3U60A

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
186
structure length
186
Chain Sequence
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
total genus 41
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60A03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60A02
3U60A 3U5ZA 3U61A
chains in the Genus database with same CATH superfamily
3EIEA 1V34A 1G3IA 3HHZA 1YSYA 4Z8XA 4IBGA 3U6EA 2OQ4A 2VF8A 3SATA 1IM2A 4CHDA 1X37A 1JR3E 1DGHB 4M0WA 2R4JA 3KOZE 4OW0A 4A3VB 1L2DA 4BBAA 4JI7M 4AW4A 2D7EA 1QUSA 4JYAM 2Y0QA 2LH0A 3J81S 4LGYA 2C96A 3AV0A 4OVZB 3U6OA 3I4YA 2VQEM 3GLFA 1H6UA 2UUBM 4KHPM 2EKFA 4MH0E 2KZSA 4KT0F 3KSJA 2XSZD 3VKHA 2G3QA 4L8RC 4FVMA 3SHGB 3KDSE 1TDHA 2BNKA 4IIWA 1NNJA 5EP4A 1YUBA 2L4FA 2KA6B 8CATA 1GJTA 3GLFE 2HCBA 2R44A 2LVOC 2L2DA 4G6ZA 3FUTA 3TPZA 3VDPA 1N77A 1FNNA 3RE8A 1WJ7A 1K82A 3B7NA 2R4EA 2G5GX 2XZUA 1G59A 1Z59A 3U6SA 2DZLA 2DHYA 1L2CA 2EA0A 3AKZA 1K3XA 3KOXE 2KW0A 4D82A 2X4AA 1QANA 2MH8A 2HHHM 4AG5A 2Z4RA 2FS1A 2QW6A 2WZJA 4NSOB 2MJ5B 1N33M 4PCZA 1JB0F 4IBIA 4JI2M 1K3WA 1BVSA 2R45A 3WHLA 1J5EM 5DYIA 2Z4SA 3U5ZB 4G4OA 3SARA 4RNAA 3B7ZA 3PXGA 2DHRA 2XFTA 3DZDA 2JY5A 3A45A 3DA1A 1IN7A 2QBYA 4AKIA 3J7AS 1KSFX 1T43A 2X8AA 3MHVC 4FCTA 2N35A 3UGJA 4G4RA 4IBJA 4DV5M 3MMPA 1IBMM 1NSFA 4WW0A 1OIPA 3GLGE 3F92A 1SXJD 1TH4A 1D0KA 3GRVA 4R3DA 3HX3A 2LVQD 3FTFA 4IJEA 3SHFA 4PD2A 1PM5A 3GLFB 4DBGB 3J80S 4IBCA 1SG9A 3ES5A 5GKNA 4RF0A 3U60A 1TTEA 3GP1A 5JI3E 1QAOA 1MJGM 4FWDA 1XXHE 2Z8YM 3LMMA 2LNHC 1IXSB 1OFIA 2JZ0A 2KNAA 4WURA 5KQ8A 3I4VA 5E26A 2OOBA 3HKPA 3HU2A 3MK6A 4BLCA 4LF9M 4LFAM 1ZV1A 1Q39A 1UFZA 5DYGA 3GPPA 2KRKA 2R62A 1PJQA 4M9XA 3GLIA 4LF5M 4CIZA 2XFSA 2EJSA 2LHGA 1CUKA 1WR1B 5IREB 4IBFA 3AL0C 4DR3M 2FOIC 4MGKE 4LF4M 1EFUB 1HNXM 1DGBA 4AZFA 2FE8A 3FTEA 4NOOB 1KYIA 4S12A 4M0DA 3VDUA 2QCUA 3A42A 4LZZA 3HY5A 3D8BA 2F4VM 1L8QA 1QYRA 2KHHA 3BOSA 1Q02A 4DV2M 1JR3A 2J7NA 3U6MA 4ZPXA 2C9CA 3H4MA 2LVPC 4NL4H 4D80A 4DV3M 2JXNA 2JY7A 3E4RA 2R0IA 1ZMWA 4Z6YA 3U5ZA 3SAUA 1XNQM 1W5SA 3B7QA 2DKLA 4NC6A 3UK6A 1R4GA 2KZUA 3T15A 4MB7A 2JNHA 4B3RM 3JR4A 1R5LA 3KS4A 3W68A 3FE3A 3NBIA 4ITQA 1VEGA 3ILKA 4D81A 2E5LM 3VFDA 4LF6M 2HL7A 2V1UA 2NQ8C 1IN6A 1QUTA 4JI6M 2CHQA 4II7A 4NXNM 3K92A 1NJGA 5EXTA 3FYCA 4DR7M 3K9PA 2O5RA 3QAUA 4LF7M 4LCBA 1PJSA 2QHOB 2VF7A 3AOEC 4IBEA 4IJFA 4LZJA 5ITYA 2DAMA 4FCWA 1NVMA 2L7HA 2I7NA 5C1BA 7CATA 4YY3M 4JI4M 2K9DA 2UUAM 2JY6B 5FSWA 5FTMA 2CV2A 1XMQM 2LBCA 1L1ZA 4R71A 3H4JA 1R2ZA 1S3SA 5BR8M 2HAKA 1E9RA 1AUAA 2XLJA 2X49A 3AOGA 1HT1E 2MROB 4LGMA 3JR5A 4JI5M 1G41A 1NY5A 2ERCA 3B89A 3GQ4A 4OX9M 1HQCA 3IG8A 2UU9M 2JA2A 4MGIE 4MM3B 1MN3A 4I81A 4QHTA 1IN5A 2JZ1A 1V33A 4CHTB 4MGZE 2EKKA 4L16A 5EP1A 4DV7M 3T6PA 2R65A 3FRHA 4CGYB 1L2BA 4X62M 4G4NA 2YR0A 5L8RF 3D8LA 5EQTA 3TWMA 1YE9A 3HJ8A 1TDZA 4MGYE 2UXDM 1P3QQ 1LV7A 1LTMA 4B3TM 3FUUA 4GKKM 5ITQA 3MJ5A 3AJIB 2BJWA 4LRTA 4CJ6A 3GRRA 4BB9A 2QQ8A 5KPTA 1R2YA 1GLNA 3J27B 3NBXX 1EE8A 1RU3A 1SXJB 3QYBA 3VKGA 2CRUA 3SFZA 3RC3A 1QDRA 3GLHE 4LJ6A 1ZMVA 1N32M 4W5WA 4JI3M 2KNVA 5EP3A 3B74A 2VIIA 1ZQ9A 4EIWA 1KFVA 1HJPA 2BJVA 4HEOA 3GLIE 2LWXA 3RC8A 4LFCM 3JAMS 3HWSA 1F4IA 1Y8GA 4PDIA 3GPYA 4AKHA 3U61B 2ZBKB 4FCVA 5KPZA 3GO8A 2Y0TA 2CP8A 1GKIA 2C99A 1MU5A 1IN4A 1OQYA 4LY6A 4JN6A 1VQ1A 2CHVA 4JXJA 4L6V6 4B3MM 5LMNM 3UMMA 2WSCF 1HR0M 3TE6A 2CFOA 3FUVA 4I5SA 3LVWA 1XC8A 1SXJC 3KW6A 3T1HM 2P5TA 1ORYB 1PGYA 4QNRA 5IZ7D 3SASA 3GRYA 3ZQJA 3L25A 3BXWA 2ZAOA 4B7FA 3PNYA 3SMPA 3LCVB 1IN8A 1NY6A 3E21A 3FYDA 4GEWA 3W67A 4IBDA 3WHKA 4HL4A 1I94M 3V76A 1IXSA 4FWHA 3U61A 2MR9A 2ZANA 4X65M 