3U60A

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
186
structure length
186
Chain Sequence
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase accessory protein 44
total genus 41
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60A03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60A02
3U61A 3U60A 3U5ZA
chains in the Genus database with same CATH superfamily
1ZQ9A 1QAQA 1IM2A 2DWZB 2K6BA 2YQZA 2ERCA 2LVAA 3SYKA 3VDPA 2BJVA 2XF3A 5L8RF 5DNYA 4D81A 2Z8YM 2L4FA 5DFLA 4NSOB 1IN7A 1DGHA 2N35A 3BGEA 4KHPM 1NJFA 3L27A 3K2LA 1C7YA 3E4RA 4ZPXA 3ES5A 1N32M 3EIEA 2QPAA 4L16A 3J80S 1GL7A 4MB7A 4P16A 1Q3BA 1ZV1A 2J7NA 3J2PB 2YR0A 4OVZB 1IY2A 4QHTA 4I5SA 2DAIA 2QQ8A 3FTCA 4NC6A 2RGHA 2WSCF 1WXQA 2XSZD 4LJ5A 1L2DA 3GLHA 4DR2M 2LVQD 2C98A 2CEAA 4GC5A 4RF1A 1IN6A 3I4YA 4B7GA 4DUZM 1IBKM 1XXHE 5IT9S 1G59A 1I94M 4GMQA 4LFAM 1IN4A 1MN3A 2K9DA 2R65A 1IN5A 3HU1A 2ZBKB 4AZFA 1V33A 3MJ5A 2EJSA 3HZJA 3VK7A 2G5GX 4IBBA 3R9XB 2RKOA 1PGYA 3U6CA 1QVRA 4CHTB 2R46A 3QWLA 4Z8XA 3R8FA 4B7HA 3GLGB 1L1TA 1P3QQ 2EUCA 2V1CA 2Z7JA 2HKJA 1R5LA 2EKFA 3B7NA 5KPZA 2F5NA 4CHDA 3SMSA 3U6SA 4QNMA 2KEBA 4NRVA 3NWLA 2UXCM 2KRKA 4GH9A 1N75A 2XLJA 5A2QS 3IG5A 4NXNM 3GQ4A 3GLGA 5E6JA 4B3MM 4JI4M 3DOAA 3CTWB 2RGOA 4KO8A 3T1YM 1EE8A 4M0DA 3GPXA 3GO8A 1J09A 5F3WA 4LF9M 3UGJA 1HT1E 2VQFM 1GLNA 2Q2EB 4IBFA 4GEWA 3TE6A 2UUAM 3K1JA 4DV5M 2QBYB 5ITRA 3LW5F 4LF8M 3WHKA 3C3EA 3J27B 3UJNA 2MR9A 4MGYE 2WSEF 3IG8A 5JI2E 3Q8GA 4EIWA 1IXRC 3BBZA 4OW0A 3TWMA 2J5YA 1N77A 1XMQM 2ZANA 3FUWA 4M0WA 3GRYA 3QYBA 2C9CA 2R62A 4A3VB 1QUSA 3SHGB 2DHYA 2QHOB 3E46A 3SAUA 4JI1M 3HKPA 1NNJA 1IBLM 4JI5M 1LV7A 3PFIA 4L8RC 4LF7M 3GLIB 4XBOA 2XFSA 1TH2A 1R2ZA 3U60B 3MMPA 4I81A 1C1KA 2F5QA 3B7QA 4DUYM 3EIHA 3U6OA 3BXWA 4JYAM 2JY8A 4F2LA 2O5RA 1I4WA 4QOZC 3HHWA 3K9PA 3GPPA 2LTUA 4QNRA 1G3IA 3KFUG 4JN6A 1N33M 1W5TA 1PJTA 4AG6A 2OOAA 3HJQA 3GQ5A 5KQDA 4I4LA 1WGNA 1WR1B 3UK6A 1TH4A 1XWIA 5ITXA 4IBKA 2XSZA 5E26A 2LHGA 3I51A 1IN8A 4GC9A 2CFOA 1NV9A 4R71A 4JXJA 3W0LB 2CHGA 1QAOA 3K8ZA 3J7AS 3L29A 3GLGE 3T1HM 1G8PA 4OU7A 2KZSA 1VDLA 4BBAA 1IXSA 2R6FA 3U6MA 3VDUA 1A5TA 1QYRA 3HY5A 5EP3A 2XFTA 3SAVA 2Z4RA 2GNOA 1HQYE 4AG5A 2LNHC 1Z59A 1MU5A 2LBCA 1L2CA 4FWHA 3GLFA 3KXEC 2BWEA 3ZQJA 1SXJE 4DV6M 3AL0C 1FNNA 5KO3A 1GJSA 2JZ1A 2JY7A 2KW0A 4DR1M 1TR8A 2V1UA 4DV0M 4QHSA 4MGHA 1GJTA 1J5EM 2OQ4A 5ITXE 3A46A 4CISA 1XXHA 2J7OA 3I01M 3B7ZA 1T43A 1TDHA 3AOEA 1L8QA 4DV7M 2XZUA 1Q02A 3AKZA 1ZMWA 3FUUA 1L1ZA 2F5PA 3KOYE 1XHBA 3LVVA 1GO5A 3L25A 1PJJA 1YSYA 4JI2M 1DO0A 2JUJA 4KODA 2MROB 1DGFA 2R4JA 4LJ9A 3ZH9B 2WZJA 4PDGA 1XNQM 4AKGA 1TH3A 3IHPA 1GKIA 1HT2E 4B3SM 1VEJA 3U61A 4DV3M 1VDDA 4X62M 5EXPA 3B89A 1OQYA 3A98B 4LGYA 5EP1A 5FSWA 2VDBB 1QDRA 3UZUA 3GRUA 4FCVA 1GL6A 4IIWA 1NHWC 2R4EA 2W82A 2DNAA 1NJGA 3C9PA 4HL4A 4LJ7A 3SASA 2KNZA 1NY6A 5FTMA 2C9OA 4JI3M 1NO1A 2Z4SA 4WURA 3RGSA 3SHFA 4GITA 2BNKA 3W67A 3D8BA 2OOBA 4CIZA 3ZCBB 2KDLA 2DWLA 4QOSA 1Z5CA 1NNUC 3U61B 2A5YB 4LRTA 1OIZA 2KXEA 4TUWA 1WIVA 2QCUA 3NBIA 1OFHA 2CV2A 3LQRA 1YLAA 2O01F 2KNAA 3CF0A 4IBEA 3H4JA 1E9SA 1DGHB 4FW9A 1IBMM 2R45A 3GLHB 4L6V6 2FH0A 4L4UA 4RKUF 4LZZA 1K82A 1SXJB 2APLA 4M9SA 1VG5A 2KRUA 3PNYA 2KZUA 1E94E 4YY3M 3AOEC 1FJGM 2I7PA 1IXZA 3GRVA 1Y8GA 2QSFX 5LMUM 2DWMA 2H1RA 3CF2A 4KLNA 1D0KA 4F1IA 2FOIC 2X49A 1DGGA 3W0FA 4LF6M 4GRIA 2F5SA 2UXBM 5BPVA 1E9RA 4DV4M 4PT5A 2RRUA 1HNWM 1PRBA 2Y0QA 1IQPA 4KT0F 4JI0M 3KOXE 3WHLA 1NHGC 5IREB 4IJFA 4GHLA 4LJ4A 3KP0E 4FD2A 3KVWA 4D80A 3B74A 2K47A 4DR6M 2QW6A 1NVMA 1JR3E 2DVWB 4ANRA 1DGBA 1KFVA 1UFZA 3VLFB 1ORYB 2DHRA 2CV1A 