUJ A; 4H10 B; 4F3L A; 1AM9 A; 2YPB A; 4ATH A; 2QL2 A; 4AYA A; 1NKP A; 1MDY A; 5EYO A; 1R05 A; 2MH3 A; #chains in the Genus database with same CATH topology 5I50 A; 2LFH A; 2YPA B; 1NLW A; 4H10 A; 5I4Z A; 3U5V A; 4F3L B; 1AN4 A; 1UKL C; 2QL2 B; 2YPB B; 1HLO A; 1MDY B; 1A0A A; 1NKP B; 4ATK A; 1K1F A; 4ATI A; 2YPA A; 1AN2 A; 1NLW B; 3MUJ A; 4H10 B; 4F3L A; 1AM9 A; 1ZZA A; 2YPB A; 4ATH A; 2QL2 A; 4AYA A; 1NKP A; 1MDY A; 5EYO A; 1R05 A; 2MH3 A; #chains in the Genus database with same CATH homology 5I50 A; 2LFH A; 2YPA B; 1NLW A; 4H10 A; 5I4Z A; 3U5V A; 4F3L B; 1AN4 A; 1UKL C; 2QL2 B; 2YPB B; 1HLO A; 1MDY B; 1A0A A; 1NKP B; 4ATK A; 4ATI A; 2YPA A; 1AN2 A; 1NLW B; 3MUJ A; 4H10 B; 4F3L A; 1AM9 A; 2YPB A; 4ATH A; 2QL2 A; 4AYA A; 1NKP A; 1MDY A; 5EYO A; 1R05 A; 2MH3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...