3U5ZB

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
b'SMITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 108
structure length 320
sequence length 320
chains with identical sequence C, D, E, L, M, N, O
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u5zB01
1S3SA 3B1YA 4MKFA 2QP4A 2VA8A 1ZD8A 4DB2A 4PSKA 3BGEA 4MH0R 3E70C 2IA5A 1XDBA 3KXKA 4EIWA 1XMIA 3PUYA 1Z63A 2ZJYA 1W2GA 4Z1MA 2CVFA 1XJCA 4H1VA 3NEYA 3RWMB 3K8YA 621PA 3Q72A 3VNUA 1TQ2A 1YU9A 2VP0A 2UZ3A 5IF9A 2ZSEA 2C9OA 1J7KA 3I5XA 5AUPB 1OH7A 4JT2A 5F98A 2ZANA 1XD9A 1E2DA 3O8BA 1DAFA 1ZUHA 2FWRA 4UNPA 3L8YA 2BCJQ 2QBYA 1WE2A 3RRNA 5EXXA 3AUYA 4DZZA 5AJWA 4E07A 2QTHA 4BFZA 4BRWA 5KDDA 1UKEA 2IYXA 2YV5A 4ESVA 3THYA 4LX0A 2NO6A 1BKDR 1KMHA 2C98A 2A78A 1YR9A 2XXAA 2JLSA 2KWIA 3B1ZA 3EZ2A 1Q44A 2ZQ5A 4I1SA 5CITA 2C9YA 1I4DD 4WXRA 4C7OA 1DPFA 2C03A 2ZSFA 4A15A 2CLDX 1E2PA 4V0ME 3PUZA 4B3XA 4TL9A 1JR6A 3EW9A 2XOKD 1GM5A 5E3HA 2P2LA 5G53C 5BQ5A 3TNFA 3VQTA 3U61B 4F4JA 2OFXA 4V0KA 4DSNA 3N2IA 4CEHA 4LHYA 1KAGA 4LYAA 4ZDWA 4P0TA 1NL3A 2XZLA 2KB0A 2QMHA 4HSEA 4A8JB 4HATA 3AVOA 3QQ5A 2QENA 5EXTA 3MSXA 2IYLD 4V03A 2GZAA 4MDFA 3AF0A 1ZC4A 3UK6A 1LY1A 2RGDA 4Q1DA 4URYR 1TF5A 1Z8FA 3MHVC 1K8RA 3MWJA 5LD2B 2DR3A 2YC4C 1E2FA 4XTRA 1SXJB 1YZTA 4MYCA 4IJMA 2NO1A 2BBWA 2FPLA 2FF7A 2JJ8A 4KSBA 2HF9A 1K5GA 1OKKD 2OCBA 4MKHA 5AJYA 1YQTA 4QHYA 1D9ZA 4TZ0A 1FQKA 3GLIB 2OAP1 3IQXA 2YOFA 4CDGA 2KSQA 4RD2A 3D31A 5AUQA 2GA8A 2NO9A 1XMVA 3KTAA 1N6IA 4PC1A 4L16A 3I92A 1XF9A 3I8XA 4F38A 4KBFA 1OH5A 3MWKA 1KY3A 2NZJA 4BLQA 1BO6A 1XCGB 4EPVA 1A4RA 4MA4A 2JJ1A 5DIFA 5FUYA 3UG6A 3I62A 1G7TA 3QF4A 4LHVA 3WY9A 1AM4D 4R71A 2EFDB 5KU1A 2I1VB 3NIBA 2IUUA 4PC7A 2JAQA 1QDEA 4B48A 4MGZR 1G18A 4RKEA 2J0UA 1IQPA 1XXHB 5JJKA 1E96A 4Q47A 1C1KA 1XD8A 2HJVA 1M6NA 3IIJA 3BC1A 1FX0A 3KKMA 4W5JA 2VYFA 4NZYA 1RE0A 4EQ6A 3LVRE 2BJWA 1G5TA 1NVWQ 2QAJA 3N5CA 4A36A 1VHLA 1NIJA 2HDNB 1UBEA 4QC2A 4EJSB 4LUCA 5CLQA 2IYZA 1C9KA 2GEUA 4G5RA 5E7JA 3HR7A 2JDID 3MLEA 3O8DA 1SXJC 3SQXA 2KE5A 4LJ6A 1U94A 3EIEA 4L9SA 1Q21A 1CF4A 1W0JD 1J2JA 3TR5A 3QPUA 3AVYA 2AKYA 1DAMA 4OJKA 2FU5C 3EIHA 1ZMXA 1ETUA 2GHIA 3LA6A 3K09A 5H68A 3T5DA 1FOEB 4Q1BA 5ELXA 4PAOA 1LFDB 1ZNXA 1YZLA 4LV6A 2A7QA 1HURA 3ZQJA 2JLUA 2IS6A 4UNQA 1UKZA 4A6XA 4BLSA 1FTNA 1X3SA 2CK3D 1RKBA 1U8AA 4M9QA 5HCIA 1X8LA 3SBDA 4IW3B 4U7DA 1T8UA 1U98A 3LX8A 5JHHB 2BMFA 4PX9A 2HLDD 4Y0VA 3OAAA 4EDHA 2DZOB 2Q9BA 4KFSA 3E2IA 1T3HA 2G1KA 1OXXK 1VYUA 4P4SA 2D7CA 3RAPR 4A3VB 2JIZA 3FYHA 4AYTA 2XNSA 4M1MA 4LBVA 1ZAKA 1ZINA 2WBLC 4AD8A 3BB4A 1HT2E 1RRCA 1IN8A 2AK3A 5BN5A 3VR4A 3QPVA 1X8KA 4M1SA 3V4FA 2G6BA 1GITA 4FWDA 2PLFA 2GZDA 4JKIA 4EJSC 3S1AA 3QNUA 3U60B 1P7CA 1VYVA 4IDNA 2N1BA 4UJ5A 1GAJA 2HXYA 3SDZA 4MITA 1IXSB 1W1WA 3K53A 2VRWA 1E2GA 4YMUA 3THWB 4TL8A 1G21E 2QRZA 1EX7A 1Z83A 1A7JA 1UM8A 3AF2A 1Z5ZA 3CF6R 4MRNA 5UKDA 4EAQA 2NMVA 2F9MA 2X19A 4D0NA 2QQ0A 1P73A 3EWSA 4B3FX 3PEVA 1E2LA 1XEWX 2Q0HA 4DB4A 1A2KC 2OZEA 1GNPA 3VKGA 1G3RA 4JN6A 5CIWA 1YZKA 4CEJB 5DYIA 5AUOB 2BV3A 5CYOA 4CYMA 1XFAA 2RGGA 2VPPA 4YC7A 2FSGA 3WRYC 4AYWA 3LBNA 2GILA 1E9AA 2E9SA 2NGRA 4TL6A 4AI6A 2GCOA 3PEUA 1S2MA 3D3QA 3MUFA 1OFHA 3CRMA 3W90A 3BB1A 4LBWA 5JZVA 5K8UA 2IYTA 1CS4C 2QGNA 3SOPA 1D5CA 1MH1A 1U0JA 4KI0A 4M21A 5G3ZA 3SU8A 2A5FA 1G3IA 3HR8A 1MO3A 3KUCA 1ZM9A 4IDPA 1L4YA 2IW3A 1GFIA 3VR3A 1GUAA 3LO5A 3T1QA 4HLDA 3BERA 3DZDA 4D82A 3CF2A 2ZSAA 2AXNA 1GOTA 4C0AC 3I61A 1Q22A 4LJ5A 2QI9C 2F55A 1W36D 1JPJA 5L3RA 3TRFA 1OIWA 3U44A 1NVMA 5JSZA 3DM9B 1JAHA 5FPSA 2FPMA 3FFBA 4B6EA 5B2ZA 5D3MA 1HUQA 4II7A 1P75A 2VSFA 3AVQA 5B64A 1W48A 3V4RA 2GEVA 3T34A 5EXPA 3GLHA 2A5YB 1YR6A 2HUPA 2KJQA 1YVDA 1PUJA 2QROA 5FL7A 4JJZA 1GZSA 1ZM3A 1OYWA 1G1MA 1LS6A 2MSDB 1NBME 4KLNA 1MRNA 1QHHA 2CJWA 2GEDA 4Q4HA 3RS2A 4HZUB 5JJLA 2QQEA 3AM1A 1CRPA 2QT0A 1R0ZA 4MRSA 5CDFA 2YNMA 1KOFA 2ZR7A 1L8QA 1NLFA 4B73A 1VG9B 1L2TA 4M1TA 3GLFA 2QMUA 4JZKA 1YZNA 3BIFA 1TL7C 1G3MA 2DWZB 2F6RA 4YMTA 2QAGB 3TSWA 1A2BA 5FTMA 2HCJB 1IN5A 4URUR 2PX3A 4ZIRB 1Z29A 2ZRJA 1P62B 1E94E 3X2SA 4HAYA 3P20A 5CLLA 4BQSA 1E1QD 2R6GA 2ZSBA 1XCMA 5DYGA 1O87A 2PT7A 1PZNA 1TUEA 1G7RA 4PPGA 4DBLC 3TSZA 3U3OA 4AG6A 2NPFA 3UMSA 4QM6A 3OEEA 5FUVA 2AHOA 3DEFA 2DPXA 3PUXA 1N3BA 2PT5A 3MMPA 4TT3A 2CNWA 4M53A 1FTSA 2O0HA 3ZYCA 2GCPA 5TVKA 3QSYA 4Q4JA 3UWKA 4HUTA 3RVBA 5E7MA 5JRJA 1JR3E 2ZUDA 1PUIA 3OIUA 3SYNA 4OQNA 2JEOA 3W5IA 3OIYA 2O8EA 2OCYC 2GJAA 4FMCF 2WWGA 1Q3HA 4AIIA 4XWAA 1AS3A 5J40A 3SHFA 1M7GA 2IBMA 3ASYA 4DSTA 2EFGA 4BRUA 4RFVA 3Q5EA 5DO9A 1VYTA 1R8SA 1BMFA 5KPJA 1OFIA 2YINC 2UZIR 4G01B 3GCGA 4LC0A 3VX3A 1Z0DA 1M74A 1X1RA 2PZEA 1AZTA 5FL3A 3TK1A 1LW7A 4N0DA 2QBYB 4B71A 1VCIA 1XP8A 2ZI4A 2FSFA 4FIDA 3R9IA 4IDOA 4FWTA 3A1WA 1Q1QA 2WJIA 5TY0A 2OXRA 5DI9A 1G8GA 2PH1A 3GEIA 4IDQA 3ZVRA 221PA 2EYQA 2W83A 1FP6A 2RCNA 5L3VA 1D2EA 4M1OA 4A82A 4PC2A 4BGDA 4ZKEA 1FL9A 2O52A 3LXXA 5DN6A 1RRPA 3BOSA 2KRKA 1NMZA 2Q9AA 4IDHA 1F2TA 4TTRA 3OFNA 3T5GA 3MJHA 3ZIAA 1UPTA 4C7OB 1BS1A 2YC2C 3LLMA 4HLUC 4C30A 4TYYA 2PMDA 2D74A 1NRJB 5FOTA 