3FE3A 5FTJA 4HLQA 3KOZE 5FLXS 1TTEA 3M0EA 3GLIA 2EO2A 1X37A 1KYIA 2VF7A 1G71A 4IBJA 3MHVC 3UMMA 4AQYM 3F92A 1V92A 3GQ3A 4IBIA 3PVSA 1HJPA 3Q8XA 1NV8A 4PD2A 3HWSA 5FTNA 2VIIA 2LHCA 4PDIA 3ZC7B 1K3WA 2HHHM 4LF5M 3CGWA 1V34A 4NRWA 2HCBA 2XZFA 3VFDA 3VKHA 2FS1A 5IZ7D 3W68A 3SARA 4MGKE 1Q3CA 1SG9A 2KNVA 3U60A 2LVOC 3D8LA 2DZNB 3VKGA 2WSFF 2ZTCA 4M9XA 1AIPC 3E9SA 2L7IA 4X66M 1PJIA 1YE9A 2CUZA 2MH8A 3L28A 2QBYA 4DR7M 3FTDA 5BR8M 1OAOC 2JA2A 4AKHA 1OTRA 3AFHA 1GABA 1XXHB 1W5SA 3GPYA 4B08A 1LTMA 2L7HA 1EIJA 1OAIA 2K0BX 2MGWA 2V6ZM 2F5OA 3HX3A 4DR4M 3H4MA 2M60A 2ZTDA 4IBDA 1NSFA 1ZMVA 4G4NA 2YFQA 2BJWA 1DO2A 3DZDA 2R9GA 3FUTA 4NL4H 2FFJA 2LWXA 4REZA 5KPTA 3C58A 3RGPA 4BLCA 3FRIA 4RNAA 2XH9A 5C18A 1NY5A 1L2BA 4FWDA 2DWNA 2G8LA 3FKEA 3SBJA 4K0KM 2DZOB 4AKIA 1TGUA 1ZAEA 1QQWA 1IXSB 3K92A 1XC8A 4GKJM 3LCVB 1QUTA 2JXNA 1MX0A 3TQSA 1Q39A 3RC3A 1TF0B 2E5LM 4FCWA 4I8OA 1H6UA 4R7GA 1OKSA 2CHVA 2LVNC 2Y21A 2B3TA 3I04M 3KSJA 4IJEA 4RF0A 4LFBM 1D0LA 3JR4A 2R0IA 3T15A 4ITQA 3KW6A 2UXDM 3GLIE 3CTDA 1ZMUA 3GLFE 3KDSE 1WHCA 3HJSA 3KS8A 1VEGA 3TWLA 2D7HA 3U6LA 7CATA 3AOGA 4MM3B 1YUBA 3VK8A 4G3OA 1MJGM 3HHXA 1SXJD 1UM8A 2BWBA 1QZEA 2CRUA 3SATA 2D7EA 5ITYA 3FTFA 3HHZA 1OIPA 4R3DA 2QP9X 5EP4A 3TPZA 3A42A 2CE7A 4IBGA 5ITQA 3CF6E 3HHYA 5EXXA 2JNHA 2L2DA 4PCZA 2KHHA 1PJQA 1IY0A 1JQJC 1RU3A 2P5TA 3LVWA 2I7NA 3HJ8A 1JB0F 4LY6A 3L2AA 5IWAM 3THGA 1XMOM 1R2YA 4OX9M 4X65M 1E32A 3U5ZB 2CWBA 4XGIA 3NBXX 3MK6A 5ITTA 2DAMA 3KS4A 3SMPA 2XGNA 4AW4A 3IECA 2DAGA 2CP8A 2L4EA 3QYEA 4Q7JA 3KOWE 4MGZE 4X64M 3KSXA 2OPFA 2DENA 2QZ4A 2OO9A 3FYCA 1R7RA 3FYDA 2DXIA 3V76A 1N78A 2AHMA 1HQCA 2D7GA 3DFZA 5DYIA 4B7FA 3GLHE 3M6AA 2Y0TA 3LQQA 1D2NA 4L15A 1KSFX 5DYGA 3ILKA 4NOOB 3K9OA 5ITUA 2JZ0A 3HU3A 4Y28F 2FNAA 2CV0A 1HNZM 4B3RM 4FCTA 4LGMA 2VF8A 3AV0A 3U6PA 2EKKA 3PNVA 4DBGB 8CATA 4YHHM 2LH0A 1DV0A 3FUVA 2FE8A 2GQFA 2G3QA 2HL7A 3DA1A 3GPUA 1HNXM 4AI6A 4M9ZA 3TWKA 3T38A 1IY1A 3J7BA 1VEKA 4FWGA 3GP1A 3JR5A 4DV2M 1MW5A 2DAKA 3U6EA 2C99A 4NSRA 5EXTA 3OTOM 1VQ1A 4JI8M 1PJSA 2H5XA 3QAUA 4XK8F 3J81S 1TDZA 4DR3M 1N34M 3I4VA 4DV1M 4LF4M 1WGLA 1PM5A 3LCUA 4LJ8A 2JWSA 1QDTA 1AUAA 1QZMA 2ZAMA 1GVNA 5GKNA 3RE8A 1OFIA 4LCBA 4S12A 1D0MA 4G4OA 3U5ZA 4GHAA 1R6BX 5EP2A 3E21A 3SC3A 5FTLA 1G4AE 4CGYB 2UUBM 5EXSA 5FTKA 4LG2A 5H37D 2F4VM 3L26A 1F4IA 4LJAA 1SXJA 2DZLA 2ZM6M 2VQEM 3RC8A 3SYLA 4BB9A 4OVZA 3KP1E 1CUKA 2YNMD 2KA6B 4FVMA 1WJ7A 4B3TM 4UN2B 1QANA 1R4GA 4MGIE 3TL4X 3RFWA 4WW0A 1Z6TA 5EQTA 4LJ6A 2EA0A 2C96A 5KQ8A 2HAKA 2LXEA 2LVPC 1T6OA 4WP2A 3U6DA 1EFUB 4JV5M 1IFYA 2XEPA 3JAMS 1JR3A 1XB2B 3HGIA 2Y20A 3AJIB 1J7KA 4LRSA 3U6QA 4G6ZA 2L09A 5LMNM 3SAWA 1QAMA 1G41A 3GRRA 1HR0M 2MJ5B 3LMMA 2L6OA 2JY6B 2JY5A 1S3SA 3C3DA 5EJCA 2DKLA 5C1BA 1SXJC 4GKKM 3PXGA 4JI7M 4II7A 4MH0E 4DR5M 2DI0A 2QNJA 4G4QA 1OJLA 2C5RA 3FD9A 3GLFB 3A45A 3FTEA 2JP7A 2R44A 3HU2A 3FUXA 1T3TA 4L78A 1Z5AA 2NQ8C 3FRHA 4D82A 5KPRA 3T6PA 2X8AA 3SFZA 2UU9M 2UUCM 4P17A 2X4AA 2DAEA 4LFCM 4NXMM 4JI6M 1BVSA 3B9PA 4Z6YA 3BOSA 4G4RA 2Z3XA 2CHQA 2O25A 2M5ZA 1N36M 5JI3E 1JR3D 4GIPA 1K3XA 4IBCA 4LZJA 2R18A 2HWJA 4W5WA 4HEOA 4CJ6A 1XNRM 2ZAOA 2QENA 1Z5BA 3M7GA
chains in the Genus database with same CATH topology
