3U5ZB

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
b'SMITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 108
structure length 320
sequence length 320
chains with identical sequence C, D, E, L, M, N, O
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u5zB01
1N6LA 1E4YA 3IILA 3EPJA 3L0SA 3QOFA 5JZVA 4AG5A 3K09C 2IBMA 2QP3A 1G8GA 2FV8A 5EP1A 1HYQA 3HU1A 4H9GA 4ERNA 2XNDD 3G82C 5EE5B 3LQQA 2J3EA 3B1ZA 1XFAA 1JB1A 2ZRHA 4YLGA 2V1XA 1N6RA 1N5IA 3CRRA 1T5LA 2Z0MA 5A4JA 5G41A 3T5GA 4CT4B 2FPLA 2WWWA 2CHQA 2F1IA 1E9CA 4JMPA 4B71A 2ZI7A 1EFRA 2AD1A 2PL3A 3AVXA 1QG4A 1D2EA 3QF4B 1CJKC 1E1QA 2QQ0A 4AKEA 4W9MC 5DI9A 3ADKA 1JXMA 1HTWA 1OKKD 2QT1A 5LBIA 4P4TA 5FOWA 1NBMA 3BH6A 4TMZA 2NMVA 4Q1AA 5KNDA 3CW2A 2QP9X 5FPSA 2XXAA 4FWTA 1Q1BA 1N6PA 4ESVA 2PT5A 1KSHA 4QRHA 4TMVA 4C0LA 5AUQA 3ZGXA 1G5RA 5GJVC 1IN7A 2W2VA 2YWFA 4V0NA 3SJAA 2QBYA 3RVBA 3KQNA 3TW8B 2CMKA 2YC4C 4EJSB 3P26A 1XEWY 2ZS9A 2ODEA 1XU4A 5D3QA 4A0RA 5JCPA 5C46F 2QM7A 3TE6A 2QAGA 4LOAA 4BRUA 5L3QB 1ESNA 4MUAA 2IWHA 3OIVA 3K1JA 1KDOA 5JEDA 4CEJA 3GLIE 1XEFA 5CLQA 4PHFA 3T12A 4LYAA 3UPUA 2X2EA 2IHYA 5KDOA 4POAA 4BEJA 2FWRA 1LVGA 3AH8A 1COWA 1JECA 3BH7A 1HT1E 5JWHA 2O8BA 4K8OA 4XSGA 1VCNA 4WW0A 4AKGA 3NG1A 5A0FA 4D4KA 4KAXA 1QDEA 3DM9B 3KKMA 3UWOA 1SKQA 2QPOA 4URWR 4C2TA 4DLTA 3GJ8A 1EESA 2QNRA 3BFVA 1ZCAA 4PPQA 4B44A 1LF5A 2GVDC 4M1TA 4TTPA 5FOUA 5HPYB 2ZJ5A 4LHWA 2WWIA 4HUQB 3U4QB 4C30A 3KJIA 2A5FA 3BK7A 3U44A 3FE2A 1OB5A 1G8YA 2AWNA 4D0GA 5FH9A 4KBGA 5AJYA 1R7RA 4LPKA 3ZD6A 3LVQE 2MSDB 4Q7MB 5HE9A 1ZNZA 2VQSA 3K0AB 3TUZC 4TTRA 4DSNA 1IM2A 821PA 2ZJ8A 2F55A 4B32A 3G0HA 3W34A 1TUEA 3CX8A 2R6DA 4MITA 1QHYA 2P5SA 5HZHA 5KTYA 3NXSA 3OZXA 4TN1A 3W6PA 1CR1A 4NU0A 1M74A 1SVIA 2K5UA 3KJGA 2DFKB 4IDHA 4UXJA 4G0NA 4Q21A 1TL7C 3FPAA 2IS6A 3SNHA 3CZQA 2H7VA 1XJ0A 2REOA 5CK5A 3WXMA 1AKEA 4RFVA 5CB8A 3QY0A 5TV2A 1E69A 4UJ5A 1G9XA 1T0JB 3IEUA 1ZNXA 3GFTA 3HR7A 3KXKA 4BRWA 1BO6A 3KFVA 4JSTA 1R8SA 2QTHA 4JL5A 3VQTA 5F2EA 2O0KA 3L82B 2VO1A 1WBDA 1HY3A 2F7SA 3AP2A 3GLHB 1S1MA 1U0LA 3FHOA 5EZ6B 3QXCA 1GKUB 2YYZA 4DZZA 2QMUA 3CH5A 2QGZA 2CVHA 5FBLB 1UKEA 1IY0A 421PA 3R8FA 4K46A 3TK1A 3J81k 2DY1A 2GJAA 5FPYA 1Q57A 5AWFC 2GA8A 2WHXA 2FU5C 1DELA 3U6BA 5JS7A 2I3BA 3ZJYA 1NJGA 3M0EA 3GLGE 1GL7A 2C03A 4IFEA 4OI4A 4URZR 3CONA 4Q1EA 1VHTA 3IPYA 3K8YA 2NO7A 5J4YA 2J45A 1NLZA 1QF9A 1YR6A 2R6CA 2WJGA 2WWGA 4WZ6A 3P4XA 1T3HA 1RC8A 1KYIA 1NMXA 3GEHA 1DAFA 1N0VC 5CDFE 4AK9A 3MRSA 1KMQA 1XRJA 2VSXA 1UPTA 3F0TA 3W5IA 4IHQA 1GRNA 3QNUA 4M22A 4Q48A 2A5DA 1TQ2A 3IGFA 4RZ2A 2J0QA 1GOTA 1NN0A 1Z3IX 1ZM9A 3V9PA 2ZEJA 2W0MA 1N5LA 2N46A 3CWZA 1UKYA 3C5CA 2O8CB 2NOAA 2WPDA 4ARZA 1GG2A 1T8TA 3EPHA 2IYXA 2A78A 4LV6A 5L3VA 2FOLA 4DB2A 1K6MA 4DDVA 1P61B 4HZUA 2ECKA 3P32A 2X2FA 1GFIA 4TLEA 3T1TA 4O2LA 3B9PA 4HAXA 1A2KC 2BHRA 1QHIA 1US8A 2CK3D 2PZEA 3LX8A 1KI8A 4RD6A 5DGXA 4AIIA 2J5XA 4B2PA 4QM6A 3EZ7A 1W47A 4I1UA 4H1VA 3THOA 1QVAA 2ODBA 1J8MF 2G88A 2OE2A 1YZLA 2VHJA 3O47A 4TQ9A 1VYUA 4PAQA 4QNRA 1TMKA 3LQRA 4AYWA 1FP7A 1RFLA 4TL8A 4Q01A 3QKRB 1E2NA 1SVSA 2Q9AA 3U3KA 3N2EA 4HLUC 1XD9A 3W3AA 4TQAA 3I1FA 4V0OA 2IC5A 2YOHA 2YOGA 3RSOA 3QEOA 5CJ2A 4XVUA 621PA 1Q21A 4LV5B 3Q8XB 3IPXA 5KPDA 4NZYA 1BKDR 4Q18A 2C98A 2GBLC 3B1VA 1E2GA 4PO8A 2XZPA 1FFHA 2FZLA 1FPMA 3CX7A 3ADBA 4ZCIA 3QJYA 3BXZA 3EX7C 1TTTA 2GWHA 1TPZA 4M1MA 221PA 3UG7A 4LBYA 3OIYA 4MGKR 4G5OA 2JGNA 4M1KA 2VP4A 2F43A 4FWGA 3E70C 4GPTA 2ZAOA 3Q7QA 4ILEA 1MKYA 4M21A 1NI3A 1OV4A 1G3MA 3GLFB 3KDSE 2WMOB 3WHKA 4RCZA 4JLBA 4BFXA 3RWOA 5HE8A 3CUEF 3UK6A 3AP1A 5CIQA 4Q7KA 4RZUA 4M9SA 3TR5A 3GD7A 2DFTA 1A7JA 4RCYA 1U9IA 4PPFA 2H8KA 1V5WA 3HU2A 5EXTA 1Z29A 1NBMD 4OJQA 4PHTA 2R6GA 4BLQA 5LD2B 4YDHB 2GF9A 4RVCA 1G7TA 4WIAA 5HR5A 1AZTA 2N1BA 4HLDA 4LK2A 5AUPB 2E9SA 2UZ3A 3FWYA 1ZNWA 4MRNA 4JLPA 3CTDA 4LY6A 1UKVY 3MCAA 4NP6A 4WA7A 5K8TA 4TYNA 3PVSA 4CGZA 5J5CA 2P67A 3B1YA 3WMEA 2ZI3A 3P1JA 3IIMA 2Z5FA 1NVWQ 3PEUA 4BLOA 4QJ3A 2IEYA 1Q0UA 1OH8A 2DVWB 5HCNA 2YOFA 2QE7A 3KTAA 2FN4A 4A8JB 1PZNA 4CW7A 1II9A 2IYLD 1UM8A 3PV0A 1YZGA 2JEOA 1DG3A 1PLKA 4HB0A 1ZM3A 4LI0A 1YZUA 1U8ZA 1XMJA 1AS2A 5IRCD 1FOEB 4QJ4A 1COWD 4RKEA 3LW8A 3A8TA 4HI0E 4RZXA 4B3FX 5FFMA 2JJ1A 3G5UA 4GOXA 4OBEA 2Q9CA 4FMCF 3RWMB 2CJWA 2HXSA 2EYQA 1KMHA 2V54A 3MFYA 4JN6A 3RRNA 2FZ4A 4YXWD 1DTSA 1JXOA 2NQ2C 1E2DA 5HKKD 4KI0A 2CLDX 3A6PC 1F2TB 2ZRFA 4LSGA 2B92A 4GMDA 1MO6A 3L0OA 3T34A 4OJKA 2EFEB 2J7PA 4JLAA 1G4AE 3LVRE 2YINC 2REXB 1ZW6A 2F3TA 3HYRA 3L0PA 4GNKA 1KI1A 3TAUA 5SZKB 4A6PA 1XXHB 3A58B 4FXPA 5DE3A 1MOZA 4AG6A 2FSFA 3KQUA 2IL1A 1BIFA 4I99A 1GILA 1N0UA 1RJ9B 1YZTA 1RRCA 3VX4A 1G3UA 4EPYA 4I1SA 4U02A 2IS2A 3AVUA 2D74A 2G0TA 2G6BA 1AGPA 4NCKA 1ZYUA 4Q4AA 4CEIA 2G9NA 3R7WB 2VL7A 4KFSA 1G291 4ZI2A 1J8YF 4UKDA 3NIBA 4DLSA 3KKPA 3CO5A 1GAJA 3NKVA 2IYWA 4GP7A 3IHWA 4N3NA 2GVZC 1G64A 1E2PA 4NTZA 3TIFA 1NNEA 3X1ZA 2J7KA 2HCBA 2P6NA 5DHAA 2JATA 3KJHA 2ZE8A 3NBFA 2YJTD 1OXXK 4JKYA 4A2WA 1CJUC 3A4MA 4Q1DA 2FE4A 5FUWA 5AJVB 2PH1A 4CEHB 1Q3TA 1VECA 3CF6R 1ELOA 1OH5A 1VCIA 2IYRA 