3U60A

Structure of t4 bacteriophage clamp loader bound to open clamp, dna and atp analog
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
186
structure length
186
Chain Sequence
b'SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase accessory protein 44
publication title How a DNA polymerase clamp loader opens a sliding clamp.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein/dna
total genus 41
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16790 Phage_clamp_A Bacteriophage clamp loader A subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.700 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3u60A03
1.20.272.50 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3u60A02
3U61A 3U5ZA 3U60A
chains in the Genus database with same CATH superfamily
1J09A 2C9OA 2FS1A 1ZMVA 5JI2E 3UMMA 3SMPA 1JB0F 3U60A 1N36M 2D7GA 2R45A 2VDBB 4DV6M 4Z8XA 1ORYB 3FRIA 4DR2M 3GLGB 2MH8A 1R5LA 3FUWA 1WXQA 3MJ5A 2CRUA 3VDUA 2UUBM 4GHAA 1TTEA 5KPZA 4B08A 2KNVA 3FUUA 1VEJA 5FLXS 3B7ZA 4LRSA 1IXSA 5EXTA 4JYAM 2D7EA 1OAIA 2JWSA 3U60B 4LJ8A 1HJPA 4I8OA 3L29A 4HLQA 3HJSA 2K6BA 5DFLA 2QENA 2LTUA 2ERCA 3HHWA 4MGYE 3J80S 5ITRA 2V1UA 1WR1B 2H5XA 1Y8GA 4LRTA 2C9CA 5EP3A 2BNKA 2EJSA 2OPFA 3IG5A 4RF1A 4DV5M 1XWIA 1IXSB 4KHPM 2HKJA 5EXPA 1HNXM 4JI8M 4IBFA 1IXZA 2VQEM 3SHGB 1L8QA 2LHGA 2R44A 1JR3D 3HZJA 3GRUA 3W68A 4GKJM 1HT1E 1NY5A 3CF6E 4AG5A 1PJIA 1NNJA 4X62M 4R71A 4UN2B 5L8RF 2UXBM 3M6AA 2KDLA 2K0BX 3LQRA 3ZC7B 3TPZA 3SAUA 3FE3A 4FVMA 5EQTA 1R2ZA 2KRKA 3IG8A 1IBKM 1SXJD 4IBKA 4WURA 8CATA 5IZ7D 4DR5M 4LF7M 3U6DA 4CIZA 2JZ1A 3LCVB 2DZLA 1PGYA 5FTMA 4AW4A 5FTJA 2DXIA 1PJQA 1TH3A 2EKKA 2FE8A 3AOGA 4S12A 1GL7A 2GNOA 4B3TM 3DZDA 3LCUA 1XNQM 2CEAA 3MMPA 2V6ZM 5ITXE 3GLIE 1Q3CA 3K92A 4MGIE 5ITQA 4DUZM 4JI6M 4P16A 2QW6A 3GLIA 4FCTA 4FWDA 4OX9M 4LFAM 1DO2A 2OOBA 4NC6A 3HJQA 4DV7M 4FWHA 1QDRA 2HAKA 