3U5ZB

Structure of t4 bacteriophage clamp loader bound to the t4 clamp, primer-template dna, and atp analog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SMITVNEKEHILEQKYRPSTIDECILPAFDKETFKSITSKGKIPHIILHSPSPGTGKTTVAKALCHDVNADMMFVNGSDCKIDFVRGPLTNFASAASFDGRQKVIVIDEFDRSGLAESQRHLRSFMEAYSSNCSIIITANNIDGIIKPLQSRCRVITFGQPTDEDKIEMMKQMIRRLTEICKHEGIAIADMKVVAALVKKNFPDFRKTIGELDSYSSKGVLDAGILSLVTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKLAEEIYSRVTPQSIIRMYEIVGENNQYHGIAANTELHLAYLFIQLACEMQWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 108
structure length 320
sequence length 320
chains with identical sequence C, D, E, L, M, N, O
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00004 AAA ATPase family associated with various cellular activities (AAA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u5zB02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u5zB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3u5zB01
1F2TB 2QU8A 4RZ3A 3QKUA 4TN1A 4HLCA 4FCTA 3AGQA 1XEWY 4P0TA 4G3XA 5D3MA 2A2ZA 1E9SA 1FQKA 3TW8B 1Q21A 3CF0A 3RS2A 5FOWA 4NBSA 2IW3A 2CDNA 1Z0FA 1KY2A 2O52A 3RRMA 4ITRC 4JT2A 2WOJA 3SI7A 4BQSA 1E0AA 3VKWA 2GK7A 4QGFA 2VQSA 4MGKR 1BMFA 4MDFA 2O0HA 4D6PA 1DG1G 3LAWA 4NL4H 2P6RA 4M4SA 1TQ4A 2WJVA 1KO1A 1E2EA 5EZ5A 3RWOA 3SEAA 4Q7JB 3VTKA 4BRWA 3AVTA 1R5NA 1NMYA 2ZITA 3RAPR 4F7WA 1CBUA 1VIYA 3B78A 1OXXK 5M04A 1NVVR 2ZANA 1MOZA 5E7MA 1H8HD 2W0SA 4PHTA 4QBHA 3GJ4A 3OFND 3LVQE 1BOFA 4C30A 4DSTA 1KAOA 1CJKC 1KZ7B 4AI6A 1NNEA 2PLRA 1K6MA 3A4LA 3LLMA 3P1JA 5DHAA 4DT1A 2X1VA 3C8UA 5DI9A 3VNUA 3GLFA 1G7TA 2V6JA 3T06B 1QHYA 4BFTA 4BLPA 4AG5A 3CWQA 3LW8A 1L7VC 1W48A 2IEZA 4ZIRB 3LRPA 1HEIA 1E2HA 4R71A 5UKDA 1QHHB 3ZH9B 4ABYA 2DZNB 5L3QB 4TLDA 1FMLA 3O8CA 2OXCA 1ZAKA 1OIXA 4Q47A 1AKYA 4IOKA 3MWYW 2QPOA 1OH5A 1SZPA 4PPNA 3QE0A 5FL7A 3JVUA 3P4XA 2WJIA 1R7RA 5C2JB 2DZOB 3UPUA 3IPYA 4NYJR 4C0QC 5BYKA 2W00A 3A37A 5HZKA 1CLUA 2Q9AA 3ND9A 3U4QB 1G4UR 2DWZB 4KYIB 3OEHD 4N3NA 1BMFD 2ZI6A 1Z0AA 4KBFA 3D8BA 3AF0A 4ZCMA 3QY0A 1DTSA 4HLQB 5BN4A 4TYPA 5CDFE 3MJRA 2Z4SA 2IYVA 3T12A 1E9EA 1KTVA 4PO8A 2EFDB 3DO6A 2OFOA 4UNSA 5JFGA 2ONJA 4EDHA 5CITA 1DBSA 5C4GB 2IUUA 4A8JC 1WB9A 1UJ2A 2Z83A 2QBYB 3IO3A 1E2MA 2PT5A 2IYXA 2EQBA 4AY2A 1DS6A 4URVR 1D8TA 3CX7A 2N1BA 4Z1MD 4HLUA 5TDHA 2HT6A 1XMIA 3DMNA 3IGFA 4N0DA 1C1KA 1A2BA 1MABA 1IN5A 2DWPA 2X77A 1G8GA 4JVMA 2VHCA 4B71A 5KPDA 2QAGB 1IY2A 2ZYVX 3PEYA 1LTQA 2X2EA 4NMMA 2FPMA 1WBDA 4F93B 2IA5A 2RGAA 3WNDA 2ZETA 1RPZA 1QHSA 1VDZA 2GWHA 1NVUQ 2HYDA 3REFA 3IHWA 2FFAA 2BMJA 3ASZA 2GVDC 4F4IA 5KDOA 2QG6A 1YR8A 3A36A 1NY5A 4FMDB 1KKMA 3AB3A 1P2UA 2V54A 2V1XA 5JI3E 5DYIA 2WPDA 4PHFA 1U99A 4A82A 2ZROA 5JBQA 3LBNA 2O8EA 4KHZA 1IOZA 4BFVA 3E70C 3L8ZA 1SXJA 3OF5A 1HE8B 1N6KA 1IN4A 2WIBA 3MRSA 3EA0A 2RGDA 1VG9B 1W47A 1XD8A 3W6OA 3UWKA 5LD2B 2EFCB 2ZJZA 3AKDA 5K8UA 4B3DA 3IPXA 3UATA 1YRAA 4KBGA 2BM1A 1J99A 3NXSA 2GXSA 4JKIA 2YKGA 1XF9A 1E9AA 4HI0E 4WXRA 3RC3A 3C5HA 4D0GA 3BH6A 4LHYA 1Q1BA 1GG2A 1Y3AA 3SR0A 2CMKA 1P6XA 1UBCA 3CONA 4EFNA 3C14C 2KSQA 1S2MA 1A2KC 5TMPA 1GKUB 3FHTA 3ZYCA 3WNCA 1X6VA 2QM7A 4V03A 4XTRA 2QMHA 3DPUA 4A2QA 2FPKA 4DC9A 4I99A 4M1MA 1D6JA 3KXKA 4DLUA 2G9NA 1D2MA 1ODFA 1C1YA 3K0SA 1OYYA 2ZI7A 4PSAA 4PZZA 1A5TA 1X3SA 1GIAA 4I4LA 5P21A 3AVOA 2OEPA 3NG1A 4OK6A 4IDHA 2GXQA 721PA 1XTKA 5TXGA 4C0LA 2R65A 5EXSA 2FMXA 2J0VA 1QVRA 2IHYA 2VTKA 4OHXA 4URUR 1UAAA 3IHLA 3K0AA 2GXAA 4C0BA 2GCOB 1SQ5A 4JL6A 3V00A 2Z4RA 4YMUA 1NVWQ 1VHLA 3T5DA 3K70B 4D4LA 2VF8A 5KHOC 3GJ3A 5HCIA 3NDBB 1KI4A 2YJTD 3IUYA 4B44A 1JEDA 2QT0A 1TX4B 1QZXA 4Q7LA 2VHJA 2IXFA 4ZKEA 3I61A 2IBMA 4HDOB 1JAHA 3D6TB 5F3WB 4BPBA 4OKSA 2VIIA 3LBHA 3IQXA 4BRUA 1P61B 4LBWA 3KQHA 3LX5A 3BH0A 1T0JB 2JJ1A 4FI3C 4XTCS 1GOTA 1EFUA 1JAIA 4HATA 1A4RA 3KQUA 1E98A 2GKSA 2ZE6A 3EA5A 3Q5DA 5FR2A 4BUJA 4MUAA 1SKQA 4TYYA 5JJLA 1GWNA 3TR0A 3HJNA 4RD4A 2J9RA 4P4UA 4EJSC 3AJIB 5H68A 3AUXA 1KHTA 4FWHA 1F48A 3ZQJA 4Q9IA 3LBIA 3QEJA 2WV9A 4NZYA 5FUVA 3A1VA 2OBNA 3QKSB 3ZVRA 2DVWB 4QRHA 1YJ5A 3AP2A 2BDTA 4MGZR 2KBFA 5TV2A 1GNPA 2FNAA 3IIJA 3W6PA 4C9BA 4LRSA 1B23P 5E7IA 3HU2A 1R5BA 2JJ2A 1S9DA 1W5TA 1EX7A 3T15A 4UXJA 2B7CA 3TLXA 4EIWA 1N6OA 3QUSA 4IOMA 5A0FA 2QMEA 5J4HA 1I2DA 2J1LA 2LKDA 2O8FB 4PANA 1AQYA 3ETLA 2J0UB 4OBEA 2PX3A 2OLKA 3U5ZB 5GADl 4PX9A 1D2NA 4ZIRA 4NYJQ 2ZSFA 2Q6TA 4GT1A 3R8FA 2C2HA 3H84A 3CX6A 4IKEA 4M22A 3EASA 1AZSC 4QGHA 1E2KA 2JJ1D 3MWJA 4G5SA 5DNYB 3MHVC 4BE7B 4W7SA 1WQ1R 1UKZA 2F9MA 3EIHA 1T3SA 1PUJA 1L4YA 5C4MA 2FSIA 4DCTA 2GCPA 2JAQA 5JEEA 3LLUA 3QXJA 3OHMA 1WXQA 1RYHA 4OK3A 2HF9A 4Q19A 1ONBA 2ZVQX 2HLDD 1CS4C 4BASA 1US8B 2XTMA 1AQUA 1R0ZA 1CRPA 2E9SA 3FWYA 2VF7A 3ADDA 2QRZA 5EE9A 4A4DA 1E9CA 2CCGA 5B57C 3F5FA 2ODNA 2HXSA 2JJ2D 4PC2A 5JMTA 3MLEA 4K8OA 4GSYA 3EX7C 1W1WA 2BIFA 4LZZA 3QOFA 1ZUNB 3P27A 2QBYA 2FH5B 5DLQC 3WBKA 5IF9A 4PFSA 5EJEA 2UZ3A 3GLGA 1J70A 1CULC 4NE2A 4P3YA 1AGRA 5J40A 3THOA 4FCVA 5FPHA 1RRFA 2D74A 2GNOA 1Z83A 3V4RA 3EIEA 1AS3A 5FBRB 1DAKA 1UDWA 4QBFA 4B3FX 3FOZA 4Q18A 2XAUA 2IYZA 4LJ8A 1DAGA 1NMXA 3CTDA 2F7SA 2QAGA 4C0SA 5J47A 3U3MA 1E6CA 1Q1EA 4Z54A 