2NO6A 2CE2X 3B60A 4HDCA 2YZ2A 4IRUB 1TU4A 3AQ4A 4YMUA 1N6OA 5G53C 1OT3A 4A0GA 1SXJC 2WIBA 1AKYA 2AFHE 2FFBA 1KKLA 3IIJA 5K8UA 2R44A 1RYHA 1W4CA 3QKUA 2QMOA 5LB2A 3D6TB 2IWRA 4PPNA 4V0KA 2BMEA 2MSCB 2RHMA 2HF8A 1H8HA 3TSWA 2P6UA 2WWXA 4RD0A 4OQLA 2KWIA 4X8MA 5JECA 2ZRDA 3H86A 1DEKA 4LJAA 1XD2B 1F5NA 3FMPB 2BMFA 1Z28A 2W0SA 3PEWA 2GJ8A 5FPTA 3ZVLA 4DCNA 2CLSA 1G19A 4NCIA 1SVKA 1S3SA 2PX0A 3BAFA 1L2TA 4TT3A 4BZXA 3THYB 4OQMA 3GP8A 3VR4A 2QT0A 2Z4RA 2HV8A 2V9PA 3BGWA 1OJLA 1R10A 1AS3A 3IO5A 4JS0A 3QF4A 1XZPA 2RGXA 2WZQA 2HYIC 1W44A 1XBTA 3WHLA 2EW1A 1M2OB 3CM0A 1CS4C 2ANCA 3W6NA 4II7A 2H92A 3HJNA 2QRNA 2OESA 2OSBA 3RS0A 3MJRA 1G4UR 4TL6A 2F6RA 1SXJE 2WJJA 1X37A 3NDPA 4JJZA 3B2EA 2ZU6A 4BLRA 2AK2A 4MRRA 1ZUNB 4QJ5A 1C1KA 5DIFA 2ZJBA 1E0KA 2PEZA 5JLJA 4EJSA 5J40A 1Z6TA 4IVPA 3W90A 1IAQA 4GFDA 4UNNA 3SN6A 2GAAA 3LLUA 4ZI3A 2ZE6A 1KI9A 1BH2A 5AK0A 5L3QA 1P62B 2F1RA 1YJ5A 3AVTA 4PZZA 3CX6A 5DYIA 3TRFA 3BD9A 3SQWA 2QU8A 1TUIA 2JDID 2JLQA 1YHNA 2JAQA 4NONA 2G1KA 1JR6A 3REGA 2IS1A 2CL7X 4BLPA 2IT1A 4D0LB 2QAGC 1SQ5A 4NYJQ 1Q1ZA 3ETLA 4JVNA 5LDDC 5P21A 5IHPA 1BMFD 2RKOA 1XTSA 2QY9A 2IA5A 1UBCA 5FPKA 4QC2A 1U0JA 3SI7A 2PZFA 3U4QA 1G5TA 4MKFA 3AP3A 4HB4A 4NYJR 1WBBA 3O8DA 3TW4A 1Z5ZA 3BIFA 5LPNA 3AVVA 2O0JA 3SHWA 2BBOA 2DWQA 2VP2A 3IUYA 3PJRA 1G17A 3K0AA 3UIEA 4O25A 2OAP1 4GI7A 5G40A 2ORWA 1ZU4A 3EPLA 1KTVA 4CYMA 1ONBA 2EFHB 1CXZA 4K81B 3CRMA 4V03A 4R98A 1E9RA 4A2PA 1EXMA 3P20A 1FZQA 5JWRA 2PBRA 2GZDA 2Q3MA 4IXNA 1KI7A 4QBHA 5CJPA 5FR2A 2FPMA 3FFAA 2VSFA 1DG1G 4FINA 4MKIA 3VR1A 1HV8A 3SJCA 2XZLA 3BERA 4Q5IA 5G3ZA 2J9RA 1XJQA 1OB2A 2O8DB 4I4LA 1Q3HA 1GL6A 2BKEA 2RGCA 3AKCA 1XP8A 4Q7JB 1W36D 1OIVA 2F9LA 3OEHA 1S3GA 4Z8YA 1G6OA 2W00A 2HJVA 2GCOB 3UXMA 2JJ1D 3AKYA 2J87A 2JLVA 4Q9JA 3GLHA 2ONKA 1KNQA 2BKUA 2DBYA 1ZD9A 1O3YA 1T9HA 1TEVA 4NPHA 1IQPA 2V6JA 2ZYVX 3RAPR 2G83A 1VCOA 2D62A 4V0LA 2V3CC 2BBTA 2G1JA 5FUYA 1WQ1R 2RGGA 1H8EA 2B21A 4XWOA 5BN5A 2J7PD 2ZRGA 3I32A 5FBRB 4GMXA 3GLGB 3SJBA 3CR7A 1E2EA 2VIIA 2IYSA 1OXVA 4C0JA 1E6CA 5KO2A 1GIAA 4FCTA 1P72A 3EARA 2VHTA 1N6KA 2OCAA 3FDIA 3ICQB 3B78A 1OF1A 4KLNA 2D2FA 1IJEA 5B58C 2WMNB 2GAOA 4RY2A 4ZPXA 3N2IA 5J4HA 1W7AA 3FHTA 1P2TA 1PUIA 4O0MA 1XCPA 2ZSFA 2PJZA 1E96A 4B33A 1Z6GA 3LA6A 4JLVA 1UBEA 2PX3A 5C18A 1YR7A 3IEVA 3R9IA 2UZIR 2YWHA 3TMKA 3EZ9A 3AF2A 2XTMA 5KDDA 1FQJA 2WKRA 3RS4A 2O8CA 4HAUA 4BPBA 2YV5A 1G1MA 1C1YA 1EFTA 4L4UA 1AS0A 2ZANA 2RGNA 2WICA 3QUSA 4Q03A 2CK3A 1D2MA 4OQNA 5FOVA 5KUTA 4KYUA 4YC7A 3CLVA 2QP4A 3K70B 1NY5A 1EFUA 2I1VB 1DO2A 4JYBA 1YE8A 3RYTC 4ZV4A 2OBNA 3FVQA 2QG6A 2ZS8A 4DSTA 2FGJA 5K8LA 3QXXA 4QHYA 5L3RA 4MKHA 3LV8A 1PUJA 2FSIA 4E5UA 2OAQ1 1G7CA 4JBXA 3OFND 1U0HC 4P0TA 4LC0A 1CR0A 2LKCA 1G7SA 3GJ4A 2JLUA 4LJ5A 2GCPA 3QKRA 4B6EA 1KOFA 2RAPA 2GEUA 4DRZA 4ZDJA 1AQUA 5IDVA 5KOYA 2OFWA 2ORVA 2VTKA 4QM7A 4CVNA 4PC6A 4M2LA 4LJ9A 2C04A 1H8HD 1BOFA 3I61A 1E3MA 3K0CA 2REBA 1GTVA 2CEAA 2VH5R 3JZAA 1JI0A 1XF9A 5FUVA 2AN9A 2XEXA 2FSGA 2L0XA 1IXRC 4JSYA 1A2BA 4F91B 2UVQA 4A1FA 1XMVA 3LXRA 1CRPA 1R4AA 3EIHA 1UDXA 2J0UB 1NKSA 4TT3D 4AY2A 2OFXA 2C8VA 1Q1QA 4A2QA 4OQFA 1XCMA 3TR0A 3EXAA 3GLFA 3CRQA 1MO4A 1ANKA 2WSMA 4JLKA 3ZQ6A 1Q12A 1LS1A 4JIMA 1VTKA 4OK3A 3W6OA 1NY6A 1UADA 4BWYA 3F8TA 2NZJA 2J0SA 4IJMA 4PANA 2XTNA 2JJ2A 3PUVA 2D7CA 4ZCMA 4C4PA 4NCHA 2GESA 3QE0A 3TVTA 1E9SA 2R2AA 4U00A 2R8RA 4M1OA 2FMXA 4FW9A 4GBMA 4DC9A 2WTUA 4FMCB 1E9EA 1M7GA 4TLBA 4IFBA 3EA0A 4G5GA 1ZINA 3B85A 2ZYTX 3QI2A 5KSPA 4M1WA 2GEDA 4FCWA 4LWZA 2QPTA 1T91A 2D4HA 4PQYA 4BUJA 1AJEA 2BM1A 3UATA 3H4MA 1IHUA 5AJXA 4RD3A 5EE9A 4EPRA 3ZLJA 1YQTA 2H57A 1XEXB 2V4ZA 3Q3JB 3X1WA 3SU8A 3T1QA 5FTNA 1GITA 1ZVQA 4JKIA 3ZVNA 2V7QA 1P75A 1PLLA 2BC9A 2ZI9A 4M9ZA 4F7WA 3CIOA 4YXWA 2RB4A 3B6EA 4ACBA 4MYTA 4ZO4A 4DLRA 1E2FA 3EWAA 2QAJA 4X8OA 3BB3A 1N3BA 3BH0A 4Q02A 5HKKA 1AM4D 1YRBA 1Z8FA 3RRMA 4GRAA 4Z54A 3LFUA 3LWNA 2ASEA 4U7DA 1VDZA 3EG5A 3EIEA 1TX4B 1WA5A 3QXSA 1W36C 2GKSA 1F2TA 4LUCA 4DEYA 2E1RA 4BEBA 2JLZA 1W2HA 2ZETA 4YMSA 1EWRA 4URYR 4LRSA 5TY0A 3TAHA 3AF0A 4WXRA 5BN3A 4F4JA 1G6HA 2OBMA 1UBGA 4TL7A 1XXHA 1P4SA 4FWIB 5BYKA 3CB4A 5B64A 2X19A 4MRPA 4IDOA 1KDPA 4N1AA 4LPSA 3FMOB 3JVVA 1XTQA 2DFNA 3I72A 1RJ9A 4JL8A 3ZYCA 1NVMA 4KXFB 1MT0A 4LC1A 1E1RD 5F3WB 4DCSA 4YMVA 2RHDA 1R0ZA 3R7WA 2ZJAA 3CKLA 1JQLB 4DCUA 3DZDA 2IYVA 3CPJB 3R9XA 4P3YA 1IY2A 1X8KA 4Q9IA 2V6ZM 5BQ5A 2ZUCA 5L3SB 3ZS8A 3JZMA 3OEHD 1P73A 4JVLA 1WF3A 3SOPA 4B3CA 4IXMA 4IDNA 1XTJA 4HB3A 5H8WA 3FMFA 2OUKA 3BORA 1M1YE 4PO9A 2A7QA 3THWB 2BOVA 4ZDWA 1LW7A 4MA4A 2DWOA 2CCJA 2BJVA 4CEHA 1KO4A 5IF9A 4BLSA 2OLKA 1KK2A 4LCBA 1P9WA 3RLFA 3FMIA 4B76A 3S1AB 1H8ED 2MSEB 4EPXA 4QGAA 1GSIA 4KODA 4R71A 1XPOA 1KJYA 4O3MA 3OEEA 2H1LA 2OZEA 1JNYA 4NH0A 4C0AC 3CF2A 3WNBA 3H84A 3RC3A 4XD7D 4M0LA 2HLDA 4P32A 3K9NA 2CXXA 2A5GA 2C9CA 4FCVA 3QXJA 1QHHB 2B8WA 1RRFA 3EZ2A 3GFPA 4JLDA 1JR3A 3B1XA 521PA 4CDGA 2JIZA 1J99A 4E03A 2ZI6A 2DHRA 4QGFA 2IYZA 1NVXQ 1XD2A 3PENA 1BS1A 4LYHA 2KBFA 2NIPA 1EFHA 1F60A 3PUZA 5GVSA 4PAMA 3LLMA 2WOOA 2GTPA 2J0VA 1W1WA 4DUGD 3VX3A 