3C3DA 5BPVA 2QNJA 2DZOB 1XHBA 4AG6A 2VQFM 4CISA 1GJSA 1IXZA 3K8ZA 1FJGM 3CTDA 3GPXA 3KS8A 4GH9A 1WGLA 1J09A 1Z5BA 2Y20A 3CF2A 1GO5A 1EIJA 3HHXA 4OVZA 3GLGA 2V6ZM 4I8OA 4OU7A 2CE7A 4L4UA 2LVNC 4P16A 3KP1E 4TUWA 2D7GA 4DR2M 1DGFA 3CTWB 1PJTA 3K2LA 4K0KM 2K6BA 2KRUA 3FRIA 2XEPA 5EJCA 3VK7A 2L09A 2DAEA 2DWNA 3HU3A 2JWSA 2O01F 1G71A 1N78A 2KEBA 3T38A 4AQYM 1ZAEA 1XXHA 2DI0A 2Y21A 5KQDA 4YHHM 3KFUG 3BGEA 5ITTA 2YQZA 2B3TA 2DAIA 2APLA 5A2QS 2FNAA 3IECA 3CF6E 3SMSA 2HKJA 3KXEC 3QYEA 4JV5M 2BWEA 3SYLA 5ITXE 2RGOA 1T6OA 3TL4X 1VG5A 1IBKM 2QPAA 4PDGA 1NHWC 1WHCA 5EP2A 3I51A 1Q3CA 1WGNA 4GHLA 4NSRA 2FH0A 1OAIA 1VDDA 4LJAA 1OTRA 2C9OA 2G8LA 3GRUA 1G8PA 4GRIA 4LJ8A 5IWAM 3HJSA 1E32A 3VLFB 5C18A 2A5YB 3T1YM 1IY2A 2M5ZA 4B08A 1MX0A 3LQRA 3C3EA 2MGWA 1QQWA 2FFJA 2KNZA 1YLAA 4KODA 1IFYA 4IBKA 4GIPA 5FTLA 1XXHB 1DGHA 4X66M 2J7OA 4XGIA 3KOWE 1D0MA 2DWMA 3J7BA 3KVWA 3M0EA 2Z7JA 2DWZB 1VEKA 4GKJM 2J5YA 2XSZA 3OTOM 1G4AE 2XH9A 4REZA 1XWIA 1HQYE 2RGHA 3FUWA 1AIPC 2DENA 3SYKA 3U6DA 3U6LA 2F5SA 1R6BX 1T3TA 2QENA 4M9SA 2F5QA 3W0LB 3E9SA 1OKSA 2CEAA 4LJ9A 2LVAA 2UXCM 2QSFX 3GLHA 3IG5A 2CHGA 5ITXA 1NV8A 3PFIA 1OJLA 2BWBA 2DNAA 4QNMA 5E6JA 4GHAA 1N34M 3SC3A 2C98A 4I4LA 2W82A 5KO3A 4RF1A 1Z5CA 4MGHA 1QAQA 5ITUA 4F1IA 5DFLA 2XF3A 4XBOA 4HLQA 1IQPA 2EO2A 2DXIA 2R9GA 1TGUA 3L27A 2L7IA 1TF0B 4DR5M 4G4QA 2DZNB 3AFHA 3LQQA 4B7HA 1PJJA 4JI1M 4DR4M 1IY1A 3R8FA 3FUXA 4LJ7A 2R6FA 4DV1M 1ZMUA 2M60A 3DFZA 1SXJE 5KPRA 3ZCBB 2GQFA 1JQJC 3M7GA 2XGNA 2D7HA 5FLXS 3HHYA 3LVVA 2DWLA 3K9OA 3KSXA 3FKEA 1J7KA 1XMOM 1SXJA 3LCUA 3PNVA 3Q8XA 2QP9X 1XNRM 5IT9S 2YFQA 1D2NA 1TH3A 3PVSA 3GLGB 3U6PA 4NXMM 2JUJA 3RFWA 5JI2E 3RGPA 3CGWA 2V1CA 2ZM6M 1VDLA 3QWLA 1N36M 2H5XA 1DV0A 1TR8A 1XB2B 2LHCA 2ZTCA 2KXEA 3FD9A 1UM8A 3HGIA 4DV0M 4DV6M 4WP2A 5EXSA 3GLHB 2K47A 2WSEF 3K1JA 5DNYA 1N75A 4DUYM 1NV9A 1IXRC 1OAOC 3VK8A 2O25A 1TH2A 4R7GA 3KOYE 3U6QA 2Q2EB 3TQSA 1Q3BA 3L2AA 3I01M 3RGSA 4KLNA 4QHSA 4PT5A 1HNZM 3I04M 5LMUM 1R7RA 3J2PB 3TWLA 3E46A 3HU1A 3LW5F 1PJIA 3BBZA 1V92A 4DR1M 1Z6TA 1QAMA 1NNUC 1QZMA 2JY8A 3HJQA 1QVRA 3L29A 2CUZA 4QOZC 1DGGA 3GQ5A 2KDLA 4LF8M 3FTCA 3R9XB 1Z5AA 2F5OA 4LRSA 4RKUF 1E94E 1NHGC 4L78A 5FTJA 3ZH9B 3GLIB 1MW5A 4LJ4A 2QBYB 1C1KA 2ZAMA 3THGA 4JI0M 2DAGA 2GNOA 4NRVA 1D0LA 2L6OA 4B7GA 3GQ3A 3ZC7B 3SAWA 4AI6A 2VDBB 1L1TA 1QZEA 3UZUA 2I7PA 2UUCM 4GC9A 2CV1A 2LXEA 1GL7A 2JP7A 4LJ5A 3L26A 4QOSA 2XZFA 4LG2A 3NWLA 1GVNA 4M9ZA 4XK8F 1NJFA 4Y28F 5ITRA 3A98B 1DO2A 1JR3D 2DAKA 4FD2A 4GMQA 3TWKA 2YNMD 5FTNA 4DV4M 1E9SA 4IBBA 4FW9A 2WSFF 4UN2B 4X64M 2QZ4A 3EIHA 3U60B 1C7YA 1WXQA 1DO0A 3M6AA 2H1RA 1HT2E 3AOEA 4F2LA 1HNWM 1QDTA 3SAVA 1NO1A 3GPUA 2K0BX 4L15A 4GC5A 2RKOA 4GITA 4P17A 3FTDA 1I4WA 1VEJA 3Q8GA 3L28A 3W0FA 2EUCA 3CF0A 4FWGA 4G3OA 4ANRA 1IBLM 3HZJA 3KP0E 2OO9A 4KO8A 4JI8M 3C9PA 2UXBM 4AKGA 3SBJA 2CV0A 2ZTDA 2R46A 1PRBA 2CWBA 1W5TA 5F3WA 1GL6A 3C58A 1OIZA 3U6CA 2RRUA 4Q7JA 4NRWA 5FTKA 1WIVA 2OPFA 3A46A 2R18A 2F5NA 1A5TA 2F5PA 5EXPA 5EXXA 4DR6M 4DUZM 2Z3XA 3DOAA 1GABA 1IY0A 2OOAA 4B3SM 2L4EA 5H37D 2DVWB 3UJNA 2C5RA 3B9PA 3HHWA 2LTUA 4LFBM 2HWJA 1OFHA 2AHMA 3IHPA
chains in the Genus database with same CATH topology