4C7OB 1HH4A 2WSMA 5FI0B 2IYTA 2X8AA 2GJKA 3VR4A 4HUQB 2EU8A 4X8HA 5DHFA 4I1VA 5JSZA 2C03A 2AWOA 1KMHB 4I1UA 4XH9B 3PFIA 1LFDB 2OILA 1EWQA 4LJ9A 1W4BA 1F60A 3R9IA 3Q8XB 3W3AA 2KBEA 1DAMA 3SYKA 4RD6A 3QPWA 4GZLA 3AKYA 4OHYA 1QHNA 2H1LA 4PO1A 4DCVA 1HA3A 3WMFA 5J4VA 3TH5A 2CL0X 3OIVA 1HE1C 1DELA 4Q1EA 2ZRAA 3JVVA 2AKYA 1UBFA 1U9IA 1DAHA 4UQOA 3Q7PA 3CNOA 3ECCA 2IL1A 2D2EA 4OQXA 3NBFA 3B9PA 3D3QA 3GLFE 1ZU5A 2J7PA 4RZ2A 3KXLA 5AWFC 5KDLA 1OH8A 4C0AC 4QNMA 1U0JA 4EAQA 4BFSA 4JZKA 3H2YA 4RVCA 2E1RA 1JR3A 5G41A 1OPXA 2QRNA 2YOGA 3Q85A 5B30A 2DWQA 3O47A 2FZLA 3VU9B 3C5CA 4C2TA 2ZJOA 1Z8FA 1FUUA 3AP3A 1Q22A 2G77B 2J7KA 2QSZA 4IDPA 4TYNA 1MH1A 2FFQA 4NU0A 2XOKD 1G8HA 2CLDX 1UKVY 4QJ3A 1P2SA 2DFKB 1RE0A 5KU1A 3V9PA 4F91B 2G88A 4IJMA 3MGCA 4Q21A 2GCOA 2PZGA 1X8LA 3CWZA 2CNWD 1XTJA 1ZNWA 2PJRA 4TSFA 3P4YA 2EYQA 2CHVA 5E7JA 1KDPA 3C16C 4I1OA 2Z6VA 2ZRHA 3ZJYA 2PZFA 2GF9A 4GMDA 4GMXA 3TK1A 2MSDB 1EGAA 4TQ9A 1ETUA 2ZR9A 2V8OA 4RKFA 2Q21A 4M9ZA 3CRW1 1O3YA 4YONB 1E2LA 2J7PD 1ZCAA 5SZJA 4YMTA 5B58C 5DSZA 4HSEA 3SJCA 1JALA 3EIQA 2C9CA 1ESMA 5FTJA 4Q4JB 3EWAA 2XEXA 4XIGS 3PEVA 5CYPA 4LSGA 1JR3D 3RS3A 5KNDA 4ZDKA 2VP2A 2HJGA 2WJHA 2YNMA 1GL6A 1QHIA 2P2LA 3BB4A 3L82B 2OHFA 4B3XA 1AKEA 1AJEA 1KIMA 4RD0A 2GXUA 5E4FA 1TQDA 2OCPA 3QVVA 4IOLA 1QG2A 4JVSB 1KMQA 4X8MA 3PUVA 2J0QA 2QM8A 3CRMA 1EWRA 4JJZA 2IYQA 2L0XA 1SXJE 1TL7C 2D4HA 2PZEA 4TT3A 1XRJA 3A1TA 3IDQA 3TUIC 4ASUA 5K8IA 2XSZD 3P26A 1ZJ6A 2MMCA 2NO6A 3NH9A 3K0CA 3K70D 4TSFD 1QDEA 1KI6B 1SKYE 1XU4A 1JQLB 1QRAA 5G40A 1YVDA 1P60A 3L8YA 4PC7A 5EP1A 1XCMA 5CB8A 2VP6A 3AGPA 3WRXC 4RD2A 3TQFA 4HZIA 1U0HC 3AVXA 2OBMA 2CE7A 2OCBA 2QE7A 3PUYA 3TSZA 1H8ED 2EYUA 4NHOA 3AKCA 3BC1A 2NO9A 4DLVA 5KDDA 1MABB 5TB5A 2OAQ1 4KITB 2VEDA 2XNDA 4AIIA 4QBGB 4XSHA 3B2EA 5JJIA 3QXCA 5IDVA 2Z5FA 4KVGA 3KKQA 2AD5A 1YKSA 3Q72A 3GLHB 1VHTA 3HDTA 2BCJQ 4WZBE 1EK0A 3HP1A 1DEKA 4A15A 1YE8A 1AZTA 1W4CA 3FMPB 3PR1A 2FOLA 1PVOA 1G9XA 1E32A 1JI0A 3ZIAA 2FE4A 3KW6A 4Q1CA 4TQUS 1N6NA 5JZVA 1R5OA 1CXZA 3X1WA 2CBZA 3E2IA 3TMKA 5AUPB 1KSFX 1WA5A 2O8EB 1W0JA 4UXHA 1IN6A 3FFBA 2J3EA 4LPSA 4PPQA 4V0MA 1FTNA 2F1JA 4BFZA 4DLZA 4TT3D 1SXJB 2ZRNA 3KFVA 3QG5A 4IDQA 3BFKA 3U7HB 3VKGA 1N6LA 1G1MA 1P72A 4O2RA 2RCNA 1BO6A 1OFUX 4TTRA 4LHXA 1M74A 3OAAA 1N0VC 2IYLD 2OM2A 4L5BA 5K8LA 4P33A 4RCZA 3RC8A 3RSLA 1BKDR 1ZNZA 4C4PA 2CVFA 4DDUA 3EXAA 2V3CC 1VECA 3VR1A 4ZI2A 1NLYA 2C04A 2BMDA 2NIPA 3QKTA 5DO9A 2QNRA 4Q1BA 4NCHA 2NZ8A 2QE7D 2WWGA 1NSTA 4C7OA 2YWGA 1J90A 3BH7A 2WAXA 3GFTA 2ONKA 4HUQA 2XNDD 3LY5A 1BIFA 3B6EA 5KNCA 1OXVA 3QXSA 1MT0A 2H8KA 2VPPA 4A0RA 1E1QA 3TJZA 1TEXA 2ODBA 2AK2A 3DVLA 3PIRA 3NC0C 2WKRA 2QPTA 4HDQB 5E3HA 3KTAA 1T3HA 2GEUA 2K5UA 3CF2A 4IEIA 1HTWA 3T35A 5CM9C 3AVYA 4FN5A 2ZE7A 3FE2A 3GPLA 2V4ZA 3G82C 4JLOA 3NEYA 3ZIAD 4OK5A 5L3VA 3P20A 4AKEA 1CJUC 3PEUA 3OIWA 4CRWB 3K0AB 4GDFA 4JYCA 1XPUA 3X2SA 1ZD9A 2ZRIA 2R6FA 2JDIA 2ZYTX 3N5CA 1YZKA 4FXPA 4KLZA 4MA4A 1W0JD 1XEFA 4YMVA 1FMJA 1KDTA 4M1YA 5F9HA 3AF4A 3B85A 3LH5A 3PUZA 3A4MA 4N1AA 5AJVB 1HT2E 3VFDA 2HYIC 2YZ2A 1QBKC 1W2HA 1N0UA 1YRBA 3LXRA 2XB4A 1Z6XA 4XVUA 3DHWC 2PMDA 2P0EA 1GVNB 1G3RA 1W49A 4RSGA 4LV6A 1JPNA 2ZJ2A 2P5SA 1U8AA 4PC3A 2JEOA 5BQ5A 2IF0A 2ZJBA 3K09C 3VU9A 4O0MA 4TLBA 4EPTA 1E99A 3A1SA 2D7DA 3SZRA 1VYUA 1ZC3A 1M7HA 2VSXA 2WMOB 2YWHA 1P73A 3PENA 3F3YA 4LGMA 1OT3A 1NVXQ 1EFTA 5TY0A 1QG4A 4MITA 3TRFA 1TUIA 2QEQA 3U3RA 4HB2A 2GTPA 1E1QD 4E03A 4CT5A 4ERNA 1W44A 4L8GA 1TQ2A 4NCJA 2GVZC 2R6CA 3QF4B 2GA8A 1ZNXA 2XITA 3QXHA 2QTFA 3F0TA 5H70A 4BFXA 2OESA 1FQJA 1G7SA 1N5JA 4MGIR 5FBWB 4WW0A 1T0HB 2JIZD 2VLIA 4PQYA 1GKIA 2FGJA 1E2FA 1DADA 4ZDIA 3EPJA 3WY9A 2REXB 4TWZA 3Q5EA 4LBZA 4B76A 2DFTA 1EXMA 4XVQA 3GLGE 3ZS9A 2ZS8A 3K0FB 4ZV4A 2CEAA 4EPXA 2ZSDA 3QXXA 5JLJA 4DEYA 4DCNA 2BVNA 4DHEA 5FUWA 1OFIA 2Q9BA 2H17A 2VSOA 4UNNA 3LV8A 4Q4HA 4Q01A 4YMSA 2ZTSA 4Q4JA 2JJ8A 4CIDA 5J5CA 2N46A 1UF9A 4ZDJA 1E4VA 1T5IA 2QZ4A 5J4YA 5L3SA 5EUQB 2ZRCA 2XB2A 4JVLA 521PA 2MMGA 4NDZA 3BGWA 2QI9C 4FWTA 3FTQA 5GVSA 5D3QA 1XEXB 3T5GA 4MRSA 1G8YA 2B6HA 4WZ6A 2CL6X 3WMEA 4BFUA 1N25A 4IOJA 1Z0KA 4BWYA 4EFLA 3AF3A 3V4FA 5LB4A 2FSHA 1P2VA 4RCYA 5DN6A 2R6GA 2WWFA 4P4SA 4Q4LA 3BWDD 4L4UA 2F3RA 2H57A 3HPRA 3ONWA 4R2HA 5KO2A 1KGDA 2WVJA 4US0R 1LNZA 3H0KA 4I1SA 3ICEA 221PA 3DZ8A 3ZGXA 2V1UA 1VCMA 3E5HA 4JBXA 2C9OA 2BMFA 4PTLA 4TMTA 1KI6A 3BK7A 4PZYA 1AA9A 2F9LA 1S8FA 1X8JA 5EP4A 2IT1A 3U7FB 5EUMA 5JI2E 1TPZA 5JHGB 1KI7A 3AVVA 4ILEA 5JWOA 2CLSA 3GLGB 2J41A 3PVSA 4DLSA 1AS2A 5FOXA 2QT1A 1KK0A 1JR3E 2YOHA 5BW8A 1WDTA 4G1UC 4K46A 1D5CA 2REBA 3GJ6A 5KSOA 4YMWA 2VL7A 1W36B 4URXR 1WP9A 2YHSA 1G20E 4LK2A 3LW7A 2EFEB 1W2GA 1FNNA 3THWB 2W2VA 4ARZB 3PJRA 1Q3TA 1ZCBA 4LJ6A 2BOVA 3GLHA 2JCSA 5G53C 5AJWA 5FL7D 4G5GA 5JSZB 2UZIR 3NBXX 2QTVB 8OHMA 1SVIA 1LF5A 4HYYA 4G5QA 1KO5A 2NOAA 2GZDA 2PCJA 4OI2A 1N6RA 4JKYA 4LI0A 4CT4B 1NMZA 1OXTA 4DJTA 2PL3A 3FYHA 3W8NA 1R0WA 1KDOA 2JGNA 5FPKA 2OUKA 1D9ZA 3AKEA 3PCRB 1W0KA 1COWA 1OLOA 3CNLA 5CIQA 4ACBA 4IW3B 4EPYA 2ODWA 1NG1A 1ZW6A 1GAJA 4IVRA 2RGNA 4QKQA 5KTYA 2YOFA 2RGGA 3SJAA 2FFBA 4DKXA 4QOSA 1M6NA 1GTVA 4QJ4A 1CP2A 4LYHA 1F2UB 2VP9A 3A58B 