4DR3M 2QNJA 1R7RA 4LJ7A 1Z59A 4GMQA 3AJIB 2LVAA 2DAGA 3QYEA 2Y0TA 3SAVA 1XNRM 4NSOB 2J5YA 3FUXA 4GIPA 1XXHE 1T6OA 2Y20A 1ZMUA 1ZV1A 2X4AA 4I81A 1MU5A 2R46A 4LJAA 4MB7A 5EJCA 2R4JA 2ZANA 2N35A 3MHVC 2EA0A 4IBEA 2JP7A 1QUTA 3U6EA 2QCUA 2KA6B 2L4FA 3I4VA 1QDTA 2JY5A 2R62A 2LWXA 3SASA 2CV1A 4JXJA 4XBOA 1E32A 2DVWB 4F2LA 3C58A 4AQYM 2R6FA 1IBLM 2JZ0A 2LNHC 4JI4M 4NRVA 3JAMS 3VKGA 4TUWA 2KZUA 1PJSA 2L6OA 4ITQA 1A5TA 3TQSA 3LW5F 5GKNA 3KOXE 4XK8F 4LF8M 2HWJA 2MROB 4G3OA 3FUTA 1ZMWA 3M7GA 4D82A 2YNMD 5LMNM 3HKPA 2R9GA 1G59A 1BVSA 3SARA 5IWAM 2O25A 4A3VB 1T3TA 3HWSA 4NXNM 5KPTA 4IIWA 1NO1A 2UXCM 4DR7M 4IBGA 4Y28F 3JR5A 2QSFX 2L4EA 2JA2A 3PNYA 1XB2B 2DZNB 2LVPC 1DO0A 2H1RA 3LQQA 1QVRA 4DV4M 3VLFB 2DWZB 4LY6A 5F3WA 1I94M 1YUBA 1SG9A 3V76A 2VIIA 1CUKA 2RKOA 1VDDA 2CE7A 1W5SA 4DBGB 4ZPXA 1TDHA 3WHKA 1D0LA 5EP2A 2BWEA 3SATA 1E94E 1E9RA 1QYRA 3HU1A 4QHTA 3UGJA 2KNZA 3M0EA 3T15A 3HY5A 2ZAMA 4FW9A 1G71A 2OO9A 3RGPA 1FNNA 4JI1M 3QWLA 3L28A 2XFSA 5DNYA 3U6MA 3U6OA 1HT2E 2BWBA 1K3WA 4WW0A 3PXGA 1SXJC 3U61A 1NVMA 4EIWA 3GO8A 4IBCA 1LV7A 4OW0A 3C3EA 2XZUA 3GPYA 4P17A 3BGEA 1IBMM 1TH4A 1VEGA 2JUJA 1G41A 2W82A 2MR9A 3H4JA 1IY2A 3HU3A 3IHPA 2FFJA 3GRRA 4WP2A 1G8PA 5ITUA 3U61B 4G4QA 2MGWA 4MGZE 3TWKA 4LF5M 3VKHA 3KXEC 3TWLA 4YHHM 3FUVA 3J7BA 1XMQM 4GH9A 2QPAA 3VK7A 3KOZE 4NOOB 1R2YA 4L6V6 3RC8A 1DGGA 1WGLA 1GKIA 1N78A 1WJ7A 3DA1A 4X65M 1R4GA 5KQDA 1IFYA 1Z6TA 2DAEA 2DAKA 3U6SA 1X37A 1N33M 2F5QA 3J81S 1GABA 3A98B 1JQJC 4HEOA 4RKUF 3GQ4A 2ZM6M 2F4VM 3R9XB 3K1JA 4QNRA 2QHOB 2LXEA 4KLNA 1MJGM 3AL0C 3T6PA 3VDPA 3TWMA 1OTRA 1DGHA 1IY1A 3I4YA 3KOWE 4Q7JA 3GPUA 1QAMA 1J7KA 2M60A 2Z4SA 2J7NA 3UZUA 3FD9A 2K47A 1C1KA 4LJ4A 4FCWA 2LHCA 5IREB 1VDLA 2XEPA 5ITXA 1D0MA 3B9PA 3TE6A 4LFCM 2EO2A 4OVZA 3J7AS 4AKGA 2RRUA 1FJGM 4LJ5A 3L26A 1DGHB 1T43A 2WSCF 4M0DA 3OTOM 4IBJA 2DAIA 1K3XA 3KP1E 1GVNA 4DR1M 2XSZA 2CHGA 2VF7A 3IECA 