1SQ5A 4RZ3A 2PEZA 1TAGA 1TQDA 3B2EA 3I3SR 2QMOA 4EUNA 2HYIC 2B8WA 2CMKA 421PA 1JAIA 1GKYA 1WMSA 4AWXA 4DWJA 3CKLA 5J4KA 3VLFB 4B75A 3L0IB 4A9AA 4JLKA 4Q4LA 1F2UA 3IEVA 3ND8A 2EYUA 2GDJA 2J9RA 4RFSA 4Q00A 2C78A 2J7PA 1XMSA 4UXIA 2IEZA 3FKSD 3LX5A 5JS8A 1N5KA 3IPYA 2W6JD 5GJVC 3WRXC 3HYRA 5KSZA 4YMVA 3R8CA 4TQUS 1J8YF 3LRPA 3OESA 5FOXA 5LB2A 4WOPA 1T5LA 1VIYA 4C0KA 3Q8XB 4A0HA 1E0AA 3AB3A 5AUNB 1LNZA 1E1RD 4NU0A 5B58C 2RMKA 2CHGA 3OEHA 1HQCA 4JLAA 1XTKA 3HYTA 4JSTA 2J0SA 4Y0AA 1G6OA 1KY2A 1OXTA 2FGKA 3A1TA 4EFMA 4Z1MD 2ONKA 3KTAB 4TYQA 1MABB 1TU4A 2ZE7A 4DLZA 4DDVA 4F92B 4C2TA 4V0OA 4WAUA 2FE4A 3I8SA 1CR2A 2BKUA 3QXCA 2JA1A 4JSYA 2G3YA 2RGXA 4POAA 3V00A 1AS2A 3GLGE 1DG3A 1I4LD 3F8TA 3QF4B 3CTDA 4JVNA 4LPKA 821PA 2AD5A 3NHAA 2AL7A 5IT5A 2FEMA 2WZQA 4N3NA 2J0UB 4FCVA 2PL3A 4L15A 1VG1A 4Q9KA 4V0NA 3QIAA 4IKEA 3CW2A 4JVSB 4UKDA 1J70A 1FX0B 2V6JA 4OQXA 1KHTA 1KKMA 3NH6A 3KQKA 2NOAA 5JMTA 3LQRA 4EQ6B 3TH5A 5M04A 3I1FA 1CJTC 2J1LA 3JZAA 4PR0A 2WICA 2XGJA 2XSZA 3B78A 1XU4A 1G3QA 1N6LA 3B1VA 2DY1A 1U2RA 2ORVA 2VHUA 1IXRC 1UDXA 1WQ1R 4FXPA 4ZDKA 2RGNC 1NY5A 2C04A 3EC2A 1FW6A 1TPZA 2JLQA 1KI2A 1M7BA 2WM9B 3RRZA 2QTVB 3G82C 3U4QA 4M9XA 2XNDA 1ZUIA 4RD0A 1CR4A 2A2ZA 5AJZA 2UVQA 3W5JA 5L3QB 3ICQB 1TX4B 3C8UA 4NYJQ 3ADDA 3N2EA 1JQJC 4V0MA 3TUIC 4EPWA 1NN5A 1IJEA 2OILA 3DOFA 2CCKA 5BN3A 3CNLA 2HJGA 2OUKA 1Z6XA 1VECA 3L43A 1AGRA 3F0TA 1Q1ZA 2O8CA 1ZD1A 5JRZA 3PUWA 4Q02A 1Z0JA 2X1VA 4PFSA 4YLGA 1WXQA 5J4HA 4JVMA 4P4SB 4QGHA 1T0JB 5EJEA 3SJCA 3AVVA 2JJ2D 3Q85A 4B44A 2J0QA 5J4VA 3T12A 1IY2A 1X1SA 4EFNA 2C8VA 4BEJA 3LY5A 1AKEA 2EU8A 2AK2A 5JS7A 5FTJA 4HI0E 3ND9A 1MKYA 2AKAB 1T5IA 2F1JA 4DSUA 4B43A 1SHKA 1GIAA 2VP2A 4OHXA 4F91B 3ZVLA 2GXSA 5H1YA 2VSOA 2JJ1D 1KO7A 4LV5B 3SEAA 4D26A 1KJWA 1G7SA 3IGFA 2OCPA 4K8OA 3AGPA 4QM7A 3PG5A 1F6BA 2ZJAA 2J5XA 1HH4A 3A4NA 1IONA 1OXUA 2P3SA 3MCAA 4EKDA 2F1IA 3EXAA 3GJ0A 1GVNB 3L0OA 4GPTA 3QJYA 4C4PA 3K09C 2XTMA 5K8TA 1G5RA 2H8KA 4DJTA 3ZLJA 4GL2A 2C77A 1PJRA 3AF4A 3GD7A 3QENA 1JPNA 3VFDA 4DLYA 3BXZA 3AKCA 2CHVA 1N25A 1UBGA 1JB1A 4A0RA 3T61A 1UJ2A 4Q1FA 1MO6A 4LYJA 2IT1A 5KSPA 2OO7A 2A5JA 1EFCA 3EG5A 4GMXA 4AKIA 1EWRA 3A37A 2GCOB 1YKSA 3GJ5A 5FFMA 3A4MA 5KHOC 1YR7A 1Z0KA 2ANCA 4HLCA 5KNBA 1AIPA 3SJZA 3NXSA 2V1XA 4FCWA 2FV8A 1JALA 5JEDA 2E87A 2ZS8A 4UJ3A 3NG1A 4FW9A 4KFUA 2GXUA 3B8HA 3LD9A 4JJKA 4LSGA 4TLBA 2XX3A 5DNYB 3ZD6A 5KDOA 1CIPA 2ZYVX 3HPQA 3LLUA 1GRQA 2FSIA 1S0UA 2WKPA 3NWJA 4GZLA 4JLPA 4QRHA 2O0KA 4XD7A 4GP7A 2K5UA 1G17A 4PHTA 3FFAA 4YQFA 1QRAA 2FA9A 5DH9A 3U44B 3NDPA 3OAAD 1OIXA 2ZEJA 1N6KA 4GOKA 1JEEA 1D2MA 4BFYA 1NVXQ 4CT4B 2JIZD 3WP0A 2X8AA 4QOSA 2VTKA 4W9MC 1VMAA 5D3MB 1OLOA 1TU3A 3AKEA 3SYLA 4TMZA 3GLHB 2B7CA 4LJ9A 1S3GA 2CCGA 1Z0AA 2WSMA 4MGIR 4US1R 4BZQA 2OESA 4DLRA 4DRZA 4LWZA 4KYIB 1QHHB 4Q4AB 2CJWB 3FHCB 2WJYA 2GZHA 4QFMA 3R7WA 1P2UA 4BE7B 521PA 2O5VA 4DUGA 4HAZA 1S9HA 3TGPA 1XBTA 1R2QA 1ZW6A 2IYQA 2V55B 4NYIR 3THXA 3GLFB 2ODWA 4TL7A 3WBJA 2CBZA 2WPDD 3OIWA 4LC1A 4PXAA 5A4JA 2VF8A 4OYHA 5KOYA 1A1VA 1D6JA 1WP9A 4FI3C 4TQ9A 3NEJA 2MSEB 1X37A 1WA5A 2ODBA 4PTLA 4PZLA 4X8HA 5BWMA 3VKHA 1DBSA 4F4IA 3KXIA 3W3AA 1FMLA 4YONB 1R0WA 5FPYA 2QPOA 1GILA 2MMGA 3R9XA 5FBWB 3RRMA 4CIDA 5BN4A 4LY6A 4GOXA 3IDQA 4JL6A 2ZREA 1KI9A 4OK6A 1OXVA 3A1VA 3QOFA 5L3SA 1SKYB 3ADKA 4O2RA 3M0EA 1SGWA 3UIEA 1KI6A 1P61B 1JBKA 2BOVA 1KDTA 2O8EB 4PO8A 3P4YA 5FUWA 3LH5A 4B3BA 2GXQA 4CEIA 4EPXA 3GFTA 5HZKA 4IOLA 3SJBA 1XZPA 2RGNA 1PV4A 2XB4A 2WKRA 4FWGA 5K8IA 4TTPA 1G4AE 4KODA 5DGXA 3SI7A 3CIOA 3RC8A 5EQTA 2ZR9A 1TQ4A 1IY1A 1Y63A 1CJUC 3CX6A 5HKKD 4A1FA 4ON9A 3EZ7A 2FZLA 1N6NA 3MJRA 5JCPA 3HU2A 3BH0A 2UKDA 4OI2A 4Q7LA 4WVFA 4I1VA 1U9IA 5BXQC 3FHTA 1QVRA 3VR5A 4QG7A 4C2UA 3T15A 1VTKA 2ZITA 3H0KA 1JNYA 3VTKA 1PLLA 4MGKR 4U02A 1X8JA 4WZBE 1C4OA 2ZTSA 2IS2A 1EFTA 4W5HA 1Z6GA 2WAYA 3QG5A 5CK5A 1IJFA 3B82A 5KTYA 1TUIA 4PHHA 3I72A 4KV9A 3WYFA 4BUJA 1F2TB 3CRW1 3KJHA 1JI0A 2OV2A 3MRSA 2CVHA 2GRJA 3TUJC 1FFHA 1RPZA 1IN7A 1NBMA 5DLQC 3A36A 4LRTA 1KK0A 2ZYUX 3LFUA 4KYUA 4HDCA 1MO5A 1FUUA 2NO7A 4BZXA 1Z6TA 2ORIA 1NF3A 1T4GA 4JBYA 4OI1A 4KXFB 5FR1A 2Z4RA 5FBQB 3EPKA 4H1UA 5HCNA 3SE0A 2R9VA 4C0JA 2VSXA 3IQWA 4B3GA 1RC8A 1FNMA 3U6KA 1Z0IA 1M1YE 1NN1A 3K9GA 4AK9A 3ZH9B 3TIFA 1Z07A 3M4YA 5EZ6B 5DISB 1RYHA 2ZAMA 1DAKA 3CWZA 1ZUNB 4RFSB 1NJFA 3RWOA 1ZCAA 1CKEA 4OI4A 4ESHA 1U8YA 3O47A 3PITA 3GPLA 4TT3D 2CNWD 4PHGA 4URVR 4G5QA 3EIQA 3I4LA 2C96A 1JEDA 2BJVA 4TLEA 3DMNA 2QL6A 2Y8EA 2RGAA 5BW8A 4C0QC 5J4YA 1P72A 4UXHA 3EA5A 4M9ZA 1KMQA 1P2TA 3V9PA 4L8GA 5KNDA 1GRNA 5FBLB 4BLTA 1KDRA 2VBCA 1II8A 4OK5A 2DFNA 2WSSA 3UXMA 1NKTA 1NLYA 4QKQA 3DZ8A 3IIKA 3F5FA 1E6CA 2NG1A 1W7AA 2OG2A 3U7FB 1E2NA 2QSYA 1SXJD 4H9GA 5CB6A 3AKYA 1UBFA 2YOHA 1QVAA 3LAWA 3PCRB 5CYPA 1JR3A 4MRPA 3ETLA 4B2IA 2P6NA 5IHPA 4N0EA 3SHWA 2ATVA 2YVUA 3A1SA 4MUAA 3RS0A 5EE0A 3QBVA 3KJEA 1WBDA 2ASEA 1EFRD 1ZC3A 4DIDA 2PMKA 1II9A 4O0MA 4D4JA 2F43A 2ZIAA 1RRGA 2QE7A 1GWNA 1RFLA 2Z83A 4FMDB 1Q12A 1Z28A 4M1WA 3RABA 2XJ4A 2P65A 3W6OA 4LJAA 1DO2A 3FGNA 2I4IA 1ZM7A 3QEJA 