3EIEA 1G3IA 3HHZA 1YSYA 4Z8XA 4IBGA 3U6EA 2OQ4A 3SATA 1IM2A 4CHDA 1X37A 1JR3E 1DGHB 4M0WA 2R4JA 3KOZE 4OW0A 4A3VB 1L2DA 4BBAA 4JI7M 4AW4A 2D7EA 4JYAM 2Y0QA 2LH0A 3J81S 4LGYA 2C96A 3AV0A 4OVZB 3U6OA 3I4YA 2VQEM 3GLFA 1H6UA 2UUBM 4KHPM 4MH0E 2KZSA 3KSJA 2XSZD 3VKHA 4L8RC 4FVMA 3SHGB 3KDSE 1TDHA 2BNKA 4IIWA 1NNJA 5EP4A 1YUBA 2KA6B 8CATA 3GLFE 2HCBA 4G6ZA 3TPZA 3FUTA 3VDPA 1N77A 1K82A 1FNNA 3RE8A 4JI1M 2R4EA 2G5GX 2XZUA 1G59A 1Z59A 3U6SA 1L2CA 2EA0A 3AKZA 1K3XA 3KOXE 2KW0A 4D82A 2X4AA 1QANA 2HHHM 4AG5A 2Z4RA 2QW6A 4NSOB 1N33M 4PCZA 4IBIA 4JI2M 1K3WA 2R45A 3WHLA 1J5EM 5DYIA 2Z4SA 3U5ZB 4G4OA 3SARA 4RNAA 3PXGA 2DHRA 3DZDA 2XFTA 3A45A 3DA1A 1IN7A 2QBYA 4AKIA 3J7AS 1KSFX 2X8AA 3MHVC 4FCTA 3UGJA 4G4RA 4IBJA 4DV5M 1IBMM 1NSFA 4WW0A 3GLGE 1SXJD 1TH4A 4R3DA 3GRVA 3FTFA 4IJEA 3SHFA 4PD2A 1PM5A 3GLFB 3J80S 4IBCA 3ES5A 5GKNA 4RF0A 3U60A 3GP1A 5JI3E 1QAOA 4FWDA 1XXHE 3LMMA 2LNHC 1OFIA 1IXSB 4WURA 5KQ8A 4DUZM 3I4VA 5E26A 3HKPA 3HU2A 4BLCA 3MK6A 4LF9M 4LFAM 1Q39A 5DYGA 3GPPA 2KRKA 2R62A 4M9XA 3GLIA 4LF5M 2XFSA 5IREB 4IBFA 3AL0C 4DR3M 2FOIC 4MGKE 4LF4M 1HNXM 1DGBA 4AZFA 2FE8A 3FTEA 4NOOB 1KYIA 4S12A 4M0DA 3VDUA 2QCUA 3A42A 4LZZA 2F4VM 3D8BA 1L8QA 1QYRA 3BOSA 3U6MA 4DV2M 1JR3A 2J7NA 4ZPXA 2C9CA 3H4MA 4NL4H 4D80A 4DV3M 3E4RA 3U5ZA 4Z6YA 1XNQM 3SAUA 1W5SA 3UK6A 2KZUA 3T15A 4MB7A 4B3RM 3JR4A 3KS4A 3NBIA 4ITQA 3ILKA 4D81A 2E5LM 3VFDA 4LF6M 2HL7A 2V1UA 2NQ8C 1IN6A 4JI6M 2CHQA 4II7A 4NXNM 3K92A 1NJGA 5EXTA 3FYCA 4DR7M 2O5RA 3QAUA 4LF7M 4LCBA 3AOEC 4IBEA 5ITYA 4LZJA 4IJFA 3W0FA 3GQ4A 4YY3M 4FCWA 1NVMA 2L7HA 2I7NA 5C1BA 7CATA 4JI4M 2UUAM 5FSWA 5FTMA 2CV2A 1XMQM 1L1ZA 1R2ZA 1S3SA 5BR8M 1E9RA 2XLJA 2X49A 3AOGA 1HT1E 4LGMA 3JR5A 4JI5M 1G41A 1NY5A 2ERCA 4OX9M 1HQCA 3IG8A 2UU9M 2JA2A 4MGIE 4MM3B 4I81A 4QHTA 1IN5A 4CHTB 4MGZE 4L16A 5EP1A 4DV7M 2R65A 1L2BA 4CGYB 4X62M 4G4NA 2YR0A 3D8LA 5EQTA 3TWMA 1YE9A 3HJ8A 1TDZA 4MGYE 2UXDM 1LV7A 4B3TM 3FUUA 4GKKM 5ITQA 3MJ5A 3AJIB 2BJWA 4LRTA 1R2YA 3GRRA 4BB9A 5KPTA 1GLNA 3J27B 1EE8A 1SXJB 3VKGA 3SFZA 3RC3A 3GLHE 4LJ6A 1N32M 4W5WA 4JI3M 5EP3A 2VIIA 1ZQ9A 4EIWA 1KFVA 2BJVA 3GLIE 2LWXA 3RC8A 4LFCM 3JAMS 3HWSA 4PDIA 3GPYA 4AKHA 3U61B 2ZBKB 4FCVA 5KPZA 3GO8A 2Y0TA 1GKIA 2C99A 1MU5A 1IN4A 4LY6A 4JN6A 2CHVA 4JXJA 4B3MM 5LMNM 3UMMA 1HR0M 3TE6A 2CFOA 3FUVA 4I5SA 3LVWA 1XC8A 1SXJC 3KW6A 3T1HM 2P5TA 1ORYB 4QNRA 5IZ7D 3SASA 3GRYA 3L25A 4B7FA 2ZAOA 3PNYA 3SMPA 1IN8A 1NY6A 3FYDA 4IBDA 3WHKA 4HL4A 1I94M 4FWHA 3U61A 2ZANA 4X65M 5BPVA 2DZOB 1XHBA 4AG6A 2VQFM 4CISA 1IXZA 3K8ZA 1FJGM 3CTDA 3GPXA 3KS8A 4GH9A 3CF2A 1J09A 1Z5BA 2Y20A 3HHXA 4OVZA 3GLGA 2V6ZM 4I8OA 4OU7A 2CE7A 4L4UA 4P16A 3KP1E 4TUWA 2D7GA 4DR2M 1DGFA 3CTWB 3K2LA 4K0KM 2KRUA 3VK7A 2XEPA 5EJCA 2L09A 2DWNA 3HU3A 1N78A 2KEBA 3T38A 4AQYM 1ZAEA 1XXHA 2Y21A 5KQDA 3KFUG 4YHHM 3BGEA 5ITTA 2YQZA 5A2QS 2FNAA 3CF6E 3SMSA 2HKJA 3KXEC 4JV5M 3SYLA 5ITXE 2RGOA 3TL4X 1IBKM 2QPAA 4PDGA 1NHWC 5EP2A 3I51A 1Q3CA 4GHLA 4NSRA 1VDDA 4LJAA 2G8LA 2C9OA 3GRUA 4GRIA 1G8PA 5IWAM 4LJ8A 3HJSA 1E32A 3VLFB 5C18A 2A5YB 3T1YM 1IY2A 2M5ZA 4B08A 1MX0A 3LQRA 1QQWA 2FFJA 4KODA 4IBKA 4GIPA 5FTLA 1XXHB 1DGHA 4X66M 2J7OA 4XGIA 3KOWE 2DWMA 3J7BA 3KVWA 3M0EA 2Z7JA 2DWZB 4GKJM 2XSZA 3OTOM 1G4AE 2XH9A 4REZA 1XWIA 1HQYE 2RGHA 3FUWA 3SYKA 3U6DA 3U6LA 2F5SA 1R6BX 1T3TA 2QENA 4M9SA 2F5QA 3W0LB 3E9SA 2CEAA 4LJ9A 2UXCM 3GLHA 3IG5A 2CHGA 5ITXA 3PFIA 1OJLA 5E6JA 4GHAA 4QNMA 1N34M 3SC3A 2C98A 4I4LA 2W82A 5KO3A 4RF1A 1Z5CA 4MGHA 1QAQA 5ITUA 2XF3A 4XBOA 4HLQA 1IQPA 2EO2A 2DXIA 2R9GA 1TGUA 3L27A 2L7IA 4DR5M 4G4QA 2DZNB 3AFHA 3LQQA 4B7HA 1PJJA 4DR4M 1IY1A 3R8FA 3FUXA 4LJ7A 4DV1M 2M60A 3DFZA 1SXJE 5KPRA 3ZCBB 1JQJC 3M7GA 2XGNA 2D7HA 5FLXS 3HHYA 3LVVA 2DWLA 3KSXA 3FKEA 1J7KA 1XMOM 1SXJA 3PNVA 3Q8XA 1XNRM 2QP9X 5IT9S 2YFQA 1D2NA 1TH3A 3PVSA 3GLGB 3U6PA 4NXMM 3RFWA 5JI2E 3RGPA 2V1CA 2ZM6M 3QWLA 1N36M 2KXEA 3FD9A 1UM8A 3HGIA 4DV0M 4DV6M 5EXSA 3GLHB 2K47A 3K1JA 5DNYA 1N75A 4DUYM 1IXRC 3VK8A 1TH2A 4R7GA 3KOYE 3U6QA 2Q2EB 3TQSA 1Q3BA 3L2AA 3RGSA 4KLNA 