4JI3M 3QAUA 3L25A 1DGFA 1RU3A 3E4RA 2DKLA 5C1BA 4PDIA 5BR8M 1TDZA 2KXEA 3GLIB 1IN8A 1Z5AA 2R4EA 3HU2A 2UUAM 4OVZB 4DV1M 2C98A 1XXHA 2KEBA 2R18A 5H37D 4LJ6A 2CHQA 2Y21A 1I4WA 3CF0A 4MH0E 4R3DA 5E26A 3RGSA 4JI2M 2P5TA 3VK8A 1DV0A 3J2PB 3U5ZA 3U6CA 2CWBA 2XH9A 3T1YM 1QQWA 4LF4M 1QAQA 4QOSA 1GL6A 3SFZA 2DZOB 1AIPC 5JI3E 4FCVA 4D81A 2DHRA 2ZTDA 2Q2EB 4M9XA 3U6LA 2JXNA 3F92A 1XXHB 4GC5A 2EKFA 2L7HA 3E46A 3ZQJA 3U5ZB 4QNMA 3KOYE 3NWLA 4B3SM 2I7NA 1OFHA 3FTEA 3EIEA 3SC3A 3KS8A 5A2QS 4GHLA 2KHHA 4JV5M 2UXDM 4JI0M 4RNAA 1VG5A 1NSFA 3EIHA 3B7NA 4AKIA 2G5GX 4MGHA 2V1CA 3BOSA 4L15A 1MN3A 4IBBA 1KYIA 3C9PA 3KSJA 4F1IA 2WZJA 3B89A 1EFUB 3E21A 4OU7A 1HNZM 5ITTA 3AOEC 3HX3A 2QP9X 2F5OA 1N32M 3I51A 1PJJA 2UUCM 4LF9M 3UJNA 3SYLA 3FRHA 1VQ1A 2NQ8C 4JI7M 1J5EM 1G4AE 2M5ZA 4B7GA 4QOZC 2Z7JA 2CP8A 5FTNA 4AKHA 1LTMA 1YE9A 3GRVA 3VFDA 3ZH9B 4LFBM 1GJSA 1OQYA 3RC3A 1OFIA 3SBJA 5FSWA 2DNAA 3I01M 4B7FA 1QAOA 1Z5CA 3D8LA 4MM3B 3C3DA 1JR3E 5EP1A 3DOAA 2LVNC 1OAOC 3ZCBB 4DV3M 1JR3A 5FTLA 2HL7A 1XHBA 3NBIA 3KVWA 2QZ4A 4DUYM 3U6PA 4CHDA 2DI0A 4L16A 1IN4A 1Q02A 3HHXA 3BXWA 3Q8XA 4B3RM 1EIJA 3GPXA 1HQYE 4BBAA 4LCBA 1SXJE 3B74A 3SMSA 2F5NA 1XMOM 4YY3M 2OQ4A 4DR4M 1SXJA 2ZAOA 4ANRA 2C96A 3FTFA 3GLGE 4GC9A 1QANA 1NJFA 1L2BA 3GLGA 2F5PA 1K82A 4LF6M 1GJTA 4CHTB 1YLAA 3LVWA 4M9ZA 5DYIA 2C5RA 1KSFX 2QBYA 2DAMA 4G4NA 3Q8GA 2MJ5B 4FD2A 2UU9M 1SXJB 4PCZA 1G3IA 2C99A 2EUCA 2O5RA 3KW6A 4CJ6A 4PD2A 2AHMA 4MGKE 4NL4H 2J7OA 1D0KA 3PVSA 4AG6A 3UK6A 1W5TA 1AUAA 4BB9A 2R0IA 1TH2A 4AI6A 5KPRA 1NHWC 3SYKA 2QBYB 3RE8A 4PDGA 3SHFA 3GRYA 3E9SA 4NXMM 4CISA 3HJ8A 2JNHA 1QZMA 2D7HA 3K8ZA 4QHSA 1OIPA 1NY6A 2CHVA 2DWLA 2WSFF 3PNVA 2BJVA 1Q3BA 4G4RA 4BLCA 1L2CA 3I04M 1QZEA 5EP4A 2WSEF 2JY8A 4GRIA 5LMUM 3L2AA 5KO3A 4HL4A 1N34M 3JR4A 5FTKA 2VQFM 3K2LA 2QQ8A 2FNAA 3W0FA 5ITYA 2KRUA 3D8BA 1Q39A 3LMMA 2G8LA 3MK6A 1C7YA 2HHHM 1GO5A 3KP0E 4LJ9A 1OIZA 