4LJYA 3KXIA 4AG6A 4B48A 5JJKA 1QHGA 4TTPA 3ZZ0A 1UKYA 3G5UA 3ZLJA 4HB4A 1C4OA 2DWOA 2AHOA 3W34A 2ZYWX 2H5EA 4TLAA 2IX3A 3RS5A 2OT3B 1NP6A 2GK6A 3C4JA 3O8DA 4Y0VA 4DB2A 5EE0A 1UM8A 1H65A 2BBTA 3H1TA 1FL9A 4Q48A 5JRJA 1ZBDA 2BEJA 1L2TA 1E4YA 4EJSA 3EZ9A 2GAOA 4KFTA 3QSYA 4IXMA 3DL0A 4XWAA 4GPTA 2WWXA 1U8YA 4JS0A 1XPRA 1U2RA 1DARA 4XOIA 2GJAA 3U3KA 3UK6A 5E95A 1XTIA 1OFTA 3D7MA 2KB0A 2ZRKA 4A3VB 2WPDD 1NI3A 3UANA 5KYKA 1T3LA 3NBZC 3NKVA 2PX0A 4D81A 2WKPA 1DAEA 1II0A 1W0KD 1COWD 2A5FA 4ZKDA 1P9WA 1SXJD 1VCNA 2VH5R 3CLVA 1JB1A 1DAIA 4OI1A 1Z2CA 4AYWA 3CPEA 2DPXA 2R9VA 1NKTA 1ZD8A 1OXSC 1Z29A 2YWEA 1T8UA 2J59A 3FHCB 821PA 3PUXA 3RHFA 5IK2A 4GI7A 4CEJB 1GNRA 4TQAA 1Z28A 5KUTA 1X86B 2FF7A 1NKSA 1Q44A 4TTQA 1XMSA 2UVQA 1UKEA 3S1AB 3WHKA 3OESA 1PZNA 1TNDA 1SULA 1J8YF 1JNYA 2BJVA 2P5TB 1E9BA 1T6NA 3TUZC 1TF7A 3IQWA 1JECA 4LPKA 2JASA 2RHMA 3CKLA 1ZM4A 1KJWA 1Z06A 2XXAA 1OJLA 3REGA 1E3MA 2OV2A 2GILA 3QF4A 4GOKA 4ZO4A 3MFYA 1XD2A 4OL0A 5AR1A 421PA 5IRCD 4W9MC 5FTNA 5CB6A 3CPJB 3B5JA 4V0ME 1I4LD 3KDSE 4DBLC 3GMTA 1PV4A 3K53A 1GRQA 2QORA 5JS7A 1QHXA 6Q21A 1XTSA 2BCGY 2GZAA 2WHXA 3NWJA 2I4IA 1JQJC 1XEWX 4TZ0A 3EAQA 4G5RA 4D0NA 4UXIA 3K0FA 5DISB 3X1XA 3IBYA 5AJYA 1OF1A 1ZP6A 2BWJA 4XVRA 3RABA 5EQTA 4RZUA 3VR2A 2QP9X 2W0MA 2LWIA 2OFXA 3TBKA 2ZEJA 1YZQA 4QBIA 1E2QA 1N5LA 2EW1A 4PZLA 1SVOA 5IK2D 4LJ5A 1KSJA 2ZS7A 3B13B 3WYAA 1KSHA 1RVDA 4MKGA 5EP2A 4ZCIA 2XZLA 3EZ7A 3SBDA 4JLMA 4PHGA 1G6OA 2WBLC 2HV8A 3AV0B 4O25A 2A5DA 1XEXA 1JJ7A 4KV9A 1FW6A 5KSYA 2QL6A 2V7QA 4JL5A 2X2FA 4LBYA 5AUOB 4LJ4A 2IWRA 3AVPA 2ZUBA 4R98A 2EFHB 5JCZA 1LV7A 3SN6A 4NYMR 2VO1A 2F3TA 4QGAA 1OFHA 4F4CA 2DFNA 3SNHA 1WBBA 3NVAA 1R0YA 2WWIA 1J2JA 3AUYA 1HURA 4U5XA 1FX0A 5GVRA 2F55A 2JLVA 2Y8EA 3MG9A 4IXNA 3BB3A 2ZRMA 3QG1A 1ANKA 3I4LA 2ZAMA 4Q9LA 4BZXA 3SQXA 4M0LA 3L0OA 4A2PA 4CYMA 3ZD7A 4OQNA 4G0NA 3IEUA 3I8XA 4MQBA 2BBSA 4NTZA 2J0SA 3BRWD 1FUKA 3K9GA 4JVNA 2ERYA 2KE5A 2DR3A 2NPIA 2O8BA 5JECA 1E79A 2R44A 3CPHA 4Z8YA 3GJ8A 5EE3A 5KPJA 1CR4A 1F3OA 3AQ4A 4QXAA 3FMOB 4UNRA 4L16A 4LRWA 3AP1A 1Z22A 2A7QA 3THWA 2VSFA 4LC1A 4ARZA 4H9GA 4C0HA 1Z6AA 2IC5A 1XCPA 1DG3A 1I4TD 2IWHA 2JLRA 4YXWA 1GITA 1OW3B 3CB4A 4WVFA 3QIAA 1NLZA 1E2IA 1P3JA 1ZRHA 1EX6A 3KTAB 5CK4A 4GITA 4KLNA 1GM5A 4D2IA 1P5ZB 2N42A 3QEOA 4TL8A 3ZS8A 3AVUA 1E2NA 2MSCB 4DCSA 1NVMA 1ZNYA 2FZ4A 3GCGA 4M1WA 4S35A 4UNPA 121PA 2ZE5A 4D26A 3CNNA 4DLYA 1ZIOA 3AM1A 3JZMA 1KAGA 3AF1A 1II9A 1G7CA 1VCOA 5BWMA 4CF7A 3TSOA 4OI0A 2O0KA 2BHRA 2XNSA 1ZM7A 3GJ7A 4PHHA 4UJ5A 5LDDC 3K9NA 1YZNA 3PQCA 2ZSAA 3UMFA 4KAXA 1F2UA 1BS1A 1VMAA 3MCAA 4PPGA 2AWNA 1G8FA 5FPTA 4V02A 1XJQA 3X1DA 2ZJAA 1Z5ZA 3ADKA 4Q66C 1CR2A 1JXMA 4QG7A 2Q3HA 5HKKA 2R6AA 2DY1A 4KFRA 1Q12A 4JJKA 2IS1A 2SHKA 1AGPA 3MMPA 1W36D 4HAYA 1R8SA 3SBEA 3UMRA 4V0LA 5EP3A 2GESA 2ZRJA 1KK3A 4LYAA 2WWHA 3A4NA 4GNKA 2A30A 1R6BX 4DLTA 2QW6A 3EZ6A 2HEIA 2D3WA 3J81k 1CR0A 3FMFA 3MUFA 3GP8A 3ZZUA 3R9WA 4A6XA 1VPLA 4NCKA 3RS0A 2QGNA 1UEIA 1OHHA 1HUQA 3WXMA 3CO5A 5HR5A 5GJBA 4RZXA 2Q3FA 4GBMA 2IF2A 1FTSA 4HB3A 2GRJA 3UG6A 1X37A 4TZ6A 3DM9B 1ZM2A 5JWRA 1S9HA 1PLKA 1TADA 3OE7A 4DDVA 1BH2A 2Z43A 2RH5A 4LJ7A 4PC6A 3RDPA 3TVDA 4A8JB 2DCUA 2A5GA 4FCWA 3QBVA 4V0KA 2IYWA 4DSUA 3T1VA 5FOUA 1A1VA 4JLBA 4JBYA 3VHLB 1G5TA 2D2FA 3K9HA 4URWR 2RGXA 4KSBA 4S2EA 1TQ6A 4IHQA 4Q4HB 2A78A 4LC0A 4QNRA 3I62A 1KK1A 3W9YA 2EVWX 1R10A 3S1AA 4MRNA 4U7DA 4AKHA 4FWIB 1GZSA 3A8TA 5L8VA 4IEEA 3SDZA 5IHPA 3GLHE 5LD2C 5L3SB 3I3SR 1IHUA 4FWGA 2PBRA 1RZ3A 1OIVA 5FUYA 3BGEA 3KJHA 1E0KA 3EC2A 4CEIA 3UG7A 4MYCA 3UMSA 5EXTA 2Q9CA 4JLAA 4AKGA 3UXMA 4Z8XA 1ELOA 2QA5A 4M21A 4CDGA 4D4JA 4HAXA 1IN8A 4MYHA 5HCNA 5H8WA 3ZD6A 3TVTA 1G3QA 2C8VA 4P4SB 4DDWA 1XD9A 4KODA 3QF7A 2NPFA 4ESVA 1P9NA 1OHHD 5CM8B 4RFVA 3VR5A 4ZCLA 1CKEA 1K8RA 3CRRA 2NO0A 3KKNA 2ZR0A 1G6HA 1RJ9B 1CR1A 1NY6A 2WJJA 4XD7A 2PMKA 3FMIA 4AYTA 4LV8B 4U00A 3BERA 3H4MA 2FX3A 4JMPA 1FPMA 2NTYC 3OE7D 4QGGA 2RGCA 4EPRA 5BN5A 2YC2C 1YR9A 4NYIR 4DXAA 1IXZA 1KK2A 2BKUA 4NYMQ 4P32A 3BFXA 4WXPA 3KKMA 5FBQB 3K70C 3EARA 5KSZA 2G1KA 3QPUA 4I81A 5F98A 2CHQA 4BGDA 3B9QA 1P4SA 2RGEA 1E9RA 2ZJ5A 4P31A 4Q4AA 5FTLA 4DUGA 3GFPA 4DSNA 2G3YA 1WCV1 4DRZA 5C18A 4A1FA 4YDSA 4DIDA 3RNLA 2JLXA 2IYYA 1XZQA 3PITA 1SHZA 1QZMA 3QENA 3BOSA 1CRQA 2CJWB 1FNMA 4MRPA 4PPFA 4EFMA 2F1HA 2BBWA 2ORWA 1JEEA 2FWRA 1ZMXA 1SVKA 2CL7X 2FGKA 4MYTA 4RD1A 1XPOA 3KJGA 2A3RA 1OH6A 1G19A 1OYWA 3RVBA 5JEDA 3RWMB 1CIPA 1V5WA 1FP6A 3EG5A 1P9RA 4ASUD 3NTUA 4BECA 4B75A 1MRNA 1KZGB 4TMXA 4JSYA 2HF8A 4KFSA 4US2R 4QHSA 2FPLA 4G01B 2V6ZM 4UKDA 1U90A 3LDAA 2C96A 1S3GA 1EESA 3AH8A 2YC4C 2C98A 2D06A 3QQ5A 2CHGA 3EW9A 2LCFA 4Q00A 2FA9A 2FU5C 2E87A 3CZPA 4C3ZA 2HCJB 5HE9A 3KQKA 4IDOA 4OQFA 4JLKA 2YWFA 4DLRA 4D80A 1IM2A 5CLLA 3WNBA 2NQ2C 3MD0A 4AURA 1S0UA 1LW7A 4DUGD 4Q9JA 4EJSB 4MKIA 3WP1B 3W5IA 4M1SA 2DHRA 2ASEA 1E69A 3FKSA 2QPAA 1N6PA 4PAQA 4B2IA 4E09A 3QPVA 2OBLA 4AC9A 2OZEA 4FW9A 2P6NA 2QQEA 4D0LB 1Z0DA 1T91A 4B3CA 3LO5A 2XGJA 3T1OA 3U44A 3GLIA 4CVNA 1VG8A 4KU4A 1SVLA 3HR8A 3DOFA 4RD3A 1Z6YA 4IFBA 5DH9A 3WMGA 1T4GA 1XMJA 2ZRPA 3U60B 1E1RA 1IJFA 1MO5A 2RKOA 4FD2A 3EPLA 5EXPA 1PUIA 