4QHSA 4PT5A 1HNZM 5LMUM 1R7RA 3J2PB 3TWLA 3HU1A 1PJIA 4DR1M 1Z6TA 1QAMA 1NNUC 1QZMA 3HJQA 1QVRA 3L29A 2CUZA 4QOZC 1DGGA 3GQ5A 4LF8M 3FTCA 3R9XB 1Z5AA 2F5OA 4LRSA 1E94E 1NHGC 4L78A 5FTJA 3ZH9B 3GLIB 1MW5A 4LJ4A 2QBYB 1C1KA 2ZAMA 3THGA 4JI0M 2GNOA 4NRVA 2L6OA 4B7GA 3GQ3A 3ZC7B 3SAWA 4AI6A 1L1TA 3UZUA 2UUCM 2I7PA 4GC9A 2CV1A 2LXEA 1GL7A 4LJ5A 3L26A 4QOSA 2XZFA 4LG2A 3NWLA 1GVNA 4M9ZA 1NJFA 5ITRA 3A98B 1DO2A 1JR3D 4GMQA 4FD2A 3TWKA 2YNMD 5FTNA 4DV4M 1E9SA 4IBBA 4FW9A 4X64M 2QZ4A 3EIHA 3U60B 1WXQA 1DO0A 3M6AA 2H1RA 1HT2E 3AOEA 1HNWM 3SAVA 3GPUA 4L15A 4GC5A 2RKOA 4GITA 3FTDA 1I4WA 3L28A 2EUCA 3CF0A 4FWGA 1IBLM 3KP0E 4KO8A 4JI8M 2UXBM 4AKGA 3SBJA 2CV0A 2R46A 1W5TA 5F3WA 1GL6A 3C58A 3U6CA 4NRWA 5FTKA 2OPFA 3A46A 2R18A 2F5NA 1A5TA 2F5PA 5EXPA 5EXXA 4DR6M 2Z3XA 3DOAA 1IY0A 4B3SM 5H37D 2DVWB 3UJNA 2C5RA 3B9PA 3HHWA 4LFBM 1OFHA 2AHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U60 A;  3U5Z A;  3U61 A; 
#chains in the Genus database with same CATH topology
 3EIE A;  1V34 A;  1G3I A;  3HHZ A;  1YSY A;  4Z8X A;  4IBG A;  3U6E A;  2OQ4 A;  2VF8 A;  3SAT A;  1IM2 A;  4CHD A;  1X37 A;  1JR3 E;  1DGH B;  4M0W A;  2R4J A;  3KOZ E;  4OW0 A;  4A3V B;  1L2D A;  4BBA A;  4JI7 M;  4AW4 A;  2D7E A;  1QUS A;  4JYA M;  2Y0Q A;  2LH0 A;  3J81 S;  4LGY A;  2C96 A;  3AV0 A;  4OVZ B;  3U6O A;  3I4Y A;  2VQE M;  3GLF A;  1H6U A;  2UUB M;  4KHP M;  2EKF A;  4MH0 E;  2KZS A;  4KT0 F;  3KSJ A;  2XSZ D;  3VKH A;  2G3Q A;  4L8R C;  4FVM A;  3SHG B;  3KDS E;  1TDH A;  2BNK A;  4IIW A;  1NNJ A;  5EP4 A;  1YUB A;  2L4F A;  2KA6 B;  8CAT A;  1GJT A;  3GLF E;  2HCB A;  2R44 A;  2LVO C;  2L2D A;  4G6Z A;  3FUT A;  3TPZ A;  3VDP A;  1N77 A;  1FNN A;  3RE8 A;  1WJ7 A;  1K82 A;  3B7N A;  2R4E A;  2G5G X;  2XZU A;  1G59 A;  1Z59 A;  3U6S A;  2DZL A;  2DHY A;  1L2C A;  2EA0 A;  3AKZ A;  1K3X A;  3KOX E;  2KW0 A;  4D82 A;  2X4A A;  1QAN A;  2MH8 A;  2HHH M;  4AG5 A;  2Z4R A;  2FS1 A;  2QW6 A;  2WZJ A;  4NSO B;  2MJ5 B;  1N33 M;  4PCZ A;  1JB0 F;  4IBI A;  4JI2 M;  1K3W A;  1BVS A;  2R45 A;  3WHL A;  1J5E M;  5DYI A;  2Z4S A;  3U5Z B;  4G4O A;  3SAR A;  4RNA A;  3B7Z A;  3PXG A;  2DHR A;  2XFT A;  3DZD A;  2JY5 A;  3A45 A;  3DA1 A;  1IN7 A;  2QBY A;  4AKI A;  3J7A S;  1KSF X;  1T43 A;  2X8A A;  3MHV C;  4FCT A;  2N35 A;  3UGJ A;  4G4R A;  4IBJ A;  4DV5 M;  3MMP A;  1IBM M;  1NSF A;  4WW0 A;  1OIP A;  3GLG E;  3F92 A;  1SXJ D;  1TH4 A;  1D0K A;  3GRV A;  4R3D A;  3HX3 A;  2LVQ D;  3FTF A;  4IJE A;  3SHF A;  4PD2 A;  1PM5 A;  3GLF B;  4DBG B;  3J80 S;  4IBC A;  1SG9 A;  3ES5 A;  5GKN A;  4RF0 A;  3U60 A;  1TTE A;  3GP1 A;  5JI3 E;  1QAO A;  1MJG M;  4FWD A;  1XXH E;  2Z8Y M;  3LMM A;  2LNH C;  1IXS B;  1OFI A;  2JZ0 A;  2KNA A;  4WUR A;  5KQ8 A;  3I4V A;  5E26 A;  2OOB A;  3HKP A;  3HU2 A;  3MK6 A;  4BLC A;  4LF9 M;  4LFA M;  1ZV1 A;  1Q39 A;  1UFZ A;  5DYG A;  3GPP A;  2KRK A;  2R62 A;  1PJQ A;  4M9X A;  3GLI A;  4LF5 M;  4CIZ A;  2XFS A;  2EJS A;  2LHG A;  1CUK A;  1WR1 B;  5IRE B;  4IBF A;  3AL0 C;  4DR3 M;  2FOI C;  4MGK E;  4LF4 M;  1EFU B;  1HNX M;  1DGB A;  4AZF A;  2FE8 A;  3FTE A;  4NOO B;  1KYI A;  4S12 A;  4M0D A;  3VDU A;  2QCU A;  3A42 A;  4LZZ A;  3HY5 A;  3D8B A;  2F4V M;  1L8Q A;  1QYR A;  2KHH A;  3BOS A;  1Q02 A;  4DV2 M;  1JR3 A;  2J7N A;  3U6M A;  4ZPX A;  2C9C A;  3H4M A;  2LVP C;  4NL4 H;  4D80 A;  4DV3 M;  2JXN A;  2JY7 A;  3E4R A;  2R0I A;  1ZMW A;  4Z6Y A;  3U5Z A;  3SAU A;  1XNQ M;  1W5S A;  3B7Q A;  2DKL A;  4NC6 A;  3UK6 A;  1R4G A;  2KZU A;  3T15 A;  4MB7 A;  2JNH