7CATA 3CTWB 3KFUG 5IT9S 3R8FA 1WHCA 1UFZA 4GEWA 4IBDA 4DR6M 1N75A 1QUSA 1PRBA 1HR0M 1HQCA 2RGHA 2JY6B 2CV2A 1IM2A 2DHYA 2K9DA 3K9PA 4REZA 2CFOA 1IN7A 1ZAEA 1EE8A 3H4MA 3ILKA 1L1ZA 3GQ5A 2ZTCA 2JY7A 1E9SA 3FKEA 2Y0QA 3W67A 1NJGA 1OJLA 3A42A 3J27B 2FH0A 3A46A 3HGIA 4NRWA 3GP1A 4X64M 2XZFA 1PJTA 5DYGA 3TL4X 1MW5A 2L09A 1R6BX 4FWGA 4GKKM 1S3SA 2L2DA 4G6ZA 4GITA 1HNWM 1ZQ9A 1N77A 3PFIA 2F5SA 3KDSE 3CGWA 5C18A 1V92A 4KO8A 1XC8A 2BJWA 4RF0A 1TF0B 1IXRC 1V34A 3THGA 2LBCA 2XFTA 3RFWA 4KT0F 1NV8A 4XGIA 4CGYB 2CV0A 3AV0A 4L8RC 1H6UA 1L1TA 1D2NA 2I7PA 2XF3A 3T38A 3KS4A 5KQ8A 2XLJA 3K9OA 4D80A 3LVVA 3WHLA 2R65A 3L27A 4IJEA 2LVOC 5E6JA 4PT5A 4W5WA 3B7QA 4II7A 1L2DA 2Z8YM 2B3TA 3QYBA 1PM5A 1DGBA 4LZZA 3FTDA 3DFZA 1WIVA 2YFQA 1YSYA 1IN6A 4NSRA 3CTDA 1KFVA 3GPPA 4JN6A 4L78A 1UM8A 2DENA 4LG2A 2FOIC 2LH0A 3BBZA 4AZFA 3KSXA 4K0KM 2APLA 4LGYA 1V33A 4L4UA 2KZSA 3AOEA 4LGMA 2Z3XA 4R7GA 3AKZA 3GLFE 1TR8A 3CF2A 4IJFA 2XSZD 1IN5A 1IQPA 1NHGC 1VEKA 2A5YB 5BPVA 3GLFA 2CUZA 2GQFA 2XGNA 3GLHE 2OOAA 1OKSA 5EXSA 1NV9A 2X49A 4M9SA 3SAWA 2O01F 4B3MM 4IBIA 3GLHA 2RGOA 2E5LM 3A45A 2L7IA 2KW0A 3FYCA 1WGNA 2VF8A 1NNUC 2X8AA 2YR0A 1Z5BA 4I4LA 2YQZA 3W0LB 4Z6YA 3GQ3A 3FTCA 3GLFB 4KODA 3AFHA 3U6QA 4LZJA 4B7HA 1F4IA 1P3QQ 4DV2M 3ES5A 3T1HM 3GLHB 2HCBA 2G3QA 2KNAA 4I5SA 4G4OA 2Z4RA 1MX0A 4X66M 4M0WA 3HHYA 3HHZA 1GLNA 1IY0A 5EXXA 3NBXX 2DWNA 1TGUA 2DWMA 4JI5M 3FYDA 2LVQD 4DV0M 2ZBKB
chains in the Genus database with same CATH topology
1J09A 2C9OA 5JI2E 3UMMA 3SMPA 3U60A 1N36M 2D7GA 2R45A 4DV6M 4Z8XA 1ORYB 4DR2M 3GLGB 3MJ5A 3FUWA 1WXQA 3VDUA 2UUBM 4GHAA 5KPZA 4B08A 3FUUA 5FLXS 4LRSA 5EXTA 4JYAM 2D7EA 3U60B 4LJ8A 4I8OA 3L29A 4HLQA 3HJSA 2QENA 2ERCA 3HHWA 4MGYE 3J80S 5ITRA 2V1UA 4LRTA 2C9CA 5EP3A 2BNKA 2OPFA 3IG5A 4RF1A 4DV5M 1XWIA 1IXSB 4KHPM 2HKJA 5EXPA 1HNXM 4JI8M 4IBFA 1IXZA 2VQEM 3SHGB 1L8QA 4GKJM 1JR3D 3GRUA 1HT1E 1NY5A 