3K0AA 4IEIA 4ZDJA 3BB3A 3QKUA 5EE3A 2OSBA 2YYZA 5HPYB 1RIFA 5DN6D 5DE3A 5FPHA 3R9WA 3ZVNA 1YZUA 4HB0A 4A0GA 2DWPA 2O8DA 4RCYA 2FJUA 3QPWA 1VKJA 4TZ6A 3SS8A 2GBLA 3OFND 4JMPA 5IK2D 3ZIAD 4KJZA 2G0TA 5FPTA 3SR0A 2V4ZA 3WNDA 4Q21A 5C1BA 2IF2A 4ACBA 3ONWA 1YRBA 4FINA 1CXZA 1R5NA 4OQFA 1I4TD 1H8HA 2A30A 1HV8A 1F60A 4RZ2A 2DFKB 4BEBA 2QW6A 3W8RA 2QA5A 2IYUA 1Q57A 2R6CA 2G9NA 3TE6A 2ZETA 2PZGA 2Q21A 3CM0A 3WNBA 1W44A 5C4MA 1MR3F 4YDSA 3EZFA 3K9LA 6Q21A 1E3MA 1JJVA 3W6NA 3KQNA 2TMKA 4O3MA 3K9HA 3KB2A 3SFVA 3DM5A 2ERYA 1ZBDA 2O8CB 2ZYTX 2MSCB 2V7QD 2HT1A 2DCUA 1KGDA 5C4GB 2QP9X 5JLJA 2J45A 3PXGA 2F7SA 1NKSA 1EK0A 2DWOA 3OEHD 4F4CA 5TXGA 4Z51A 4JBXA 1IXZA 1F48A 1FP7A 1OHHD 2XOKA 2YWHA 3SFZA 3ZQ6A 1HE8B 3M6AA 3U3RA 5JI2E 1E9DA 1IBRA 2B8TA 4BZPA 4LJ4A 3P1JA 1ZM2A 1P9NA 3P27A 3ADBA 4YXWD 4KFRA 4XJXA 4PANA 1XPRA 2G1JA 2YWGA 3Q9LA 3BK7A 2XITA 2JATA 2AFHE 4P4UA 2A3RA 4Z8XA 1Z22A 1W5TA 2DFTA 2DWQA 1LF5A 2IEYA 2ZYWX 4PC3A 3CBQA 3WP1B 5AK0A 5E95A 2Q6TA 4FWIB 4PQRA 2WWYA 4HDQB 1G291 2C9CA 2CEAA 5B30A 1DOAA 1IM2A 1R0XA 4CZ2A 2WWFA 1YHNA 3B13B 3K0CA 4O2LA 1W49A 2ZUCA 2VP4A 4KITB 3C7KA 2OBMA 4JLNA 4XVUA 3GLGA 2XSZD 1E2MA 1N6HA 3PENA 2NZ8A 1KSJA 4I99A 1P2SA 3W9YA 5LDDC 3CPHA 1QHSA 2J46A 3KXLA 4LBYA 1G8PA 1CR1A 2A5DA 2QG6A 1XPOA 2YHSA 1XX6A 2NQ2C 3IO3A 2ZRMA 2A5GA 2EQBA 4TYWA 2BKEA 1OYYA 3Q7PA 2PJZA 3KKNA 1KIMA 4PQFA 2OBLA 1T91A 1GNRA 1AZSC 1TNDA 1P6XA 1WDTA 4A6PA 1QZXA 1EGAA 2ZSDA 4ZO4A 3VMFA 1E79A 3FMOB 4UNNA 1FNNA 4MRRA 5CJ2A 3EWAA 2FX3A 1NP6A 2BDTA 3HU1A 1XZQA 4B74A 4BFSA 2FMXA 3Q3JB 2ZI3A 4D4KA 4S35A 3KQHA 3CRQA 1Q1BA 3H4MA 4NMMA 3W3ZB 4KCGA 4BFTA 2P5SA 1CR0A 3PVSA 1NVVR 4WBSA 4GRAA 5C2JB 4G1UC 4OQLA 4OQMA 4ZV4A 2JDIA 2ZJOA 4JLOA 2DVWB 3KKQA 4LOAA 5GADl 4Q1CA 2NTYC 5CIQA 3U3MA 4B3DA 4S2EA 5L8VA 3KJGA 2WVJA 1BOFA 4PZZA 1ZM4A 2AXPA 1Q1EA 1NSTA 3R7WB 1P9RA 4XSHA 2VH5R 4NYMR 1HY3A 1TQ6A 4KBGA 4BFWA 2ZXUA 1XEWY 3LBHA 3QXXA 3QXJA 3JVUA 3R20A 3IKJA 1N0UA 2DHRA 3LW8A 3WBKA 2JLZA 5J4LA 4DEYA 2WAXA 1E9EA 2B21A 2OE2A 4MRVA 5TV2A 3THXB 2CXXA 2AD1A 4XIGS 2FFAA 3BBPA 3C14C 2IYSA 1P9WA 3TVDA 3T35A 3DKPA 2ZE6A 3THYB 1MT0A 1US8A 2EWWA 2ZRKA 4PO1A 4LRWA 3VNVA 1CEEA 1KMHB 2HLDA 3U3KA 1HA3A 2FFHA 3QXHA 3L8ZA 3U7EB 3CZPA 1KZ7B 5HE9A 1T3LA 3CONA 3GEEA 2RAPA 4GFDA 3C41J 3VU9A 2XXAB 2IYYA 5HZHA 4MGYR 1FZQA 1ZRHA 4UXJA 1DVRA 1OIVA 3TW4A 2XB2A 4LRSA 5DHFA 2BWJA 5FI1B 4JVLA 2WWIA 3AF1A 4TLDA 3RNLA 4GP6A 3IO5A 3D8BA 4TWZA 3LVQE 4BECA 1QZMA 2RGEA 4CEHB 2IYVA 4PO9A 3RC3A 2HCBA 3GJ8A 5L3SB 4DCSA 3LBIA 1W4CA 4LJYA 2ODEA 3VHXA 3X1ZA 4DCVA 4C0HA 4FCTA 1KI6B 4OHYA 5AWFC 5FR2A 1H8EA 4QNMA 3BORA 4D4LA 5KO2A 1W0KD 4XD7D 2ZU0C 4CEIB 5H8WA 1X86B 2ZS9A 4DLTA 3CZQA 3GFPA 4LV8B 1XTSA 2OM2A 2QTFA 2QU8A 5JFGA 2WJJA 2WJGA 4XWKA 3QXSA 3RS7A 2CCJA 2L0XA 1E9RA 2WMNB 3H84A 1GDDA 4XH9B 2GWHA 2KBFA 1KYIA 3L0PA 5J47A 1AQYA 1K6MA 1YRAA 1ZIOA 1SVSA 4JLBA 2XZOA 2QMEA 1X6VA 4GZMA 3C15C 2P67A 2QM7A 4NCKA 3P32A 3GJ3A 1KZGB 4NE2A 3IHWA 1NN0A 4LHZA 4OK3A 4DEXA 1G5PA 2DB3A 2ZI9A 4I1UA 4QXAA 3CO5A 1KI1A 2FNAA 4D81A 1KK2A 3TVTA 1XPUA 2C5LA 3H1TA 4URXR 2ECKA 3IHLA 4KU4A 1XTRA 1EX6A 4IFEA 4QBFA 5CJPA 5ANRB 4QGFA 4LDJA 3HU3A 3AGQA 1B0UA 3ZJYA 2O8BA 2ZE5A 4IRUB 5FTLA 1L7VC 1DEKA 3H2YA 1D8TA 2IXEA 4P3YA 3G0HA 1TF2A 3CLVA 3ZZTA 3G5UA 2JASA 4RCZA 2FN4A 4JT4A 3CRVA 2JGNA 2NO0A 4WW0A 4G3XA 3U7HB 3QI2A 5LB4A 1MRSA 1E2JA 4NONA 2D2FA 4M1YA 3F3YA 3ADCA 4PZYA 1ESMA 3KFXA 5F2EA 2HXSA 4RSGA 3PJRA 3REGA 1KSHA 1R6BX 1R0YA 2CLCX 4IVRA 4FWHA 1Z3IX 2CL7X 4BFXA 2QZ4A 1U9IC 4NTZA 4O25A 1II8B 2I3BA 4TMWA 4DHEA 4KHZA 3MG9A 4K46A 3BRWD 5H70A 2G83A 3K70B 4RJLA 1Y3AA 1RYFA 1E98A 1Z08A 1A5TA 4LBZA 2GXAA 1G8FA 4PAQA 3FHOA 5SZKB 1EXMA 2CL6X 2FSHA 4JYBA 3PEWA 2RGBA 1JXOA 4AKEA 4IOJA 2Q9CA 2D3WA 5EE5B 1E0KA 1N5LA 4HB4A 2GVDC 3FMFA 4UQOA 2F43B 2ORWA 1XTIA 1KNXA 4GT1A 2IUTA 4WZAE 3VR1A 3UKDA 4KAXA 2RHMA 1R5BA 4L9WA 2I1QA 1SXJE 3K0AB 1DAIA 4NDZA 1Z06A 1GNQA 3S1AB 4OL0A 4A4DA 5EP3A 3KZ1E 3FE2A 4U5XA 3CNOA 4DCNA 1CULC 2EW1A 5JI3E 2W0SA 2O8DB 3CPEA 1R5OA 1LTQA 3GLIE 1R10A 3A1UA 3NC0C 4WA7A 1CRQA 1DS6A 1Q0UA 1RW4A 3B7GA 1NG1A 1U0HC 1QF9A 1U90A 2ZRDA 2XTZA 3SJAA 2W2XA 1LF0A 3L2OB 5TB5A 4Q01A 2P5TB 1XEFA 1AA9A 1XD2A 3AP1A 1UEIA 2WIAA 3W8NA 1M34E 1PLKA 3EZ6A 3U7GA 1J8MF 2YZ2A 4PHFA 2R44A 2DZNB 4R9UC 5CM8B 2VP6A 5FTKA 4LJ7A 3WNCA 4GNKA 3RYTC 5HR5A 3K70C 3TR0A 4Q9JA 5J5CA 5TARA 5JWRA 1EFUA 1XXHE 3NBYC 3IPXA 4IXMA 3B5JA 4FMCB 3UANA 2GJSA 5AJXA 2H92A 4JS0A 4PAMA 4B33A 3QY0A 5EUQB 3U2QA 4JLVA 2PEYA 2OAQ1 2ZJ8A 4A2QA 5KUTA 3QEOA 2Z5FA 4QJ5A 3A6PC 2EWVA 5AJVB 2REOA 2ZRLA 1LV7A 4Q19A 2WSSD 1Z2CA 3DL0A 2OCAA 1R4AA 3I5YA 1KNQA 5EZ5A 4C0BA 3TLXA 2BIFA 3A58B 4WXPA 2Q3MA 3KQLA 5AR1A 1EG7A 5CM9C 4M1KA 1T0HB 5CK4A 4Q1AA 1JR3D 5JSZB 1XTJA 2GBLC 2H18A 4B76A 1G20E 1Q3TA 3Q5DA 4J0QA 1O3YA 4OJQA 1XJQA 2SHKA 4JLDA 4RKFA 4IOMA 4JLMA 3ICEA 1E9CA 2ZU6A 3HPRA 4B2PA 3CRRA 1U81A 1HT1E 1T8TA 3L82B 3FKSA 1DELA 2WWXA 3E1SA 3RS5A 1VCMA 3P26A 3K1JA 5E7IA 2J87A 3SBEA 2XZPA 4NYIQ 4QGAA 4Q4HB 2IYWA 3EZ9A 1DE0A 2BVNA 3AP3A 3FTQA 4HUQA 3QE0A 2ZAOA 