1ZQ9A 1QAQA 1IM2A 2DWZB 2YQZA 3SYKA 2ERCA 5DNYA 4JI7M 3VDPA 2BJVA 2XF3A 4D81A 4NSOB 1IN7A 1DGHA 3BGEA 4KHPM 1NJFA 3L27A 3K2LA 3E4RA 4ZPXA 3ES5A 1N32M 3EIEA 2QPAA 4L16A 3J80S 1GL7A 4MB7A 4P16A 1Q3BA 2J7NA 3J2PB 2YR0A 4OVZB 1IY2A 4QHTA 4I5SA 3FTCA 2RGHA 4LJ5A 1WXQA 2XSZD 1L2DA 3GLHA 4DR2M 2CEAA 2C98A 4DUZM 4GC5A 4RF1A 1IN6A 3I4YA 4B7GA 1IBKM 1XXHE 5IT9S 1G59A 1I94M 4GMQA 4LFAM 1IN4A 2R65A 1IN5A 3HU1A 2ZBKB 4AZFA 3MJ5A 3VK7A 2G5GX 4IBBA 3R9XB 2RKOA 3U6CA 1QVRA 4CHTB 2R46A 3QWLA 4Z8XA 3R8FA 4B7HA 3GLGB 1L1TA 2EUCA 2V1CA 2Z7JA 2HKJA 5KPZA 2F5NA 4CHDA 3SMSA 3U6SA 4QNMA 2KEBA 4NRVA 3NWLA 2UXCM 2KRKA 4GH9A 1N75A 2XLJA 5A2QS 3IG5A 4NXNM 3GQ4A 3GLGA 5E6JA 4B3MM 4JI4M 3DOAA 3CTWB 2RGOA 4KO8A 3T1YM 1EE8A 4M0DA 3GPXA 3GO8A 1J09A 5F3WA 4LF9M 3UGJA 1HT1E 2VQFM 1GLNA 2Q2EB 4IBFA 3TE6A 2UUAM 3K1JA 4DV5M 2QBYB 5ITRA 4LF8M 3WHKA 3J27B 3UJNA 4MGYE 3IG8A 5JI2E 4EIWA 1IXRC 4OW0A 3TWMA 1N77A 1XMQM 2ZANA 3FUWA 4M0WA 3GRYA 2C9CA 2R62A 4A3VB 3SHGB 3SAUA 4JI1M 3HKPA 1NNJA 1IBLM 4JI5M 1LV7A 3PFIA 4L8RC 4LF7M 4XBOA 2XFSA 1TH2A 1R2ZA 3U60B 4I81A 1C1KA 2F5QA 4DUYM 3EIHA 3U6OA 4JYAM 2O5RA 1I4WA 3HHWA 3GPPA 4QNRA 1G3IA 3KFUG 4JN6A 1N33M 1W5TA 4AG6A 3HJQA 3GQ5A 5KQDA 4I4LA 3UK6A 1TH4A 1XWIA 5ITXA 4IBKA 2XSZA 5E26A 3I51A 1IN8A 4GC9A 2CFOA 4JXJA 3W0LB 2CHGA 1QAOA 3K8ZA 3J7AS 3L29A 3T1HM 3GLGE 1G8PA 4OU7A 2KZSA 4BBAA 3U6MA 3VDUA 1A5TA 1QYRA 5EP3A 2XFTA 3SAVA 2Z4RA 2GNOA 1HQYE 4AG5A 2LNHC 1Z59A 1MU5A 1L2CA 4FWHA 3GLFA 3KXEC 3AL0C 1SXJE 4DV6M 1FNNA 5KO3A 2KW0A 4DR1M 2V1UA 4DV0M 4QHSA 4MGHA 1J5EM 2OQ4A 5ITXE 3A46A 4CISA 1XXHA 2J7OA 1TDHA 3AOEA 1L8QA 4DV7M 2XZUA 3AKZA 3FUUA 1L1ZA 2F5PA 3KOYE 1XHBA 3LVVA 3L25A 1PJJA 1YSYA 4JI2M 1DO0A 4KODA 1DGFA 2R4JA 4LJ9A 3ZH9B 4AKGA 4PDGA 1XNQM 1TH3A 1GKIA 1HT2E 4B3SM 3U61A 4DV3M 1VDDA 4X62M 5EXPA 3A98B 4LGYA 5EP1A 5FSWA 3UZUA 3GRUA 4FCVA 1GL6A 4IIWA 1NHWC 2R4EA 2W82A 4X66M 1NJGA 3SASA 4HL4A 4LJ7A 1NY6A 5FTMA 2C9OA 4JI3M 4WURA 2Z4SA 3RGSA 3SHFA 4GITA 2BNKA 3D8BA 3ZCBB 2DWLA 4QOSA 1Z5CA 1NNUC 3U61B 2A5YB 4LRTA 2KXEA 4TUWA 2QCUA 3NBIA 1OFHA 2CV2A 3LQRA 3CF0A 4IBEA 1E9SA 1DGHB 4FW9A 1IBMM 2R45A 3GLHB 4L4UA 4LZZA 1K82A 1SXJB 4M9SA 2KRUA 3PNYA 2KZUA 1E94E 4YY3M 3AOEC 1FJGM 2I7PA 1IXZA 3GRVA 5LMUM 2DWMA 2H1RA 3CF2A 4KLNA 2FOIC 2X49A 1DGGA 3W0FA 4LF6M 4GRIA 2F5SA 2UXBM 5BPVA 1E9RA 4DV4M 4PT5A 1HNWM 2Y0QA 1IQPA 4JI0M 3KOXE 3WHLA 1NHGC 5IREB 4IJFA 4GHLA 4LJ4A 3KP0E 4FD2A 3KVWA 4D80A 4DR6M 2K47A 2QW6A 1NVMA 2DVWB 1JR3E 1DGBA 1KFVA 3VLFB 1ORYB 2DHRA 2CV1A 5FTJA 4HLQA 3KOZE 5FLXS 3M0EA 3GLIA 2EO2A 1X37A 1KYIA 4IBJA 3MHVC 3UMMA 4AQYM 3GQ3A 4IBIA 3PVSA 3Q8XA 4PD2A 3HWSA 5FTNA 2VIIA 4PDIA 3ZC7B 1K3WA 2HHHM 4LF5M 4NRWA 2HCBA 2XZFA 3VFDA 3VKHA 5IZ7D 3SARA 4MGKE 1Q3CA 3U60A 3D8LA 2DZNB 3VKGA 4M9XA 3E9SA 2L7IA 1PJIA 1YE9A 2CUZA 3L28A 2QBYA 4DR7M 3FTDA 5BR8M 4AKHA 2JA2A 3AFHA 1XXHB 1W5SA 3GPYA 4B08A 2L7HA 2V6ZM 2F5OA 4DR4M 3H4MA 2M60A 4IBDA 1NSFA 4G4NA 2YFQA 2BJWA 1DO2A 3DZDA 2R9GA 3FUTA 4NL4H 2FFJA 2LWXA 4REZA 5KPTA 3C58A 3RGPA 4BLCA 4RNAA 2XH9A 5C18A 1NY5A 1L2BA 4FWDA 2DWNA 2G8LA 3FKEA 3SBJA 4K0KM 2DZOB 4AKIA 1TGUA 1ZAEA 1QQWA 1IXSB 3K92A 1XC8A 4GKJM 1MX0A 3TQSA 1Q39A 3RC3A 2E5LM 4FCWA 4I8OA 1H6UA 4R7GA 2CHVA 2Y21A 3KSJA 4IJEA 4RF0A 4LFBM 3JR4A 3T15A 4ITQA 3KW6A 2UXDM 3GLIE 3CTDA 3GLFE 3KDSE 3HJSA 3KS8A 3TWLA 2D7HA 3U6LA 7CATA 3AOGA 4MM3B 1YUBA 3VK8A 3HHXA 1SXJD 1UM8A 3SATA 2D7EA 5ITYA 3FTFA 3HHZA 4R3DA 2QP9X 5EP4A 3TPZA 3A42A 2CE7A 4IBGA 5ITQA 3CF6E 3HHYA 5EXXA 4PCZA 2P5TA 4QOZC 1IY0A 1JQJC 3LVWA 4LY6A 3GLIB 2I7NA 3HJ8A 4OX9M 4AI6A 3L2AA 5IWAM 3THGA 1XMOM 1R2YA 4X65M 1E32A 3U5ZB 4XGIA 5ITTA 3MK6A 3SMPA 3KS4A 2XGNA 4AW4A 3KOWE 4MGZE 4X64M 3KSXA 2OPFA 2QZ4A 3FYCA 3FYDA 1R7RA 2DXIA 1N78A 2AHMA 1HQCA 2D7GA 3DFZA 5DYIA 4B7FA 3GLHE 3M6AA 2Y0TA 3LQQA 1D2NA 4L15A 1KSFX 5DYGA 3ILKA 4NOOB 5ITUA 3HU3A 2FNAA 2CV0A 1HNZM 4B3RM 4FCTA 4LGMA 3AV0A 3U6PA 3PNVA 8CATA 4YHHM 2LH0A 3FUVA 2FE8A 2HL7A 3DA1A 3GPUA 1HNXM 4M9ZA 3TWKA 3T38A 1IY1A 3J7BA 3GP1A 4FWGA 