3WHLA 1GDDA 4KCGA 1Q57A 1AN0A 3B1ZA 4OQMA 4QFMA 4TL7A 2CK3A 1ZM9A 3OAAD 2O8DB 2AX4A 2B8TA 4EPVA 2REOA 3B1WA 4DZZA 1E2GA 3GJXC 4GP6A 4WIAA 1LS1A 4OHZA 2ZM5A 5JRZA 5LB2A 4D4MA 3OEEA 1NBMA 2JLSA 4MRRA 4QHTA 5CJ2A 1G3UA 1CTQA 3B82A 3OFNA 5F9FA 1W4RA 1XFAA 3DMDA 4FMCF 5FBLB 3SQWA 2J87A 5IT5A 3JZAA 3RRNA 4CEHB 4IDNA 3LVRE 3NIBA 1JPJA 4II7A 2FN4A 3CBQA 4KJZA 1Z63A 4FWDA 4IVPA 3RANA 1HV8A 1SVWA 2F43A 2YYZA 3A1UA 3NDPA 1F5NA 4LUCA 4MGYR 4QL3A 1J7KA 4B73A 4EQ6B 2OXRA 3HYTA 2XXAB 4HZUA 4C0KA 2BV3A 1TUEA 1XD2B 3PG5A 1XBTA 3CIOA 3FKSD 4WZAE 2GDJA 2GEDA 4E5UA 3BFVA 1G4AE 2VHQA 1M7BA 5AJXA 2AKAB 4MH0R 3VX4A 1Q20A 1ZIPA 3CZQA 4BFYA 2B7BA 3PUWA 2PEZA 3N70A 4DEXA 5JCPA 3KUCA 1DPFA 2JDID 1IQPA 2ANBA 2XZPA 2IS4A 621PA 4A8JA 1MO6A 1NF3A 3BB1A 4O2LA 3R7WB 2VBCA 4QM7A 3OEHA 1AS0A 3MSXA 1E1RD 4TL9A 1GP2A 2F1RA 4HUTA 1E94E 2ORIA 4B47A 4NPHA 5DE3A 3QBTA 1Q3HA 3THXA 1XWIA 1R8QA 3T61A 2OFWA 2H92A 4DCUA 3U6KA 4CEJA 3R9XA 2CK3D 4A0GA 3ND8A 1L4UA 3T1QA 1P62B 1N5IA 1GL7A 1PJRA 2QQ0A 3QVUA 3TR5A 4BLRA 3L2OB 3OEED 1NBMD 2I1VB 4GL2A 2BEKA 4F92B 4Q02A 2H18A 3H86A 1PLLA 3N2EA 4GRAA 4MKFA 3FVQA 2V6IA 3B1VA 4KYUA 4LV5B 4OI4A 3RS7A 3W3ZB 1TMKA 3I5XA 4Z1MA 5F2EA 4RJLA 1G3MA 3HU1A 4KVAA 3ZDQA 4B2PA 1DO2A 3TGPA 2JATA 4D82A 2VP0A 1EFRA 2GBLC 5FFMA 1XXHB 3C15C 4NCIA 4JL8A 3KKOA 2R2AA 3NH6A 1LS6A 3LD9A 2G83A 3VAAA 1NN5A 2R9GA 3NC1C 1FX0B 1E0JA 1XCGB 4NYIQ 4M1KA 4PO9A 4AWXA 1DOAA 1GRNA 1CU1A 2ZI9A 1RJ9A 1U98A 2GAAA 2WAYA 1TTTA 3CX8A 4WBSA 2QMOA 3FB4A 3A1WA 4BEBA 3UIEA 4XJXA 5HZHA 3CW2A 2ZXUA 5BYJA 3NHAA 1NJFA 2ZI5A 3BAFA 5FI1B 3IKJA 2QN6A 4M9XA 3KL4A 5ANRB 1GFIA 2NG1A 2KWIA 4W5HA 4ESHA 1VKJA 2C77A 4PSKA 1M34E 3AVQA 4C2UA 2O8BB 1YQTA 3QKRB 1IXRC 1HY3A 1S4QA 4X8OA 3DKPA 1HQYE 4DVGA 4GFDA 5SZKB 4NP6A 4AYXA 4B6FA 3SYNA 4V0OA 2IYSA 2QP4A 2WWYA 1KI1A 2J5XA 1G18A 4PAMA 1GUAA 3RYTC 2B92A 3LQRA 3FPAA 3DDCA 4IFEA 2ZRFA 2FEMA 2W2TA 3RSOA 5BN3A 5JHHB 2CJWA 2G0TA 1II8B 4JLNA 1DAFA 4Q1DA 5A4JA 1G3IA 2BC9A 2GF0A 4HB0A 4LHVA 2JA1A 4KXFB 1Q0UA 5DGXA 1EFRD 2H7VA 4OJKA 3SC3A 1NN0A 2O0JA 5DN6D 4MYUA 1CJMA 1ZU4A 1ZUIA 4A0HA 1VG0B 3KZ1E 1SHKA 2JLYA 4RY2A 3U61B 5FTMA 3ICQB 2WWWA 1IY1A 2B8WA 1ZM3A 2QMUA 3FKQA 4JLJA 3IEVA 3GEEA 3KQNA 4FINA 1AM4D 2RHDA 2ZI4A 4QHYA 1E2DA 1YZUA 5EZ6B 5LPNA 2ZUCA 5KSPA 2IYRA 2ZRBA 4B2LA 5BXQC 4H1VA 2WZQA 3ZZTA 4BZPA 1XZPA 5H1YA 3D31A 4IRUB 3BE4A 2WSSA 4J0QA 4R7ZA 2QSYA 3MWLA 2IYUA 1RIFA 3K0EA 1RFLA 1GNQA 1Z0JA 3ZQ6A 4DIEA 4HAUA 2F1IA 1D2EA 3VX3A 3X1YA 5FH9A 2KRKA 4OJQA 3LNCA 3AVWA 1KNXA 3BS4A 4M9QA 2OCAA 1DO0A 2H16A 3SJZA 5DIFA 1U8ZA 3OIUA 5GJVC 2Q0HA 1UDXA 2WIAA 3M1IA 3UKDA 4OHVA 4ZPXA 4B3GA 3B1XA 3QJYA 3TUJC 3U7EB 5SZHB 4B43A 4HLUC 2HDNB 1MO3A 4K81B 5DI3B 2EWVA 4A92A 4LOAA 4B33A 3THYB 1V43A 3G0HA 2BBOA 2FG5A 4M1OA 5LBIA 4HEJA 1TU4A 3DKVA 1KNQA 4LCBA 3SHWA 1NRJB 1M8PA 5K8TA 1Z47A 4PR0A 2JLZA 2WTUA 2OO7A 2ZJ8A 4LBVA 5J4KA 3TE6A 4P4TA 2C9YA 2G6BA 4MDEA 1VTKA 1XB2A 1B0UA 4BLSA 4U02A 3LFUA 2VYFA 4GOXA 3EPKA 2O8DA 5CIWA 3TAHA 4NH0A 4GZMA 2QENA 2W2XA 1FP7A 2IXEA 1SVMA 1WE2A 1S1MA 2ZU6A 3BJIC 2YVUA 1ZUHA 2WJYA 2D7CA 1E9DA 1KO7A 1Z08A 2WSSD 1Z3IX 4B74A 4EPWA 3RRYA 3TAUA 1GL9B 2J45A 5A5GA 2ZQ5A 3I1FA 3GFOA 3GEHA 3O8RA 1SXJC 1IAQA 1TU3A 4CEHA 1CEEA 3SE0A 2BJWA 2RGNC 4US1R 1UPTA 1FFHA 4URZR 1W5SA 4LRTA 1KOFA 3SU8A 2AXPA 2BMEA 2O5VA 1G21E 1RRCA 5CYOA 2P6UA 4BLTA 4B32A 1NG9A 4EQ6A 4L9WA 4F4JA 2YINC 2O8CB 1F2TA 4CEIB 4TMWA 4M1TA 1J8MF 2G1JA 2UKDA 4BZQA 2HJVA 3B8HA 3PEWA 3CUEF 1KSGA 1OB5A 4EUNA 3NHBA 1IXSB 2ATXA 2OE2A 1YZGA 3HPQA 4A36A 3PXGA 2AL7A 1TEVA 1RYFA 4MRVA 2WM9B 1YR7A 1YR6A 1AK2A 4C0JA 3R7WA 3KJEA 1G41A 4Q03A 3VHXA 1XTRA 3DM5A 2HLDA 1MRSA 1NVVQ 1O87A 4PSVA 5AUNB 5GJCA 4AK9A 4GP7A 4DLXA 1QF9A 3WBJA 4WA7A 2JLWA 1IY0A 1EG7A 2FSGA 4M2LA 1OH7A 2NGRA 5FPSA 3U6BA 1E96A 5AK0A 1EFHA 2VP5A 1G7RA 1HQCA 2TMKA 2XJ4A 2FJUA 1ZVQA 4FMCB 1GKYA 2IS6A 2FV8A 4JN6A 1RW4A 3HU3A 4X8LA 2P3SA 1ZINA 2CXXA 2ZR7A 1IJEA 3KB1A 4Q5IA 1EFCA 5KOYA 2NMVA 1T8TA 3NBYC 4Q4AB 4Q1FA 5ELXA 1WRBA 4DB4A 3TSWA 3BIFA 4LX0A 1S1CA 1ZYUA 2AK3A 2QUZA 5FOTA 5FUXA 3IBGA 5HTKA 1OE0A 1RRPA 1XXHA 2OCYC 3IIKA 4DLWA 1G291 1JR6A 3TIFA 3E1SA 5L3RA 2WICA 3ZVMA 1QHHA 5L3QA 2HXYA 2IUTA 2PJZA 1MO4A 3KKPA 1T9HA 3GLIE 3KUDA 2W6JA 2XZOA 1K5GA 2VHUA 1CF4A 1G64A 3ZVNA 3SFVA 4A2WA 2RMKA 3I92A 4B35A 2W6IA 1KO8A 1W4AA 1YU9A 2I3BA 3X1ZA 1ZC4A 2ERXA 4JLVA 3K1JA 4RFSB 5CLQA 3U4QA 1KI3A 5FTKA 2D62A 4YLGA 2HCBA 4KO8A 1KI2A 3QKRA 2IXGA 1NBME 1NN1A 4D4KA 1LVGA 1NN3A 3L0IB 4QJ5A 1BYIA 4R9UC 2ODEA 2XTZA 4HAVA 3ADBA 1KJYA 1OSNA 4BLQA 3IO5A 1WMSA 2OSBA 3BD9A 3TW4A 3WYFA 1TF5A 3HWSA 1X1SA 5C1BA 2FSFA 2IK8A 5FBVB 2GZHA 1CJTC 1KKLA 3MWKA 2CCJA 4PQRA 3U3OA 4M8NE 1II8A 5EE5B 2V7QD 3EWSA 2QTHA 1M2OB 3RS4A 2JLQA 1VYTA 1OIWA 4B6EA 2EFGA 3VMFA 1HT1E 4NCNA 1KY3A 3T1TA 1E0SA 1UFQA 3Q7QA 3U44B 2W6JD 4W5WA 3GLIB 1Q1QA 2PT7A 3CH4B 2GEVA 1VG1A 3PV0A 2ZS9A 1N6IA 1Z07A 2I1QA 2XOKA 4G5OA 5AUQA 2GHIA 2J46A 2W6ID 2WOOA 1ZD1A 4MUBA 1S96A 4O3MA 2ZVPX 1U81A 2C5LA 1PLJA 3KX2A 3A6PC 1SGWA 1LB1B 2HT1A 5B2ZA 3I72A 4YC7A 4LWZA 1KDRA 4TMVA 3AEZA 4BLOA 4DDTA 2CNWA 3ASYA 4WAUA 2W83A 1OV4A 3KQLA 2YV5A 2DB3A 4DSOA 1E79D 1XDBA 2PEYA 