3N70A 4B3CA 3R8FA 2DFLA 721PA 1LB1B 3VHLB 1KO1A 3MD0A 3IBGA 1SVOA 3GLGB 1N5IA 3LW7A 2CE2X 1V5WA 3LQQA 4URZR 1I2DA 3EPLA 4JL5A 5A0FA 2R6FA 2W0MA 5B57C 2BMDA 2ZRBA 5KYKA 3UWOA 4NH0A 2HT6A 2C95A 2CHQA 3QKTA 3EASA 5FBVB 1DTSA 2PCLA 4RD3A 4DLXA 1E9FA 2JLYA 2JCSA 4M22A 1H8HD 3AH8A 4MYHA 1ZNYA 1GRRA 2PX0A 1RJ9A 5JJIA 4G0NA 2ZI7A 4LGMA 2H5EA 3EA0A 2R6DA 4M8NE 4ZI3A 2Q3HA 4UNRA 5SZIA 3OE7A 3BFXA 4KVGA 1TEXA 1YZQA 3QVUA 2BC9A 4LPSA 3WMEA 2JLXA 1OB5A 3WYGA 1E4VA 3ZGXA 5EE9A 4ASUA 4ERNA 3C5HA 3OF5A 2FG5A 1G64A 4Q48A 1G16A 5BYJA 3AEZA 4Q4JB 4I81A 4NHOA 1E4YA 1KSFX 2GTPA 1G3UA 1S1MA 5GVSA 5KPDA 1II0A 1XEXA 4R2HA 3J81k 3SQWA 121PA 2GF0A 4BLPA 4OI0A 2J59A 4Q7JB 1G6HA 3DMDA 2ZRFA 4P33A 1F5NA 4DDUA 2QNRA 3GFOA 3IIMA 3K0CC 4GOJA 1ZU5A 3TQFA 2VO1A 4TSFA 5FOWA 2AN9A 2GK7A 2D2EA 3AV0B 2IXGA 4Q1EA 2O0JA 1U8ZA 1KKLA 2REBA 3PEYA 3BH6A 2QRNA 4JBWA 2QT1A 1E2EA 2XJ9A 4A2WA 4A0FA 3AF3A 4X8LA 3TKLA 3GJ6A 4IEEA 1OXSC 4G5GA 3QKSA 2Z43A 2H1LA 3FWYA 5FL7D 1PLJA 2WMOB 3BAFA 4DLUA 2IWHA 1KO5A 4B35A 3IBYA 2ZE8A 1D9XA 1US8B 5G41A 1SVKA 2D62A 1N6PA 3CX7A 1E9SA 2O8FA 2N46A 3ZVMA 3QKRA 1CU1A 3AVTA 4HAVA 4ZCLA 4CRWB 4EFLA 2MMCA 3VU9B 2JJ2A 3MFYA 1UKYA 2FFBA 5G3YA 3GEHA 3OZXA 4F93B 3FB4A 2P6RA 3KJIA 3QVVA 4BWYA 4AY2A 3MWLA 1E2QA 3K0FA 4OBEA 1DG1G 2IUSA 4M2LA 1MABA 1UDWA 4PPFA 4ACAA 1CJMA 4HAXA 4Q9IA 4QL3A 5KDLA 2W00A 4ZPXA 2OT3B 4US2R 3CNNA 2WOOA 4JYCA 3X1DA 4Q18A 4DT1A 2GVZC 3B1XA 4IVPA 4R2IA 1IHUA 2R2AA 5HTKA 1E79D 1F2UB 1V43A 5IRCD 2W2TA 3FDIA 1KTVA 3LWNA 3OEED 1OH6A 4C0SA 2R65A 3SZRA 4QJ3A 2EFEB 2VL7A 2X2EA 3AJIB 1Z6AA 4BLOA 4TTQA 4V02A 2FPKA 4A8JC 2BMEA 4AC9A 4RD1A 4FD2A 3IILA 1E0JA 3M1IA 1E2HA 4C9BA 3SN6A 5LD2C 2IXFA 2R62A 4MQBA 4DVGA 4E03A 1TMKA 2QSZA 2V54A 3ZS8A 4NBSA 2IC5A 3B9PA 2P6UA 3CB4A 4RZXA 4AG5A 1BMFD 2ZVPX 2GCNA 3AUXA 2Z6VA 5L3QA 3H86A 5JWHA 3IUYA 4GITA 4C3ZA 2BBTA 1COWA 2DBYA 2IF0A 2OXCA 2ZI6A 1N2CE 5FOSA 4D4MA 1KI7A 1SZPA 1OB2A 3PUVA 2N42A 4OHZA 1CBUA 3HWSA 1SVIA 3W34A 1Z2AA 2B7BA 5FH9A 2O8BB 3DVLA 3T1VA 1M2OB 2RHDA 3JVVA 3PQCA 3VAAA 5KSOA 1VCNA 4A92A 1DAEA 4U00A 4X8OA 2PBRA 4DLVA 5SZJA 1W36B 2W6IA 1YE8A 4GI7A 2HYDA 5DSZA 1T3SA 2H17A 3TMKA 4EPTA 1ODFA 3FOZA 4HEJA 1G19A 1W2HA 2ZRCA 4CF7A 2V3CC 1M7HA 3T06B 2ZVQX 3DO6A 1W4RA 4OKSA 4L5BA 1ZU4A 1MOZA 1QHNA 2QEQA 2VHCA 4DKXA 3P4XA 1AS0A 4XVQA 3ECCA 4L4UA 3HP1A 2ZUBA 3BFKA 2D4HA 2B6HA 3VR6A 5JWOA 2REXB 4Q03A 1LS1A 3PFIA 5HE8A 3A4LA 3K0SA 3NBFA 4QHTA 3U4QB 2CLSA 4R7ZA 5SZHB 3DKVA 2ATXA 5EXSA 2WOJA 4ZCMA 5E4FA 2PJRA 2J7KA 5JCZA 2J7PD 2BEJA 1H8ED 2VP9A 4AKHA 1ZVQA 2WPDA 3RSOA 3AVUA 4UNSA 3B6EA 1T6NA 2VEDA 3Q7QA 1BYIA 3LNCA 1I2MA 4LHWA 1J90A 4QNRA 3TJZA 5DI3A 1NNEA 4TMVA 3B60A 3LXRA 5FBRB 4A2PA 4IHQA 4NP6A 5JHGB 2KBEA 1E2IA 3FKQA 4LHXA 4ARZA 1IAQA 3KFVA 3PR1A 2IK8A 4HB3A 1KI8A 3OHMA 2ZJ5A 4XWOA 3NTUA 4GSYA 3O8RA 2A9KA 3UG7A 1OFTA 1W36C 2OBNA 2WIBA 4BPBA 1NY6A 3EC1A 1ZP6A 2V1UA 2Z4SA 1SKQA 1ZJ6A 2B92A 4YMWA 3CWQA 2F1RA 1HYQA 1N6OA 2QORA 3BE4A 4TMKA 1CLUA 1FQJA 2ZRHA 3U3JA 1ZCBA 3W6PA 1GKIA 3NVAA 2EFCB 1OF1A 2JLVA 3TUZC 2ZJZA 3AVXA 1DARA 5GVRA 1E32A 3WXMA 1AQUA 2EFHB 3CF0A 2X2FA 4LK2A 3BD9A 1HE1C 4NCHA 4RZUA 4ITRC 1PVOA 4ILEA 1QG4A 2F3TA 3CR7A 5EP1A 5F9HA 1CJVC 2GKSA 4B34A 2V6ZM 4Z54A 5EP2A 4Q7KA 1XD2B 3AQ4A 1G41A 1OKKA 2VHTA 1N6RA 5F9FA 1XMJA 2H16A 4G5SA 5HKKA 2ZRIA 3AP2A 2BM0A 1W46A 1E9BA 2J0VA 1P5ZB 3BJIC 4Q7MB 1KJZA 1MO4A 2YWFA 3NKVA 4Q9LA 1UBCA 4GBMA 3FPAA 1GL7A 2QGZA 1QHIA 2PZFA 1Z0FA 3RRYA 4D0LB 4Q4AA 4B6FA 3OIVA 3D7MA 4RY2A 2XNDD 4TLAA 2QPAA 1U99A 4N1AA 3VKWA 1VPLA 4DCTA 2LCFA 3NBZC 4LYHA 3NBXX 2H57A 4BASA 4W5WA 2BCGY 3QUSA 4MYTA 4B32A 1VG8A 1E99A 1IN6A 2FFQA 2F1HA 1P2VA 3RLFA 1OPXA 4LJ8A 4JKYA 2W58A 1NVVQ 4DC9A 2R9GA 1ESNA 2D7DA 4E22A 1SVWA 1AN0A 1QHYA 1ZD9A 2FOLA 2LWIA 2R6AA 1XJ0A 3DOEA 3TAHA 4E5UA 3RSLA 1D2NA 1XNJA 2ZRGA 1SVLA 4DIEA 3KB1A 4OHVA 1GSIA 2ZJ2A 2YJTD 5FUXA 1NIPA 2CDNA 3HJNA 3QG1A 2WWHA 4NYMQ 2VHQA 3REFA 1FMJA 3ZZUA 2JLWA 4LYFA 4HYYA 1CP2A 1JJ7A 1W0JA 4NCJA 3KQUA 4PQYA 1SVMA 3B1WA 2V9PA 4Q66C 2AWOA 4US0R 5KNCA 4HUQB 1HEIA 3GQBA 4URWR 1ZNWA 2OEPA 3BWDD 4LI0A 3FMPB 4A8JA 4TYNA 1QHGA 3EAQA 4TMTA 2VQSA 2VHJA 3FMIA 3T1OA 4PPQA 4XOIA 3RS4A 1ZYUA 2CK3A 5TDHA 4XTCS 4AURA 4ZCIA 1XB2A 4ZKDA 1EESA 1QHXA 4PSAA 3RANA 2AWNA 1SXJA 4BFUA 1LVGA 3GJ7A 3GP8A 2OFWA 4HAUA 1B23P 4KSCA 2ZS7A 3EPHA 4FMBB 5G40A 1KK3A 3KL4A 3X1YA 1OT3A 2GK6A 2QAGC 4WZ6A 3GLIA 1RJ9B 2E1RA 3NH9A 1N0VC 3AVPA 1EFRA 1KI3A 4D25A 3UMFA 2JLRA 1S9DA 2G77B 1S4QA 1G8YA 1P60A 2ZRNA 1OV4A 4FN5A 5FOVA 2V8OA 2WTUA 4DDTA 3AKDA 4CT5A 1KJYA 1CJKC 1DAGA 1ONBA 3ZS9A 3WMGA 5JEEA 4X8MA 4NPHA 3VX4A 3B9QA 1UF9A 4B47A 3C4JA 2BEKA 3DPUA 1U0LA 1OFUX 2RH5A 1XEXB 1WB9A 3VR2A 4TLCA 5IK2A 1WF3A 1XXHA 4DLWA 4KO8A 2OFOA 3EARA 4OHWA 4WIAA 3RHFA 1KK1A 3BFVA 3ZD7A 5GJCA 1R8QA 1AGPA 2GF9A 2V6IA 2GJ9A 3HDTA 4AKGA 4MUBA 2RGCA 4EJSA 2CL0X 1JECA 3L0SA 1VHTA 2QP3A 4I4LA 1G9XA 1L4UA 4V0LA 4XSGA 3X1XA 4EPRA 3U6BA 1R7RA 1WBBA 1YR8A 1E0SA 2W2VA 3A8TA 2Q3FA 1KAOA 1NMXA 1RRFA 3BGWA 3IEUA 4PPNA 2NPIA 2G0NA 2GAAA 2GJKA 2CE7A 3QKSB 2BBOA 2XAUA 