1OXSC 4MUBA 2OCYC 2ZVPX 3THYA 3IO3A 3DZ8A 1G8PA 2A30A 3KZ1E 2ATVA 1P2UA 5FTJA 2EFDB 3AKDA 1Z6YA 3GJ3A 2KBEA 5GJWC 1UAAA 1R8QA 1D6JA 3BRWD 4QGGA 3R8CA 1G21E 2FFQA 4NDZA 3P4YA 2GJ9A 4QBGB 3KB1A 3DDCA 1RIFA 4HAZA 5TMPA 1SXJB 1RW4A 2XGJA 1OYWA 3FOZA 2NG1A 3B9QA 3T35A 2VHUA 2BBSA 3WMGA 3SZRA 3SYNA 1RRPA 3HDTA 3AM1A 1CR4A 1Z63A 1R6BX 3KX2A 2ZRCA 2A9KA 1KI6B 2Q9BA 2GK7A 2PMKA 3A1UA 4P4UA 5CB6A 3TKLA 1TU3A 5CIWA 721PA 4OHXA 3TBKA 3VNVA 3T5DA 1C4OA 2JA1A 1K8RA 3ZZUA 2P2LA 1DADA 4YQFA 1I4LD 2R62A 2ZI5A 1Z6XA 3HWSA 3HPRA 2Z43A 3ASZA 4P4SA 4IW3B 2JDIA 3U7EB 1QHNA 3RS5A 3ZZTA 5KHOC 2ZR0A 2ANBA 1DAHA 2WWYA 1NG9A 4S2EA 2KSQA 3KFXA 5EE0A 4EJSC 5EE1A 4WAUA 3LBHA 1DO0A 5HCIA 4EQ6A 2YKGA 3VR2A 3TSZA 3B7GA 1BMFA 3MWJA 3ZD7A 1E2IA 5GVRA 1QHGA 4E22A 4IDPA 1PLJA 2JLSA 3RDPA 1D2NA 1W46A 4KSCA 2O8EB 5EP4A 2NO1A 1E98A 1OFIA 1I4DD 5SZJA 4DDUA 3LD9A 3MUFA 3JVUA 1OIXA 3ECCA 3KKOA 3P27A 4B74A 1MABB 2JJ2D 4G5SA 2QGNA 1JJ7A 4DIDA 1E0SA 2CDNA 1GP2A 3MSXA 2EFCB 3SBDA 4Q4HB 4B75A 1CJTC 4EPVA 3AF1A 3A1TA 1L8QA 1R5OA 5FI0B 4F92B 1F6BA 3C16C 3E1SA 4GOJA 4M1SA 3HPQA 2PJRA 4OHWA 2AXNA 1FNMA 3FKSD 1NG1A 1BYUA 4L9WA 1M6NA 4B3DA 1CR2A 5FOXA 2IF2A 3CRVA 1Z08A 4FWDA 1XWIA 1JEDA 4DLWA 4F38A 2C95A 1NSTA 4KFUA 1IN4A 1ETUA 3MGCA 2NZ8A 2O8DA 2RGDA 2W6IA 4D82A 4KCGA 2QAGB 4NYMR 3MG9A 5H1YA 1EG7A 2IYUA 2ZUBA 4PSAA 4DJTA 4QHTA 4PXAA 1XTRA 4L15A 1U90A 3AVPA 2GCOA 2V7QD 4MGIR 1HE1C 4MQBA 4CEJB 2GNOA 1NLYA 3PITA 4DXAA 4ZDKA 5AJZA 5A5GA 2WJVA 2PEYA 1ZM2A 3R20A 4A0HA 1E9BA 2WV9A 1XNJA 3BE4A 3Q9LA 1DARA 2QZ4A 3DM5A 4PQRA 4D0NA 5DH9A 1YVDA 3WBKA 2A5YB 2HYDA 2DZNB 1XTIA 2YWGA 4Q19A 1NMZA 3A1VA 3AUXA 4DLVA 4EAQA 1D9XA 2CBZA 1CJVC 4JLJA 3QPWA 3QVVA 3T06B 2B6HA 2GK6A 1BYIA 1N25A 1T5IA 2ZQ5A 1W4AA 3CNLA 3NWJA 1R0YA 1ZP6A 1K5GA 1IXZA 3GCGA 1W49A 2QL6A 5EZ5A 4ON9A 1E0JA 1IONA 3WP1B 4CF7A 2EFGA 4AD8A 1CLUA 2V1UA 1WXQA 3PUXA 4OI1A 4KLZA 3ADDA 3VR6A 2WJIA 4LHYA 2XOKA 3IBYA 2CE7A 4LRTA 1QHSA 2AKYA 3NH6A 3BFKA 3QBVA 2HT6A 3LH5A 1J2JA 1NLFA 1OW3B 3FFBA 4MYUA 3NBXX 1W0KD 3I8SA 2W58A 5EXXA 4LV8B 3SDZA 3WNDA 3NHAA 2O52A 1TF7A 3GJXC 5FBQB 1VPLA 5CM9C 4JJKA 5EUQB 3OFNA 2FEOA 1QZXA 1RKBA 3PG5A 2IX3A 3QF7A 4UNRA 1NF3A 5FOTA 3AVYA 4OHZA 2RGNC 3OEED 2BJWA 3B5JA 3LDAA 5DI3B 1VG8A 4Q66C 2HLDD 1XX6A 4UJ3A 1CKEA 2VLIA 1KGDA 4FMDB 2DB3A 1JR3D 1JAHA 3T1VA 2JIZD 1OSNA 5GJBA 2GJKA 3EWSA 3A37A 4BASA 3HU3A 2JLRA 1AZSC 2P0EA 4OKSA 2G0NA 4AYTA 1E79A 1KSJA 1VYTA 5J4LA 4RD1A 1KIMA 4Q9HA 4NCNA 5J47A 2GF0A 3AEZA 2VEDA 3L0IB 3C41J 2C9OA 1S8FA 1OPXA 5EP3A 1E0AA 1NIPA 4HDOB 2AK3A 3BJIC 2J0UA 4MDEA 5B2ZA 2QW6A 3RS2A 2AKAB 3B1WA 3OAAA 3ZQJA 3K0CC 4Q1BA 1CF4A 1KI4A 3VMFA 2PCLA 3AV0B 1TF2A 2W2TA 4XH9B 1Z2CA 2ERXA 4WZAE 4D80A 1T4GA 5DLQC 2C96A 3CNNA 4GITA 1KY3A 2FSHA 1ZMXA 4MRVA 1CIPA 1UFQA 4W5HA 1Q44A 4DDWA 4P31A 3QIAA 4YDSA 3ZH9B 3B82A 3U3MA 4Q9KA 3U3OA 3KL4A 4FD2A 4QXAA 2V8OA 3I62A 2H5EA 4HLUA 1E2QA 1GUAA 1ZM4A 3FKQA 5GJCA 4EPTA 2EYUA 4KSBA 1ZUHA 1MO3A 5E4FA 3KXLA 3K53A 2GXSA 2OEPA 4LDJA 4L16A 3R9WA 2QPAA 2AL7A 1NRJB 4TMXA 1RZ3A 5JCZA 5LD2C 1MV5A 3SYKA 3GLIB 1ZD8A 3EZ6A 1VKJA 1GWNA 1KO8A 3GPLA 2LCFA 1IN6A 4C0BA 1ZJ6A 1KHTA 1LFDB 4AKHA 4L5BA 3EA5A 2KJQA 1UDWA 3FYHA 5AUNB 2P3SA 4EFLA 1MRSA 2VRWA 5DO9A 2UKDA 5UKDA 3V00A 1U94A 4B47A 4KJZA 3GEEA 2FGKA 1IXSB 2R65A 1XEXA 4OHVA 1IBRA 4IEIA 3SBEA 2NGRA 5C1BA 1FTNA 2ZYWX 2PLFA 4RFSB 4C0KA 5JRZA 1DAMA 1DAIA 3NTUA 4LRWA 4NCJA 4HUQA 1WP9A 3PXGA 2IYQA 4I81A 2F43B 5BXQC 3VKGA 2IUSA 1RYFA 5FI1B 5FTLA 5CITA 2KB0A 4TLDA 4XJXA 4B48A 4TLCA 2FFHA 3QQ5A 5E7IA 4GT1A 1Z0IA 1ZC4A 2P65A 2VSOA 3SS8A 1Z0DA 1R5NA 3GLFE 1Z06A 3MLEA 4JLNA 2GZAA 2IHBA 2TMKA 3CPEA 1JPNA 1NBME 4NBSA 3I92A 2XB4A 2BDTA 4RD4A 1VMAA 1FUKA 2OXCA 4XTCS 1U99A 4GZLA 2QSZA 3KXIA 1N0WA 4LJ4A 1E1RA 1RRGA 3K9LA 3EIQA 3VU9B 1KJWA 2SHKA 2IXFA 4Q9LA 4PTLA 4PR0A 4XVRA 3I5XA 2O8FB 2QMEA 3UMRA 4AWXA 4C2UA 4GOKA 2F3RA 5E7JA 4AKIA 4B34A 2ZXUA 4I1OA 1FX0B 1X8LA 3E5HA 3KTAB 1EK0A 4A6XA 2Q6TA 2ZJOA 3D7MA 2W6ID 5C4GB 3U7GA 1OH7A 1FUUA 1P2SA 1NVVQ 4P33A 5L3SA 1AGRA 1DS6A 4XOIA 1OXUA 2OCBA 4US0R 3RSLA 1WDTA 2QEQA 1KO1A 2YWEA 5BWMA 3L8ZA 4PFSA 5JHGB 3ZDQA 2FX3A 1WE2A 4RZ3A 2ZUDA 2OM2A 2BIFA 1NVVR 3B8HA 3THWA 2OV2A 4DCTA 1UBFA 1NN5A 3MWYW 4DIEA 2BEKA 1G3RA 1D5CA 2CJWB 2HCJB 4V02A 4YMWA 3WBJA 2N42A 4GP6A 4A82A 4Q00A 3RNLA 3ADCA 1YZNA 3CZPA 3FHCB 5FTKA 2J59A 3BB4A 3S1AA 4GL2A 3KB2A 4XD7A 1CRQA 4JYCA 4DLXA 4MYCA 1E9FA 1ESMA 3GMTA 3EASA 3GJ7A 4TQUS 2AHOA 4E07A 3EZFA 4BZPA 1SVWA 1NP6A 2ZM5A 3DOEA 1NJFA 1SZPA 4FN5A 1QHHA 4LHXA 2VP6A 1TF5A 3OIUA 4CT5A 3OE7A 3U2QA 1YR8A 2BEJA 1JBKA 2B8TA 1FW6A 2XZOA 1X6VA 4HYYA 4LJYA 1Z0FA 2VA8A 2IS4A 2ZYUX 1XXHE 4DUGA 3H1TA 1CULC 5D3MB 4S35A 2IK8A 3PIRA 5IT5A 1HA3A 2JLXA 4L9SA 1U2RA 4OK5A 1P2VA 1SGWA 2ZR7A 3BFXA 4I1VA 3THXB 2J1LA 3AF4A 1FMLA 2XOKD 2HT1A 2W2XA 4Y0VA 5EXPA 2OG2A 4XSHA 3RANA 2QRZA 3U60B 4A4DA 4WZBE 4UNQA 1OYYA 2X1VA 1Z6AA 5KSZA 2LWIA 4PC3A 1IN8A 3GEIA 1DBSA 2FPKA 2ZRIA 3D8BA 3M1IA 4OL0A 3K70D 1SXJA 4IOKA 4QHSA 1X8JA 2Q0HA 2QN6A 2F1JA 4AI6A 3NEYA 5KNCA 2V55B 4BZQA 4DWJA 1Y3AA 