3L0SA 1RC8A 5HE8A 2WKQA 5CDFA 3VLFB 2ORVA 4MKHA 2C78A 4KI0A 2FDCA 3VQTA 1XNJA 3GJ0A 4JSTA 2PCLA 1TAGA 4R2IA 3KJIA 3Q9LA 3F8TA 2AFIE 2QP3A 3B60A 2BM0A 1OXUA 3U7GA 4UJ3A 4YXWD 1XJ0A 1MV5A 3N2IA 4Q7MB 3CR8A 1IN7A 2F43B 3THYA 1Z6GA 3P32A 5DI3A 2DBYA 3I5YA 4HZUB 3VNVA 3SHFA 1G16A 2ZRGA 4AD8A 1W36C 1M1YE 4EKDA 1X1RA 2QAGC 2ECKA 4M9SA 5D3MB 2P65A 1T5LA 3LX8A 3GJ5A 1GILA 3U2QA 3DZDA 3EC1A 4KFUA 3M4YA 3EZ2A 2EWWA 4KSCA 1R0XA 4Q7KA 1Z0IA 1Y63A 3K9LA 4OYHA 4CZ2A 2MSEB 1JXOA 3W6NA 4IVQA 4YQFA 3LXXA 1XX6A 1YZTA 2GETA 3FFAA 3THXB 4LHWA 2FEOA 2Q3MA 1U94A 1GRRA 1CJVC 3I73A 4LDJA 2AXNA 5AJZA 4XWKA 5HPYB 2XSZA 4F38A 1OB2A 2A5JA 4JT4A 4LYJA 1AIPA 4Y0AA 5HKKD 4NONA 3B7GA 1WF3A 3KFXA 4DWJA 2ZRLA 4UNQA 5EXXA 1N6HA 2W58A 4FMBB 2RGBA 2VHTA 1LF0A 4TYWA 1U9IC 2ZAOA 5B64A 4TYQA 1D9XA 5FL3A 1RRGA 1G5PA 1UEJA 2WMNB 1OKKA 2IHBA 4LY6A 2O8CA 3LA6A 1I2MA 1KO4A 1DE0A 2BKEA 3OZXA 4V0NA 3RLFA 1H8EA 4DT1B 4ACAA 3ADCA 1NL3A 3L43A 3KB2A 4OQLA 3GLFB 2KJQA 2WJGA 2ZUDA 1W46A 1G5RA 4Q9HA 5TVKA 4TLEA 2RB4A 1E2PA 1N5KA 2XJ9A 1R2QA 2XTNA 1IBRA 2P67A 1N0WA 5KNBA 1ESNA 1Z6TA 3WRYC 3T34A 2A5YB 4A6PA 3U3JA 5SZIA 1N2CE 1QVAA 2OLJA 4WOPA 4QM6A 5FOVA 3R20A 1NIPA 2LKCA 1IONA 3C7KA 2R6DA 2ATVA 3CH5A 2DFLA 1G8PA 3QKSA 5G3YA 3OIYA 4B3BA 3LQQA 4FMDF 4TLCA 4BEJA 2X19A 4LJAA 3CF6R 3TNFA 3TKLA 2ZRDA 2ZJYA 5TARA 3GEIA 3CRVA 5GJWC 3UWOA 1G17A 2R8RA 4HDCA 2QAJA 1BYUA 2GJ9A 2B21A 4GOJA 3TQCA 1UADA 3M6AA 2C99A 4OHWA 1YHNA 4D25A 1NIJA 2CCKA 3AF2A 2ZSBA 3DEFA 3ZVLA 5JS8A 2O8FA 3M0EA 1YZLA 2RAPA 2JLUA 2J0UA 2HUPA 4JYBA 1A82A 2ZYUX 3GD7A 1KJZA 1FOEB 1Q1ZA 5CJPA 1OKKD 2CVHA 4JIMA 1MR3F 2QGZA 3WP0A 1KI9A 4Q1AA 2GCNA 1I4DD 2NZJA 3O8BA 4B34A 1MKYA 4XWOA 4AKIA 2AFHE 3SFZA 3VR3A 1P2TA 4Q9KA 1N3BA 3CR7A 3GQBA 4JLPA 5EE1A 4PXAA 2IS2A 2OAP1 1L8QA 4N0EA 4TMZA 4RFSA 2A9KA 4RKEA 3VKHA 2KI5A 4XD7D 2VA8A 2C95A 1US8A 4LHZA 2G0NA 4E07A 3SJBA 4ZI3A 3QI2A 1A7JA 3W90A 2NO1A 1VIAA 3VR6A 2ANCA 3CRQA 3I32A 4HAWA 4QC2A 4XSGA 2AD1A 4L9SA 1FZQA 2ZIAA 1NLFA 2AR7A 1Z2AA 3IIMA 4JLDA 4L15A 1C9KA 3K09A 1DVRA 2DYKA 3RRZA 1NJGA 3I8SA 4M53A 5G3ZA 2V55B 3DOEA 2OG2A 3BBPA 3L0PA 2PH1A 1KI8A 3K0CC 4URYR 3WYGA 3SYLA 1E2JA 3FDIA 1UBGA 4Z51A 1F6BA 1SKYB 2AN9A 2ZSEA 3FGNA 2ZE8A 3HYRA 1JJVA 4CW7A 4HAZA 1XJCA 1XP8A 1U0LA 3W8RA 1P7CA 1P75A 4A9AA 1M7GA 3NEJA 2CLCX 4PQFA 1X8KA 1RKBA 4TL6A 3SOPA 5C46F 4W5JA 2ZPTX 1HYQA 1K5DA 4TMKA 1NSFA 2F6RA 3FHOA 1KMHA 2V9PA 3LWNA 5DYGA 3R8CA 1KYIA 2GJSA 2CE2X 2ZU0C 1XTQA 1JBKA 4NKRA 4POAA 5FPYA 4CGZA 3K8YA 4HLDA 3MJHA 2Z0MA 3B1YA 4PAOA 1LY1A 1GSIA 1W7AA 2JIZA 4LYFA 1R4AA 2IUSA 1VCIA 2R62A 2ZREA 1E9FA 2IEYA 3BXZA 2NO7A 5CK5A 2QY9A 4YDHB 2VRWA 5J4LA 1H8HA 5JWHA 4H1UA 1TF2A 3CM0A 3EZFA 1UBEA 1XMVA 2VP4A 3HR7A 4PC1A 5FOSA 4ON9A 3SS8A 4E22A 1VYVA 2ZI3A 2FFHA 3Q3JB 3BORA 2PLFA 4BFWA 2GJ8A 2XX3A 3MAAC 4FIDA 3QNUA 4JBWA 4A0FA 3EPHA 5FR1A 3IILA 1SVSA 1XXHE 2QROA 3W5JA 4ZDWA 2GBLA 1S3SA 3C41J
chains in the Genus database with same CATH superfamily
2QRHA 4KR7A 4B87A 4REQB 5JT1A 1X9GA 2YIJA 1OQAA 3UQZA 4RTQA 2QTZA 3OPQA 3ZBUA 3A6FA 3LAWA 4FLMA 3VTKA 3I9LA 2CLIB 3ROXA 3BIOA 3I28A 1RNLA 4DSTA 4DA4A 2R2GA 3ELBA 3HACA 1OTHA 5DI9A 1QU2A 3T06B 4ZIRB 1XVIA 2QN1A 3AJ8A 2DZNB 2NUTA 3OOEA 4WURA 2JKZA 2XE7A 3SNKA 3M9WA 4JYAM 3RTEA 4C0QC 3I1JA 3MJFA 1QB7A 3TRJA 4EZIA 2H0AA 3MJRA 2IYVA 3LOPA 5FWAA 5MFPA 4DHWA 4BNIA 3H19A 2X8BA 5IHXA 2N47A 1OI3A 5IWAM 3GMIA 1XN1A 3DMNA 2X5JO 4ZQHA 2B4KA 2X77A 4H7IA 4ND4A 1LLFA 1N8SA 4R51A 3WNDA 1AQ6A 5I3CA 1TDJA 3LCVB 2BR4A 3LKBA 1QIDA 1PQYA 4R1NA 2WPDA 4BBAA 5IBQA 1JKFA 2WD7A 2ZROA 2WC1A 2CZGA 4AMBA 1OREA 1R5JA 4M55A 1W47A 3AKDA 2BM1A 3MIZA 3NXSA 4DMMA 3RC3A 4WXRA 1IG3A 1GPAA 1MG0A 4NMWA 4EFNA 3C14C 4FD3A 5PNTA 5TMPA 3FHTA 1NI5A 1TDZA 3E9YA 1G20B 5FHQA 1D6JA 3KXKA 4XEHA 2J7NA 4RV4A 1N33M 4RV9A 5FI3A 1FLAA 2PL1A 3I3OA 3K0AA 2JUJA 3ZGLA 4MV3A 1UBRS 5FJJA 1FBNA 3NHUA 4RSMA 1GJSA 1QHEA 4ND5A 3OG9A 1J0DA 3P8ZA 1IQRA 4H3VA 3A9WA 1PNVA 3VC7A 5FR2A 5DNVA 3TEMA 4MUAA 3BD8A 4D45A 4EJSC 4EUSA 3AUXA 4Q9IA 1J8QA 1Q1NA 3VH1A 1QXSA 3ZVRA 4M0CA 5TV2A 3H5AA 4JD5A 1S2NA 3KVOA 2Y71A 4EIWA 3A4VA 3F6RA 2E7ZA 3DMPA 3N87A 1VG5A 4NYJQ 4MXDA 1UBTS 3JQ9C 5AXCA 4DADA 4D8YA 1PE0A 4QO8A 4BE7B 2IZ6A 1PJZA 3GRAA 5C4MA 1DCKA 2FSIA 5EWMB 3LLUA 3QXJA 1LJUA 1I33A 4OK3A 4W5OA 1E1DA 3I6YA 1AQUA 3R7AA 4DV4B 3W2EA 2QCUA 1DCMA 1Y8ZA 1ZICA 3QWAA 2JJ2D 3BIWA 2WPNA 3WRWA 4K8OA 3EX7C 5IASA 1FNBA 1VZ3A 2FH5B 3IPCA 2H1SA 1R4MA 4NE2A 1WKVA 2OVBA 3BXFA 1Z83A 2P3QA 1GU7A 2HSWA 3D8RA 3AZOA 4FYMA 1E6CA 1XTUA 1RS0A 4N4AA 3I37X 4I1VA 2FPPB 5LP1A 4XH9B 3BKWA 3LVWA 2ZBUA 1KOLA 4EGFA 1O4VA 1PJCA 1MX0A 4CIWA 3HB1A 4F2DA 4DCVA 3U4HA 2ZRAA 5JQWA 4EB3A 1C1HA 2XMBA 2RE8A 3LUHA 3KIPA 2IL1A 4OQXA 1JDUA 1VBKA 5DNCA 2CUNA 1Q14A 1UP6A 5CT9A 4BFSA 2QRNA 4KKXB 3BZUA 1QGUA 2BFAA 1OWOA 1B41A 5TS3A 1BFKA 4HBZA 5KWIA 5I8ZA 5KU1A 2EDCA 3T3HA 4PLFA 3SHTA 4IBGA 3NIFB 4ZZ2A 2LUOA 2WP0A 2AE1A 4I66A 2Z6VA 3AI2A 4H77A 2MSDB 1Y1QA 2HU2A 3AIMA 3NHSA 1ZCAA 3PNMA 5SZJA 4DR4B 5ARDA 4HSEA 5CG2A 2FOIA 2XVXA 2HHHM 3TAXA 1E58A 4G1BA 5JO9A 1XRLA 2OGZA 5J23A 1PFVA 1QG2A 3U7IA 3PUVA 4YP1A 4YFVA 2NTVA 2CN1A 1O95A 3BMNB 4ZVNA 1XRJA 