2OLKA 4JIMA 4F7WA 4ZI2A 2HF8A 2WHXA 3BS4A 3TBKA 4DDWA 2NIPA 2VLIA 1S1CA 1GG2A 3U5ZB 4DUGD 1ZIPA 2C2HA 2O8FB 2V7QA 1Z6YA 1NVUQ 2GJ8A 3QKRB 2GAOA 3RDPA 1W47A 3TAUA 4EPYA 2ZM5A 3LV8A 1QG2A 1HQYE 1T9HA 2ANBA 3BH7A 4QGGA 2WKQA 1OHHA 1UADA 2QY9A 5LBIA 3GLHE 1IN4A 3KW6A 2IHBA 3SNHA 1OH8A 2WWWA 3K0FB 2AX4A 2IHYA 1BYUA 4KFTA 1W4BA 2DYKA 1KI4A 4NCIA 4HDOB 4K81B 4P32A 4YDHB 4YXWA 2EVWX 2ONJA 4IFBA 4TMXA 4YMSA 1AK2A 5KSYA 4DSOA 2C99A 4W7SA 1N0WA 5CDFE 4DXAA 4DT1B 2F9LA 4D6PA 3UPUA 3CX8A 1E69A 1JQLB 3NHBA 1W5SA 1OSNA 4R98A 5EP4A 1M8PA 2ZJBA 3GLFE 2XEXA 2YWEA 4P4TA 1C1YA 2VF7A 2QM8A 3OE7D 5CB8A 2RKOA 2PLRA 1XWIA 2WV9A 4NL4H 1OW3B 1AKYA 1JXMA 3PIRA 1P4SA 5EE1A 4ASUD 2FGJA 4TQAA 5TMPA 1UAAA 4C0LA 1NG9A 3WYAA 5P21A 3K0EA 2VP5A 5BYKA 2VIIA 3ZZ0A 3SYKA 3I32A 3K9NA 3WMFA 4D2IA 4PSVA 3THWA 2IS4A 1GL6A 3C16C 3QF7A 2IL1A 4IOKA 4HAWA 5FTNA 1S8FA 3KX2A 3UMRA 5C18A 4D80A 3AVWA 3C5CA 2QPTA 5A5GA 1NSFA 1P3JA 1RVDA 3QBTA 2ZRPA 4MYUA 2FH5B 4GDFA 3JZMA 1EWQA 3TW8B 1YJ5A 4HLQB 2H7VA 1H65A 4TSFD 4KLZA 4DCUA 4CEJA 1OJLA 5FPKA 1GL9B 1RZ3A 2GETA 4LCBA 1E1QA 3TSOA 2BM1A 1GTVA 1SKYE 3E5HA 1ANKA 1S96A 2ZPTX 3GMTA 2QN6A 3ZDQA 4M0LA 4TN1A 1BIFA 2YOGA 3I73A 1UEJA 2J41A 1HTWA 3TQCA 5DHAA 4G5OA 3D6TB 1NI3A 1VCOA 3WHKA 2LKCA 2ZROA 1YZGA 5GJWC 4NYJR 2G88A 3EX7C 1F3OA 2Z0MA 1DAHA 4CW7A 3UATA 4MKIA 1K5DA 2P0EA 1FPMA 4LZZA 1WCV1 8OHMA 3WHLA 1XTQA 1DO0A 4I1OA 4B2LA 4HZIA 2BBSA 2QUZA 2IYRA 3RS3A 1XRJA 1GP2A 1SHZA 5D3QA 3ASZA 5JECA 2ZI5A 1NJGA 2FEOA 1TADA 3KDSE 5JBQA 5EUMA 1DADA 1G7CA 2GNOA 3MGCA 3CUEF 4IVQA 4NKRA 1NBMD 1OE0A 2IX3A 3O8CA 4MDEA 1J99A 1ELOA 1NN3A 1VIAA 2GESA 1XCPA 4GMDA 4JLJA 2AFIE 1TEVA 1KDOA 4QHSA 5C46F 3MAAC 4ZDIA 4M4SA 1KO8A 2X77A 3SC3A 2ERXA 2J3EA 2OHFA 4ABYA 2R8RA 5IDVA 2IS1A 1A82A 2YKGA 1VDZA 3FVQA 3KUDA 3LDAA 4JL8A 4IXNA 1NLZA 4HZUA 1UKVY 4QBIA 3T1TA 1SULA 2WJVA 2FZ4A 5DI3B 4BLRA 3CPJB 1WRBA 5F3WB 1TTTA 1IY0A 2FDCA 5GJBA 4KVAA 1Z47A 4ARZB 2HV8A 2XTNA 4BFVA 3KKPA 4RD4A 2HEIA 4FMDF 3KKOA 4M9SA 1UFQA 2QAGA 4DLSA 3EPJA 3DDCA 3PV0A 3K70D 4ZIRA 1TF7A 4QBHA 1W4AA 3MWYW 3THOA 4CGZA 2PCJA 1IOZA 1N5JA 1BH2A 4RD6A 2ODNA 3B85A 2LKDA 2ZRAA 3NC1C 1VG0B 1G8HA 1AJEA 3GJ4A 4TYPA 4E09A 1QBKC 1G4UR 2F3RA 2BMJA 4CVNA 2OLJA 2ZR0A 1COWD 4HB2A 4MKGA 1KSGA 3CR8A 4QJ4A 5LPNA 2D06A 4AYXA 4Q9HA 2RB4A 2WJHA 5FOUA 5FI0B 4D0GA 2QE7D 1Q20A 1ZNZA 2W6JA 4QBGB 1W0KA 3CH4B 1KO4A 3GJXC 5K8LA 1MV5A 2IWRA 4HLUA 1EFHA 3CH5A 2W6ID 4Q5IA 4PC6A 2AR7A 1CTQA 2KI5A 1E2KA 4P31A 1GKUB 3DHWC 4Z8YA 1KDPA 3NDBB 1E1RA 4RVCA 1FUKA 4XVRA 4NCNA 2BHRA 1NMYA 3X1WA
chains in the Genus database with same CATH superfamily
4MH0R 4RY9A 3E70C 3PUYA 3UMCA 3JQ9C 3R40A 2UZ3A 3NASA 2IZZA 4F9FA 1FUIA 3GJSA 4FYVA 3H5OA 3U4MA 4GMFA 2NO6A 3AIOA 3OY7A 4IS3A 1IY8A 2GI4A 3HGIA 3G8AA 2JHGA 5KMGA 2ZQ5A 1ZMRA 3UJNA 1U7DA 3EW9A 1GM5A 4ARAA 2DSNA 4MUYA 1W9HA 3FOWA 2AUTA 2KB0A 1Y8RA 3A6FA 5EXTA 1G5FA 3R7DA 4Q1DA 1VB5A 3U56A 4ZAZA 1DGHA 1RLIA 1D9ZA 4BNWA 1TKBA 2GO7A 3ZCQA 1HDRA 1JEJA 4EMUA 3KP0E 3WK6A 5DIFA 1M34B 2YVQA 2EX1A 2F5NA 2XNJA 3RSQA 1QP8A 4J94A 3RIXA 2VYFA 5J1TB 3TLGB 3LVRE 4DZTA 4GKKM 2XBLA 5CLQA 3PXEA 3KTFA 3ND6A 4C3OB 2RE8A 1ZJWA 2JI9A 1G20B 1FOEB 3T5DA 1IXYA 4AUNA 3D5TA 4KRXA 1FTNA 1X3SA 4NXNM 4Y0NA 4MOWA 3R44A 4WP2A 2HLDD 4RF1A 1Z2DA 3PZRA 4IIVA 1YHYA 1OGIA 4F5ZA 2F5QA 4UHCA 4UEQA 2G6BA 3SXUB 4JKIA 1ZW1A 2HA3A 3N7TA 4EEKA 1IXSB 1ARZA 2VNHA 3T7RA 1IATA 3RG8A 3UK0A 1XEWX 1E2LA 3QX9A 5BSVA 1ZXXA 1YZKA 1S5PA 1XFAA 3WRYC 2QD1A 3BZUA 1LDEA 1KRWA 4I08A 2GCOA 5K8CA 3REQB 4PLGA 5JZVA 2EBFX 5K8UA 5BNIA 3FLAA 5EKSA 1EVQA 3L05A 3U4AA 2IW3A 2Y6UA 3UBMA 4F2PA 2VJKA 3LY9A 5JNWA 4LYGA 5E4JA 4W82A 3W9UA 1P75A 2VSFA 2OD9A 5KQMA 4FHFA 4KXMA 3LUCA 4P36A 1GZSA 1G1MA 1B4DA 1XLTC 4R5HA 2CJWA 1G8MA 5FJIA 4EB6A 5FAKA 1RAIA 2ZR7A 5KJCA 1NLFA 3FD9A 4WOKA 1JU3A 3AETA 1R0CA 3BXXA 1E5QA 1G3MA 4GECA 1MA3A 1D7AA 3VAZA 3P0HA 1E94E 3AHDA 2B5VA 2XGSA 1DTWA 4MZXA 5F9MA 3L07A 1JAXA 5K4GA 4QOEA 3UMSA 1N3BA 3CJQA 1U0RA 5TVKA 1TU0A 4HUTA 3HHPA 4UAVA 1PUIA 2TRSB 4J6FA 4MIOA 4FFSA 3G1WA 1ENYA 4W4TA 2EFGA 1LA2A 2O2IA 1O9HA 5H9VA 3LGAA 4ALLA 1Z0DA 4YJ2B 1JA1A 1VL5A 4Y9SA 3GEGA 4JXZA 3FXAA 4WY5A 1G8GA 1FP6A 5L3VA 1C3VA 4E32A 2MJ5B 3T5GA 3ZIAA 4RFLA 5DF1A 4HX5A 2D74A 1WOMA 4BDTA 1DINA 2P8SA 1AURA 3O38A 1GYRA 1VP9A 4RDIA 5J4KA 1GUBA 3QYAA 2FI1A 3IEMA 4JCCA 3QHAA 3D4NA 3ND8A 4CFZA 2J9RA 3HFGA 2J7PA 1KWGA 1XMSA 2W6JD 3LMMA 5KSZA 3RARA 4KQ2A 2HKJA 3Q8XB 2GH1A 1EP2B 4AMBA 2O19A 1RWPA 2PMCA 3ZBTA 2QVYX 2ZE7A 1VMEA 4DDVA 1FFXA 3MTAA 5K7SA 2BKUA 3QXCA 4JSYA 1RXIA 1XE3A 1DQSA 2LIPA 2FEMA 2EXXA 4L15A 2JNWA 2AZDA 2ONCA 3VGPA 2EOAA 4OM8A 1XTTA 1KKMA 5C7LO 1UWCA 4ML3A 1EFKA 4FXPA 3HY4A 3KPVA 1Z82A 3HJSA 3GYBA 4Q3OA 3ZU3A 3VYVA 4XM2A 4NYJQ 3N2EA 2CUTA 3JD4A 1JFRA 4JLUA 4QEKA 1ZD1A 4GPIB 3PUWA 3M9LA 2X1VA 1YS6A 1C9YA 3U7JA 4ALMA 4EFNA 2C8VA 4QWMA 4IXDA 3AHCA 2WSBA 5IC4A 4LV5B 1VE6A 4B1FA 4PLPA 4J29A 4HQNA 1VBFA 3CLRD 3QEMB 2J5XA 3G8BA 2YN2A 3EXAA 3GJ0A 1GVNB 4UHBA 4GPTA 3SCZA 1YKGA 4JN6B 3K09C 1G5RA 3BL8A 4EATA 1KQ3A 1Z5WA 3L2AA 5JD3A 5SICE 1FU8A 