3CBQA 1KSGA 4US2R 1EWQA 1KI6A 1M7BA 4UXHA 2Q3FA 1XZQA 3DMDA 4Z1MD 4EKDA 2Q3HA 1KAGA 4TL9A 4M4SA 3WYGA 3ZZ0A 2XJ9A 4NHOA 4A0FA 1NN3A 4BFVA 2DZOB 4V0MA 2F9MA 4JLMA 5SZIA 1PJRA 3X1XA 3A1SA 4JZKA 3WRYC 4QKQA 1JAIA 2WVJA 3WMFA 2R9VA 4IOJA 2R9GA 1XJCA 4M1YA 3AVOA 2GJSA 2VF7A 3Q72A 1ZAKA 3RRYA 2FA9A 3IQXA 1E79D 4LBZA 5BW8A 1CBUA 1F2UB 3TJZA 1Z0KA 3U3RA 3AF3A 1F3OA 1JR3E 4OI0A 2VP9A 4QL3A 4ZCLA 1E9AA 2IXEA 3QVUA 4TMWA 4XTRA 1IOZA 2XITA 4BFUA 4FMDF 3OAAD 4A9AA 1GL9B 2OO7A 3BC1A 3E2IA 1XEWX 3QSYA 5M04A 1NL3A 1VG9B 4AYXA 1FQKA 4MRSA 2ZRPA 1QZMA 1VG0B 2O8EA 2BV3A 5TARA 5LB4A 2Z4SA 1DAGA 1W4RA 1MR3F 1E99A 3PUWA 2DFLA 3SQXA 2WSSA 2DR3A 3TSOA 4CIDA 1MABA 1YRAA 3ZVRA 4KV9A 1Q1EA 2DPXA 3MJHA 3DMNA 1SVOA 2IUUA 4BFTA 3QEJA 4TMKA 2CHGA 3MMPA 4DLYA 2OILA 1YZKA 3NEJA 4Q4HA 3FKSA 1E94E 1I2DA 1U9IC 2O0HA 2ZRJA 4ASUD 5EJEA 1IJFA 2ZRLA 3LRPA 4A8JA 1N2CE 4HLQB 2WWFA 1AIPA 2QQEA 1VIAA 4BFWA 1SKYE 1GNPA 2RCNA 4NYIQ 2VHQA 2ZAMA 2GXAA 1Z22A 1KO5A 1S1CA 1S2MA 1O87A 3HP1A 1TEXA 5EXSA 2AX4A 2BMDA 2DWZB 4M9QA 5C2JB 2EQBA 4NYIR 2VP5A 3GQBA 3NBYC 3HR8A 3EAQA 4LGMA 4C3ZA 1ZRHA 3K0SA 4C7OB 1Z83A 1JEEA 1XDBA 1HEIA 2CVFA 1J7KA 1DE0A 3BB1A 3I3SR 3LO5A 4QG7A 1LTQA 4B2IA 4LZZA 2Y8EA 2PT7A 5JSZB 3A4LA 3QKTA 4LX0A 1AN0A 2ZRNA 3Q5DA 3WYAA 3ND8A 4O2RA 2VYFA 2YHSA 1OE0A 2EWWA 3ICEA 4B43A 1ZIOA 3NVAA 4HEJA 1T3SA 2NO0A 4Q4JB 1P9RA 2H17A 3QKSB 2LKDA 3KKNA 4GSYA 4D26A 1TNDA 2ZS7A 3T61A 1KI3A 2DCUA 4B3XA 5BN4A 1E9DA 1HQYE 2CCKA 2VBCA 3VKWA 3BOSA 3AGPA 2ZU0C 2QM8A 3U61B 4PC7A 2Z6VA 2P5TB 1DAEA 2HUPA 2ZR9A 2AFIE 2WAYA 1XPUA 5DN6A 4BECA 1II8B 1X1SA 1G7RA 1Q20A 2XSZA 3I5YA 3TLXA 1Z0JA 4URVR 5JMTA 2XB2A 2QUZA 2QTVB 1N5KA 4CZ2A 1W5TA 3TUIC 4PSKA 5EUMA 2HF9A 4JT2A 1S0UA 4D81A 3VKHA 4ACAA 3LXXA 1IY1A 5KPJA 1OHHA 4PX9A 2FFAA 1XB2A 1X3SA 1W48A 4JT4A 1NSFA 3PUYA 4DLZA 4US1R 1W0KA 2J41A 2GCNA 5JBQA 2C2HA 1I4TD 1L4UA 1DOAA 5FOSA 1Z0AA 2HJGA 2I4IA 2WJYA 4DHEA 2BWJA 4TSFA 2H16A 2CHVA 2RGBA 1JJVA 5JJKA 2BM0A 3REFA 2XTZA 4ESHA 5E3HA 2G77B 5E95A 5SZHB 1GNQA 1WRBA 2ZTSA 3GJ0A 2KI5A 4M53A 4U5XA 4BQSA 4CRWB 3EW9A 5FUXA 1S96A 4ZIRB 1G5PA 1VG1A 4HZIA 4TZ6A 1QG2A 2GXUA 3NDBB 3KQHA 2NO9A 2F1HA 6Q21A 1SHZA 5IK2D 3IQWA 2ODWA 5F98A 3K0EA 3N5CA 1XTKA 4KYIB 4TTQA 4BFZA 3BWDD 2CLCX 5DI3A 2HEIA 4QFMA 2Q21A 2C9YA 3QG1A 3O8CA 3K70C 2C78A 3CWQA 2XJ4A 1OIWA 1W0JD 1VYVA 5FL3A 3K0FB 2D7DA 3OE7D 5FL7D 1EFCA 3AB3A 2IF0A 3NC0C 4AC9A 3QPUA 4MGYR 3Q7PA 1ZBDA 2BMJA 2ZITA 2AWOA 4Y0AA 1A1VA 4LYFA 3TNFA 4XIGS 2RMKA 1HURA 2I1QA 2JCSA 2ZROA 4DEXA 2QMHA 2BCJQ 3D31A 4KFRA 3VHXA 3MWLA 4D2IA 3UMFA 1NIJA 1Z07A 1SHKA 3SYLA 1U8AA 5HZKA 3M6AA 1R5BA 3OESA 2WJHA 4WVFA 3T1OA 2OT3B 3QENA 2Z83A 5GADl 3EPKA 2W6JA 1GKIA 2PLRA 2B7BA 5FTMA 1R2QA 1N6NA 1Y63A 4AURA 5DHFA 5FBVB 3DL0A 1SXJD 2VPPA 2B7CA 4FIDA 4HSEA 3K09A 4OK6A 1UEJA 1LF0A 1P9NA 3MHVC 4KITB 1D8TA 1KNXA 2ZRBA 4Q47A 5FBWB 1P3JA 3BGEA 4DT1B 4WBSA 2BBWA 3ZVMA 4KVGA 3HYTA 1WB9A 1OFHA 3O8BA 4PZLA 4YMTA 2FEMA 3W8RA 5CM8B 4IVQA 2VHCA 4M9XA 5J4VA 4LYJA 2EU8A 1QBKC 3PEYA 3GLIA 1JQJC 2OBLA 3CH4B 2MMGA 4XVQA 4LJ8A 4LJ7A 1NN1A 1EX7A 3U7FB 1E2JA 3BS4A 4PHHA 3V4RA 4C0HA 2ATXA 3LNCA 1GRRA 1VIYA 3DKVA 5K8IA 5KSYA 1U98A 1GVNB 4G5RA 1M8PA 5TDHA 1XPRA 4JLOA 3RS3A 5JHHB 5AUOB 1C9KA 2OLJA 2NPIA 3GJ6A 4R2HA 2G3YA 1SVMA 2FJUA 4PSVA 2KRKA 4RFSA 5KYKA 4JBYA 2IYYA 2ONJA 4F4IA 1FL9A 2BCGY 1DAKA 2ZIAA 3DPUA 4PPGA 4RKFA 4ABYA 1GKYA 3EC2A 5J4KA 4KU4A 4WOPA 2MMCA 4G01B 1Z47A 3WNCA 3LY5A 3SR0A 3ZS9A 2GHIA 1EFRD 4PC2A 3SEAA 2WSSD 3QXHA 5KSOA 1E1QD 3MAAC 1L4YA 4IKEA 4X8LA 3VHLB 2XXAB 3C5HA 3VR3A 2P6RA 1TQ4A 1NKTA 3DEFA 1HUQA 1G8HA 2WWHA 1EX6A 4NMMA 4NYMQ 2ZJZA 4QGHA 3WYFA 2QBYB 2R6AA 1AA9A 3UWKA 3C4JA 1JALA 1VCMA 3IBGA 2V6IA 3VU9A 3W8NA 4B73A 5JI2E 2O8FA 3UMSA 4IOLA 2ZE7A 3Q85A 3TQCA 2WKPA 4A92A 1E2HA 4HB2A 4OQXA 3WY9A 2PZGA 4ZDIA 1A5TA 4IEEA 4QBIA 2A3RA 1FX0A 2DYKA 2GETA 4NL4H 5CYOA 1LV7A 3V4FA 4EFMA 4B3GA 2JJ8A 3T15A 1D9ZA 5JS8A 3KQLA 3H2YA 1KDRA 4LHZA 4EIWA 4PHGA 4W5JA 4BFYA 3KUDA 1V43A 2O8BB 1J90A 1QRAA 4UQOA 3VLFB 1CU1A 3AJIB 5JJLA 4BGDA 3CPHA 5JJIA 1WCV1 1Z2AA 2QI9C 2J46A 2OCPA 2KE5A 1S9HA 4EUNA 4A36A 2IUTA 2ODNA 4FWHA 2X8AA 4D4MA 1YZQA 1P60A 1N6HA 1AQYA 1UF9A 3LW7A 3GLGA 3Q5EA 2ZREA 1GM5A 1XMIA 3U44B 3IIKA 2O5VA 5DSZA 4MH0R 4QOSA 4LBWA 1U81A 4X8HA 3VTKA 3QBTA 2WBLC 3FGNA 1W2GA 3MD0A 4TLAA 3RC8A 4D4JA 4TMTA 4Q7LA 2QROA 3A36A 5DISB 5CDFA 5F9FA 2D06A 3GFOA 1H65A 1UJ2A 1T6NA 3PCRB 2HDNB 5AJWA 3ZIAA 2NPFA 4WXPA 3I4LA 1UKZA 2VF8A 1HQCA 4J0QA 3ND9A 5DN6D 4DB4A 3AUYA 3MWKA 4G3XA 1M7HA 2XSZD 4QBFA 3C8UA 3LX5A 1MRNA 3SC3A 3U7HB 2FG5A 3LBIA 3B13B 2XAUA 2ZRMA 2CNWA 3W5JA 4EPWA 2RGEA 3OF5A 5JEEA 4KHZA 5D3MA 4JBWA 1FTSA 4R7ZA 3PFIA 1LB1B 1E32A 1KK3A 4IVRA 3CF0A 4BFSA 2RGAA 1ZU5A 1OHHD 3THXA 1FNNA 3RABA 4PQFA 1TADA 4FI3C 4LHVA 4EDHA 1OLOA 4TSFD 1ZC3A 2GILA 2ZJYA 2ORIA 4G5QA 4ZKEA 5HTKA 2AR7A 2GZHA 2ZSBA 3EC1A 5B57C 3RRZA 4TYPA 5KU1A 3GLHE 1CJMA 4DVGA 4OHYA 2WKQA 4EFNA 1T0HB 3K9HA 4Z1MA 1E2LA 2D3WA 2PMDA 3SFZA 1RPZA 2IXGA 2ZRAA 1A4RA 5JRJA 3L2OB 4URXR 5F9HA 4ZKDA 5BYJA 3WRXC 1KO7A 4URUR 