3JR5A 4DV2M 1MW5A 3U6EA 2C99A 4NSRA 5EXTA 3OTOM 4JI8M 3J81S 3QAUA 1TDZA 4DR3M 1N34M 3I4VA 4DV1M 4LF4M 1PM5A 4LJ8A 5GKNA 2ZAMA 3RE8A 1QZMA 1GVNA 1OFIA 4LCBA 4S12A 4G4OA 3U5ZA 4GHAA 1R6BX 5EP2A 3SC3A 5FTLA 2UUBM 1G4AE 4CGYB 5EXSA 5FTKA 4LG2A 5H37D 2F4VM 3L26A 4LJAA 1SXJA 2ZM6M 2VQEM 3RC8A 3SYLA 4BB9A 4OVZA 3KP1E 2YNMD 2KA6B 4FVMA 4B3TM 1QANA 4MGIE 3TL4X 3RFWA 4WW0A 1Z6TA 5EQTA 4LJ6A 2EA0A 2C96A 5KQ8A 2LXEA 3U6DA 4JV5M 2XEPA 3JAMS 1JR3A 3HGIA 2Y20A 3AJIB 1J7KA 4LRSA 3U6QA 4G6ZA 2L09A 5LMNM 3SAWA 1QAMA 1G41A 3GRRA 1HR0M 3LMMA 2L6OA 1S3SA 5EJCA 5C1BA 1SXJC 4GKKM 3PXGA 4II7A 4MH0E 4DR5M 4G4QA 1OJLA 2C5RA 3FD9A 3GLFB 3A45A 3FTEA 3HU2A 3FUXA 1T3TA 4L78A 1Z5AA 2NQ8C 4D82A 5KPRA 2X8AA 3SFZA 2UU9M 2UUCM 4LFCM 2X4AA 4NXMM 4JI6M 3B9PA 4Z6YA 3BOSA 4G4RA 2Z3XA 2CHQA 1N36M 2M5ZA 1K3XA 5JI3E 1JR3D 4GIPA 4IBCA 4LZJA 2R18A 4W5WA 1XNRM 2ZAOA 2QENA 1Z5BA 3M7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 A;  3U60 A;  3U5Z A; 
#chains in the Genus database with same CATH topology
 1ZQ9 A;  1QAQ A;  1IM2 A;  2DWZ B;  2K6B A;  2YQZ A;  2ERC A;  2LVA A;  3SYK A;  3VDP A;  2BJV A;  2XF3 A;  5L8R F;  5DNY A;  4D81 A;  2Z8Y M;  2L4F A;  5DFL A;  4NSO B;  1IN7 A;  1DGH A;  2N35 A;  3BGE A;  4KHP M;  1NJF A;  3L27 A;  3K2L A;  1C7Y A;  3E4R A;  4ZPX A;  3ES5 A;  1N32 M;  3EIE A;  2QPA A;  4L16 A;  3J80 S;  1GL7 A;  4MB7 A;  4P16 A;  1Q3B A;  1ZV1 A;  2J7N A;  3J2P B;  2YR0 A;  4OVZ B;  1IY2 A;  4QHT A;  4I5S A;  2DAI A;  2QQ8 A;  3FTC A;  4NC6 A;  2RGH A;  2WSC F;  1WXQ A;  2XSZ D;  4LJ5 A;  1L2D A;  3GLH A;  4DR2 M;  2LVQ D;  2C98 A;  2CEA A;  4GC5 A;  4RF1 A;  1IN6 A;  3I4Y A;  4B7G A;  4DUZ M;  1IBK M;  1XXH E;  5IT9 S;  1G59 A;  1I94 M;  4GMQ A;  4LFA M;  1IN4 A;  1MN3 A;  2K9D A;  2R65 A;  1IN5 A;  3HU1 A;  2ZBK B;  4AZF A;  1V33 A;  3MJ5 A;  2EJS A;  3HZJ A;  3VK7 A;  2G5G X;  4IBB A;  3R9X B;  2RKO A;  1PGY A;  3U6C A;  1QVR A;  4CHT B;  2R46 A;  3QWL A;  4Z8X A;  3R8F A;  4B7H A;  3GLG B;  1L1T A;  1P3Q Q;  2EUC A;  2V1C A;  2Z7J A;  2HKJ A;  1R5L A;  2EKF A;  3B7N A;  5KPZ A;  2F5N A;  4CHD A;  3SMS A;  3U6S A;  4QNM A;  2KEB A;  4NRV A;  3NWL A;  2UXC M;  2KRK A;  4GH9 A;  1N75 A;  2XLJ A;  5A2Q S;  3IG5 A;  4NXN M;  3GQ4 A;  3GLG A;  5E6J A;  4B3M M;  4JI4 M;  3DOA A;  3CTW B;  2RGO A;  4KO8 A;  3T1Y M;  1EE8 A;  4M0D A;  3GPX A;  3GO8 A;  1J09 A;  5F3W A;  4LF9 M;  3UGJ A;  1HT1 E;  2VQF M;  1GLN A;  2Q2E B;  4IBF A;  4GEW A;  3TE6 A;  2UUA M;  3K1J A;  4DV5 M;  2QBY B;  5ITR A;  3LW5 F;  4LF8 M;  3WHK A;  3C3E A;  3J27 B;  3UJN A;  2MR9 A;  4MGY E;  2WSE F;  3IG8 A;  5JI2 E;  3Q8G A;  4EIW A;  1IXR C;  3BBZ A;  4OW0 A;  3TWM A;  2J5Y A;  1N77 A;  1XMQ M;  2ZAN A;  3FUW A;  4M0W A;  3GRY A;  3QYB A;  2C9C A;  2R62 A;  4A3V B;  1QUS A;  3SHG B;  2DHY A;  2QHO B;  3E46 A;  3SAU A;  4JI1 M;  3HKP A;  1NNJ A;  1IBL M;  4JI5 M;  1LV7 A;  3PFI A;  4L8R C;  4LF7 M;  3GLI B;  4XBO A;  2XFS A;  1TH2 A;  1R2Z A;  3U60 B;  3MMP A;  4I81 A;  1C1K A;  2F5Q A;  3B7Q A;  4DUY M;  3EIH A;  3U6O A;  3BXW A;  4JYA M;  2JY8 A;  4F2L A;  2O5R A;  1I4W A;  4QOZ C;  3HHW A;  3K9P A;  3GPP A;  2LTU A;  4QNR A;  1G3I A;  3KFU G;  4JN6 A;  1N33 M;  1W5T A;  1PJT A;  4AG6 A;  2OOA A;  3HJQ A;  3GQ5 A;  5KQD A;  4I4L A;  1WGN A;  1WR1 B;  3UK6 A;  1TH4 A;  1XWI A;  5ITX A;  4IBK A;  2XSZ A;  5E26 A;  2LHG A;  3I51 A;  1IN8 A;  4GC9 A;  2CFO A;  1NV9 A;  4R71 A;  4JXJ A;  3W0L B;  2CHG A;  1QAO A;  3K8Z A;  3J7A S;  3L29 A;  3GLG E;  3T1H M;  1G8P A;  4OU7 A;  2KZS A;  1VDL A;  4BBA A;  