1XNQM 5IT4A 3I37X 1Q0PA 2FV8A 1F14A 4LSGA 1IY9A 3W6UA 3NWJA 1QB8A 1OT5A 4I0WB 1IEWA 4XD7A 1Q7EA 2FA9A 2DC1A 1YE5A 4BFYA 1ISPA 1LU9A 1RPTA 3WP0A 2VTKA 4BNDA 1Y9DA 4GICA 3JRWA 1S3GA 3WB1A 3DSRA 2CXUA 2K6BA 1S9HA 5L3ZA 2AJTA 2UUBM 2FMKA 3BTUA 1XBTA 1ZQ1A 2ODWA 3F46A 3U3XA 2CBZA 1C8KA 2JFVA 4UM8B 4GKKB 2W2QA 2WSFF 3D8RA 4JUAA 2VF8A 3WMRA 3SX4A 4DN6A 4FI3C 3CVJA 1TM5E 1G8AA 1SBNE 3I76A 4LY6A 1EI9A 3NXKA 2RH4A 4I9GA 3ZOZA 3PNQA 1XWWA 4RO0A 2PLWA 5FUWA 3KDAA 2ZBKB 3GFTA 5JBNA 2O7NA 3M8KA 1MD9A 4M60A 2CC2A 3DXZA 1Y63A 1NNSA 1CUBA 4PG6A 3ABRB 5BT9A 4ROTA 1NJ8A 3KM0A 3BH0A 3SKXA 4RWZA 1XMOM 1QVRA 1O9GA 3EXFA 3VTKA 1X8JA 4YWHA 4OH7A 4IIFA 4Y2GA 4OHUA 1B93A 1EFDN 1FFHA 3A36A 3LFUA 1ZMWA 4KXFB 4TTSA 3MRTA 3K9WA 2R79A 1TAQA 1NC1A 1WMBA 2YCBA 4UUOA 3OQIA 2C96A 4YV0A 2DR2A 2NVUB 5BVGA 3DZJA 3R0JA 1E6CA 1P1IA 2IJGX 3F8SA 2I8LA 1E1MA 5JH7F 1TA4A 1SXHA 3FPLA 4UDYX 4IBJA 4U2GA 2PMKA 1II9A 3DE7X 4JC0A 1GSOA 3JWIA 4YUVA 3MF4A 2AOVA 2EJTA 5FPHA 1YASA 2J30A 3DZFA 2FJUA 1S7GA 4EFKA 5GIOE 3CMMA 1CQWA 5IZ4A 1GCOA 1W5BA 1TTEA 1LEHA 2G9NA 5ALZA 4LXGA 4DJFC 3UQZA 4UPEA 3D6FA 3KB2A 1T24A 1YB6A 1PEAA 3OZIA 3BMOB 2W2LD 4HG2A 1KGDA 1SCKA 5HSGA 1FP7A 5NLLA 1OHHD 3PKIA 4M0UA 1R74A 3SFZA 3U3RA 3NHJA 1ZM2A 3BXPA 1I6MA 2JATA 1Z22A 1V8BA 5A4KA 3CBQA 2W6QA 5B30A 5EWLA 3K0CA 2VP4A 3FZNA 2OGSA 4HXYA 3U6LA 2A5DA 2QG6A 1EAMA 3BAZA 1EWKA 4MEAA 3L8CA 4AJLA 1IWPB 1BJTA 4LA4A 2JFGA 1PR0A 1TLLA 4MR7A 4MRRA 3ZWCA 2OV1A 1QG6A 2PBFA 4D4KA 3W77A 5LJIA 2A1TR 5CLJA 2P5SA 4UN2B 1K97A 1V7PC 5MHTA 1BS2A 3HEMA 4O59O 2Y9PB 2VH5R 2QUHA 2HV9A 5TS2A 5J4LA 3L01A 5A4FS 4X95A 5K45A 4OX9M 2YY5A 4PO1A 3CZPA 1NE7A 3CONA 3GEEA 3L0DA 4IUCS 4F2HA 4HNRA 4B4UA 4KAJA 2VCYA 5GONF 4CTNA 4DCVA 3KEQA 1LCIA 5FR2A 2R7NA 2FG6C 1IDOA 4DLTA 2JVKA 4IPTA 1E9RA 3L0PA 4YJ3B 1AQYA 3VJMA 1I2CA 3RHTA 3HE3A 3IX7A 2TECE 1KZGB 3N0XA 4LHZA 3A4YA 2C5LA 2EFJA 2GO1A 4L8LA 3E35A 1I33A 1ZO8A 2PRKA 5FB3A 2RHLA 3DDOA 3GCWA 1XNQB 2G06A 2QGFA 4HX2A 4TUWA 4MV0A 3GGSA 4F84A 1M2VB 5U9CA 1QLWA 3H4JA 4DR6B 3ADCA 4OGLA 3IG8A 1XRLA 3U7QB 1Y5LA 2WW8A 4UC0A 3W2HA 1OKSA 5TGZA 3MG9A 13PKA 1KEPA 5H70A 3DLIA 1E8DA 2C4MA 3ED5A 1SZDA 1G8FA 3B36A 1KH1A 2B8NA 4KR9A 3FVRA 2OVBA 2Q2QA 1H0KA 4WEQA 2UUBB 1DIRA 4BVAA 3LT0A 2YIJA 1R5BA 2NN3C 3RK0A 1NV8A 4BKOA 3CNOA 3LIPA 1CULC 1R5OA 2BGMA 5FNVB 5B1HA 1W94A 1U90A 2WIAA 1M34E 1K0FA 3DZGA 3PQ3A 3KB8A 4LJ7A 3UT5B 5J5CA 5I5EA 4YMLA 2AKEA 4FMCB 5LA6A 3VO1A 1H0RA 3O2JA 2PX8A 2ZJ8A 3DXYA 4BU0A 4WOCA 3HLYA 5ELLA 2X58A 1R4AA 2HQRA 4FR0A 4H3SA 3KQLA 1XMOB 4WK4B 4MI9A 5CA1F 1YKFA 1G20E 1ES9A 2KNZA 4XQGA 4C1NA 3F90A 5A7GA 3FKSA 4B45A 3FUWA 1PQWA 1KO1A 4E5SA 3P9ZA 2I3ZA 1K3WA 3GLGB 1L7OA 2BKVA 1IUOA 1OTYA 2Y9MB 5A0FA 2F2TA 3FSJX 3UWOA 4N3AA 2HT6A 2WU8A 1DTSA 2ECOA 3DEZA 3U17A 1GRRA 2X9LA 2YUIA 4AN4A 1RJ9A 1X9GA 4FU0A 2TMGA 3EA0A 5IM4A 3F6CA 4UNRA 3HNRA 3WYGA 1CS0B 4X94A 3MQ2A 2LHGA 5IXJA 3WX0A 1E4YA 1II0A 1PM5A 3FMVA 1XR3A 4EEXA 3AUJB 2F3UA 2VZEA 2BFOA 1DB3A 1TYDE 2JP7A 1U8ZA 1UINA 4FP9A 3H87A 4QXOA 3G2NA 1TUBB 4B35A 2ZE8A 3EFOB 2JGKA 5E6UA 2E89A 1X19A 5DHPA 2APLA 2X42A 4AY2A 4MK4A 1DG1G 1R6TA 3DAFA 1U0TA 3H99A 1AE1A 4K26A 1DJQA 4MKZA 3K6JA 5HTKA 2QLLA 4HGQA 1U3GA 3L27A 5GAJA 1L6RA 3W0LB 5CGZA 3A04A 1Z6AA 3L28A 4LGCA 4AC9A 3RF7A 4D57A 4J3JA 3M1IA 2X8BA 1SZJG 2IXFA 4W5OA 3VPXA 3B7QA 4RZXA 5JMOA 2KMLA 1EEHA 4XGRA 3H05A 1CBUA 4B85A 2RCYA 1HNZM 2HRCA 2JKYA 3H5WA 3MS4A 2WUFA 1VCNA 2XZDA 4JB8A 4QDZA 2YH2A 3PFCA 2V3CC 1DHRA 4RIGA 3OLCX 1EBBA 4MDHA 3F1KA 2ZUBA 3EGEA 5TT1A 1LS1A 1NR5A 2VDQB 4NBRA 2EC5A 1YBAA 4C06A 3TL4X 4FJ1A 3H1GA 3AVUA 2EZTA 1HRKA 1J90A 4QNRA 4IHQA 2MYTA 4CKBA 1LX6A 4NOJA 4LCEA 4P92A 1F0KA 3O26A 1CDZA 3EC1A 5F7OA 1U6IA 3DTYA 2XHZA 4OX9B 4P5PA 4BMOB 3OA0A 4J4BA 2FOIA 3PD7A 5GVRA 4PG4A 1AQUA 3OFSA 3E3AA 5BOVA 3NW9A 2EBWA 5HIJA 5A7FA 1XMJA 1TO6A 4BNYA 1E9BA 2LTAA 1PR5A 3N2KB 4K2AA 1UBCA 1GL7A 4DUYM 1Y7PA 2CXPA 1I3NA 4TLAA 2QPAA 2NTVA 2QN1A 2I67A 4Y9UA 3DKKA 1IN6A 2Y1EA 3QH4A 1ZY2A 3C1AA 5DLYA 1SVWA 3FI9A 1AN0A 2HHLA 3OJEA 3JQ8A 2GD6A 3F6BX 3M9XA 2P1DA 5IKOA 3PRHA 4AW4A 2CZGA 4C88A 4INOA 1PR6A 1QHGA 1HNXM 3OY2A 3GAMA 4LXHA 1QFXA 4HV4A 4WZAA 1V6CA 1JSXA 1UBLS 2I4TA 2NUAB 3G0DA 4FMBB 1KK3A 4EYQA 3KQYA 3PDJA 4AQYM 1RRVA 3GRVA 3GLIA 4Y6LA 4UUAA 5KVSA 4CDRA 3EAFA 4HNTA 5E8JA 4HJXA 4NG5A 2JBHA 4MWSA 2HLHA 3KD2A 3ZHYA 1L4GA 2PT6A 5DV9A 2BLLA 5I4CA 1KK1A 4I5SA 3R1IA 4OBWA 4K03A 1FNBA 3QOYA 4I50B 4MUBA 4IQFA 4R51A 4NZPA 4EHHA 1L4UA 4V0LA 3HQ4O 2JVJA 3DE0X 3U3DA 2NPIA 1EP1B 4ZI2A 1GCIA 3IAXA 1S1CA 4OFZA 5B7QA 4NS4A 2VJDA 3HKEA 5CHYA 3WL4A 2WKQA 1MPXA 1ZR4A 2CMGA 4EG6A 1B2RA 2CF6A 1SBHA 4I4TA 1D6MA 4IFBA 4DJJA 4D6PA 3CX8A 4IZOA 2ZJBA 3VPCA 2PUHA 2RKOA 2J5QA 2WV9A 4KE9A 4YRSA 3RCBA 3K0EA 5BYKA 2RBGA 1KJ9A 3S8YA 3COZA 4WNYA 3THWA 1T9GR 3G1UA 2C2WA 5FV7A 5FTNA 4K3UA 4D80A 3W5SA 5AOCA 2P3QA 3QTLA 1UXKA 2ET6A 1PW7A 3ZY2A 2YVKA 4DF3A 3THGA 2PL1A 3B1JA 1Q14A 4F5EA 3HK2A 3TPCA 3C97A 2FEOA 2Q62A 4AS1A 1CWUA 1KYYA 3O8CA 1J99A 2D1FA 3OEYA 3L6UA 1VIAA 1O94A 2WJZB 4GMDA 1H2AS 1KDOA 2BFBA 1URPA 