1CQWA 2MMCA 2YBEA 3LA8A 1W5FA 2EWMA 3VZSA 3M6VA 3U48A 2ZTUA 3VPAA 4G86A 5K4AA 4PY2A 1U1IA 3HJUA 5DNYA 5KKCA 2OM6A 3J80A 3GPYA 2C7BA 4KV7A 2AD5A 3LUBA 2I3GA 2XXBA 3NBAA 2P77A 3UHPA 4Q1CA 4S0ZA 4D8UA 3WGLA 4DOMA 2YXDA 3JD4A 1WHSA 4WV3A 3I5MA 2ZRNA 3GYGA 1OC2A 1F2VA 2HF2A 3I51A 2A92A 3G1UA 2I66A 4BV9A 3MYYA 1E18A 3JQRA 4TS1A 2E49A 4IGEA 2VPPA 1YXMA 2AK2A 2C4KA 4NZNA 2VNHA 1BXGA 3CF2A 4MLDA 1NNI1 3FE2A 4M7PA 3OZTA 5CXUA 4OK5A 4MVJH 3OIWA 3KQSA 1EI9A 1VGQA 3ZDYB 1QIGA 1UXGA 3ETCA 2PMDA 4CV2A 4ZYUA 4MA0A 1TR8A 2JFFA 1VJ0A 1E99A 1QFJA 3AONB 4HB2A 4E03A 4F4FA 5HXAA 1JLKA 1PWHA 1Z5OA 4QWMA 4CKYA 2OESA 4KQXA 3A4TA 3OETA 3PXCX 4BN5A 2R7LA 4ZDIA 1PZGA 1JXQA 2RHGB 3GLGE 5AKEA 2ZB2A 3NHKA 2ZP1A 5GV7A 3AF5A 3LV8A 3ZJVA 2FG6C 3UJ9A 2ZRCA 1TEHA 1WVIA 1OFUA 4MJ7A 2PS0A 4MRSA 2A9RA 1VXOA 4BFUA 4NF2A 5DN6A 3AYXB 2HSDA 3ICEA 1ZRSA 4RDCA 3E5HA 4FFWA 1K68A 3HVIA 3U7FB 4KWIA 3AVVA 5DTMA 1KI7A 5DYWA 1ZG3A 2ISQA 1JG2A 3HXKA 3U40A 3KAQA 1VHDA 3AI3A 1D0SA 1YULA 2X13A 3THWB 5CRIA 2W2VA 3FYDA 4ARZB 3ZE6A 5G53C 3TN7A 1KO5A 3NPMA 4JKYA 3JRWA 1O4WA 4JI7M 1FPQA 4XWGA 1KDOA 4KQJA 3LOQA 4HFNA 2FQ1A 3MBKA 4FHCA 5FNVB 3LHKA 3P71T 4C04A 2CVZA 1SAYA 4NNPA 5A4IS 2FFBA 1SU4A 1PYDA 4LYHA 1Y7TA 4OH7A 4GM1A 4TTPA 3R7BA 4CI0B 1EE1A 4HH0A 1ZMUA 3TLMA 3U09A 1O0CA 2X4DA 1K98A 3NTLA 2Y2UA 2F3UA 1TCCA 1FL9A 2Y1CA 4F1WA 2C2KA 4OHPA 1GKLA 5J1SB 3UK6A 4QULA 2ZRKA 5LLTA 4JYZA 5KYKA 4WOCA 1T3LA 1ZX1A 4D81A 1FLVA 1COWD 1DKPA 1CB7A 4L72A 1IHPA 2YHIB 1A7UA 2YR0A 4JHXA 1DAOA 4CCWA 2K7ZA 2J59A 4GI7A 5C5EA 3R5JA 1X86B 5DBGA 1V3QE 1A8QA 2UVQA 4FDUA 2BF7A 2PYZA 3K2IA 2A1TR 5B6IA 4ZHQA 3NU1A 1NUAA 4YJDA 2OV2A 4EEXA 2LPMA 2VXOA 5A03A 5CB6A 2ERCA 4G0QA 3R23A 4KXYA 2O1WA 1GRQA 1XTSA 4FZVA 4P7KA 3IESA 3NR2A 5IZCC 2HCTA 3R3JA 5EFOA 1XQVA 2RSLA 2BSAA 4MQ6A 1KYWA 5EQTA 1FIUA 4FBLA 5CHEA 5FD8A 2HQ1A 1QYVA 3RUCA 2QJRA 2ZQZA 4LXXA 3B6KA 3CMCO 3G6KA 1OJ7A 3ZXUB 2UUBB 1Z74A 5JCZA 4ZOLF 3FJYA 3PGKA 5HNKA 2QTNA 2VK8A 3LSYA 5CX4A 2QXUA 4IXNA 4JYMA 4WZAA 1NP3A 5D2CA 4CIYA 4WHMA 3S68A 3VSEA 4MQBA 4M7WA 2CEKA 4FYVA 2F5SA 3Q1LA 1FP4B 1XA3A 3HB7A 4I55F 2IWHA 2BR3A 1KWKA 3KJNA 3M4NA 2WYHA 3EQ6A 3NGMA 2I03A 4Q05A 4GITA 3LUCA 2CMFA 4AU1A 3ISVA 4B3MB 4HPJB 1OA1A 2OVFA 4E2WA 1U7WA 4UJ5A 1P1KA 3NTQA 1XZCA 4V02A 3JXEA 2CD7A 1PG0A 3H9JA 3OZSA 1DEAA 4QRDA 2SHKA 1AKTA 1Y3DE 3TZEA 3B3JA 5CP8A 1XIVA 4GQBA 4WNAA 2JCBA 3VGPA 1SCAA 4CKEB 4AP6A 3D4LA 3W3AD 1HSZA 4CETA 1QH9A 3RTCA 3DM9B 2PGNA 3HJCA 4JV5B 2Z43A 2HRRA 1ADBA 3WRXA 1Z6PA 1T0PA 1QOQB 4KPEC 1L5FA 4I3FA 2ZBKB 5LJIA 3N8DA 1GZSA 3BGVA 1RWBA 2UXCB 1BEEA 3N8IA 4FVMA 3GYBA 4CMBA 1J5PA 3UMSA 4MYCA 5ICGA 5CVTA 2AFIB 1EDZA 4HAXA 1E3TA 3UBMA 1K5HA 1XD9A 3QF7A 1OHHD 5CM8B 2DUWA 4KHPB 4N5LA 2AZDA 2NO0A 5K0CA 1XNRM 3U4IA 1CR1A 4RE6A 3FMIA 2YMQA 4N01A 2DAGA 1R4ZA 4DXAA 3DUWA 4OATA 4UZSA 3IELA 1T0BA 4DSNA 5KNDD 2GD0A 4QDJA 5JCJD 1KJIA 2CJWB 4MS3A 1KEUA 4D3XA 1FA9A 4OQYA 3LLVA 2FWRA 2PJUA 4J3NA 4G37A 2JI4A 1R4NA 1TOAA 3E9RA 2UZ4A 4KN9S 2Q5FA 5CBPB 4US2R 3MNFA 1WULS 3FNGA 4CL8A 5HGXA 4RTMA 1B4DA 1DHTA 2C98A 3CT4A 5FEMA 1RM3A 1O9HA 5HOEA 4LXTA 1P2BA 3V9AA 1PQWA 3F96A 4D80A 4ALMA 4WESB 2WSLA 3OCZA 3M4ZA 1LDGA 1ZA1A 4EITA 4YJFA 3V4PB 2OZEA 2QQEA 3JU3A 4IIFA 3T1OA 4KU4A 2GCEA 2HSEA 3STXA 5F77A 3BIXA 4QFMA 1SUWA 2B8TA 2E48A 1CF9A 2DSNA 3EZNA 4HNRA 4LMRA 4B4UA 3A2KA 3DMDA 2A9QA 3HYLA 1OBVA 4QUGA 3OUUA 3DT6A 1G63A 4Y2HA 1F5NA 1AZWA 1E3WA 2OXRA 1OZ0A 3CIOA 3KM0A 1UWKA 3EUAA 2IV2X 3T9DA 4LOJA 5F23A 1YQ9A 5D3KA 1FCJA 1VIMA 4RE5A 1R8QA 1ESZA 3AUUA 4H7KA 1NBMD 5K45A 3H1EA 4EG7A 4PYNA 3ETNA 3I5XA 4OI4A 4YAWA 5B6PA 2PSHA 3U49A 4WKOA 3EFHA 5KYYB 1DX9A 2WSIA 1FB5A 1RWQA 1W29A 3FE3A 1JQDA 2FW1A 1HDZA 4NRVA 2BONA 3S8EA 3A1WA 4BEBA 3DKRA 5A02A 3UJ3X 1LDMA 1XMXA 4YYZA 1VKJA 2GCGA 1IXRC 2FEWB 3QEKA 4NP6A 2Y0TA 4I7EA 4P54A 3L0DA 4QLAA 5G1PA 4KXMA 1SIBE 2WB2A 5IBRA 2NUBA 4MW2A 1YE5A 4GEWA 4O4JF 5KSPA 2IYRA 4YV7A 2B2XA 2GPSA 1PGPA 4BZPA 3BD6A 2RIRA 2WSSA 1XRQA 1IZ8A 2IYUA 2X5KO 5BUSA 1QF7A 4KQ2A 5GTDA 4YT4A 3F6PA 1SUFA 3MWEB 3T52A 2UZAA 5K8JB 3TQOA 2DBVO 4UN2B 4IIXA 5ITXE 2Q0HA 1A2QA 5SZHB 1DRWA 2ZSIA 2IOYA 3CNEA 4RHTA 4L50A 3BILA 1CS0A 5DT9A 1IUNA 1XB2A 2VYFA 1O08A 2TS1A 4Z7NB 2XDQA 1S1MA 5FB3A 4JKOA 1IL0A 1QLWA 3O8RA 1TA4A 3NUZA 5AK5A 3E21A 4LRTA 1WQ3A 1Z13A 4F3YA 5IM4F 1E7QA 1ZMWA 1XDZA 1F12A 1Q0ZA 1Z26A 3Q3EA 3OIDA 2Q2QA 3GXOA 3GEBA 1OB5A 1Z2EA 3ZPXA 2PBFA 4B7FA 5ALKA 1CUAA 2XUFA 4KC0A 3SZOA 4ZAWA 1WNFA 4C0JA 5KCMA 3KJEA 1G41A 2AZTA 3FSGD 4C43A 1PS9A 3DM5A 1AQNA 1EG7A 3ZJTA 2Q2EB 4OU4A 5AI5A 1E96A 4G85A 2VP5A 1TDHA 3WQRA 3CLHA 2XJ4A 2FJUA 3FTDA 4FMCB 2F8MA 4RL4A 4IEFB 4PLYA 2X0IA 2ZR7A 1PL6A 4Q5IA 2PTGA 4BU1A 2I4MA 4WNYA 2PJZA 4H1TA 2HJRA 4EYQA 1TT5A 2IZ1A 2DXIA 2W6IA 5EQFA 5CXXA 3ELWA 1AKNA 1MEOA 3U4QA 2VHWA 5FWXB 3CZ4A 3VR2D 5ELMA 1G2OA 5LNK1 1RWMA 3WLHA 2DPGA 5DOVA 3EZLA 1BVRA 3O38A 1MB3A 1E0SA 5D5QA 1L4KA 4UBIA 4BX2A 2AI1A 2PT7A 3QITA 5AUQA 2WOOA 2GPYA 1ZJYA 4O3MA 2ZVPX 2BUAA 4AMVA 2UYOA 1KTIA 1SGWA 3WV4A 5B2ZA 3I72A 2OZLA 3ASYA 1RC8A 2GQFA 5HE8A 1WMBA 2IODA 4UPVA 5D86A 2EJSA 3JTEA 4ZQCB 4V1CI 1MORA 2MYTA 1ZN7A 1B14A 5LP6B 5A9SA 3THYA 1XTZA 