1IXS A;  2R6F A;  3U6M A;  3VDU A;  1A5T A;  1QYR A;  3HY5 A;  5EP3 A;  2XFT A;  3SAV A;  2Z4R A;  2GNO A;  1HQY E;  4AG5 A;  2LNH C;  1Z59 A;  1MU5 A;  2LBC A;  1L2C A;  4FWH A;  3GLF A;  3KXE C;  2BWE A;  3ZQJ A;  1SXJ E;  4DV6 M;  3AL0 C;  1FNN A;  5KO3 A;  1GJS A;  2JZ1 A;  2JY7 A;  2KW0 A;  4DR1 M;  1TR8 A;  2V1U A;  4DV0 M;  4QHS A;  4MGH A;  1GJT A;  1J5E M;  2OQ4 A;  5ITX E;  3A46 A;  4CIS A;  1XXH A;  2J7O A;  3I01 M;  3B7Z A;  1T43 A;  1TDH A;  3AOE A;  1L8Q A;  4DV7 M;  2XZU A;  1Q02 A;  3AKZ A;  1ZMW A;  3FUU A;  1L1Z A;  2F5P A;  3KOY E;  1XHB A;  3LVV A;  1GO5 A;  3L25 A;  1PJJ A;  1YSY A;  4JI2 M;  1DO0 A;  2JUJ A;  4KOD A;  2MRO B;  1DGF A;  2R4J A;  4LJ9 A;  3ZH9 B;  2WZJ A;  4PDG A;  1XNQ M;  4AKG A;  1TH3 A;  3IHP A;  1GKI A;  1HT2 E;  4B3S M;  1VEJ A;  3U61 A;  4DV3 M;  1VDD A;  4X62 M;  5EXP A;  3B89 A;  1OQY A;  3A98 B;  4LGY A;  5EP1 A;  5FSW A;  2VDB B;  1QDR A;  3UZU A;  3GRU A;  4FCV A;  1GL6 A;  4IIW A;  1NHW C;  2R4E A;  2W82 A;  2DNA A;  1NJG A;  3C9P A;  4HL4 A;  4LJ7 A;  3SAS A;  2KNZ A;  1NY6 A;  5FTM A;  2C9O A;  4JI3 M;  1NO1 A;  2Z4S A;  4WUR A;  3RGS A;  3SHF A;  4GIT A;  2BNK A;  3W67 A;  3D8B A;  2OOB A;  4CIZ A;  3ZCB B;  2KDL A;  2DWL A;  4QOS A;  1Z5C A;  1NNU C;  3U61 B;  2A5Y B;  4LRT A;  1OIZ A;  2KXE A;  4TUW A;  1WIV A;  2QCU A;  3NBI A;  1OFH A;  2CV2 A;  3LQR A;  1YLA A;  2O01 F;  2KNA A;  3CF0 A;  4IBE A;  3H4J A;  1E9S A;  1DGH B;  4FW9 A;  1IBM M;  2R45 A;  3GLH B;  4L6V 6;  2FH0 A;  4L4U A;  4RKU F;  4LZZ A;  1K82 A;  1SXJ B;  2APL A;  4M9S A;  1VG5 A;  2KRU A;  3PNY A;  2KZU A;  1E94 E;  4YY3 M;  3AOE C;  1FJG M;  2I7P A;  1IXZ A;  3GRV A;  1Y8G A;  2QSF X;  5LMU M;  2DWM A;  2H1R A;  3CF2 A;  4KLN A;  1D0K A;  4F1I A;  2FOI C;  2X49 A;  1DGG A;  3W0F A;  4LF6 M;  4GRI A;  2F5S A;  2UXB M;  5BPV A;  1E9R A;  4DV4 M;  4PT5 A;  2RRU A;  1HNW M;  1PRB A;  2Y0Q A;  1IQP A;  4KT0 F;  4JI0 M;  3KOX E;  3WHL A;  1NHG C;  5IRE B;  4IJF A;  4GHL A;  4LJ4 A;  3KP0 E;  4FD2 A;  3KVW A;  4D80 A;  3B74 A;  2K47 A;  4DR6 M;  2QW6 A;  1NVM A;  1JR3 E;  2DVW B;  4ANR A;  1DGB A;  1KFV A;  1UFZ A;  3VLF B;  1ORY B;  2DHR A;  2CV1 A;  3FE3 A;  5FTJ A;  4HLQ A;  3KOZ E;  5FLX S;  1TTE A;  3M0E A;  3GLI A;  2EO2 A;  1X37 A;  1KYI A;  2VF7 A;  1G71 A;  4IBJ A;  3MHV C;  3UMM A;  4AQY M;  3F92 A;  1V92 A;  3GQ3 A;  4IBI A;  3PVS A;  1HJP A;  3Q8X A;  1NV8 A;  4PD2 A;  3HWS A;  5FTN A;  2VII A;  2LHC A;  4PDI A;  3ZC7 B;  1K3W A;  2HHH M;  4LF5 M;  3CGW A;  1V34 A;  4NRW A;  2HCB A;  2XZF A;  3VFD A;  3VKH A;  2FS1 A;  5IZ7 D;  3W68 A;  3SAR A;  4MGK E;  1Q3C A;  1SG9 A;  2KNV A;  3U60 A;  2LVO C;  3D8L A;  2DZN B;  3VKG A;  2WSF F;  2ZTC A;  4M9X A;  1AIP C;  3E9S A;  2L7I A;  4X66 M;  1PJI A;  1YE9 A;  2CUZ A;  2MH8 A;  3L28 A;  2QBY A;  4DR7 M;  3FTD A;  5BR8 M;  1OAO C;  2JA2 A;  4AKH A;  1OTR A;  3AFH A;  1GAB A;  1XXH B;  1W5S A;  3GPY A;  4B08 A;  1LTM A;  2L7H A;  1EIJ A;  1OAI A;  2K0B X;  2MGW A;  2V6Z M;  2F5O A;  3HX3 A;  4DR4 M;  3H4M A;  2M60 A;  2ZTD A;  4IBD A;  1NSF A;  1ZMV A;  4G4N A;  2YFQ A;  2BJW A;  1DO2 A;  3DZD A;  2R9G A;  3FUT A;  4NL4 H;  2FFJ A;  2LWX A;  4REZ A;  5KPT A;  3C58 A;  3RGP A;  4BLC A;  3FRI A;  4RNA A;  2XH9 A;  5C18 A;  1NY5 A;  1L2B A;  4FWD A;  2DWN A;  2G8L A;  3FKE A;  3SBJ A;  4K0K M;  2DZO B;  4AKI A;  1TGU A;  1ZAE A;  1QQW A;  1IXS B;  3K92 A;  1XC8 A;  4GKJ M;  3LCV B;  1QUT A;  2JXN A;  1MX0 A;  3TQS A;  1Q39 A;  3RC3 A;  1TF0 B;  2E5L M;  4FCW A;  4I8O A;  1H6U A;  4R7G