3CF6E 4AG5A 1PJIA 1NNJA 4X62M 2UXBM 3M6AA 3LQRA 3ZC7B 3TPZA 3SAUA 4FVMA 5EQTA 1R2ZA 2KRKA 3IG8A 1IBKM 1SXJD 4IBKA 4WURA 8CATA 5IZ7D 4DR5M 4LF7M 3U6DA 5FTMA 4AW4A 5FTJA 2DXIA 1TH3A 2FE8A 3AOGA 4S12A 1GL7A 4B3TM 2GNOA 3DZDA 1XNQM 2CEAA 5ITXE 2V6ZM 4DUZM 4JI6M 1Q3CA 3K92A 4MGIE 5ITQA 2QW6A 3GLIE 4P16A 3GLIA 4FCTA 4FWDA 4OX9M 4LFAM 1DO2A 3HJQA 4DV7M 4FWHA 4DR3M 1R7RA 4LJ7A 1Z59A 4GMQA 3AJIB 2Y0TA 3SAVA 1XNRM 4NSOB 3FUXA 4GIPA 1XXHE 2Y20A 2X4AA 4I81A 1MU5A 2R46A 4LJAA 4MB7A 5EJCA 2R4JA 2ZANA 3MHVC 2EA0A 4IBEA 3U6EA 2QCUA 2KA6B 3I4VA 3SASA 2R62A 2LWXA 2CV1A 4JXJA 4XBOA 1E32A 2DVWB 3C58A 4AQYM 1IBLM 2LNHC 4JI4M 4NRVA 3JAMS 3VKGA 4TUWA 2KZUA 2L6OA 4ITQA 1A5TA 3TQSA 5GKNA 3KOXE 4LF8M 3FUTA 3M7GA 4D82A 2YNMD 5LMNM 3HKPA 2R9GA 1G59A 3SARA 5IWAM 4A3VB 1T3TA 3HWSA 4NXNM 5KPTA 4IIWA 2UXCM 4DR7M 4IBGA 3JR5A 2JA2A 3PNYA 2DZNB 1DO0A 2H1RA 3LQQA 1QVRA 4DV4M 3VLFB 2DWZB 4LY6A 5F3WA 1I94M 1YUBA 2VIIA 2RKOA 1VDDA 2CE7A 1W5SA 4ZPXA 1TDHA 3WHKA 5EP2A 3SATA 1E94E 1E9RA 1QYRA 3HU1A 4QHTA 3UGJA 3M0EA 3T15A 2ZAMA 4FW9A 3RGPA 1FNNA 4JI1M 3QWLA 3L28A 2XFSA 5DNYA 3U6MA 3U6OA 1HT2E 1K3WA 4WW0A 3PXGA 1SXJC 3U61A 1NVMA 4EIWA 3GO8A 4IBCA 1LV7A 4OW0A 2XZUA 3GPYA 3BGEA 1IBMM 1TH4A 1G41A 2W82A 3HU3A 1IY2A 2FFJA 3GRRA 1G8PA 5ITUA 3U61B 4G4QA 4MGZE 3TWKA 4LF5M 3VKHA 3KXEC 3TWLA 4YHHM 3FUVA 3J7BA 1XMQM 4GH9A 2QPAA 3VK7A 3KOZE 4NOOB 1R2YA 3RC8A 1DGGA 1GKIA 1N78A 3DA1A 4X65M 5KQDA 1Z6TA 3U6SA 1X37A 1N33M 2F5QA 3J81S 3A98B 1JQJC 3GQ4A 2ZM6M 2F4VM 3R9XB 3K1JA 4QNRA 2LXEA 4KLNA 3AL0C 3VDPA 3I4YA 1DGHA 1IY1A 3KOWE 3GPUA 1QAMA 1J7KA 2M60A 2Z4SA 2J7NA 3UZUA 3FD9A 2K47A 1C1KA 4LJ4A 4FCWA 5IREB 2XEPA 5ITXA 4AKGA 3B9PA 3TE6A 4LFCM 2EO2A 4OVZA 3J7AS 1FJGM 4LJ5A 3L26A 1DGHB 4M0DA 3OTOM 4IBJA 1K3XA 3KP1E 1GVNA 4DR1M 2XSZA 2CHGA 4JI3M 3QAUA 3L25A 1DGFA 3E4RA 5BR8M 5C1BA 4PDIA 1TDZA 2KXEA 3GLIB 1IN8A 1Z5AA 2R4EA 3HU2A 2UUAM 4OVZB 4DV1M 