A;  4B3R M;  3JR4 A;  1R5L A;  3KS4 A;  3W68 A;  3FE3 A;  3NBI A;  4ITQ A;  1VEG A;  3ILK A;  4D81 A;  2E5L M;  3VFD A;  4LF6 M;  2HL7 A;  2V1U A;  2NQ8 C;  1IN6 A;  1QUT A;  4JI6 M;  2CHQ A;  4II7 A;  4NXN M;  3K92 A;  1NJG A;  5EXT A;  3FYC A;  4DR7 M;  3K9P A;  2O5R A;  3QAU A;  4LF7 M;  4LCB A;  1PJS A;  2QHO B;  2VF7 A;  3AOE C;  4IBE A;  4IJF A;  4LZJ A;  5ITY A;  2DAM A;  4FCW A;  1NVM A;  2L7H A;  2I7N A;  5C1B A;  7CAT A;  4YY3 M;  4JI4 M;  2K9D A;  2UUA M;  2JY6 B;  5FSW A;  5FTM A;  2CV2 A;  1XMQ M;  2LBC A;  1L1Z A;  4R71 A;  3H4J A;  1R2Z A;  1S3S A;  5BR8 M;  2HAK A;  1E9R A;  1AUA A;  2XLJ A;  2X49 A;  3AOG A;  1HT1 E;  2MRO B;  4LGM A;  3JR5 A;  4JI5 M;  1G41 A;  1NY5 A;  2ERC A;  3B89 A;  3GQ4 A;  4OX9 M;  1HQC A;  3IG8 A;  2UU9 M;  2JA2 A;  4MGI E;  4MM3 B;  1MN3 A;  4I81 A;  4QHT A;  1IN5 A;  2JZ1 A;  1V33 A;  4CHT B;  4MGZ E;  2EKK A;  4L16 A;  5EP1 A;  4DV7 M;  3T6P A;  2R65 A;  3FRH A;  4CGY B;  1L2B A;  4X62 M;  4G4N A;  2YR0 A;  5L8R F;  3D8L A;  5EQT A;  3TWM A;  1YE9 A;  3HJ8 A;  1TDZ A;  4MGY E;  2UXD M;  1P3Q Q;  1LV7 A;  1LTM A;  4B3T M;  3FUU A;  4GKK M;  5ITQ A;  3MJ5 A;  3AJI B;  2BJW A;  4LRT A;  4CJ6 A;  3GRR A;  4BB9 A;  2QQ8 A;  5KPT A;  1R2Y A;  1GLN A;  3J27 B;  3NBX X;  1EE8 A;  1RU3 A;  1SXJ B;  3QYB A;  3VKG A;  2CRU A;  3SFZ A;  3RC3 A;  1QDR A;  3GLH E;  4LJ6 A;  1ZMV A;  1N32 M;  4W5W A;  4JI3 M;  2KNV A;  5EP3 A;  3B74 A;  2VII A;  1ZQ9 A;  4EIW A;  1KFV A;  1HJP A;  2BJV A;  4HEO A;  3GLI E;  2LWX A;  3RC8 A;  4LFC M;  3JAM S;  3HWS A;  1F4I A;  1Y8G A;  4PDI A;  3GPY A;  4AKH A;  3U61 B;  2ZBK B;  4FCV A;  5KPZ A;  3GO8 A;  2Y0T A;  2CP8 A;  1GKI A;  2C99 A;  1MU5 A;  1IN4 A;  1OQY A;  4LY6 A;  4JN6 A;  1VQ1 A;  2CHV A;  4JXJ A;  4L6V 6;  4B3M M;  5LMN M;  3UMM A;  2WSC F;  1HR0 M;  3TE6 A;  2CFO A;  3FUV A;  4I5S A;  3LVW A;  1XC8 A;  1SXJ C;  3KW6 A;  3T1H M;  2P5T A;  1ORY B;  1PGY A;  4QNR A;  5IZ7 D;  3SAS A;  3GRY A;  3ZQJ A;  3L25 A;  3BXW A;  2ZAO A;  4B7F A;  3PNY A;  3SMP A;  3LCV B;  1IN8 A;  1NY6 A;  3E21 A;  3FYD A;  4GEW A;  3W67 A;  4IBD A;  3WHK A;  4HL4 A;  1I94 M;  3V76 A;  1IXS A;  4FWH A;  3U61 A;  2MR9 A;  2ZAN A;  4X65 M;  3C3D A;  5BPV A;  2QNJ A;  2DZO B;  1XHB A;  4AG6 A;  2VQF M;  4CIS A;  1GJS A;  1IXZ A;  3K8Z A;  1FJG M;  3CTD A;  3GPX A;  3KS8 A;  4GH9 A;  1WGL A;  1J09 A;  1Z5B A;  2Y20 A;  3CF2 A;  1GO5 A;  1EIJ A;  3HHX A;  4OVZ A;  3GLG A;  2V6Z M;  4I8O A;  4OU7 A;  2CE7 A;  4L4U A;  2LVN C;  4P16 A;  3KP1 E;  4TUW A;  2D7G A;  4DR2 M;  1DGF A;  3CTW B;  1PJT A;  3K2L A;  4K0K M;  2K6B A;  2KRU A;  3FRI A;  2XEP A;  5EJC A;  3VK7 A;  2L09 A;  2DAE A;  2DWN A;  3HU3 A;  2JWS A;  2O01 F;  1G71 A;  1N78 A;  2KEB A;  3T38 A;  4AQY M;  1ZAE A;  1XXH A;  2DI0 A;  2Y21 A;  5KQD A;  4YHH M;  3KFU G;  3BGE A;  5ITT A;  2YQZ A;  2B3T A;  2DAI A;  2APL A;  5A2Q S;  2FNA A;  3IEC A;  3CF6 E;  3SMS A;  2HKJ A;  3KXE C;  3QYE A;  4JV5 M;  2BWE A;  3SYL A;  5ITX E;  2RGO A;  1T6O A;  3TL4 X;  1VG5 A;  1IBK M;  2QPA A;  4PDG A;  1NHW C;  1WHC A;  5EP2 A;  3I51 A;  1Q3C A;  1WGN A;  4GHL A;  4NSR A;  2FH0 A;  1OAI A;  1VDD A;  4LJA A;  1OTR A;  2C9O A;  2G8L A;  3GRU A;  1G8P A;  4GRI A;  4LJ8 A;  5IWA M;  3HJS A;  1E32 A;  3VLF B;  5C18 A;  2A5Y B;  3T1Y M;  1IY2 A;  2M5Z A;  4B08 A;  1MX0 A;  3LQR A;  3C3E A;  2MGW A;  1QQW A;  2FFJ A;  2KNZ A;  1YLA A;  4KOD A;  1IFY A;  4IBK A;  4GIP A;  5FTL A;  1XXH B;  1DGH A;  4X66 M;  2J7O A;  4XGI A;  3KOW E;  1D0M A;  2DWM A;  3J7B A;  