A;  1OKS A;  2CHV A;  2LVN C;  2Y21 A;  2B3T A;  3I04 M;  3KSJ A;  4IJE A;  4RF0 A;  4LFB M;  1D0L A;  3JR4 A;  2R0I A;  3T15 A;  4ITQ A;  3KW6 A;  2UXD M;  3GLI E;  3CTD A;  1ZMU A;  3GLF E;  3KDS E;  1WHC A;  3HJS A;  3KS8 A;  1VEG A;  3TWL A;  2D7H A;  3U6L A;  7CAT A;  3AOG A;  4MM3 B;  1YUB A;  3VK8 A;  4G3O A;  1MJG M;  3HHX A;  1SXJ D;  1UM8 A;  2BWB A;  1QZE A;  2CRU A;  3SAT A;  2D7E A;  5ITY A;  3FTF A;  3HHZ A;  1OIP A;  4R3D A;  2QP9 X;  5EP4 A;  3TPZ A;  3A42 A;  2CE7 A;  4IBG A;  5ITQ A;  3CF6 E;  3HHY A;  5EXX A;  2JNH A;  2L2D A;  4PCZ A;  2KHH A;  1PJQ A;  1IY0 A;  1JQJ C;  1RU3 A;  2P5T A;  3LVW A;  2I7N A;  3HJ8 A;  1JB0 F;  4LY6 A;  3L2A A;  5IWA M;  3THG A;  1XMO M;  1R2Y A;  4OX9 M;  4X65 M;  1E32 A;  3U5Z B;  2CWB A;  4XGI A;  3NBX X;  3MK6 A;  5ITT A;  2DAM A;  3KS4 A;  3SMP A;  2XGN A;  4AW4 A;  3IEC A;  2DAG A;  2CP8 A;  2L4E A;  3QYE A;  4Q7J A;  3KOW E;  4MGZ E;  4X64 M;  3KSX A;  2OPF A;  2DEN A;  2QZ4 A;  2OO9 A;  3FYC A;  1R7R A;  3FYD A;  2DXI A;  3V76 A;  1N78 A;  2AHM A;  1HQC A;  2D7G A;  3DFZ A;  5DYI A;  4B7F A;  3GLH E;  3M6A A;  2Y0T A;  3LQQ A;  1D2N A;  4L15 A;  1KSF X;  5DYG A;  3ILK A;  4NOO B;  3K9O A;  5ITU A;  2JZ0 A;  3HU3 A;  4Y28 F;  2FNA A;  2CV0 A;  1HNZ M;  4B3R M;  4FCT A;  4LGM A;  2VF8 A;  3AV0 A;  3U6P A;  2EKK A;  3PNV A;  4DBG B;  8CAT A;  4YHH M;  2LH0 A;  1DV0 A;  3FUV A;  2FE8 A;  2GQF A;  2G3Q A;  2HL7 A;  3DA1 A;  3GPU A;  1HNX M;  4AI6 A;  4M9Z A;  3TWK A;  3T38 A;  1IY1 A;  3J7B A;  1VEK A;  4FWG A;  3GP1 A;  3JR5 A;  4DV2 M;  1MW5 A;  2DAK A;  3U6E A;  2C99 A;  4NSR A;  5EXT A;  3OTO M;  1VQ1 A;  4JI8 M;  1PJS A;  2H5X A;  3QAU A;  4XK8 F;  3J81 S;  1TDZ A;  4DR3 M;  1N34 M;  3I4V A;  4DV1 M;  4LF4 M;  1WGL A;  1PM5 A;  3LCU A;  4LJ8 A;  2JWS A;  1QDT A;  1AUA A;  1QZM A;  2ZAM A;  1GVN A;  5GKN A;  3RE8 A;  1OFI A;  4LCB A;  4S12 A;  1D0M A;  4G4O A;  3U5Z A;  4GHA A;  1R6B X;  5EP2 A;  3E21 A;  3SC3 A;  5FTL A;  1G4A E;  4CGY B;  2UUB M;  5EXS A;  5FTK A;  4LG2 A;  5H37 D;  2F4V M;  3L26 A;  1F4I A;  4LJA A;  1SXJ A;  2DZL A;  2ZM6 M;  2VQE M;  3RC8 A;  3SYL A;  4BB9 A;  4OVZ A;  3KP1 E;  1CUK A;  2YNM D;  2KA6 B;  4FVM A;  1WJ7 A;  4B3T M;  4UN2 B;  1QAN A;  1R4G A;  4MGI E;  3TL4 X;  3RFW A;  4WW0 A;  1Z6T A;  5EQT A;  4LJ6 A;  2EA0 A;  2C96 A;  5KQ8 A;  2HAK A;  2LXE A;  2LVP C;  1T6O A;  4WP2 A;  3U6D A;  1EFU B;  4JV5 M;  1IFY A;  2XEP A;  3JAM S;  1JR3 A;  1XB2 B;  3HGI A;  2Y20 A;  3AJI B;  1J7K A;  4LRS A;  3U6Q A;  4G6Z A;  2L09 A;  5LMN M;  3SAW A;  1QAM A;  1G41 A;  3GRR A;  1HR0 M;  2MJ5 B;  3LMM A;  2L6O A;  2JY6 B;  2JY5 A;  1S3S A;  3C3D A;  5EJC A;  2DKL A;  5C1B A;  1SXJ C;  4GKK M;  3PXG A;  4JI7 M;  4II7 A;  4MH0 E;  4DR5 M;  2DI0 A;  2QNJ A;  4G4Q A;  1OJL A;  2C5R A;  3FD9 A;  3GLF B;  3A45 A;  3FTE A;  2JP7 A;  2R44 A;  3HU2 A;  3FUX A;  1T3T A;  4L78 A;  1Z5A A;  2NQ8 C;  3FRH A;  4D82 A;  5KPR A;  3T6P A;  2X8A A;  3SFZ A;  2UU9 M;  2UUC M;  4P17 A;  2X4A A;  2DAE A;  4LFC M;  4NXM M;  4JI6 M;  1BVS A;  3B9P A;  4Z6Y A;  3BOS A;  4G4R A;  2Z3X A;  2CHQ A;  2O25 A;  2M5Z A;  1N36 M;  5JI3 E;  1JR3 D;  4GIP A;  1K3X A;  4IBC A;  4LZJ A;  2R18 A;  2HWJ A;  4W5W A;  4HEO A;  4CJ6 A;  1XNR M;  2ZAO A;  2QEN A;  1Z5B A;  3M7G A; 
#chains in the Genus database with same CATH homology