2C98A 1XXHA 2KEBA 2R18A 5H37D 4LJ6A 2CHQA 2Y21A 1I4WA 3CF0A 4MH0E 4R3DA 5E26A 3RGSA 4JI2M 2P5TA 3VK8A 3J2PB 3U5ZA 3U6CA 2XH9A 3T1YM 1QQWA 4LF4M 1QAQA 4QOSA 1GL6A 3SFZA 2DZOB 5JI3E 4FCVA 4D81A 2DHRA 2Q2EB 4M9XA 3U6LA 1XXHB 4GC5A 2L7HA 3U5ZB 4QNMA 3KOYE 3NWLA 4B3SM 2I7NA 1OFHA 3FTEA 3EIEA 3SC3A 3KS8A 5A2QS 4GHLA 4JV5M 2UXDM 4JI0M 4RNAA 1NSFA 3EIHA 4AKIA 2G5GX 4MGHA 2V1CA 3BOSA 4L15A 4IBBA 1KYIA 3KSJA 4OU7A 1HNZM 5ITTA 3AOEC 2QP9X 2F5OA 1N32M 3I51A 1PJJA 2UUCM 4LF9M 3UJNA 3SYLA 2NQ8C 4JI7M 1J5EM 1G4AE 2M5ZA 4B7GA 4QOZC 2Z7JA 5FTNA 4AKHA 1YE9A 3GRVA 3VFDA 3ZH9B 4LFBM 3RC3A 1OFIA 3SBJA 5FSWA 4B7FA 1QAOA 1Z5CA 3D8LA 4MM3B 1JR3E 5EP1A 3DOAA 3ZCBB 4DV3M 1JR3A 5FTLA 2HL7A 1XHBA 3NBIA 3KVWA 2QZ4A 4DUYM 3U6PA 4CHDA 4L16A 1IN4A 3HHXA 3Q8XA 4B3RM 3GPXA 1HQYE 4BBAA 4LCBA 1SXJE 2F5NA 3SMSA 1XMOM 4YY3M 2OQ4A 4DR4M 1SXJA 2ZAOA 2C96A 3FTFA 3GLGE 4GC9A 1QANA 1NJFA 1L2BA 3GLGA 2F5PA 1K82A 4LF6M 4CHTB 3LVWA 4M9ZA 5DYIA 2C5RA 1KSFX 2QBYA 4G4NA 4FD2A 2UU9M 1SXJB 4PCZA 1G3IA 2C99A 2EUCA 2O5RA 3KW6A 4PD2A 2AHMA 4MGKE 4NL4H 2J7OA 3PVSA 4AG6A 3UK6A 1W5TA 4BB9A 4AI6A 1TH2A 5KPRA 1NHWC 3SYKA 2QBYB 3RE8A 4PDGA 3SHFA 3GRYA 3E9SA 4NXMM 4CISA 3HJ8A 1QZMA 2D7HA 3K8ZA 4QHSA 1NY6A 2CHVA 2DWLA 3PNVA 2BJVA 1Q3BA 4G4RA 4BLCA 1L2CA 5EP4A 4GRIA 5LMUM 3L2AA 5KO3A 4HL4A 1N34M 3JR4A 5FTKA 2VQFM 3K2LA 2FNAA 3W0FA 5ITYA 2KRUA 3D8BA 1Q39A 3LMMA 2G8LA 3MK6A 2HHHM 3KP0E 4LJ9A 7CATA 3CTWB 3KFUG 5IT9S 3R8FA 4IBDA 4DR6M 1N75A 1HR0M 1HQCA 2RGHA 2CV2A 1IM2A 4REZA 2CFOA 1IN7A 1ZAEA 1EE8A 3H4MA 3ILKA 1L1ZA 3GQ5A 1E9SA 3FKEA 2Y0QA 1NJGA 1OJLA 3A42A 3J27B 3A46A 3HGIA 4NRWA 3GP1A 4X64M 2XZFA 5DYGA 3TL4X 1MW5A 2L09A 1R6BX 4FWGA 4GKKM 1S3SA 4G6ZA 4GITA 1HNWM 1ZQ9A 1N77A 3PFIA 2F5SA 3KDSE 5C18A 4KO8A 1XC8A 2BJWA 4RF0A 1IXRC 3THGA 2XFTA 3RFWA 4CGYB 2CV0A 4XGIA 3AV0A 4L8RC 1H6UA 1L1TA 1D2NA 2I7PA 2XF3A 3T38A 3KS4A 5KQ8A 2XLJA 4D80A 3LVVA 3WHLA 