2R7KA 1I14A 2OHVA 2P9EA 1N7JA 4B8YA 5D3MB 4F5YA 1PTKA 1I1QB 3C2QA 2IFTA 4G5HA 3D6VA 3NOXA 4Q7KA 1V7QA 2VNJA 4N47A 3HY6A 2R6JA 2YS7A 4LDJA 2IVZA 4LYJA 3JV7A 1AIPA 5KNBH 4RMHA 1YGYA 4DWJA 3GN1A 3MLBA 4CM5A 5I7SA 1EINA 3CUYA 3DCIA 1MGPA 2RGBA 4BNGA 3L93A 3VZCA 2QJOA 3SICE 5F1PA 1N5KA 1FXWF 2OOSA 2OCLA 3WRYC 1VYHA 3T34A 4G0WA 1QVAA 4DLBA 1NIPA 4JEIA 2ZRQA 4QICA 4NXMB 1WCIA 4B3BA 2AN3A 4FMDF 3RS8A 3OMLA 3NHRA 3CRVA 2AC2A 3C6YA 3ZHSA 1RYBA 2ADFA 2VPYA 2FUCA 3M0EA 2PX2A 1J97A 5DBIA 4HVAA 5HUHA 4PSCA 4M86A 2HNBA 4NJOA 3BDAA 3VDNB 4WCFA 3QLEA 3ELYA 5LXTA 1TGUA 1T10A 3Q10A 1EVLA 1MNAA 2OAP1 2ODAA 2DUNA 3ISJA 5AIAA 5B1IA 5IYZA 2RBGA 3SJBA 3L4KA 3H7IA 5ILGA 2BTQB 3O6VA 4ZCSA 2V8BA 3DPSA 4E6PA 4BJ5A 1ZXLA 5AKLA 4PYMA 4Z51A 2H65A 1JEJA 1MIHA 2Y4OA 3NBKA 3K8ZA 1P75A 2D8AA 2CT8A 1K89A 4HFRA 3RU7A 1C81A 1ODCA 5C7LO 1JRLA 2Q4EA 1XHFA 5JAOA 1M6VB 2FQXA 1PBTA 1VZ2A 1ZGJA 3CGWA 3V48A 2DPHA 2SCUB 3PXEA 2PO5A 4A0FA 4HGZA 5F76A 2QROA 4ZC1A 3ACBA 3MGBA 3ZXYA 2WWRA 3EUFA 1PFWA 3TW8B 4OIMA 1Z4IA 2JZOA 1V6SA 4YJHA 1OGYA 3RE8A 2AH5A 1V2GA 5E26A 1E2EA 4G0UA 4YRSA 3KJFA 1B74A 1RIIA 3KYJB 4QBKA 1OI7A 5M29A 5FIUA 3NJRA 4DG5A 3QH4A 5DHAA 3ORHA 4NENA 1WU8A 1HEIA 3GELA 4JGGA 1FMLA 2WFLB 2B2CA 1QBGA 2L17A 1WXGA 1QV6A 2BWBA 4W1RA 2VYNA 3UPUA 5EPUA 3NUGA 2C3YA 2JCXA 2ZBPA 4ZT5A 5M34A 3FTEA 2EP8A 1O94C 1DTSA 4TYPA 3EWIA 1UC4B 1P4JA 2UVDA 3ABZA 1ZCFA 2CC2A 3ODGA 1TD9A 1WB9A 1UJ2A 3O7WA 5DHQA 2IYXA 2Z1DA 4HLUA 5K6AC 1T2CA 3OMWA 2R6HA 1CZOA 3VZQA 4Y18A 1LBEA 4QYMA 4TQGA 2PDAA 2X2EA 2PX5A 9MHTA 1LPBB 2XT6A 3H2HA 4E2FA 2QVGA 4YLYA 2BMJA 4MH0E 4E30A 3IMGA 2PMCA 3IEMA 1QK3A 4NU5A 1V35A 1QYCA 1U2QA 3LBNA 5HOQA 2HX1A 4KGXA 2O2ZA 3SIWA 3NIWA 1AHPA 1JHYA 2WIBA 3FNBA 3EA0A 5C31A 4QOIA 1P1HA 5CT4A 3JATB 4ALLA 5A3RA 1Y3AA 4GMHA 5EZYB 1ZK3A 1D4AA 3IT2A 4JAVC 1NW9B 3NOVA 2CNBA 1TVMA 4KAFA 4DLUA 3ED1A 1XWFA 1SKUA 2CXRA 1TO2E 3GEDA 2MU1A 4I50A 2OENG 1NRIA 4C0LA 2Q8QA 5BR1A 1UAAA 1NVBA 3IHLA 2WHPA 4MPJA 1NVWQ 4NZ9A 3IUYA 1N2ZA 4Q7LA 4XM0A 2VHJA 3ZV7A 2E4YA 1YB7A 1G5FA 4BPBA 1UXIA 1P61B 4JJ7A 5JZMA 4LBWA 1O6FA 2PRZA 1CQJA 4JWKA 5G0TA 4BVGA 4WN3A 4BUJA 3WLEA 2H4FA 1UMDB 3ZI7A 1ORHA 2OFPA 2WV9A 2DVWB 2BGRA 5JC8A 2DKOA 3VYRB 4CKZA 2I29A 2O25A 2WJ6A 5I7FA 5KTRA 1QIJA 2N0SA 5I9SA 4LOIA 5J4HA 8ADHA 2Q9UA 4H1WA 3RJZA 4RQAA 1AA6A 3I64A 1T2DA 1J0EA 2GPBA 5DNAA 4QGHA 3MWJA 1C9MA 2H2WA 1PUJA 4EUHA 2Y1OA 3PXAA 2HF9A 2ZVQX 4IMPA 1XTBA 4FUTA 1CS4C 4QXPA 1RPAA 3LGSA 1VE3A 4JENA 3R3YA 2VF7A 3L8DA 1O9GA 5FAKA 2OGUA 4RY8A 1VDDA 4AFNA 1RQPA 1Q7GA 2ZBVA 3DGEC 1EVJA 5BVHB 5DW0A 5FBRB 3FNHA 4NU8X 1D4OA 2Q3CA 4C7OB 3AZPA 1PG2A 3LSTA 4BB6A 2C03A 3IIEA 2NTJA 4GKJM 4LJRA 3UW3A 1MMFB 3LNTA 3JYPA 5IP5A 4OHYA 1HA3A 3ZWKA 4AN1A 2MR9A 5K0FA 4Q1EA 3JVVA 4ZYVA 4UQOA 4CQLB 4TTAA 2XF3A 3FCEA 1T4MA 3ZWXA 1ZH4A 3IUNA 4X54A 3GLFE 3I9OA 4RZ2A 4OU7A 1OXBB 3REQA 3H87A 1IBKB 2FZLA 2XQFA 1Q22A 4ZARA 3W79A 1SQGA 4NU0A 3MBOA 1HORA 2MSWA 2ENUA 2Z1MA 3CKYA 2A7XA 4F91B 2G88A 4IJMA 1UJ6A 1H5NA 4TWRA 1OKSA 3MRTA 2YHUA 4I1OA 2X0JA 1BWSA 4U63A 2GF9A 4RVFA 1FNCA 1U28A 1U5CA 5ESWA 1ETUA 3UKJA 2V8OA 4RKFA 1K3TA 1E2LA 3RFCA 1N92A 5FTJA 1GO2A 1Z4OA 3H16A 3FTFA 4FOTA 1QGED 4RD0A 3AJDA 3ZOKA 3EGOA 1SXJE 2D4HA 5BN4B 3ZNOA 4YJ3F 1KPHA 3K70D 4EW1A 1XU4A 3L8YA 3G8BA 5K0GA 3AW9A 3ONVA 2P9YA 2ZQYA 5TT1A 1FFDA 2QUHA 1YZHA 4DLVA 4KR9A 1K3WA 4P9NA 4QBGB 3S29A 2HLNA 1N7IA 4AO6A 1YI0A 3HP1A 2PLAA 3SOZA 1W4CA 1SMKA 2DX7A 2W4MA 2EO2A 4F45A 2JRCA 4C0XA 1Q2XA 2X15A 4A5OA 1KXJA 2YFHA 1PT8A 3OAAA 2OM2A 1K6XA 2QZ9A 1YJCA 4MP8A 4C4PA 3IJPA 3Q2KA 3ER8A 2Y66A 3BH7A 3EVAA 1NULA 1UC5B 1KOGA 5F4BA 1XZIA 4G0OA 4YT8A 4CQMB 4K9PA 2TYSB 1L3IA 3BSYA 2P3LA 1JIVA 1GPBA 2GD1O 3O93A 3Q15C 2ORED 2JDIA 4CKWB 4L0CA 4LE1A 1QBKC 4JOQA 1X2EA 3R0ZA 3TLKA 2VXYA 3HSSA 3VNAA 4RSGA 2SKCA 2P9TA 3RSSA 1L4NA 4UATA 1V4BA 5DNUA 3OPYB 2QLNA 4P0PB 1P73A 3UAGA 2PUFA 5F64A 3U3RA 4KQFA 4JVOA 3MS4A 1EFLA 1SOWA 4JOBA 5ITZB 3Q3GE 3KOWA 3WLPA 1ZOIA 3DMTC 3AM3A 4JI6B 2I22A 4XVQA 3ZS9A 3V2UA 1Q16A 4CIDA 3TTUA 1EWVA 2YHAA 3KWMA 3NO4A 5SYAA 1XEXB 3CJRA 2R25B 4WZ6A 4XJVA 5D85A 5LP6C 1S5PA 4FN4A 4FKZA 1O94D 3FPGA 4I1SA 2C5HA 1NRWA 4F96A 1LBHA 3AHCA 1VCMA 3HYCA 4TMTA 1AA9A 1WXWA 5EP4A 3LYUA 4JASB 3QE9Y 1IN1A 1HZZA 4FDMA 2HSGA 2PKCA 2B61A 4F06A 1WDTA 4G1UC 1U0SY 4D96A 2VL7A 1JF8A 4Q4CA 5TPWB 1ZQ1A 4EKEA 4HWKA 3WB9A 4AP9A 2Q3EA 2Y0EA 2BEWA 4CG1A 1BN6A 3FGPA 3WL5A 3CNLA 3EJ6A 4UC0A 2D2IA 1JFLA 4GO1A 1MN3A 5JQGF 1SQ0A 3L49A 4R8MA 4ZRNA 3KXIA 1J25A 3MEQA 3ZLJA 1UQRA 1PIWA 1D1SA 2H5EA 2IX3A 4DB2A 5JRJA 1LPOA 3U6OA 2BSQA 3AUAA 4GPTA 2XMRA 2F8LA 5DHPA 4D4GA 2B0JA 1OY1A 5ELLA 4EW2A 4RZSA 3EUEA 2JY7A 2FN8A 4KK4A 1GNRA 4DM7A 5F7OA 1N32B 3WLRA 1XMSA 3D7NA 2CVPA 1HG0A 2YQ5A 4XW2A 4H7DA 1N2IA 3Q1KA 1NR7A 3CKLA 4E70A 1NI4A 3QLJA 3KKEA 1I4LD 1YL5A 1QHXA 3ZV4A 1C4WA 2WHXA 1FSZA 3NWJA 2P9HA 2RI0A 2FVXA 2QYSA 3C6QA 4J1TA 4BX0A 3O92A 4Y6RA 1YDHA 3VJLA 1XZBA 4GYKA 4ZMSA 1KSJA 4XRRA 3WMXA 4M7OA 3FVTA 3NX4A 4F1JA 2J6BA 2X2FA 5DMXA 2IWRA 3AVPA 2L4EA 4OP1A 1Z39A 2LTUA 2XB8A 3VZDA 2F8SA 1J2JA 1OGIA 2A6PA 4ZT4A 4RJ2A 4EGAA 4L3OA 1NNUA 3I83A 2CVOA 4MNTA 1Y8QB 2HREA 4MVJE 4AJ1A 3RTAA 