1X1RA 3AVQA 4E09A 3F5FA 3K9GA 1G3IA 1S4QA 3PQCA 3L43A 1KY2A 1KZGB 1OFUX 1M34E 3CR8A 2WIAA 2XNSA 4L8GA 1I2MA 4MYHA 4UNPA 4DSUA 2C5LA 2IYTA 3FTQA 4HLCA 4JVSB 2XNDA 4KBFA 5C4MA 1E2KA 2XX3A 4NKRA 3TQFA 1F2UA 1JPJA 1SVLA 1ZNYA 4H1UA 5H68A 4B35A 4DCVA 3DO6A 5AR1A 1CEEA 1SULA 1GDDA 2A2ZA 4KFTA 3C14C 4HAVA 4XWKA 5ANRB 2DWPA 2OFOA 3D3QA 3NBZC 1R0XA 1W5SA 1VHLA 1TQDA 4JVMA 5L8VA 4W7SA 4ARZB 5CK4A 5TB5A 4C0SA 2AD5A 5FR1A 3CNOA 4G1UC 2W6JD 3SJZA 1GZSA 3UKDA 3VAAA 3KJEA 2WPDD 4HZUB 2X77A 3X2SA 1Q22A 1OKKA 3GJ5A 1US8B 4PC1A 4HDQB 4ASUA 4OI2A 1XCGB 1S9DA 3I8XA 4M8NE 1KKMA 4RJLA 3TH5A 1F48A 4A15A 2GBLA 1NVUQ 2QTFA 4RSGA 5DNYB 1MH1A 2CCGA 3AGQA 4DSOA 4JL6A 1E4VA 1SKYB 2OHFA 2WAXA 3AVWA 1LNZA 2WOJA 2HXYA 3X1DA 3TVDA 1OH6A 1RE0A 4PO1A 4D4LA 5TXGA 1P5ZB 1OFTA 1LS6A 4YONB 4TYQA 3SHFA 1YR9A 2GRJA 2ZRKA 2ZJ2A 4F4CA 4V0ME 1T8UA 5E7MA 2ERYA 4A8JC 2VP0A 4P4SB 4RD2A 5JI3E 3QPVA 4C7OA 1HH4A 4PZYA 3SFVA 1G18A 3N70A 3A4NA 5B30A 1KJZA 1U8YA 1ZIPA 3NH9A 4FMBB 5TVKA 1NMYA 1HT2E 3U3JA 3L8YA 5JFGA 5JSZA 3O8RA 2GXQA 4UXIA 4A3VB 4EQ6B 4Z51A 3UG6A 3KKQA 3AKEA 1A82A 1G41A 1XMSA 4LBVA 1QVRA 2GDJA 1YKSA 3LBNA 3U5ZB 2EWVA 3H0KA 4Q1CA 4Q4JA 1PVOA 3QKSA 1G20E 2D2EA 1N5JA 3W3ZB 4IDQA 2EVWX 3QG5A 3DHWC 2IEZA 3KQKA 1ZCBA 4TWZA 4UNSA 2JASA 2R6FA 2E87A 2YC2C 5DYGA 3OHMA 2ZSDA 3IDQA 3VR5A 2CL0X 3C7KA 2YVUA 2C77A 4HATA 2H18A 5EQTA 4PAOA 4MKGA 4DLUA 1YU9A 1ODFA 2QENA 1P6XA 121PA 1II8A 3NC1C 4W5WA 5JWOA 4XWAA 4TZ0A 3FB4A 3NHBA 2QORA 2JLWA 3IHLA 1RVDA 2FF7A 2W83A 1OXTA 1R0WA 2QE7D 1HE8B 1TAGA 3I73A 8OHMA 2RH5A 1CTQA 2YNMA 1GRQA 4B6FA 3M4YA 2ZSAA 5G3YA 2BVNA 1W36B 4TYWA 3TUJC 3BBPA 4HAYA 3DVLA 3ONWA 2AXPA 4D6PA 4MDFA 1KAOA 1KSFX 3X1YA 3KW6A 2NTYC 5KNBA 3DKPA 4Z8XA 5EP2A 2C99A 1KMHB 1KK1A 2ZE5A 1UEIA 1XD8A 2QA5A 1B0UA 2ZVQX 3DOFA 3W9YA 4B3BA 5IK2A 3CRW1 4ZIRA 1KK0A 1WMSA 1K5DA 5H70A 3WP0A 3RS7A 1X86B 1L7VC 1B23P 4Q1FA 5FPHA 5KDLA 1FP6A 4LJ6A 4MGZR 1W0JA 4C9BA 4NE2A 4GDFA 5ELXA 5FL7A 2CL6X 4BE7B 4DKXA 3ZIAD 2ZI4A 1N6IA 4Q4LA 3K0FA 3SE0A 4R2IA 2FNAA 3ASYA 5CYPA 1QHXA 1P7CA 4KVAA 2CNWD 2OXRA 1ZM7A 4GZMA 3U6KA 4C0QC 4TYYA 3LAWA 4IOMA 1DPFA 4D25A 3VNUA 1T3LA 4Q4AB 4CEIB 2FDCA 5CLLA 2QSYA 2PCJA 3UANA 1ZUIA 1GNRA 3F3YA 2A5JA 1G16A 3VFDA 1MO5A 1FMJA 1IN5A 1TQ6A 2FH5B 4R9UC 4DDTA 1EGAA 1AK2A 2JLYA 2GEVA 4N0EA 1CP2A 4F93B 4KO8A 1LY1A 4OYHA 2ZPTX 1E2MA 4HAWA 1PV4A 3RHFA 3TGPA 3C15C 3IKJA 2IW3A 1II0A 2WM9B 1ZD1A 4QNMA 3PEVA 3A1WA 5EE3A 4BLTA 4B2LA 1KZ7B 4N0DA 1G3QA 1DVRA 4DT1A 1KI2A 1G8FA 3KUCA 1J70A 3OIWA 3PR1A 4HUTA 1W4BA 4ITRC 2ZSEA 4DBLC 1KDTA
chains in the Genus database with same CATH superfamily
3MS4A 3ANYB 3K09C 2BLLA 1GFSA 3V2GA 3COJA 2NM0A 4YRCA 3LUAA 3WADA 1N5IA 1RHRA 3KS9A 1E9CA 3KUKA 4Z3DA 1OMOA 2CV1A 4F5ZA 4X1YB 4WZZA 3JQ8A 1USVA 4B46A 1G5RA 1GU0A 4ZEMA 5KTOA 3RVBA 1FFSA 4BWGA 2VOJA 3P26A 2ETVA 3BQMB 3HCWA 4RIFA 4MUAA 3FOCA 4FM9A 2W6ZA 7MDHA 1IPEA 4K8OA 3ELDA 1SKQA 3H3XA 3IIIA 1ZCAA 3AHEA 3X43A 4BKMA 1DRWA 3DC2A 3QOWA 3EXHB 4BATA 3BK7A 1T5BA 3L3BA 4LQCA 1IZYA 1I33A 1NPTO 3FHJA 3KLPX 2WZJA 3KQOA 4QDUA 2QLTA 2F55A 1TUEA 1X0XA 1T4BA 5EMMA 1R64A 2K5UA 2JGMA 1Q7RA 2R7NA 1KOLA 3DV9A 1Z18A 2REOA 4UBLA 4RFVA 5CB8A 4JL5A 5IXSA 1OXBB 3LYHA 1YOBA 5TQVA 3ICPA 2D0DA 1DXOA 2WJAA 3UJDA 421PA 4B6PA 3EXFB 4H1TA 3SJUA 1ND6A 2GNAA 4N82A 3OT1B 1OX4A 4RVUA 1GL7A 4WE3A 2PO7A 4FFOA 3K8YA 2NYVA 1A72A 5CDFE 1UPTA 4HQRA 3SBXA 4S04A 2H4WA 1FLVA 3IB6A 2SKDA 3HDJA 4RE5A 4GS5A 3PHCA 4LV6A 2FOLA 4L02A 1D4AA 1ZGAA 4HAXA 1VFNA 4RPGA 4B2PA 4QUKA 2CLKB 4H1VA 3THOA 2L7IA 5K8CA 5DNYA 4YP6A 3H3JA 1XN1A 4MMYB 3T0GA 3LQRA 1ZUWA 3QKRB 1SVSA 2C7QA 1XD9A 5CJ2A 1AKVA 2H63A 1U31A 3IPXA 5KPDA 2JHCA 3GZTB 4LQDA 1NVEA 3UCEA 3EX7C 4D9IA 2F64A 3R75A 1CZNA 4LBYA 1NUUA 4JI5B 3HLKA 5JXHA 3Q7QA 4M21A 1NI3A 1ORTA 1O08A 1B6RA 4JH0A 3AP1A 5CIQA 3O6VA 4RCYA 1Z29A 2FPRA 3PJFA 5HR5A 1OLSA 4HLDA 4AAYA 1MO2A 1Z37A 3LDUA 4JLPA 1J8DA 2MSWA 1MW9X 3IQGX 4ENQA 3UK1A 3O83A 2HJHA 1ABFA 4CLXA 1T36A 4NX2A 5FHQA 1UM8A 2HHCA 4RY8A 1RQLA 2XH8A 2JEOA 2IZ5A 2C2ZA 3U5TA 3WDKA 2NUAB 5CA1A 1FOEB 4YP9A 2UYOA 5FWDA 1WWKA 3LSYA 4CLRA 4FMCF 5DNDA 2GZ2A 5BQXA 2NZWA 2YNMC 1Y3FE 3UOWA 5MGNA 3A6PC 3MSCA 4D3SA 4LOIA 4WOKA 4A6PA 5DE3A 1QRSA 2O7RA 2ZT8A 3U6EA 2H48A 2RB5A 1GD1O 2QUIA 2GQ0A 4BO7A 1LBQA 3TL3A 4Y6RA 3I2IA 3CO5A 1PQUA 5CCXA 4NTZA 4GU5A 1AGNA 2P6NA 2I2DA 1X9IA 4EZIA 5FUWA 5B1EA 1WXFA 1Z0ZA 2ZUUA 3UWMA 2QT9A 1YNSA 2DFVA 2YW9A 3IE1A 2MSCB 4IXTA 1HXHA 4QGBA 1W8IA 5EJIA 4RWZA 1GZ7A 1YB2A 3VPXA 1WB4A 1Y6FA 3IO5A 3BCRA 1CS4C 2W8ZA 2EHDA 2F6RA 2VDPB 1FRQA 4G4NA 4DR6M 5HTOA 1F6WA 4QJ5A 4YAKA 1CS0B 5CW2A 3OM8A 5KWEA 1DCMA 3ROXA 1P39A 1R6AA 1F6DA 1ITZA 3N6VA 3SQWA 2ZXEA 4ZO6A 2CL7X 2PZMA 3IR7A 1XTSA 3A26A 5ITYA 3PS9A 4ATNA 2ZSHA 2H1SA 1DBQA 1F8FA 3H4IA 3IHKA 3KJXA 5H3CA 3RKUA 1E9RA 5ERXA 4LZJA 5I5GA 3HVRA 4AS1A 2ZJ0A 1CIJA 4Q7JB 2W00A 2ZIWB 2V74B 1P0FA 2UUPA 2ONKA 4MUHA 3PK0A 3U4GA 2ZYVX 4GVLA 1YVRA 4HRYA 3UGQA 3PUHA 2BBTA 4BIMA 2B21A 1KJ8A 2L18A 1DX4A 3REQB 4ZJZA 3P2YA 2WIGA 5CP8A 4C0JA 4ND2A 4Q16A 1N2SA 5B58C 1PGYA 5AVQA 3O92A 3PQ6A 1RI1A 1K66A 1V11B 1T3TA 3FW1A 4RDCA 3L7YA 4OVZA 2AZTA 3LG2A 3RS4A 1H2FA 1E4EA 3AIMA 2Z2XA 4D3XA 3C7AA 4OQNA 5FOVA 2BE7A 2I1VB 3MJSA 2RH4A 2ZS8A 4ZO7A 3QXXA 1JU4A 1EQ2A 2QRVB 3WGUA 3RU9A 2OAQ1 5CFNA 2ZYRA 4NS1A 1XHLA 3GJ4A 5C8DA 1ECPA 1N3IA 4X0EA 4CVNA 2Y1GA 1N7GA 4BO9A 2OMKA 1I94M 1BGWA 2OV1A 3PXXA 2L0XA 4JCCA 3HY4A 1OXKB 4CQMD 3DAHA 3WLOA 1IOVA 1FRZA 4BP3A 1R4AA 3EIHA 5JANA 2YVAA 3GLFA 4R1SA 3ZQ6A 4R7TA 3W6OA 1NY6A 4IZIA 2Z8YA 2HIMA 3D7NA 2J0SA 3LIPA 1Z82A 2PU5A 2IHNA 1TKRA 3S40A 5DTIA 4GXRA 4C4PA 3A6KA 2R8RA 2HIHA 1X7GA 1E9EA 1SCDA 2PQMA 1NUHA 4IFBA 5A05A 1RXSA 3AJRA 3RIHA 2VJYA 1DT5A 4R5MA 2QN8A 4LWZA 4XQCA 1C0KA 5JYEA 4L9RA 1C1HA 5FTNA 1IK4A 2JY7A 1YB7A 4FB5A 4DLRA 5J43A 1N3BA 3PZBA 3BH0A 2A9OA 1VBMA 3GQ5A 4LUCA 4OO3A 1EWRA 1TIKA 1K6EA 3AF0A 1DP4A 2G07A 2A1UB 6YASA 3I72A 5JUWA 1MT0A 4HZGA 4DAOA 5KPZA 5F3WB 2QZJA 3M5WA 2RHDA 3ZXUB 2VA9A 2V6ZM 3ZS8A 3FOBA 3WE7A 3DUFB 1VMKA 1AZWA 4LKOA 4L75A 3VDUA 1GA1A 2JFYA 5E4YA 2BP7B 3TRHA 4ZJUA 1XCOA 1W35A 1MEOA 5BR7A 4G0QA 4QU8A 3DF9A 2WZBA 3W05A 4ISBA 3FLBA 4M7OA 3GNQA 2BD0A 2PNFA 3O8OB 4FU0A 4RWEA 1W1WA 3G8AA 2J4CA 1SBYA 3I4FA 4EI9A 2X5JO 2GJ9A 4EYEA 2JP7A 2YXPX 1E5QA 4WXHA 2DT5A 2ZPAA 2PMKA 5LDHA 2FZEA 721PA 3RVLA 4UHDA 1C3JA 1I4LD 3RGGA 2DPYA 3HPRA 4HDKA 1L1TA 3ML1A 5L6LB 2ZUFA 2KSQA 3M5CA 3OZWA 3HBNA 3J7AC 1G20B 1UXKA 4LFBB 4LF9B 4U63A 1OFIA 1OIXA 3OPMA 1C3EA 3K6KA 4DIDA 1DUIA 1CERA 4YRTA 1L8QA 4MGHA 2B1JA 1DO8A 2PJRA 3NT5A 2BFWA 3CUYA 2QMZA 1NG1A 2C7RA 4MUFA 4A5SA 4YO8A 1IDN1 2JI8A 1C3OB 4MOWA 1IULA 1IN4A 2HFJA 3MGCA 4M36A 5JAQA 3PHHA 3NBUA 1JHDA 4P58A 3WJ1A 4MGIR 2FJ0A 4A0HA 2DFDA 3Q9LA 2Z3WA 1NNLA 1ZONA 2ID4A 1GGVA 4R0VA 2DZNB 3F1KA 2CBZA 3PUJA 1PJ2A 3SM3A 2JFXA 3OCUA 1Y8GA 3DAPA 1E5DA 5DNWA 4KWHA 1G8MA 2QL6A 3WP1B 3JYOA 1P33A 2Z5GA 4OI1A 2FP3A 2ODAA 2KPOA 1XK7A 3ZH2A 2AKYA 4ZHQB 1QCCA 1NLFA 4C2BA 4EKYA 4TN5A 3UH1A 4FK8A 4HUJA 2EIXA 4GL4A 4LYDA 4NAVA 3AJAA 5M29A 3FBWA 3M5PA 2J9FB 4EHHA 1BXKA 4KPGA 4CM5A 1LQUA 4DR5B 4AY5A 1XX6A 1VLHA 1Z62A 3L07A 5TGZA 2H51A 4CQMA 5GJBA 3JASB 1Q7CA 2G0NA 2QXUA 4Q9HA 3QUBA 1NIPA 1X1DA 4ZOQI 2OQ4A 2NVBA 2R3SA 1DCTA 1Z2CA 2HA7A 1VKZA 1TD9A 1KY3A 1ZMXA 5HHTA 3SVZA 3UXHA 4LE0A 3OSZA 5AKGA 4AJ1A 4FHZA 5EHIA 4JC8A 4I6EA 3V00A 1MQ8B 3ET4A 4RTPA 2QQGA 1QCZA 4YCAA 3MYRA 1FTNA 2IVFA 4C0KA 5A9RA 4JI6M 1E6EA 4ZQHA 3CLRD 1MB3A 2QSFX 3ZHQA 3Q1LA 5CITA 3RFTA 4BKQA 4HNTA 3MLEA 4NBSA 2YXBA 3MN1A 1FLNA 5HRUA 2QSZA 4HN9A 1RYMA 2IPMA 5IVPA 1B16A 4XVRA 3VC1A 4RXUA 4Y67A 1TI7A 3CG4A 3TX6A 1Z17A 4XK8F 3RC9A 3B8HA 3QLEA 1E8MA 1AXGA 1NI4B 1G3RA 4US2R 1OT5A 4GL2A 1GSHA 3ZNQA 1T2AA 3GMTA 3C6YA 3W2IA 1MC4A 5L8RF 1JHVA 2HK7A 2DPHA 3JZDA 2WHRA 4LHXA 3JQBC 2BEJA 5LN1A 1X6VA 4HYYA 2IS4A 1MIHA 1XXHE 1J5PA 3H1TA 4S35A 2FPUA 3IUPA 4K6HA 2Y1XA 3I12A 5F98A 4F4UA 1JIIA 5DBIA 3KETA 4R6WA 4BVLA 3SZMA 1G21B 2H2DA 3QYAA 4G4JA 3CVOA 2LWIA 3GEIA 3TQHA 1QYCA 3C7TA 1HMYA 1YRHA 3WIOA 3P9PA 4LSWA 2Y0DA 4DUZM 3O93A 2VDBB 3HNPA 4E15A 4BFLA 3R7SA 4F9TA 4EJ2A 4PS1A 3IQXA 1T35A 3WFJA 3TJZA 4WLNA 1FXWA 4G81A 4FMDF 1OBCA 4A9AA 3JRWA 2OO7A 3WISA 5LB4A 2DR3A 1YRAA 1W73A 1SVOA 2VUHB 4IZ6A 2BFNA 3NEJA 2O0HA 5EJEA 3L6RA 8ATCA 3TRIA 3MINB 3EF3A 1NQ5A 2X76A 4F4DA 3R41A 3WK9A 2NVUB 1P0CA 1Y3BE 3AR8A 4WKGA 1YDEA 5J2UA 3UFXA 4YRMA 4G84A 4Q4JB 3T3NA 1O77A 3VOAA 2WLSA 1TNDA 1NDUA 1TW2A 2QM8A 2YXNA 4L85A 5ALFA 1RXYA 2AFIE 1XPUA 1X1SA 1UC4B 2QX7A 5L40A 1V95A 5IYZA 4RK5A 4MV9A 3L28A 2GPAA 2XE8A 1GZ4A 1DOAA 3DT6A 1Z0AA 1Q0QA 1RKVA 1YS1X 1UFZA 2NO5A 4U5XA 5AVOA 3PJDA 2R2GA 4KTTE 4ZVQA 4MYDA 1AXRA 5HOEA 2XHZA 3IDAA 3QW2A 3UTCA 5DVZA 1IRIA 2P4EA 5AKHA 3AOGA 4PNZA 4XYGA 1PWEA 3IDOA 1GAQA 1N2IA 4NR0A 1HURA 2PKXA 2O2HA 3DR3A 3LUBA 4DEXA 4MPPA 1TAQA 1LD3A 1Z07A 3W8EA 4WZAB 1DTWA 3K73O 4E7OA 1D0VA 4GRDA 2Q7XA 1D8TA 4Q47A 3PU6A 3BGEA 4YMTA 3BGDA 1JQJC 1L0BA 1EX7A 4FDMA 4TZKA 3ZHXA 1SUPA 4YIHA 2FUG1 1KWKA 3ICWA 4G5RA 1M8PA 5EIBC 3GJ6A 5B12A 2NPIA 3WK5A 4Q9NA 2VXBA 3Q2OA 3BMCB 6LDHA 1Z47A 4FYJA 3TZKA 5A5EA 2VNSA 1H1TA 3RROA 4X8LA 2IPLA 1K3UB 3KV3O 1CX9B 4NMMA 5SY9A 4YT8A 3U4IA 4B73A 2PZGA 2ZCVA 1LV7A 5H37D 3VDPA 4PHGA 3V55A 4EIWA 2FETA 2QF7A 1V43A 2YZ7A 4UEJA 5KMGB 3LT0A 3X0DA 2KE5A 1KZ4A 4KE9A 3L1HA 4MUNA 3SSNA 3MUOA 4G4IA 4DC0A 4HLNA 4ENPA 3PIIA 4DANA 2GM5A 3OICA 4UBNA 1QQ5A 5I9IA 5DN6D 3ABQB 3U7HB 5JEEA 2JLBA 3THXA 4KPYA 1WMAA 4MH0E 1KRWA 1JU9A 4TSFD 4ROTA 2HBQA 2YYSA 5EKTA 5A3JA 4MS3B 5B57C 1LX6A 3VYVA 4CQNA 4OVKA 3CE6A 5HKLA 1CJMA 4HNAB 1R4ZA 5AVJA 1A4XA 3RC2A 4HFNA 5F9HA 1YGYA 4DV3M 3F5FA 3AMVA 1OFUX 4FR0A 5AOCA 1RIIA 2W82A 3TECE 5FULA 2WJ3A 3IT2A 4NBNA 4JP5A 3WLHA 3JALB 4LXQA 4ARZB 5TB5A 1DV0A 2QS9A 2MTBA 3K05A 1HM5A 4ZREA 1DBIA 1T2FA 3NRJA 4OI2A 1S9DA 5ER9A 3ZXYA 3DWFA 4JJFA 2QVCA 2D5LA 1HORA 2JARA 1L4HA 2G5PA 4LY9A 1SQFA 5KX5F 4PO1A 1AKMA 2GRJA 5E7MA 3O4GA 1D7AA 3SFVA 2FLKA 3NH9A 1CRZA 1FFWA 2GXQA 3GG9A 3MCVA 3H5NA 3EZYA 5EUCA 4ID9A 1Y4AE 1VJCA 3MMZA 4RMNA 3IERA 4BO6A 4ANFA 3IDQA 3WDLA 2W42A 3QI7A 3ZLUA 3L7JA 3DUFA 3ZTYA 2BVNA 3HI4A 3LC2O 3FIJA 2NTYC 1P1BA 4JN6B 4XSVA 2EV9A 3V3TA 