2R65A 3L27A 4IJEA 5E6JA 4PT5A 4W5WA 4II7A 1L2DA 1PM5A 1DGBA 4LZZA 3FTDA 3DFZA 2YFQA 1YSYA 1IN6A 4NSRA 3CTDA 1KFVA 3GPPA 4JN6A 4L78A 1UM8A 4LG2A 2FOIC 2LH0A 4K0KM 4AZFA 3KSXA 4LGYA 4L4UA 2KZSA 3AOEA 4LGMA 2Z3XA 4R7GA 3AKZA 3GLFE 3CF2A 4IJFA 3TWMA 2XSZD 1IN5A 1IQPA 1NHGC 2A5YB 5BPVA 3GLFA 2CUZA 2XGNA 3GLHE 3SAWA 5EXSA 4B3MM 2X49A 4M9SA 4IBIA 3GLHA 2RGOA 2E5LM 3A45A 2L7IA 2KW0A 3FYCA 1NNUC 2X8AA 2YR0A 1Z5BA 4I4LA 2YQZA 3W0LB 4Z6YA 3GQ3A 3FTCA 3GLFB 4KODA 3AFHA 3U6QA 4LZJA 4B7HA 4DV2M 3ES5A 3T1HM 3GLHB 2HCBA 4G4OA 4I5SA 2Z4RA 1MX0A 4X66M 4M0WA 3HHYA 3HHZA 1GLNA 1IY0A 5EXXA 2DWNA 1TGUA 2DWMA 4JI5M 3FYDA 4DV0M 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U61 A;  3U5Z A;  3U60 A; 
#chains in the Genus database with same CATH topology
 1J09 A;  2C9O A;  2FS1 A;  1ZMV A;  5JI2 E;  3UMM A;  3SMP A;  1JB0 F;  3U60 A;  1N36 M;  2D7G A;  2R45 A;  2VDB B;  4DV6 M;  4Z8X A;  1ORY B;  3FRI A;  4DR2 M;  3GLG B;  2MH8 A;  1R5L A;  3FUW A;  1WXQ A;  3MJ5 A;  2CRU A;  3VDU A;  2UUB M;  4GHA A;  1TTE A;  5KPZ A;  4B08 A;  2KNV A;  3FUU A;  1VEJ A;  5FLX S;  3B7Z A;  4LRS A;  1IXS A;  5EXT A;  4JYA M;  2D7E A;  1OAI A;  2JWS A;  3U60 B;  4LJ8 A;  1HJP A;  4I8O A;  3L29 A;  4HLQ A;  3HJS A;  2K6B A;  5DFL A;  2QEN A;  2LTU A;  2ERC A;  3HHW A;  4MGY E;  3J80 S;  5ITR A;  2V1U A;  1WR1 B;  2H5X A;  1Y8G A;  4LRT A;  2C9C A;  5EP3 A;  2BNK A;  2EJS A;  2OPF A;  3IG5 A;  4RF1 A;  4DV5 M;  1XWI A;  1IXS B;  4KHP M;  2HKJ A;  5EXP A;  1HNX M;  4JI8 M;  4IBF A;  1IXZ A;  2VQE M;  3SHG B;  1L8Q A;  2LHG A;  2R44 A;  1JR3 D;  3HZJ A;  3GRU A;  3W68 A;  4GKJ M;  1HT1 E;  1NY5 A;  3CF6 E;  4AG5 A;  1PJI A;  1NNJ A;  4X62 M;  4R71 A;  4UN2 B;  5L8R F;  2UXB M;  3M6A A;  2KDL A;  2K0B X;  3LQR A;  3ZC7 B;  3TPZ A;  3SAU A;  3FE3 A;  4FVM A;  5EQT A;  1R2Z A;  2KRK A;  3IG8 A;  1IBK M;  1SXJ D;  4IBK A;  