3KVW A;  3M0E A;  2Z7J A;  2DWZ B;  1VEK A;  4GKJ M;  2J5Y A;  2XSZ A;  3OTO M;  1G4A E;  2XH9 A;  4REZ A;  1XWI A;  1HQY E;  2RGH A;  3FUW A;  1AIP C;  2DEN A;  3SYK A;  3U6D A;  3U6L A;  2F5S A;  1R6B X;  1T3T A;  2QEN A;  4M9S A;  2F5Q A;  3W0L B;  3E9S A;  1OKS A;  2CEA A;  4LJ9 A;  2LVA A;  2UXC M;  2QSF X;  3GLH A;  3IG5 A;  2CHG A;  5ITX A;  1NV8 A;  3PFI A;  1OJL A;  2BWB A;  2DNA A;  4QNM A;  5E6J A;  4GHA A;  1N34 M;  3SC3 A;  2C98 A;  4I4L A;  2W82 A;  5KO3 A;  4RF1 A;  1Z5C A;  4MGH A;  1QAQ A;  5ITU A;  4F1I A;  5DFL A;  2XF3 A;  4XBO A;  4HLQ A;  1IQP A;  2EO2 A;  2DXI A;  2R9G A;  1TGU A;  3L27 A;  2L7I A;  1TF0 B;  4DR5 M;  4G4Q A;  2DZN B;  3AFH A;  3LQQ A;  4B7H A;  1PJJ A;  4JI1 M;  4DR4 M;  1IY1 A;  3R8F A;  3FUX A;  4LJ7 A;  2R6F A;  4DV1 M;  1ZMU A;  2M60 A;  3DFZ A;  1SXJ E;  5KPR A;  3ZCB B;  2GQF A;  1JQJ C;  3M7G A;  2XGN A;  2D7H A;  5FLX S;  3HHY A;  3LVV A;  2DWL A;  3K9O A;  3KSX A;  3FKE A;  1J7K A;  1XMO M;  1SXJ A;  3LCU A;  3PNV A;  3Q8X A;  2QP9 X;  1XNR M;  5IT9 S;  2YFQ A;  1D2N A;  1TH3 A;  3PVS A;  3GLG B;  3U6P A;  4NXM M;  2JUJ A;  3RFW A;  5JI2 E;  3RGP A;  3CGW A;  2V1C A;  2ZM6 M;  1VDL A;  3QWL A;  1N36 M;  2H5X A;  1DV0 A;  1TR8 A;  1XB2 B;  2LHC A;  2ZTC A;  2KXE A;  3FD9 A;  1UM8 A;  3HGI A;  4DV0 M;  4DV6 M;  4WP2 A;  5EXS A;  3GLH B;  2K47 A;  2WSE F;  3K1J A;  5DNY A;  1N75 A;  4DUY M;  1NV9 A;  1IXR C;  1OAO C;  3VK8 A;  2O25 A;  1TH2 A;  4R7G A;  3KOY E;  3U6Q A;  2Q2E B;  3TQS A;  1Q3B A;  3L2A A;  3I01 M;  3RGS A;  4KLN A;  4QHS A;  4PT5 A;  1HNZ M;  3I04 M;  5LMU M;  1R7R A;  3J2P B;  3TWL A;  3E46 A;  3HU1 A;  3LW5 F;  1PJI A;  3BBZ A;  1V92 A;  4DR1 M;  1Z6T A;  1QAM A;  1NNU C;  1QZM A;  2JY8 A;  3HJQ A;  1QVR A;  3L29 A;  2CUZ A;  4QOZ C;  1DGG A;  3GQ5 A;  2KDL A;  4LF8 M;  3FTC A;  3R9X B;  1Z5A A;  2F5O A;  4LRS A;  4RKU F;  1E94 E;  1NHG C;  4L78 A;  5FTJ A;  3ZH9 B;  3GLI B;  1MW5 A;  4LJ4 A;  2QBY B;  1C1K A;  2ZAM A;  3THG A;  4JI0 M;  2DAG A;  2GNO A;  4NRV A;  1D0L A;  2L6O A;  4B7G A;  3GQ3 A;  3ZC7 B;  3SAW A;  4AI6 A;  2VDB B;  1L1T A;  1QZE A;  3UZU A;  2I7P A;  2UUC M;  4GC9 A;  2CV1 A;  2LXE A;  1GL7 A;  2JP7 A;  4LJ5 A;  3L26 A;  4QOS A;  2XZF A;  4LG2 A;  3NWL A;  1GVN A;  4M9Z A;  4XK8 F;  1NJF A;  4Y28 F;  5ITR A;  3A98 B;  1DO2 A;  1JR3 D;  2DAK A;  4FD2 A;  4GMQ A;  3TWK A;  2YNM D;  5FTN A;  4DV4 M;  1E9S A;  4IBB A;  4FW9 A;  2WSF F;  4UN2 B;  4X64 M;  2QZ4 A;  3EIH A;  3U60 B;  1C7Y A;  1WXQ A;  1DO0 A;  3M6A A;  2H1R A;  1HT2 E;  3AOE A;  4F2L A;  1HNW M;  1QDT A;  3SAV A;  1NO1 A;  3GPU A;  2K0B X;  4L15 A;  4GC5 A;  2RKO A;  4GIT A;  4P17 A;  3FTD A;  1I4W A;  1VEJ A;  3Q8G A;  3L28 A;  3W0F A;  2EUC A;  3CF0 A;  4FWG A;  4G3O A;  4ANR A;  1IBL M;  3HZJ A;  3KP0 E;  2OO9 A;  4KO8 A;  4JI8 M;  3C9P A;  2UXB M;  4AKG A;  3SBJ A;  2CV0 A;  2ZTD A;  2R46 A;  1PRB A;  2CWB A;  1W5T A;  5F3W A;  1GL6 A;  3C58 A;  1OIZ A;  3U6C A;  2RRU A;  4Q7J A;  4NRW A;  5FTK A;  1WIV A;  2OPF A;  3A46 A;  2R18 A;  2F5N A;  1A5T A;  2F5P A;  5EXP A;  5EXX A;  4DR6 M;  4DUZ M;  2Z3X A;  3DOA A;  1GAB A;  1IY0 A;  2OOA A;  4B3S M;  2L4E A;  5H37 D;  2DVW B;  3UJN A;  2C5R A;  3B9P A;  3HHW A;  2LTU A;  4LFB M;  2HWJ A;  1OFH A;  2AHM A;  3IHP A; 
#chains in the Genus database with same CATH homology