4ZCTA 3T6PA 5C35A 1M5RA 1EK5A 5A62A 2RHGB 1NRXA 3NUQA 3NQ41 2ZI4A 3IV6A 1P7CA 4WDRA 2CNWD 4Z5XA 1ZM7A 3LYLA 1XJWA 2P9FA 5KKCA 3OEYA 3QU5A 4CEIB 1D2GA 3R3HA 4MJ3A 3UANA 3FCYA 3JAKB 1XE3A 3ROKA 3RODA 3QPDA 5SY4A 4I5GA 3TIGA 2QUBA 4MGZE 3KB6A 5HIAA 5K0JA 2UZ1A 3EFOB 4N0DA 2WIDA 4UEQA 4LE1A 2IUFA 1GPBA 2FR8C 2YWJA 4PYOA 4F3TA 2ZSEA 4XJSA 3BK2A 3SF8B 1E9VA 3RG2A 1OTXA 2XNDD 1E2UA 2J3EA 1FFDA 1GVNA 1T5LA 3LWBA 3SS9X 2CJYA 2QQ0A 3HJCA 1V16B 2VJMB 3N05A 4AL4A 2GBFA 2XCLA 4HWGA 3I6ZA 4C7KA 5L4NA 2D5BA 1KR2A 4LRYA 5T3UA 3NRCA 4N3CA 1SUBA 3P7MA 1HLGA 3RYIB 2O59A 3JW8A 5JCPA 4YY3M 1LSUA 4GE0A 4GPD1 3T12A 1Y98A 5HMMA 1N7JA 3BH7A 1JSXA 3NG1A 1H93A 2JGFA 3DM9B 4EHDA 3GJ8A 1EESA 4TV9A 2X8JB 3TFWA 5BMVA 2X14A 4ALLA 1AVTA 4DZTA 1LPOA 1SCIA 2AWNA 2EX1A 3LHIA 4LPKA 3TOSA 4GP9A 1YASA 5LZ4A 2P5SA 4U7JA 2IS6A 3QLUC 2FMIA 1AKEA 1RHQA 5TV2A 4UJ5A 4V39A 1YB1A 1T8WA 1WBDA 1JQ3A 5CAEB 4NRVA 3DL2A 5FOQA 3Q3IA 2BRUC 2G5GX 4KAJA 2F8SA 5F4BA 4CMGA 8ADHA 4TKMA 3QTTA 2NO7A 1NLZA 2RHOA 4ZOAA 4JUCA 1KMQA 4ZO9A 2A5DA 1A4IA 1GOTA 1VFPA 1OI7A 4B6OA 3A3NA 1TEZA 5L3VA 1RWOA 5EJFA 4RKWA 3I76A 4B4WA 2OTCA 1GUDA 3ANXA 2NTVA 2BHRA 2ZTDA 2P75A 4AB1A 4LJLA 5ICCA 3A7DA 2FUG6 2XECA 4PAQA 2A0KA 3C3WA 2PTGA 3LPLA 3BWVA 1F2VA 3SMPA 5A7GA 4EHJA 1X42A 2M6KA 4OGKA 1TA0A 4X61A 4UE3S 2JGNA 4FWGA 4GPTA 2ZAOA 5LQRA 2XMZA 1OQYA 4EEZA 3PC2A 1J5EB 4OXRA 3GD7A 1HK7A 1X7YA 1AZTA 3CUSA 2N1BA 5H0IA 1ZNWA 4WXEA 5B37A 3U6SA 2I5PO 5CA0F 4TUYF 1VSQA 5GP1A 1BU8A 1WDKA 2WUFA 3JAWA 3UHJA 1VGQA 8CATA 1DG3A 4R84A 3AR6A 4ER6A 2R86A 1Y33E 3P96A 2BGRA 1S7GA 3FI9A 5KQRA 3N6XA 5FFMA 1WM1A 2Q9CA 3FSGD 4RIIA 4UUBA 2R79A 4X24A 3JWPA 3NTOA 4L76A 3E21A 3SQLA 4BDSA 4Y2GA 3A58B 2LDBA 1ZG3A 2KZSA 5LYJF 4O4JF 1IIBA 2DUMA 4OM8A 4K9NA 5I9BA 3VDMA 1I0IA 1Y9DA 1WB5A 1G21A 1V5GA 1RADA 3L4KA 1UFKA 2VPTA 1B00A 2FUCA 4HNQA 1AKTA 3TIFA 4DRXB 1F7VA 3AINA 2ZE8A 3F74A 4CDMA 3ZBQA 2AN4A 4ZEWA 3W1WA 3VA7A 3PDWA 3VGJA 3JZFA 2ZZNA 4MW9A 1QH8B 4S24A 1MN3A 1CUVA 3UF0A 2QM0A 5JECA 2ZRDA 1Y8ZA 2ZRQA 5K5EA 2IYNA 4XYLA 1PJIA 1ZH4A 4TT3A 2PKQP 2XOXA 4IMRA 2AG5A 2HYIC 3UJHA 1IBSA 4AXBA 3RS0A 2VTVA 3QOYA 2OCIA 1RI3A 2JI4A 4LTDA 2C7BA 2RJNA 3IJPA 2IYPA 3OI7A 1JZSA 5AK0A 1RBMA 5ELLA 2VUUA 3L8CA 1AIPC 5DLDA 4CGYA 4OW0A 1DQPA 2Y2VA 2NO4A 1Q1ZA 2RKOA 1Q1AA 5IABA 3SI7A 4BX8A 3K6RA 1Z5ZA 1R16A 2GLUA 3PHGA 4DR1B 3DMRA 5KQGA 4EI8A 1JKJA 2BFCA 2O7QA 1OC2A 1V45E 5DNCA 3RD5A 2ZSIA 3F7NA 3PF8A 1HV8A 1XMOM 3VHQA 3HUUA 4W5OA 3HCDA 4Q9JA 2BKUA 4RETA 3ACCA 5FUYA 1IIRA 3FA2A 5CX1A 3I32A 3SJBA 3V4ZA 1XIVA 1NO1A 2IYSA 1OXVA 3KOZE 2JRCA 3E7PA 1K86A 3QVKA 5GQSA 3TTWA 2F5NA 4WZAA 4JLVA 3HXTA 5ER6A 4XCVA 4LCJA 1C1YA 4H77A 3IVGA 5G0UA 1NP3A 1CUZA 3K70B 1MX5A 1YE8A 5DBFA 3A3PA 4DSTA 4OXNA 4YJ2F 1E0DA 3G0CA 5FLEX 4JKOA 2VPWA 4LJ9A 1RPJA 4ARIA 4GBGA 2OFPA 1JI0A 1XF9A 4ZN6A 1T0IA 1G2QA 3SHTA 2XWBF 3STHA 1ACLA 4CMEA 2C8VA 1LSJA 3CRQA 1FJXA 2FW7A 2R8XA 3KWMA 3CVUA 5SYAA 2IPNA 3I9OA 4OG2A 2GBGA 3ELWA 4WK4B 4NCHA 3H9BA 3GUZA 2LVOC 1E9SA 2Q0SA 4FW9A 4F45A 4FMCB 2QR3A 5HQJA 3FZQA 3U9SA 1ZINA 1EB8A 1T8YA 4MIKA 4DPKA 5ALIA 4Z0PA 1IEWA 3TDNA 1RS0A 1MZPA 1W85B 3KZKA 2D0OB 2WB2A 1V4NA 1AM4D 1TR8A 4Z54A 4M98A 3RHZA 1W36C 3UMJA 2H2FA 3UMYA 3P2JA 5E3IA 4WXRA 1G6HA 4GE3A 5LFAA 4D97A 4Y6QA 2G70A 4R05A 2J3QA 1I01A 1JFFB 4ZAGA 4DLPA 3HKDB 2OC4A 2H59A 2FZKA 5LP1A 3WYCA 5BV8A 2PRZA 3OJWA 2ATIA 3IBSA 1E5XA 4B0PA 1RABA 1GGMA 4MW7A 4OIFA 4RK0A 3PGMA 5H82A 4BLSA 5DF1A 3W04A 4N18A 4L57A 4MEBA 2Q5CA 2X6TA 1Z6ZA 3ICOA 4IF4A 4XD7D 4P32A 5K3FA 2OHXA 1QKKA 2IYZA 1M1UA 4YUZA 3RU7A 2NIPA 3EGDA 3HH8A 4BYMA 2ZVPX 2AG6A 2JHPA 2A30A 4KN5A 3ORFA 5D5QA 3GJ3A 2V3WA 1CVIA 2BZ0A 3BRWD 1OBVA 1DRVA 1NXXA 1HDZA 1UFOA 1ZOLA 1UZLA 5ITXA 3HDTA 3KKZA 4DQKA 3DE7X 3BWMA 3UMGA 4CMJA 4IV5A 5CIWA 2EKQA 1KZHA 1DADA 1M54A 2RHJA 4MKZA 1Z6XA 4EQZA 4LA4A 4W8OA 1FJHA 4G67A 3JQEA 2FWPA 2YKGA 4MI3A 4TV8B 1SUFA 5DHPA 4I4TA 5FAKA 4JA2A 2RK4A 2GS9A 4MI9A 3P27A 4QREA 2B83A 1H2EA 5EMNA 1E3WB 4YUYA 3H5TA 1CR2A 4KXMA 3L7KA 2J5BA 2YFKA 1RZRD 3FUWA 1ETUA 2RGDA 3DBLB 1BC5A 2Q2QA 2ZUBA 4CDNA 4ZZIA 2V7QD 3F6PA 3GLSA 1DWUA 3F71A 1GA6A 3OD5A 3GGOA 5DH9A 2A5YB 1GDTA 5I7AA 1PG0A 2YQ5A 5T8KC 3A1VA 1ZEMA 2EARA 2W6PA 4JOQA 2WK1A 3R40A 4PGAA 3GAFA 1T5IA 2NNWB 3FCOA 3HZJA 3VPGA 3UCXA 2AB0A 4LF8B 2NU7A 4MO2A 2Q1SA 2OC9A 4BAGA 3D5TA 3DV0A 3TFOA 3ZWPA 3RUIA 1R66A 2XUKA 5EUQB 5EJ4A 5DPMA 5KOHB 3IEMA 1QIFA 2LWXA 3AL2A 5FI5A 3SF8A 2BJWA 1NPDA 2O2IA 2ZZMA 2VLIA 4MWTA 1BKSB 2ZZKA 1JR3D 1C2TA 2Z30A 2OKCA 2JJMA 2VQEB 5J47A 2VEDA 4AMGA 1TYCA 1OPXA 3ZQKA 2OZLB 1V16A 2GTIA 1KI4A 2E6UX 2Q1TA 2C96A 4JJ6A 1CIPA 3QIAA 3K5IA 4UU1A 3B82A 2XFSA 1OU0A 2B3DA 2G72A 4URHA 5JASA 1UOOA 2FQYA 1MO3A 3OCJA 2GN9A 4M38A 1NRJB 4TMXA 1QJ4A 1MXHA 4FKZA 2XZFA 4BEWA 2H85A 2YZKA 3WOVA 3L8DA 2FGKA 2XIJA 4CKXA 1I9CA 4HWSA 1IXSB 4IEIA 2AUTA 5C1BA 1H2RS 4NCJA 1VJ0A 5C7YA 1RYFA 1R5NA 1Z06A 3E9ZA 2XB4A 3Q3GE 4RD4A 3HCNA 3O03A 2XUOA 3K6JA 3EIQA 3R3ZA 1JQAA 2Q2NA 1XL0A 3TAXA 4UREA 3D4NA 1X8LA 2Q6TA 1BOOA 4QQNA 4TTVA 4XOIA 2AR9A 3SKVA 1DJLA 1KY5A 3THWA 