 1ZQ9 A;  1QAQ A;  1IM2 A;  2DWZ B;  2YQZ A;  3SYK A;  2ERC A;  5DNY A;  4JI7 M;  3VDP A;  2BJV A;  2XF3 A;  4D81 A;  4NSO B;  1IN7 A;  1DGH A;  3BGE A;  4KHP M;  1NJF A;  3L27 A;  3K2L A;  3E4R A;  4ZPX A;  3ES5 A;  1N32 M;  3EIE A;  2QPA A;  4L16 A;  3J80 S;  1GL7 A;  4MB7 A;  4P16 A;  1Q3B A;  2J7N A;  3J2P B;  2YR0 A;  4OVZ B;  1IY2 A;  4QHT A;  4I5S A;  3FTC A;  2RGH A;  4LJ5 A;  1WXQ A;  2XSZ D;  1L2D A;  3GLH A;  4DR2 M;  2CEA A;  2C98 A;  4DUZ M;  4GC5 A;  4RF1 A;  1IN6 A;  3I4Y A;  4B7G A;  1IBK M;  1XXH E;  5IT9 S;  1G59 A;  1I94 M;  4GMQ A;  4LFA M;  1IN4 A;  2R65 A;  1IN5 A;  3HU1 A;  2ZBK B;  4AZF A;  3MJ5 A;  3VK7 A;  2G5G X;  4IBB A;  3R9X B;  2RKO A;  3U6C A;  1QVR A;  4CHT B;  2R46 A;  3QWL A;  4Z8X A;  3R8F A;  4B7H A;  3GLG B;  1L1T A;  2EUC A;  2V1C A;  2Z7J A;  2HKJ A;  5KPZ A;  2F5N A;  4CHD A;  3SMS A;  3U6S A;  4QNM A;  2KEB A;  4NRV A;  3NWL A;  2UXC M;  2KRK A;  4GH9 A;  1N75 A;  2XLJ A;  5A2Q S;  3IG5 A;  4NXN M;  3GQ4 A;  3GLG A;  5E6J A;  4B3M M;  4JI4 M;  3DOA A;  3CTW B;  2RGO A;  4KO8 A;  3T1Y M;  1EE8 A;  4M0D A;  3GPX A;  3GO8 A;  1J09 A;  5F3W A;  4LF9 M;  3UGJ A;  1HT1 E;  2VQF M;  1GLN A;  2Q2E B;  4IBF A;  3TE6 A;  2UUA M;  3K1J A;  4DV5 M;  2QBY B;  5ITR A;  4LF8 M;  3WHK A;  3J27 B;  3UJN A;  4MGY E;  3IG8 A;  5JI2 E;  4EIW A;  1IXR C;  4OW0 A;  3TWM A;  1N77 A;  1XMQ M;  2ZAN A;  3FUW A;  4M0W A;  3GRY A;  2C9C A;  2R62 A;  4A3V B;  3SHG B;  3SAU A;  4JI1 M;  3HKP A;  1NNJ A;  1IBL M;  4JI5 M;  1LV7 A;  3PFI A;  4L8R C;  4LF7 M;  4XBO A;  2XFS A;  1TH2 A;  1R2Z A;  3U60 B;  4I81 A;  1C1K A;  2F5Q A;  4DUY M;  3EIH A;  3U6O A;  4JYA M;  2O5R A;  1I4W A;  3HHW A;  3GPP A;  4QNR A;  1G3I A;  3KFU G;  4JN6 A;  1N33 M;  1W5T A;  4AG6 A;  3HJQ A;  3GQ5 A;  5KQD A;  4I4L A;  3UK6 A;  1TH4 A;  1XWI A;  5ITX A;  4IBK A;  2XSZ A;  5E26 A;  3I51 A;  1IN8 A;  4GC9 A;  2CFO A;  4JXJ A;  3W0L B;  2CHG A;  1QAO A;  3K8Z A;  3J7A S;  3L29 A;  3T1H M;  3GLG E;  1G8P A;  4OU7 A;  2KZS A;  4BBA A;  3U6M A;  3VDU A;  1A5T A;  1QYR A;  5EP3 A;  2XFT A;  3SAV A;  2Z4R A;  2GNO A;  1HQY E;  4AG5 A;  2LNH C;  1Z59 A;  1MU5 A;  1L2C A;  4FWH A;  3GLF A;  3KXE C;  3AL0 C;  1SXJ E;  4DV6 M;  1FNN A;  5KO3 A;  2KW0 A;  4DR1 M;  2V1U A;  4DV0 M;  4QHS A;  4MGH A;  1J5E M;  2OQ4 A;  5ITX E;  3A46 A;  4CIS A;  1XXH A;  2J7O A;  1TDH A;  3AOE A;  1L8Q A;  4DV7 M;  2XZU A;  3AKZ A;  3FUU A;  1L1Z A;  2F5P A;  3KOY E;  1XHB A;  3LVV A;  3L25 A;  1PJJ A;  1YSY A;  4JI2 M;  1DO0 A;  4KOD A;  1DGF A;  2R4J A;  4LJ9 A;  3ZH9 B;  4AKG A;  4PDG A;  1XNQ M;  1TH3 A;  1GKI A;  1HT2 E;  4B3S M;  3U61 A;  4DV3 M;  1VDD A;  4X62 M;  5EXP A;  3A98 B;  4LGY A;  5EP1 A;  5FSW A;  3UZU A;  3GRU A;  4FCV A;  1GL6 A;  4IIW A;  1NHW C;  2R4E A;  2W82 A;  4X66 M;  1NJG A;  3SAS A;  4HL4 A;  4LJ7 A;  1NY6 A;  5FTM A;  2C9O A;  4JI3 M;  4WUR A;  2Z4S A;  3RGS A;  3SHF A;  4GIT A;  2BNK A;  3D8B A;  3ZCB B;  2DWL A;  4QOS A;  1Z5C A;  1NNU C;  3U61 B;  2A5Y B;  4LRT A;  2KXE A;  4TUW A;  2QCU A;  3NBI A;  1OFH A;  2CV2 A;  3LQR A;  3CF0 A;  4IBE A;  1E9S A;  1DGH B;  4FW9 A;  1IBM M;  2R45 A;  3GLH B;  4L4U A;  4LZZ A;  1K82 A;  1SXJ B;  4M9S A;  2KRU A;  3PNY A;  2KZU A;  1E94 E;  4YY3 M;  3AOE C;  1FJG M;  2I7P A;  1IXZ A;  3GRV A;  5LMU M;  2DWM A;  2H1R A;  3CF2 A;  4KLN A;  2FOI C;  2X49 A;  1DGG A;  3W0F A;  4LF6 M;  4GRI A;  2F5S A;  2UXB M;  5BPV A;  1E9R A;  4DV4 M;  4PT5 A;  1HNW M;  2Y0Q A;  1IQP A;  4JI0 M;  3KOX E;  3WHL A;  1NHG C;  5IRE B;  4IJF A;  4GHL A;  4LJ4 A;  3KP0 E;  4FD2 A;  3KVW A;  4D80 A;  4DR6 M;  2K47 A;  2QW6 A;  1NVM A;  2DVW B;  1JR3 E;  1DGB A;  1KFV A;  3VLF B;  1ORY B;  2DHR A;  2CV1 A;  5FTJ A;  4HLQ A;  3KOZ E;  5FLX S;  3M0E A;  3GLI A;  2EO2 A;  1X37 A;  1KYI A;  4IBJ A;  3MHV C;  3UMM A;  4AQY M;  3GQ3 A;  4IBI A;  3PVS A;  3Q8X A;  4PD2 A;  3HWS A;  5FTN A;  2VII A;  4PDI A;  3ZC7 B;  1K3W A;  2HHH M;  4LF5 M;  4NRW A;  2HCB A;  2XZF A;  3VFD A;  3VKH A;  5IZ7 D;  3SAR A;  4MGK E;  1Q3C A;  3U60 A;  3D8L A;  2DZN B;  3VKG A;  4M9X A;  3E9S A;  2L7I A;  1PJI A;  1YE9 A;  2CUZ A;  3L28 A;  2QBY A;  4DR7 M;  3FTD A;  5BR8 M;  4AKH A;  2JA2 A;  3AFH A;  1XXH B;  1W5S A;  3GPY A;  4B08 A;  2L7H A;  2V6Z M;  2F5O A;  4DR4 M;  3H4M A;  2M60 A;  4IBD A;  1NSF A;  4G4N A;  2YFQ A;  2BJW A;  1DO2 A;  3DZD A;  2R9G A;  3FUT A;  4NL4 H;  2FFJ A;  2LWX A;  4REZ A;  5KPT A;  3C58 A;  3RGP A;  4BLC A;  4RNA A;  2XH9 A;  5C18 A;  1NY5 A;  1L2B A;  4FWD A;  2DWN A;  2G8L A;  3FKE A;  3SBJ A;  4K0K M;  2DZO B;  4AKI A;  1TGU A;  1ZAE A;  1QQW A;  1IXS B;  3K92 A;  1XC8 A;  4GKJ M;  1MX0 A;  3TQS A;  1Q39 A;  3RC3 A;  2E5L M;  4FCW A;  4I8O A;  1H6U A;  4R7G A;  2CHV A;  2Y21 A;  3KSJ A;  4IJE A;  4RF0 A;  4LFB M;  3JR4 A;  3T15 A;  4ITQ A;  3KW6 A;  2UXD M;  3GLI E;  3CTD A;  3GLF E;  3KDS E;  3HJS A;  3KS8 A;  3TWL A;  2D7H A;  3U6L A;  7CAT A;  3AOG A;  4MM3 B;  1YUB A;  3VK8 A;  3HHX A;  1SXJ D;  1UM8 A;  3SAT A;  2D7E A;  5ITY A;  3FTF A;  3HHZ A;  4R3D A;  2QP9 X;  5EP4 A;  3TPZ A;  3A42 A;  2CE7 A;  4IBG A;  5ITQ A;  3CF6 E;  3HHY A;  5EXX A;  4PCZ A;  2P5T A;  4QOZ C;  1IY0 A;  1JQJ C;  3LVW A;  4LY6 A;  3GLI B;  2I7N A;  3HJ8 A;  4OX9 M;  4AI6 A;  3L2A A;  5IWA M;  3THG A;  1XMO M;  1R2Y A;  4X65 M;  1E32 A;  3U5Z B;  4XGI A;  5ITT A;  3MK6 A;  3SMP A;  3KS4 A;  2XGN A;  4AW4 A;  3KOW E;  4MGZ E;  4X64 M;  3KSX A;  2OPF A;  2QZ4 A;  3FYC A;  3FYD A;  1R7R A;  2DXI A;  1N78 A;  2AHM A;  1HQC A;  2D7G A;  3DFZ A;  5DYI A;  4B7F A;  3GLH E;  3M6A A;  2Y0T A;  3LQQ A;  1D2N A;  4L15 A;  1KSF X;  5DYG A;  3ILK A;  4NOO B;  5ITU A;  3HU3 A;  2FNA A;  2CV0 A;  1HNZ M;  4B3R M;  4FCT A;  4LGM A;  3AV0 A;  3U6P A;  3PNV A;  8CAT A;  4YHH M;  2LH0 A;  3FUV A;  2FE8 A;  2HL7 A;  3DA1 A;  3GPU A;  1HNX M;  4M9Z A;  3TWK A;  3T38 A;  1IY1 A;  3J7B A;  3GP1 A;  4FWG A;  3JR5 A;  4DV2 M;  1MW5 A;  3U6E A;  2C99 A;  4NSR A;  5EXT A;  3OTO M;  4JI8 M;  3J81 S;  3QAU A;  1TDZ A;  4DR3 M;  1N34 M;  3I4V A;  4DV1 M;  4LF4 M;  1PM5 A;  4LJ8 A;  5GKN A;  2ZAM A;  3RE8 A;  1QZM A;  1GVN A;  1OFI A;  4LCB A;  4S12 A;  4G4O A;  3U5Z A;  4GHA A;  1R6B X;  5EP2 A;  3SC3 A;  5FTL A;  2UUB M;  1G4A E;  4CGY B;  5EXS A;  5FTK A;  4LG2 A;  5H37 D;  2F4V M;  3L26 A;  4LJA A;  1SXJ A;  2ZM6 M;  2VQE M;  3RC8 A;  3SYL A;  4BB9 A;  4OVZ A;  3KP1 E;  2YNM D;  2KA6 B;  4FVM A;  4B3T M;  1QAN A;  4MGI E;  3TL4 X;  3RFW A;  4WW0 A;  1Z6T A;  5EQT A;  4LJ6 A;  2EA0 A;  2C96 A;  5KQ8 A;  2LXE A;  3U6D A;  4JV5 M;  2XEP A;  3JAM S;  1JR3 A;  3HGI A;  2Y20 A;  3AJI B;  1J7K A;  4LRS A;  3U6Q A;  4G6Z A;  2L09 A;  5LMN M;  3SAW A;  1QAM A;  1G41 A;  3GRR A;  1HR0 M;  3LMM A;  2L6O A;  1S3S A;  5EJC A;  5C1B A;  1SXJ C;  4GKK M;  3PXG A;  4II7 A;  4MH0 E;  4DR5 M;  4G4Q A;  1OJL A;  2C5R A;  3FD9 A;  3GLF B;  3A45 A;  3FTE A;  3HU2 A;  3FUX A;  1T3T A;  4L78 A;  1Z5A A;  2NQ8 C;  4D82 A;  5KPR A;  2X8A A;  3SFZ A;  2UU9 M;  2UUC M;  4LFC M;  2X4A A;  4NXM M;  4JI6 M;  3B9P A;  4Z6Y A;  3BOS A;  4G4R A;  2Z3X A;  2CHQ A;  1N36 M;  2M5Z A;  1K3X A;  5JI3 E;  1JR3 D;  4GIP A;  4IBC A;  4LZJ A;  2R18 A;  4W5W A;  1XNR M;  2ZAO A;  2QEN A;  1Z5B A;  3M7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...