 3EIE A;  1G3I A;  3HHZ A;  1YSY A;  4Z8X A;  4IBG A;  3U6E A;  2OQ4 A;  3SAT A;  1IM2 A;  4CHD A;  1X37 A;  1JR3 E;  1DGH B;  4M0W A;  2R4J A;  3KOZ E;  4OW0 A;  4A3V B;  1L2D A;  4BBA A;  4JI7 M;  4AW4 A;  2D7E A;  4JYA M;  2Y0Q A;  2LH0 A;  3J81 S;  4LGY A;  2C96 A;  3AV0 A;  4OVZ B;  3U6O A;  3I4Y A;  2VQE M;  3GLF A;  1H6U A;  2UUB M;  4KHP M;  4MH0 E;  2KZS A;  3KSJ A;  2XSZ D;  3VKH A;  4L8R C;  4FVM A;  3SHG B;  3KDS E;  1TDH A;  2BNK A;  4IIW A;  1NNJ A;  5EP4 A;  1YUB A;  2KA6 B;  8CAT A;  3GLF E;  2HCB A;  4G6Z A;  3TPZ A;  3FUT A;  3VDP A;  1N77 A;  1K82 A;  1FNN A;  3RE8 A;  4JI1 M;  2R4E A;  2G5G X;  2XZU A;  1G59 A;  1Z59 A;  3U6S A;  1L2C A;  2EA0 A;  3AKZ A;  1K3X A;  3KOX E;  2KW0 A;  4D82 A;  2X4A A;  1QAN A;  2HHH M;  4AG5 A;  2Z4R A;  2QW6 A;  4NSO B;  1N33 M;  4PCZ A;  4IBI A;  4JI2 M;  1K3W A;  2R45 A;  3WHL A;  1J5E M;  5DYI A;  2Z4S A;  3U5Z B;  4G4O A;  3SAR A;  4RNA A;  3PXG A;  2DHR A;  3DZD A;  2XFT A;  3A45 A;  3DA1 A;  1IN7 A;  2QBY A;  4AKI A;  3J7A S;  1KSF X;  2X8A A;  3MHV C;  4FCT A;  3UGJ A;  4G4R A;  4IBJ A;  4DV5 M;  1IBM M;  1NSF A;  4WW0 A;  3GLG E;  1SXJ D;  1TH4 A;  4R3D A;  3GRV A;  3FTF A;  4IJE A;  3SHF A;  4PD2 A;  1PM5 A;  3GLF B;  3J80 S;  4IBC A;  3ES5 A;  5GKN A;  4RF0 A;  3U60 A;  3GP1 A;  5JI3 E;  1QAO A;  4FWD A;  1XXH E;  3LMM A;  2LNH C;  1OFI A;  1IXS B;  4WUR A;  5KQ8 A;  4DUZ M;  3I4V A;  5E26 A;  3HKP A;  3HU2 A;  4BLC A;  3MK6 A;  4LF9 M;  4LFA M;  1Q39 A;  5DYG A;  3GPP A;  2KRK A;  2R62 A;  4M9X A;  3GLI A;  4LF5 M;  2XFS A;  5IRE B;  4IBF A;  3AL0 C;  4DR3 M;  2FOI C;  4MGK E;  4LF4 M;  1HNX M;  1DGB A;  4AZF A;  2FE8 A;  3FTE A;  4NOO B;  1KYI A;  4S12 A;  4M0D A;  3VDU A;  2QCU A;  3A42 A;  4LZZ A;  2F4V M;  3D8B A;  1L8Q A;  1QYR A;  3BOS A;  3U6M A;  4DV2 M;  1JR3 A;  2J7N A;  4ZPX A;  2C9C A;  3H4M A;  4NL4 H;  4D80 A;  4DV3 M;  3E4R A;  3U5Z A;  4Z6Y A;  1XNQ M;  3SAU A;  1W5S A;  3UK6 A;  2KZU A;  3T15 A;  4MB7 A;  4B3R M;  3JR4 A;  3KS4 A;  3NBI A;  4ITQ A;  3ILK A;  4D81 A;  2E5L M;  3VFD A;  4LF6 M;  2HL7 A;  2V1U A;  2NQ8 C;  1IN6 A;  4JI6 M;  2CHQ A;  4II7 A;  4NXN M;  3K92 A;  1NJG A;  5EXT A;  3FYC A;  4DR7 M;  2O5R A;  3QAU A;  4LF7 M;  4LCB A;  3AOE C;  4IBE A;  5ITY A;  4LZJ A;  4IJF A;  3W0F A;  3GQ4 A;  4YY3 M;  4FCW A;  1NVM A;  2L7H A;  2I7N A;  5C1B A;  7CAT A;  4JI4 M;  2UUA M;  5FSW A;  5FTM A;  2CV2 A;  1XMQ M;  1L1Z A;  1R2Z A;  1S3S A;  5BR8 M;  1E9R A;  2XLJ A;  2X49 A;  3AOG A;  1HT1 E;  4LGM A;  3JR5 A;  4JI5 M;  1G41 A;  1NY5 A;  2ERC A;  4OX9 M;  1HQC A;  3IG8 A;  2UU9 M;  2JA2 A;  4MGI E;  4MM3 B;  4I81 A;  4QHT A;  1IN5 A;  4CHT B;  4MGZ E;  4L16 A;  5EP1 A;  4DV7 M;  2R65 A;  1L2B A;  4CGY B;  4X62 M;  4G4N A;  2YR0 A;  3D8L A;  5EQT A;  3TWM A;  1YE9 A;  3HJ8 A;  1TDZ A;  4MGY E;  2UXD M;  1LV7 A;  4B3T M;  3FUU A;  4GKK M;  5ITQ A;  3MJ5 A;  3AJI B;  2BJW A;  4LRT A;  1R2Y A;  3GRR A;  4BB9 A;  5KPT A;  1GLN A;  3J27 B;  1EE8 A;  1SXJ B;  3VKG A;  3SFZ A;  3RC3 A;  3GLH E;  4LJ6 A;  1N32 M;  4W5W A;  4JI3 M;  5EP3 A;  2VII A;  1ZQ9 A;  4EIW A;  1KFV A;  2BJV A;  3GLI E;  2LWX A;  3RC8 A;  4LFC M;  3JAM S;  3HWS A;  4PDI A;  3GPY A;  4AKH A;  3U61 B;  2ZBK B;  4FCV A;  5KPZ A;  3GO8 A;  2Y0T A;  1GKI A;  2C99 A;  1MU5 A;  1IN4 A;  4LY6 A;  4JN6 A;  2CHV A;  4JXJ A;  4B3M M;  5LMN M;  3UMM A;  1HR0 M;  3TE6 A;  2CFO A;  3FUV A;  4I5S A;  3LVW A;  1XC8 A;  1SXJ C;  3KW6 A;  3T1H M;  2P5T A;  1ORY B;  4QNR A;  5IZ7 D;  3SAS A;  3GRY A;  3L25 A;  4B7F A;  2ZAO A;  3PNY A;  3SMP A;  1IN8 A;  1NY6 A;  3FYD A;  4IBD A;  3WHK A;  4HL4 A;  1I94 M;  4FWH A;  3U61 A;  2ZAN A;  4X65 M;  5BPV A;  2DZO B;  1XHB A;  4AG6 A;  2VQF M;  4CIS A;  1IXZ A;  3K8Z A;  1FJG M;  3CTD A;  3GPX A;  3KS8 A;  4GH9 A;  3CF2 A;  1J09 A;  1Z5B A;  2Y20 A;  3HHX A;  4OVZ A;  3GLG A;  2V6Z M;  4I8O A;  4OU7 A;  2CE7 A;  4L4U A;  4P16 A;  3KP1 E;  4TUW A;  2D7G A;  4DR2 M;  1DGF A;  3CTW B;  3K2L A;  4K0K M;  2KRU A;  3VK7 A;  2XEP A;  5EJC A;  2L09 A;  2DWN A;  3HU3 A;  1N78 A;  2KEB A;  3T38 A;  4AQY M;  1ZAE A;  1XXH A;  2Y21 A;  5KQD A;  3KFU G;  4YHH M;  3BGE A;  5ITT A;  2YQZ A;  5A2Q S;  2FNA A;  3CF6 E;  3SMS A;  2HKJ A;  3KXE C;  4JV5 M;  3SYL A;  5ITX E;  2RGO A;  3TL4 X;  1IBK M;  2QPA A;  4PDG A;  1NHW C;  5EP2 A;  3I51 A;  1Q3C A;  4GHL A;  4NSR A;  1VDD A;  4LJA A;  2G8L A;  2C9O A;  3GRU A;  4GRI A;  1G8P A;  5IWA M;  4LJ8 A;  3HJS A;  1E32 A;  3VLF B;  5C18 A;  2A5Y B;  3T1Y M;  1IY2 A;  2M5Z A;  4B08 A;  1MX0 A;  3LQR A;  1QQW A;  2FFJ A;  4KOD A;  4IBK A;  4GIP A;  5FTL A;  1XXH B;  1DGH A;  4X66 M;  2J7O A;  4XGI A;  3KOW E;  2DWM A;  3J7B A;  3KVW A;  3M0E A;  2Z7J A;  2DWZ B;  4GKJ M;  2XSZ A;  3OTO M;  1G4A E;  2XH9 A;  4REZ A;  1XWI A;  1HQY E;  2RGH A;  3FUW A;  3SYK A;  3U6D A;  3U6L A;  2F5S A;  1R6B X;  1T3T A;  2QEN A;  4M9S A;  2F5Q A;  3W0L B;  3E9S A;  2CEA A;  4LJ9 A;  2UXC M;  3GLH A;  3IG5 A;  2CHG A;  5ITX A;  3PFI A;  1OJL A;  5E6J A;  4GHA A;  4QNM A;  1N34 M;  3SC3 A;  2C98 A;  4I4L A;  2W82 A;  5KO3 A;  4RF1 A;  1Z5C A;  4MGH A;  1QAQ A;  5ITU A;  2XF3 A;  4XBO A;  4HLQ A;  1IQP A;  2EO2 A;  2DXI A;  2R9G A;  1TGU A;  3L27 A;  2L7I A;  4DR5 M;  4G4Q A;  2DZN B;  3AFH A;  3LQQ A;  4B7H A;  1PJJ A;  4DR4 M;  1IY1 A;  3R8F A;  3FUX A;  4LJ7 A;  4DV1 M;  2M60 A;  3DFZ A;  1SXJ E;  5KPR A;  3ZCB B;  1JQJ C;  3M7G A;  2XGN A;  2D7H A;  5FLX S;  3HHY A;  3LVV A;  2DWL A;  3KSX A;  3FKE A;  1J7K A;  1XMO M;  1SXJ A;  3PNV A;  3Q8X A;  1XNR M;  2QP9 X;  5IT9 S;  2YFQ A;  1D2N A;  1TH3 A;  3PVS A;  3GLG B;  3U6P A;  4NXM M;  3RFW A;  5JI2 E;  3RGP A;  2V1C A;  2ZM6 M;  3QWL A;  1N36 M;  2KXE A;  3FD9 A;  1UM8 A;  3HGI A;  4DV0 M;  4DV6 M;  5EXS A;  3GLH B;  2K47 A;  3K1J A;  5DNY A;  1N75 A;  4DUY M;  1IXR C;  3VK8 A;  1TH2 A;  4R7G A;  3KOY E;  3U6Q A;  2Q2E B;  3TQS A;  1Q3B A;  3L2A A;  3RGS A;  4KLN A;  4QHS A;  4PT5 A;  1HNZ M;  5LMU M;  1R7R A;  3J2P B;  3TWL A;  3HU1 A;  1PJI A;  4DR1 M;  1Z6T A;  1QAM A;  1NNU C;  1QZM A;  3HJQ A;  1QVR A;  3L29 A;  2CUZ A;  4QOZ C;  1DGG A;  3GQ5 A;  4LF8 M;  3FTC A;  3R9X B;  1Z5A A;  2F5O A;  4LRS A;  1E94 E;  1NHG C;  4L78 A;  5FTJ A;  3ZH9 B;  3GLI B;  1MW5 A;  4LJ4 A;  2QBY B;  1C1K A;  2ZAM A;  3THG A;  4JI0 M;  2GNO A;  4NRV A;  2L6O A;  4B7G A;  3GQ3 A;  3ZC7 B;  3SAW A;  4AI6 A;  1L1T A;  3UZU A;  2UUC M;  2I7P A;  4GC9 A;  2CV1 A;  2LXE A;  1GL7 A;  4LJ5 A;  3L26 A;  4QOS A;  2XZF A;  4LG2 A;  3NWL A;  1GVN A;  4M9Z A;  1NJF A;  5ITR A;  3A98 B;  1DO2 A;  1JR3 D;  4GMQ A;  4FD2 A;  3TWK A;  2YNM D;  5FTN A;  4DV4 M;  1E9S A;  4IBB A;  4FW9 A;  4X64 M;  2QZ4 A;  3EIH A;  3U60 B;  1WXQ A;  1DO0 A;  3M6A A;  2H1R A;  1HT2 E;  3AOE A;  1HNW M;  3SAV A;  3GPU A;  4L15 A;  4GC5 A;  2RKO A;  4GIT A;  3FTD A;  1I4W A;  3L28 A;  2EUC A;  3CF0 A;  4FWG A;  1IBL M;  3KP0 E;  4KO8 A;  4JI8 M;  2UXB M;  4AKG A;  3SBJ A;  2CV0 A;  2R46 A;  1W5T A;  5F3W A;  1GL6 A;  3C58 A;  3U6C A;  4NRW A;  5FTK A;  2OPF A;  3A46 A;  2R18 A;  2F5N A;  1A5T A;  2F5P A;  5EXP A;  5EXX A;  4DR6 M;  2Z3X A;  3DOA A;  1IY0 A;  4B3S M;  5H37 D;  2DVW B;  3UJN A;  2C5R A;  3B9P A;  3HHW A;  4LFB M;  1OFH A;  2AHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...