3BD8A 2O2JA 2HGSA 4YMWA 2HCJB 3RU2A 2IXAA 3KB2A 4XD7A 1CRQA 1VZ3A 3EVAA 4TQUS 3HP7A 2FKNA 2PWPA 1JXAA 4CCYA 4FN5A 3U6DA 3B52X 3SOZA 2B8TA 1K27A 4GLJA 1HA3A 4K87A 1AA6A 5KBYA 1RWPA 2YV2A 1QP0A 4RMHA 2FX5A 1OTHA 3KQPA 3BRWA 5E0KB 2I4NA 1OYYA 2O06A 4PYMA 4O4IF 3M1IA 3K70D 3TOVA 4JI4B 3MTGA 1X8JA 4BN0A 1AMNA 4DLAA 1KSGA 5KCZA 1EWQA 5JYCA 3G3EA 4M4SA 3H5LA 3UAOA 4EY5A 3K71B 3V8RA 2EKBA 5IAKA 3T9DA 4HL6A 2NV6A 2VF7A 1GKLA 3EQ7A 2Y0BA 5FORA 1IL0A 3IPAA 4LBZA 5BW8A 2Q5OA 4RK7A 3PDJA 4FMPA 2VP9A 3DC7A 1IOZA 3QSYA 4MRSA 2ADMA 4MWBA 2N0SA 4Y2UA 1G59A 4FQ5A 1J21A 3AUUA 4QVIA 1FU7A 1MABA 2WIFA 3DMNA 2IUUA 4QFBA 3BULA 5G4KA 3WLLA 4HDMB 2X0NA 1MV8A 2YJGA 1T4CA 3OLYA 5JD5A 2M6RA 1RZRA 3IAHA 2X3UA 1KR5A 2NP6A 2H0QA 1SRQA 1M10A 5B7NA 3HN6A 1ZOPA 2BMDA 4C3ZA 1G5HA 3UT0A 2BDEA 1ORVA 3E5RA 5L4LA 1U3GA 2PANA 1CQIA 4EUHA 3HO6A 3KKNA 2TMDA 2DCUA 4DDKA 2A0UA 2F3PA 5U4XA 1G9SA 1I6WA 1CW2B 2HHAA 5F3DA 3L4BA 2L19A 3K6SA 3L01A 2XB2A 1N5KA 2XCQA 1H2YA 3WGHA 2GEFA 1B8VA 1V47A 3AXSA 3WLIA 2XA9A 4OB6A 4PCVA 5ED4A 2FK7A 5J2TA 4BGEA 2CHVA 4Y2VA 4BNGA 1NF8A 2E5LM 3E9RA 1JYEA 4TTQA 5AI9A 4IKOA 2HEIA 3EMVA 3QG1A 2C78A 5EN4A 1V0JA 3E8SA 3NC0C 3HJQA 4MGYR 4WUVA 4A3SA 4MVYA 2B4QA 4K0RA 3D31A 1AHHA 4CCSA 4L28A 4LVCA 2GK4A 5A7HA 5HZKA 3T94A 3EPKA 1AE1A 2B7BA 3BHIA 3JXEA 2ZULA 1P9NA 2BEUB 5EPOA 2P69A 3ZVMA 1WOMA 2FEMA 5CVJA 2W6NA 3GLIA 2MMGA 4LJ7A 1NN1A 3HCCA 1X19A 2KMLA 4INZA 1U28A 4JEHA 3FCXA 1VBKA 3Q15C 3ZCXA 1ZZEA 2FJUA 2P27A 3ON5A 3RJ5A 2I4TA 3DPUA 4PPGA 2GN6A 2HL7A 4PC2A 1BFKA 1X80B 3M6MD 4N7BA 4MROA 4NYMQ 4D43A 5CBKA 1POWA 5K3DA 5A6SB 1MVNA 4A92A 3NHPA 3OU2A 2DYKA 3I34X 1KVTA 4GYJA 4IH9A 3SR4A 4BJ3A 2FEAA 3VZCA 2DUWA 2B30A 4M8SA 3GI1A 3ENWA 4MKXA 1A8HA 4X8HA 3IL2A 4QDKA 5DISB 2QROA 3KQMA 2B3TA 2VATA 3ETJA 3R0IA 2WVHA 2H1OA 1VP9A 1AO3A 5AVSA 5DGTA 4M60A 1ZICA 3ORYA 2AX3A 3QFCA 2WSLA 3WRXC 4ZYTA 1VB3A 1ZHOA 2QYOA 3CR8A 1HNZM 2WIAA 4UNPA 3ZGYA 2IYTA 3IVXA 3K1YA 1IVSA 1IBLB 2PAFA 4NKRA 5DM60 1ZNYA 3ILXA 4RL6A 3ZK9A 5ANRB 2OFOA 1N1GA 1YJ8A 5CB4A 3MRTA 1XZNA 4BP1A 1Q22A 3RQIA 3ZZ1A 4HDQB 3LMMA 4D92A 2XNCA 2X0JA 4AROA 1YA4A 3AVWA 3CYFA 1O6FA 3UT5A 3BRCA 4RF0A 1T1GA 2VP0A 3B2NA 1NFFA 5ITUA 3R2JA 3WQBA 2HSGA 1SJ9A 4AN0A 1U2DA 3OP4A 4MB0A 2ZBVA 4PAOA 2DM6A 1X38A 1H4TA 2EL7A 3KEOA 2JLWA 1FJGM 1RVDA 2V7BA 4FDAA 4Q3NA 2ORYA 1E3LA 1KQ3A 1XWFA 1EHYA 4RELA 3SKXA 4QNNA 4OCZA 3MB8A 2R25B 2RK6A 1RLIA 1R9MA 1S8AA 2CNOA 3E9EA 2GD1O 3EVZA 4D9CA 4BE7B 4OP3A 5CYPA 3RK1A 2IH4A 2JGKA 2I4OA 2IYEA 4DR6B 2QSYA 5AHWA 3NS7A 3TJMA 3I5MA 1QGUB 4GOND 1VPWA 3CZ5A 2P4UA 4Y9UA 4QNMA 4HTFB 3VU8A 3Q8MA 1RM5A 3E48A 3GLRA 3IXLA 1WJ7A 1N6LA 3QOFA 2B78A 3AEXA 3HM9A 2QRUA 3R76A 1T6BY 1JAXA 2XA1A 1JHQA 3R7BA 4TV8A 2ZRHA 2BHNA 3IDFA 2OK7A 2WWWA 2B1IA 3L6OO 2WA1A 3NV7A 4Q1AA 2BZSA 2G08A 1O1YA 5CDHA 4NENA 5ITXE 3C5WP 1FSFA 3FOEC 2WUDA 1Y3HA 1XU4A 3L4EA 5IVIA 1NGSA 1ZNQO 1ILEA 3Q9UA 2N35A 4D9HA 5KVAA 2O3TA 2I6TA 1N32M 2QPOA 2XF8A 3KP0E 3GH1A 1ZIDA 3T9FA 4HUQB 5E1DA 4C30A 3A0UA 4GD3Q 1Q2XA 2DWMA 4DMUB 2F8LA 2IHKA 4DSZA 3N07A 3WXBA 1QHYA 3VPAA 2ZUVA 1BJKA 3SNHA 4LGVA 2X9LA 4LEIA 2IUEA 4JI3M 1G9XA 1T0JB 2XI4A 4RANA 1MRZA 1BO6A 5LXTF 4JSTA 3JVIA 3GLHB 3DZBA 1VHQA 3FHOA 3OM1A 1I94B 3JAMS 3H7AA 3QELB 3K15A 1QJCA 3D0RA 1KXJA 2DY1A 1UBLS 4TRRA 5BWLA 4NAUA 4RK6A 2E4YA 4IQ4A 1VHTA 1YJQA 1Y5NA 2VKTA 1GRNA 4C1BA 2ZWPA 3WLEA 2CXOA 3DBOB 1THZA 2A0XA 1XZ8A 2NSDA 3FTDA 4TLEA 3GT0A 2OA0A 4HNSA 5CH3A 1JIVA 2XMCA 1QKJA 2QJTA 1Z5OA 4ARUA 4I1UA 2Q1YA 5KTPA 3JPYA 2HADA 3IVAA 4ND8B 4AVYA 3QV2A 4NZYA 4PO8A 3BXZA 2R6R1 1Q1NA 4CHGA 4IGIA 4J2HA 5DYWA 1H0HA 1HFEL 1SUEA 1XSEA 4QX6A 3HWX1 3QWBA 3S8EA 2CFIA 4B7UA 5LD2B 2HB6A 4RVCA 3OZAA 3PVSA 1NVWQ 1CK4A 3KVNA 4I8OA 4A8JB 1II9A 4ZU6X 4YAJA 4EM6A 1YZGA 2ZTVA 2ZBPA 2EC5A 4OLHA 1YD7A 5KJ6A 1JLMA 4UHBA 1Y34E 1QK3A 4UW9A 1R4MA 2QVBA 3GG2A 3HDVA 2IEGA 4YXWD 4N7RA 1JXOA 4AFNA 2BEVB 2B92A 3T34A 4G4QA 4GNKA 3IMKA 5AESA 3SARA 3V4SA 5TX7A 1ZWLA 3O3CA 2O7VA 2G6BA 1FK8A 4NCKA 3V7WA 2C8JA 3ICVA 2AOUA 1I0LA 4BNXA 3NKVA 1E2PA 2NAPA 2J7KA 2JATA 4CM7A 5C8XA 1XNQB 4ZZ0A 5AJVB 3ESAA 4KPEC 5DT9A 2GPBA 1KJQA 4BNKA 1KKLA 3JYPA 1W4CA 3ZWMA 2HF8A 3HEBA 2HX1A 1UMKA 1J07A 3H86A 1F5NA 3CJTA 2HCTA 2W0SA 3PEWA 1L7QA 4H6VA 1LRLA 4E6PA 5DMHA 4LHSA 5KVQA 1V2HE 3AR3A 4HQ0A 3WHLA 2ECFA 2H92A 3NPAA 3PCTA 2DETA 3HMKA 3MJRA 3AIOA 4U7TB 4HDMA 1U8CB 4MVJM 4X1YA 1OWOA 4BLRA 4TTJA 4ZICA 1TK9A 2ONYA 2PEZA 3VDNB 5DTQA 5H4GA 3OTOM 1NF9A 1TTHA 3KOUA 5CHYA 2IZOA 2PMWB 1KPGA 1MC8A 2AMJA 4LAFA 2P9QA 1NT2A 3G8DA 5KYWB 4F46A 1BQEA 4JVNA 3EXHA 1U63A 3IOBA 4MKFA 3RG8A 1R0BA 3OFVA 1P1HA 1Q5PA 1VPDA 3H83A 3T5TA 3HCAA 5K3EA 1O0SA 3ZW9A 4MV3A 2VSFA 3VR1A 3QUAA 4DJ5X 2XVYA 1GL6A 3HHEA 4Z8YA 2HDWA 2HJVA 4D4IA 3SHVA 4JGGA 1ZD9A 5LSAA 3RAPR 3EXFA 4B79A 1YFJA 5J5AA 2ZW9A 3TZEA 3FOFC 1HNNA 3OT1A 5ALYA 1WUKS 3VV3A 4M0FA 4DQVA 4O0MA 4E1VA 2PX3A 4QATA 4Z4HA 2V7UA 4ZVTA 1SD2A 2HWUA 1OXMA 1ZY2A 4G1VA 4Q03A 4YR9A 4BCDA 1BN6A 2FSIA 5IU6A 3IAS1 4J7XA 3QKRA 2JY6B 2Q4TA 3CNBA 1BCSB 2OFWA 4M2LA 1APBA 4CXMA 2AC4A 2WJPA 4XQ9A 4PYKA