1ONSA 2B78A 2PN1A 1LBIA 3PGXA 1TUBA 1X38A 5ALUA 4I5SA 3ILKA 4A10A 1QFZA 2ZK7A 4TL8A 1KERA 3DV0B 3AVUA 4D26A 4DLYA 4CF7A 5FO0A 5FFNA 1WUKS 4AY6A 4GWGA 1G8FA 2VNKA 3X1DA 3VVLA 3LOUA 4JJKA 3S99A 3OPXA 4LNHA 4CMCA 1M1NB 2GESA 3FAKA 2SKDA 4OJTA 5DBFA 1OWMA 1VDLA 4CLOA 4ZVPA 3F71A 5DX8A 2G06A 2A0WA 1ID8A 4E46A 4ZEXA 2UZ1B 4RQBA 1YIAA 2VHYA 4MWSA 1PLKA 3WVNA 4J0DA 2I3DA 3DSRA 3RDPA 2QRMA 3LXMA 1H69A 5EWLB 3WS7A 1FMTA 2X8LA 4DR6M 2RGXA 4NXNB 4IHQA 2DFPA 5KOJB 1PJQA 4DQUA 3S27A 4NAVA 1AMOA 1QIIA 2RKBA 3KBBA 3BBLA 3R7NA 2PBRA 2X3UA 1OIVA 3KJHA 4NSRA 3MERA 1I3LA 2BKAA 4N82A 4DNFA 3TVTA 1X9HA 3Q0IA 1I4WA 2EL7A 5LZ8A 3GIWA 3PR3A 4MUEA 2RK3A 3PKZA 2XCUA 3URMA 1CZRA 1RABA 3CJTA 2FY8A 2Y67A 1U1DA 8CATA 4NYIR 1IXZA 5LYJA 4GVXA 2XQIA 1SBNE 1D0VA 3B9QA 3IR6A 3GFPA 2GUGA 2FQWA 3P2IA 1WCV1 2YNMD 5ICCA 3E7WA 2W6MA 1YC5A 2QS9A 4NG5A 2A4MA 3G0GA 2Q8PA 3PDIB 3VC2A 5I4BA 2NNLD 4EB6A 1I2BA 1CIPA 4LN1A 3CN7A 1RTKA 2A33A 4BECA 4AZTA 1W85B 3WWCA 2G76A 1H0RA 3I2HA 2HQBA 1YB6A 2HIHA 4LQLA 2EP7A 1JIUA 4WK6A 1UOEA 2HCJB 1W5AA 1SBIA 3BN3A 2EZ8A 2FH0A 4D0RA 3HHZA 5M3BA 4QQRA 5AI9A 3W5IA 1YHZA 2GSDA 4OHRA 4FW9A 3RNOA 1T91A 4D9EA 2XGJA 4CLEA 4Q24A 3GLIA 1J23A 3DGFC 4RD3A 3WMGA 4OHMA 1DBVO 2CK3A 2AX4A 3OQJA 2XKJE 4B3SB 4N5DA 2Q7OE 3ZU4A 5JRZA 3ICVA 2HA5A 3R4VA 1QAMA 3RROA 3UGQA 5FBLB 4CEHB 1W1UA 5H4HA 3RRNA 3G13A 1Z63A 4FWDA 4IVPA 1TT7A 1RAAA 2ODTX 1W6UA 3EMDA 4EQ6B 1RAFA 2GDJA 2FUEA 1M7BA 1Q20A 3RFTA 5ED0A 5E1BA 4A8JA 3BB1A 1NF3A 2RC6A 2XYPA 2F1RA 4G8BA 5FBHA 1A1SA 4J0JA 4O4HA 5C4IA 5FAXA 3EVTA 4H17A 2VHEA 5KREA 3TW0A 4Q02A 5IABA 4BYGA 4HH4A 2C4MA 1J1IA 1P91A 1QWOA 4KYUA 2X40A 3WADA 1JIXA 4RJLA 3QBDA 1YHYA 3RARA 4LTMA 4HQKA 3TPCA 5CX1A 5BOSA 4RACA 4IIBA 4WBSA 4G9EA 1NJFA 5FI1B 1JYEA 3KQOA 2GEFA 4BP3A 1HNXM 3GPDG 3WGUA 3QHPA 3RT1A 1UPUA 4XQ0A 4B6FA 1BJRE 4KMOA 1Y8RB 1GQYA 1H23A 3VJMA 1RYNA 3FPAA 3HJRA 4UVDA 3RV4A 5BN3A 1T6YA 3OTQA 2AJLI 2XVZA 2HMAA 5DGXA 3O1JC 2R4EA 4MGYE 4I5EA 3HHEA 5KMGB 2Z8XA 2YZ7A 3BCSA 3AY6A 4LVCA 4FINA 2VZ8A 3IOCA 4B2LA 3ZZTA 1XZPA 3D31A 1BAPA 5IT9S 5REQA 4NMHA 4KUEA 5KYUA 3QLTA 5L7YA 1AV6A 2H85A 3Q87B 4KXXA 1H0HA 3OCXA 3W5CA 2B83A 1R6UA 4B43A 4K81B 5LQSA 1Z12A 4AWAA 3TO5A 4KI7A 2BP7B 2ZYSA 4QVIA 3UH1A 1ZD4A 1HO3A 2IGTA 2EEZA 2X58A 3EPKA 3MOSA 2AHMA 1FP7A 2XLCA 4AN4A 3BJIC 3BEDA 1IXYA 3UMBA 1C0KA 2H1WA 3RRYA 4BQRA 5A5GA 4HG2A 5IJXA 4NC9A 2AXPA 2HA4A 1EVKA 3HUDA 4K87A 4BRSA 3M33A 1QTQA 1QAQA 3B8HA 1QC5B 1KDZA 5CEEA 2H48A 1EHYA 1TEVA 3ACDA 3RHTA 3S81A 1UJ5A 3ZDDA 5H5JA 4KNVA 4M2LA 3LUAA 2NGRA 5TX7A 1LPPA 1YOBA 2RHWA 2FV8A 4JN6A 3W5HA 4TMFA 1CWUA 4EG0A 5JS6A 2BM9A 4L4YA 4IJWA 3OT1B 3IBFA 1TLTA 4FDVA 4YCAA 3D02A 3LKVA 1MC8A 3I92A 4WERA 3SZUA 1X7YA 1ZHFA 1KIAA 4L78A 1XXLA 1MD9A 1YT5A 4AZ3A 2VSYA 1Y33E 4KO8A 2OXFA 4FNAA 4LY9A 2I71A 1N5DA 4BO2A 2NXCA 1VLZA 1X1SA 3GRVA 1JKMA 3U3OA 2OOAA 2VJNA 4I0WB 4GMQA 2SBTA 1VYTA 3KOWE 2EFGA 3KJZA 3ZHZA 2V7XA 4RJJA 2CDRA 2XOKA 2J46A 3O1LA 4TUYA 2VKTA 4X1IB 3FJ1A 4HPWA 2AJ8A 1ZNQO 2VJDA 3P97A 1XDBA 5CVDA 3RVSA 3ZQUA 2W90A 1BHSA 1K75A 2DJ5A 1U0BB 1LCIA 4AQ7A 4MYRA 4U0KA 1OXUA 1UBKS 4GIPA 2JGAA 1F0PA 3CR8A 1E6UA 1XDDA 3FN4A 4LHEA 2XHZA 2JAHA 3RVOA 3GJ5A 5B7PA 5AK3A 2WJ3A 2PXHA 1JILA 1L1EA 1I7LA 4FCCA 2QLFA 1JHZA 1FMCA 1U94A 1GRRA 4ZQEA 2A5JA 4JT4A 4MCHA 1YASA 5TE9A 5J2UB 3FIUA 1LF0A 4DMFA 2O8CA 4BKMA 5JY1A 4S1WA 3KB2A 5C7YA 1OPRA 1NQUA 4TLEA 1M73E 3MINA 4Z4GA 1LTKA 3ZY3A 4BCDA 3WLQA 4QM6A 4KWCA 4N0PA 2QLLA 1NLMA 4L73A 5JPCA 3CTMA 2ZJYA 2QAJA 1G71A 1MRZA 2VCEA 2JLUA 4NOMA 1A82A 4D9BA 2YH2A 1GHTA 1OKKD 3WL3A 1UFOA 4DM4A 3L5OA 2ZJ3A 3OZEA 3KWJA 3GXBA 2QMQA 3STWA 3MLAA 1QUTA 1DSSG 3GWGA 4ME6A 4GXNA 5DNEA 3N07A 4XSGA 4TTSA 3M3DA 4MPPA 3A6KA 5T4EA 1K5PA 1D0KA 1M5UA 1GR0A 2ISSD 2OG2A 2RGUA 3DDUA 3PF8A 1E2JA 1D2RA 4OX9B 2JH9A 1ZOPA 4DG9A 4G65A 5LA6F 2J32A 2R1VA 3NEJA 1KAMA 1X8KA 3CZ5A 3PQ2A 2OQVA 3H6KA 4B3JA 1ML4A 1XTQA 3BJEA 4WZBB 2Z0MA 1QZEA 1W88A 4AW4A 1Y5MA 4YDHB 4C6TA 2IBTA 2FFJA 3SXUB 4CTKA 4H1UA 4PC1A 5HVNA 1C0LA 3ZU2A 3SC6A 4OFZA 2FFHA 4JBWA 4MW4A 4D9JA 1ZGCA 1D8TA 4KXWA 2XA2A 4RZ3A 3OQIA 4Y2QA 5HRUA 4AJ4A 1PKEA 4C07A 3ICPA 1UM9A 1A71A 4ITRC 4BQSA 4FM9A 3OM0A 5K3FB 5D01A 4NL4H 2V0CA 1KO1A 4NATA 3K9FC 2ZITA 3R8XA 3UA4A 1H8HD 1ORVA 3MJ5A 2Q5IA 2A3NA 1TGYA 1TKBA 3QELA 3W2GA 4UAVA 4BFTA 3NBMA 1UK9A 1W48A 4CM1A 1QHHB 5ALTA 4AZSA 3LY8A 1SZPA 4CF6A 1V4VA 5C2JB 1VL2A 2WF8A 4L57A 4LMBA 3OEHD 1BMFD 4W5TA 3TX6A 3SC4A 5CW1A 2YYSA 2R6ZA 5I7HA 5CDFE 4KGVA 5JFOA 3C7AA 5C7IO 4EMBA 1K3XA 1NU8A 3H0CA 2F3QA 2PT5A 5C1DA 4E0BA 2OXTA 1ZI8A 3R6WA 1YNSA 2DP4E 1P1RA 1V9SA 2FJPA 4DW8A 1F8GA 1QH1A 5CVEA 1WBDA 3NTXA 5AIBA 3KS9A 3LP6A 1JEAA 2AQ8A 5E6SB 2GVDC 1UCFA 4JIGA 4X6UA 4XX1A 3W7BA 4OCZA 4Y2YA 2XLBA 3F9CA 4ZXFA 2VYVA 3KKLA 1F6WA 1KVQA 2FWIA 4C3OB 4K3VA 4F9EA 2MR6A 3CONA 2JNWA 1O5TA 1Z18A 3G5MA 3EMBA 1GG8A 4K26A 3J7AS 2JGRA 2QM7A 1W34A 4XTRA 3T99A 5BR8B 5IAGA 1SCUA 1D5WA 1ZEJA 2AXEA 4ZQFA 3V42A 3K0SA 4RVDA 2PAAA 3NHFA 4I4LA 2OEPA 4OK6A 4IDHA 1LH0A 1R12A 1N2EA 3R9KA 3WYBA 1XVVA 3T5DA 3K70B 3EWNA 2VDRB 5BWBA 3IT1A 1TX4B 1ADJA 2IXFA 2PRYA 2Y9MB 2HO4A 4AIRA 1ZPDA 1J42A 5CH8A 5DJ5A 1NPYA </