4QHSA 1WWKA 1GU0A 3UGTA 4NFHA 1AUQA 5G4LA 2R8RA 3RGWS 2QOEA 1B8PA 3CZ5A 2ZSJA 4F3CA 5HXAA 4JBGA 1SULA 1WXIA 4B6PA 1OYVA 4WK6A 2R751 2R1VB 2W71A 1PFVA 3KWLA 1Y7IA 3INGA 1IOZA 3S1LA 1NBHA 3N3BC 1YNOA 3TPZA 2BMJA 4MVJD 4BB0A 2ZR0A 4LMRA 1MENA 1XHFA 3CR8A 2AB0A 3P9QA 2G6TA 2QQ5A 1KO4A 1J8DA 2XMZA 2BGWA 2FSUA 4Q5IA 5HF8A 4EG3A 1I7PA 4AZSA 1NC3A 4PU0A 2FMTA 4MKFA 3NBUA 4D46A 1KBZA 3WAKA 3C1OA 4OSEA 2CVFA 4PLHA 4NZOA 1SCIA 1P8AA 4DNPA 2PLAA 4WN9B 2IOFA 5BURA 3G8CA 2R7LA 3RT1A 4M49A 3AUYA 2EGHA 1GTL1 4LYDA 5AJWA 1UKEA 4YQYA 2YV5A 3ANTA 4O2BF 2A78A 3CCFA 4I1YA 2W2KA 3WQQA 1ZDMA 3U80A 3JAKB 3O73A 1I2AA 1BEUB 5DT9A 3H04A 5G53C 1HNZB 4ZT5A 3HO6A 4V0KA 3WLAA 3QLVC 3ENWA 2Q4BA 4DV6M 5BQ3A 5GZ3A 5TS3A 3ENZA 4RIFA 4A8JB 3A9SA 3FDJA 4DBLE 3QJ5A 1Y1SA 1LY1A 4KREA 3AONB 2XRMA 2C5EA 1K5GA 3GY0A 3EG9B 3WFZA 5IM5A 4NPAA 4PCVA 3RKSA 2KSQA 3WA6A 4G0XA 4LSWA 4PC1A 4O4IB 4PYQA 3I62A 4J3NA 2G1UA 5KI6A 2GN2A 1XTPA 3GFGA 3X3HA 1XD8A 3CH7A 4ZODA 1FX0A 1DNPA 4DMFA 3Q6IA 1RYBA 4BJ1A 5LOVF 3GVXA 1C8LA 4EJSB 4P1ZA 2IYZA 3ZJTA 3MCTA 1A8IA 4MLPA 3T4XA 3QRWA 4ZI5A 2GLXA 1S3IA 2ES4A 1XP5A 1GCAA 4CMKA 3ZKAA 1YZLA 3C58A 5JZMA 4BL5A 1U98A 3RQIA 4DLKA 1V1RA 3QLTA 3LKDA 1QOZA 5T6BA 4MPDA 2GCIA 4AD8A 4HTAA 1YDGA 1WF6A 3V4ZA 1TZCA 2QYHA 4EG5A 4OLHA 3D1JA 3FDFA 3TWOA 5CVVA 3GG9A 4UJ5A 3BX1A 1H9AA 3K53A 4MRNA 4PO3X 5T8KA 1Z5ZA 3CF6R 1NSYA 2K9DA 4D0NA 2ZJ4A 1ONNA 2Q0HA 4G4SP 3VKGA 2PKXA 2P62A 2FMHA 2YMPA 3JQGA 4ZEOA 3UPDA 1VGVA 4MA0A 2Q0QA 1UPFA 2H29A 1WXHA 3CLSD 5AVSA 2JCVA 3WB9A 3ITNA 1GFIA 1GUAA 3I01M 5D3KA 4LZLA 4AQYB 5IASA 1EUCA 4YAEA 3I61A 2VPXA 4LJ5A 4RHUA 1W36D 4LTMA 2QL9A 1EIJA 5EMMA 5ALEA 2OQIA 1XCOA 3VTFA 5HVNA 1UBMS 2WFLA 4CMEC 5D3MA 1W1IA 5CA0A 1WD7A 3KYCB 2GEVA 4JJZA 1R0LA 1NBME 4CPDA 4X3OA 4RA9B 5CDFA 2J9YB 4HEHA 2DWZB 4I8XA 1AB6A 3IVRA 3WWYA 2I22A 2ZRJA 1XZDA 3A46A 3V1NA 5FWXA 2AN1A 4D8VA 3ESCA 1J9ZA 4YBRA 2GFQA 2FPGA 2BGRA 3PUXA 3JTMA 4JJFA 5KYXB 4MQEB 3QSYA 3N0TA 3EDRA 3IBSA 5JRJA 4EZIA 3OIUA 4OQNA 3OIYA 1BXKA 1YOBA 1C7YA 2LNHC 4YCDA 2GYYA 2HNKA 4U7GA 1SUFA 1XP8A 2VJPA 3N2GA 1Q1QA 5JRDS 5KINB 3GMIA 4XIIA 3OUTA 3RSFA 1QGDA 2YJNA 1BMTA 4D4IA 5JDIA 4TYYA 4FYHA 3BWYA 4MVCA 1U8TA 4HUJA 3WWCA 1RABA 4JOQA 2VJBA 1RR6A 2AYYA 4R1UA 2I8CA 4NPCA 1WW3A 2PR7A 3I09A 3NRBA 4CDMA 1LTKA 1WETA 2P4HX 2HD4A 3A1TA 2GKGA 4TYQA 1G2QA 2HA4A 1EX9A 3CRZA 3BD6A 5CEFA 3SY8A 3NHRA 4MI1A 3GLGE 1BW9A 2D5CA 1E3WB 2I7DA 1FS4A 1NLMA 1PW5A 2BFFB 1FJ2A 4V0NA 1TKCA 2BHLA 5U4QA 3ICPA 2X8JA 1IMOA 4LMPA 3B1VA 4S0XA 5LQNA 2ZT5A 3SM9A 1VPVA 2EX0A 3I83A 1P2FA 3SGLA 4JNKA 2R46A 5F52A 1RZRD 1Y1RA 1GGFA 3MHPA 4IL5A 2RHTA 3TUIC 1NN5A 2H2IA 4YRQA 3R6WA 4KI7A 1OR8A 1P3QQ 5F1YA 5JRZA 2V7EA 2QTRA 3LPAA 2JJ2D 3E5RA 1B1CA 4XEUA 4BEJA 1WHTA 2PH3A 2EU8A 3ND9A 2AKAB 3LCRA 3HO1A 4BBPA 5DHSA 2VA9A 3VHQA 1MW5A 2E4YA 4QM7A 3A1CA 2CFTA 2ZJAA 3N53A 4U9IS 2R18A 4P38A 1D04A 3ZWAA 1WSWA 5FLXA 2XTMA 2H8KA 4GC9A 3NUGA 4GL2A 3JALA 5HYVA 2HL7A 1N25A 4L7VA 1J5XA 4DV6B 2V7BA 1YKSA 4K2HA 4WZZA 5KNBA 4BNTA 4ROSA 3MT7A 1ZMBA 4ENUA 4M1QA 3E27A 1Y9AA 3MILA 2ETVA 4RVHA 4JQYA 1VRWA 3GRUA 3VTZA 4GZLA 4WERA 3IP3A 3N6RA 2ZBEA 2ENUA 1PJ2A 3OZUA 4DY6A 1EX1A 2CVZA 2X6TA 4Y6OA 3SYLA 2X4LA 1P7YA 1NVFA 5BXYA 4XCXA 4B6JA 2GTHA 1OLUB 4KYIB 4BE7B 2WJYA 1P2UA 5HM6A 4HAZA 4GSLA 1JHZA 4M83A 4NYIR 2IYQA 2PGDA 3AG6A 1J0DA 5B12A 5A4JA 5KOYA 3ZK9A 3KNZA 1WP9A 4NOLA 3WISA 4E2WA 3G9TA 5JVDB 1CVIA 3EEYA 2DNAA 3R9XA 4BJ6A 1XFDA 5L3SA 2QD3A 3M0EA 3DBIA 4RORA 1B0PA 2O8EB 1SCQA 3LH5A 4W6QA 2Q5HA 3GC6A 3K1ZA 1NUPA 1VA4A 1RKVA 2XB4A 1WSBA 1BDMA 3KQTA 5LU9A 5PGMA 3CX6A 4A1FA 1VBKA 1K9SA 4B2YA 4O8CA 1V8OA 5JCPA 4YRBA 3KJZA 4G1EB 3QG5A 5AO9A 1I51A 1R8YA 4KV9A 4BUJA 3EODA 3CRW1 3OO1A 3MRSA 2GRJA 1VLQA 1VXOA 5F76A 2ZYUX 4N5MA 1P0MA 4ENWA 5BO5A 3P9RA 3DOUA 4PONA 5AKZA 4B3GA 1KQOA 4O02B 2BFPA 2WZJA 3TIFA 3T7TA 3RWOA 5ABPA 1ULZA 1NJFA 1CKEA 4RVFA 4CKWA 4QYSA 1PL7A 4B80A 5BW5A 2Y68A 4DSZA 5JAQA 2I2CA 3T9EA 4HVCA 1W5FA 3PC2A 1NDHA 5ALDA 3F5FA 1UMKA 2HQSA 2QSYA 3LAWA 2P6NA 3SHWA 2UZ0A 3KSDO 2LGJA 5K1ZA 2VSYA 1RIFA 1QPBA 4PFKA 4BJ3A 4EY3A 4A0GA 4JMPA 4K9NA 1N3IA 3H5RA 3N0WA 1A5ZA 1T2AA 3J80S 1SFRA 3REOA 5E9WA 3O84A 4MHSA 5JXGA 5REQA 4ZPJA 4XI9A 2PZGA 1J1IA 1M2WA 4C78A 2O8CB 2ZYTX 1VM6A 1MBZA 2GPYA 2FHPA 1DMSA 3USCS 1XU7A 1VJRA 1W5AA 4XGIA 1IBRA 4MS4B 2NXCA 4LOLA 4YXWD 1D1TA 1ENZA 3W05A 3ZV3A 4AWAA 3RIEA 3UVEA 3C70A 4W8HA 4AUMA 2ZWIA 5LDDC 2YHSA 1VKOA 1MO2A 2BKEA 5LUBA 2HSZA 1T91A 1AZSC 3R3VA 1E79A 1FNNA 1GR1A 2FX3A 3HU1A 2OG1A 1G6KA 3AMVA 4B74A 1AT1A 4M6WB 4HHEA 2NU8A 3BWBA 4F3RA 1B43A 4MB2A 3QVJA 1A9SA 1V3TA 5A9TA 2ZJOA 4JLOA 5AVXA 4Q1CA 2NTYC 3HR4A 1VFPA 3H17A 3L49A 3HP4A 1XVIA 3NYWA 4KBGA 3D3KA 3GEDA 2O5CA 3F71A 2FFAA 1AIPC 5DPMA 2IYSA 1ZN8A 4MICA 1GGEA 1US8A 3MBKA 4D9GA 1Y8AA 3VPHA 1CQIA 2WF5A 3COJA 1D3AA 2F67A 1Q2UA 1V16B 2YIMA 2OP1A 2FWMX 1Q1GA 4G2TA 2WWIA 4OXQA 3R7LA 1YB4A 3RYIB 3RC3A 4DCSA 3W1VA 3KOMA 3LRXA 1EPUA 4DWWA 4RS3A 3IT2A 2BFDB 2G1PA 1UXJA 4NAUA 5H8WA 1E59A 4LV8B 1UFZA 2WHYA 1ZJ4A 1KYIA 1YRAA 1I7DA 2ZLBA 3LY8A 3W5AA 2G9UA 4PTYA 3ZJVA 5H4HA 1KIFA 3FH0A 3KP1E 2C5BA 4QBFA 3H83A 3EDQA 1GN9A 2EKDA 3EDCA 1PFGA 5FTLA 1K1EA 4QUDA 2WM2A 3PX7A 1VMKA 4DV7M 5HA5A 3W3AD 5DGHA 1TI7A 5J59A 1E2JA 3EUAA 3IVMA 2DFPA 5FLKA 3RC7A 5ULLA 3QQPA 3E84A 1F12A 4ER0A 3BMXA 1B6SA 2Y05A 4FFMA 2WYUA 3OD5A 3C24A 1W85A 1Z5AA 4JELA 4KB5A 9LDTA 2F90A 4UEJA 5E4YA 3MK6A 5DBIA 2IIBA 4FCCA 2CL5A 4U5XA 4I66A 3ZCSA 1HLPA 2W0SA 4JI2B 3DAOA 3MMNA 3S99A 1T9GS 4WZBA 4WTOA 4TPKA 2R44A 1SR8A 3GRCA 1RJEA 3C8ZA 3V32A 4MXDA 4ZC8A 4UTPA 2WAMA 4OJYA 2QJOA 4QUEA 2YY7A 4RMNA 4NRVA 5CK4A 4WKOA 4TUYB 2X0JA 3OOJA 4OJQA 1JAZA 1G4HA 4KO2S 3HPRA 2I9PA 3EEOA 2PQMA 3IB6A 5E7IA 4DMCA 1H1DA 2J87A 1I3CA 4MVJM 5IF3A 3QPAA 3QE0A 4RKYA 4OB6A 3ZEAA 3CVUA 5U1PA 4WPGA 3KEGA 2Y20A 3ZU4A 4G09A 1S2GA 1D5WA 4O4HB 3W8EA 1G66A 2ZBDA 1NFRA 5IHXA 2AMVA 3LNTA 3PQ8A 2JLXA 2W4IA 5CJJA 4DG8A 5T3UA 1D2AA 2KPOA 1MN6A 2AEFA 1ZV1A 2VJMA 4RTLA 4XPIA 4H6VA 3IH5A 1RHQA 3VR3D 5KPDA 1T1GA 2FCRA 4QE3A 1AUVA 2J59A 3HHYA 2H4JA 3L7CA 5B37A 2WK1A 2D2EA 3FG9A 4Q1EA 4RK1A 2IGBA 3ICCA 4ZZ3A 4DA6A 1D0IA 2H1LA 1R00A 4R84A 3MK31 3B3JA 1KO5A 2VWPA 4L0MA 2XIJA 2X5NA 2B20A 4CRWB 3H5IA 3C3YA 4IXWA 1P0QA 4DIOA 4US2R 3P9XA 3AQIA 3L79A 3W8FA 3PS9A 4OH1A 3HJCA 1TR8A 4EF5A 2WSIA 2I55A 3F9RA 3VKVA 3DBHA 5JXWA 3HV0A 4M38A 3UEOA 3WRWA 4IJ6A 4ITVA 1JU9A 3L92A 1JIXA 3ZHRA 3ACBA 2BBTA 4QU0A 4ZV7A 3TZCA 4NVRA 5FH9A 3KG2A 3JVVA 5DGTA 5EGSA 3ZG6A 4BNUA 2D59A 4U7TB 3MOSA 1Y9JA 4EPTA 2GOYA 4D8XA 2Y0BA 2AG0A 4C20A 1Q19A 3KHUA 2PUCA 2XLCA 2QEQA 1X92A 1Q5PA 1FXSA 1FFYA 1SIUA 3PXAA 1R9MA 1OLXA 3DKVA 2HMUA 2VTDA 3ZGZA 1C1DA 2P30A 1PJ4A 4HB3A 1JH9A 4RABA 1SQGA 1T1IA 1RRMA 3KSBC 1WTCA 4AJOA 4F3NA 5LYJB 3FPCA 2V1UA 1CUHA 3LWZA 1A72A 3PJGA 1W1UA 4IG4A 5GGXA 3QX8A 4XUEA 2PQ6A 4JK3A 1RE1A 4ZJUA 1N4AA 4X41A 4G0PA 4RZUA 1HO3A 3U6OA 3I6ZA 2G1AA 2H16A 4J07A 1VHWA 3NKVA 3U26A 2QGZA 4C08A 1TH2A 1VJ1A 4D0LB 1JS1X 1X15A 3H0CA 3D4PA 2R1TB 3PXXA 4FFDA 3KWMA 2W4MA 1SMKA 1M8FA 4AS2A 5KWJA 2DPYA 4LJ8A 4MULA 4UD6A 5HF6A 4DR1M 4X63A 1XJ0A 4DIEA 4E4TA 2YJTD 1LPSA 2J5YA 2QX8A 3THSA 1G98A 4BVHA 1E6MA 1AOXA 3SBJA 3UAXA 3AM5A 4LI0A 5CXUA 3C5EA 3I9V1 1X1BA 2IP1A 3L04A 4CG0A 4TV8A 3VNAA 3A32A 3GP8A 3UO8B 2QRHA 3FWKA 3SMPA 4C6TA 2C29D 1E7WA 1NXTA 2V8OA 4UVGA 3AKDA 3EGVA 4XQCA 1TCUA 1SC3A 3IEIA 3VR2A 1XXHA 2WP0A 4EGJA 2XODA 3BVPA 3PXBA 3PWTA 2V6IA 2RGCA 5F2NA 5F98A 1UBKS 4I4LA 1IQRA 3U6BA 4YH1A 1KAOA 1X0XA 4DG5A 2QJWA 2OHGA 4F7WA 2WD9A 4AJIA 3A6DA 3RDPA 5T57A 2VDMB 1WMDA 4BP9A 1T9HA 3BH7A 4C43A 3D0KA 1RIIA 3K0FB 3KC2A 1QH8A 3FUCA 2IHYA 2K47A 3JXEA 3V1TC 2EVWX 4XZ3A 4DSOA 4DT1B 4Q05A 4DDKA 4RY0A 3T6PA 3Q8WA 2I0FA 2JLCA 4LE1A 2H3HA 2G9RA 5ER9A 3HJUA 3F7TA 1RAAA 2VKTA 2YN4A 2VUTA 2Q41A 3L0CA 4YT5A 4MYUA 3JZMA 1EWQA 2ZT7A 4HLQB 2ZWVA 2WNSA 4H4CA 5K4HA 2YHIB 3ZV4A 1Y98A 4PQGA 4GPBA 4MCIA 2LCQA 5ICFA 4JHLA 1VLJA 1FDRA 2ZI5A 3TZQA 4BUCA 1KEVA 4QLAA 4OIMA 3IHKA 3OX1A 3LQ1A 1XLWA 5AOVA 1Y7TA 1EE8A 4ZU3A 2V74B 1TRKA 2J3EA 4FK8A 1A82A 4JL8A 5AM4A 4EY8A 1F7VA 3QXGA 4YUZA 1TM4E 4ZANA 3BXHA 1DKOA 4EITA 4QODA 1UFQA 1W52X 3B85A 3D7LA 3SPXA 4U8HA 1ZOIA 5K0GA 2AH5A 2D06A 3JYHA 4EHDA 3GQ4A 1OU0A 5K03A 1NNUA 1I6LA 2KHZA 1QC5A 2W6ID 2X0DA 3KVVA 1XZBA 5CYGA 4NCNA 2WMNB 1BXGA 4B17A 4E46A 3H7IA 5HKBA 2LUOA 3KFUG 5LJLA 1AZWA 1E5TA 4B8YA 4N8SA 1UDCA 3HZZA 1VLMA 1GQQA 4FONA 3G9QA 3TRIA 2JIBA 2Z9DA 4HNVA 2DLNA 3SG0A 3QUAA 3MTQA 1YR9A 5FV4A 1NHWA 3MTEA 4M7RA 2C5HA 4JLWA 5LCXA 3T9DA 1RQLA 2IQIA 3TNFA 4MYDA 3P2YA 4F46A 4NXNB 4QT0A 3MQ4A 4HQ0A 1P7ZA 3U7IA 2DHYA 3M6UA 4YP6A 1TT7A 2A33A 5AXBA 3T38A 3DBVO 4ED9A 1XDGA 1YAJA 4TZ0A 4IF6A 4M55A 3TQHA 3KTAA 1MV8A 4PGHA 2NZJA 4EPVA 3ELDA 1MZVA 5FUYA 2WTBA 1G7TA 3WY9A 3T3PB 4B48A 3NEAA 4Q47A 3PGLA 5KZMB 3I9NA 4X54A 1QOPB 4GBJA 2BJWA 2GSDA 2PUBA 3EHEA 2JDID 4M87A 4RQUA 4JOSA 3ROEA 1Q21A 4R7GA 3AW9A 1DAMA 4ND8A 4WKBA 1JSZA 3JQAD 4LNHA 2OORA 2NZYA 3RAPR 3COSA 3OOYA 4YRFA 3IKVA 1IN8A 3I9V6 4ZRDA 4MEJA 2R8OA 1GUDA 4EJSC 3QNUA 1AHIA 1P7CA 2FUKA 4R8MA 1VYVA 2N1BA 2MOKA 1ZK2A 2OXFA 1JV2B 3GJRA 4DR1B 4YMUA 3FDZA 1R15A 2WU0A 3PGA1 2QRZA 5CTAA 1XTZA 5TE9A 4KXVA 1CY4A 1G3RA 3SF8B 3PUKA 4H08A 5AUOB 1RQGA 1B74A 2JB9A 1QYWA 1E9AA 2E9SA 2W6OA 3VDRA 4AMGA 4H7JA 1PJ8A 2C2XA 2ZSKA 4A0QA 4AY4A 1FP4A 2XZUA 3T1QA 2O0MA 3U44A 4EHAA 1NVMA 1GEGA 5HIIA 3DFIA 3KE9A 2IX9A 3R5TA 4NU6A 1X9IA 1VKHA 1Y6QA 3PYXA 1K9VF 4KLNA 3QW2A 4HZUB 2GBCA 3IDFA 4N0MA 1L8QA 4YV2A 3GLFA 3OZTA 1EVKA 2F6RA 5AD1A 4BO9A 5LP6F 4YT8A 4NSRA 5ECGC 2PA3A 2ZSBA 5DYGA 1TUEA 2VNKA 3C7DB 4DUZM 4PPGA 4LVNA 1ZONA 3TSZA 5DTRA 3AI3A 4M53A 4HX9A 2JEOA 3BBLA 4F45A 5EC8A 3GT4A 1YDEA 1SOVA 4FFLA 3M89A 1VJGA 1PL8A 1H2XA 2XMPA 4H0NA 3B89A 4MIEA 3IR6A 4UHFA 5AKGA 1SQ0A 4EGFA 4IDQA 4MPTA 3BCSA 3S5JA 4DRYA 3BOSA 3RC1A 4IDHA 1NMZA 1Q91A 4BMDA 2GK3A 3M81A 3A3PA 3EW7A 3RNOA 3WLOA 5FOTA 3UHAA 5FTWA 5EFZA 1TAGA 1XMQM 1B1AA 4ZTZB 4JD5A 3CKLA 2X2PA 4D3SA 5GJVC 5T41A 3UJ7A 2FETA 1J21A 3LRPA 3LWDA 4A0HA 4GLLA 3NTRA 3UHFA 4JLAA 4JSTA 1OXTA 1XL1A 4FHEA 4LHSA 1C14A 1H0SA 4EO9A 3BE5A 1E1DA 3AY0A 4J2TA 4WXMA 4RGYA 4L9RA 3N86A 3JARB 1LTMA