4WUR A;  8CAT A;  5IZ7 D;  4DR5 M;  4LF7 M;  3U6D A;  4CIZ A;  2JZ1 A;  3LCV B;  2DZL A;  1PGY A;  5FTM A;  4AW4 A;  5FTJ A;  2DXI A;  1PJQ A;  1TH3 A;  2EKK A;  2FE8 A;  3AOG A;  4S12 A;  1GL7 A;  2GNO A;  4B3T M;  3DZD A;  3LCU A;  1XNQ M;  2CEA A;  3MMP A;  2V6Z M;  5ITX E;  3GLI E;  1Q3C A;  3K92 A;  4MGI E;  5ITQ A;  4DUZ M;  4JI6 M;  4P16 A;  2QW6 A;  3GLI A;  4FCT A;  4FWD A;  4OX9 M;  4LFA M;  1DO2 A;  2OOB A;  4NC6 A;  3HJQ A;  4DV7 M;  4FWH A;  1QDR A;  2HAK A;  4DR3 M;  2QNJ A;  1R7R A;  4LJ7 A;  1Z59 A;  4GMQ A;  3AJI B;  2LVA A;  2DAG A;  3QYE A;  2Y0T A;  3SAV A;  1XNR M;  4NSO B;  2J5Y A;  3FUX A;  4GIP A;  1XXH E;  1T6O A;  2Y20 A;  1ZMU A;  1ZV1 A;  2X4A A;  4I81 A;  1MU5 A;  2R46 A;  4LJA A;  4MB7 A;  5EJC A;  2R4J A;  2ZAN A;  2N35 A;  3MHV C;  2EA0 A;  4IBE A;  2JP7 A;  1QUT A;  3U6E A;  2QCU A;  2KA6 B;  2L4F A;  3I4V A;  1QDT A;  2JY5 A;  2R62 A;  2LWX A;  3SAS A;  2CV1 A;  4JXJ A;  4XBO A;  1E32 A;  2DVW B;  4F2L A;  3C58 A;  4AQY M;  2R6F A;  1IBL M;  2JZ0 A;  2LNH C;  4JI4 M;  4NRV A;  3JAM S;  3VKG A;  4TUW A;  2KZU A;  1PJS A;  2L6O A;  4ITQ A;  1A5T A;  3TQS A;  3LW5 F;  5GKN A;  3KOX E;  4XK8 F;  4LF8 M;  2HWJ A;  2MRO B;  4G3O A;  3FUT A;  1ZMW A;  3M7G A;  4D82 A;  2YNM D;  5LMN M;  3HKP A;  2R9G A;  1G59 A;  1BVS A;  3SAR A;  5IWA M;  2O25 A;  4A3V B;  1T3T A;  3HWS A;  4NXN M;  5KPT A;  4IIW A;  1NO1 A;  2UXC M;  4DR7 M;  4IBG A;  4Y28 F;  3JR5 A;  2QSF X;  2L4E A;  2JA2 A;  3PNY A;  1XB2 B;  2DZN B;  2LVP C;  1DO0 A;  2H1R A;  3LQQ A;  1QVR A;  4DV4 M;  3VLF B;  2DWZ B;  4LY6 A;  5F3W A;  1I94 M;  1YUB A;  1SG9 A;  3V76 A;  2VII A;  1CUK A;  2RKO A;  1VDD A;  2CE7 A;  1W5S A;  4DBG B;  4ZPX A;  1TDH A;  3WHK A;  1D0L A;  5EP2 A;  2BWE A;  3SAT A;  1E94 E;  1E9R A;  1QYR A;  3HU1 A;  4QHT A;  3UGJ A;  2KNZ A;  3M0E A;  3T15 A;  3HY5 A;  2ZAM A;  4FW9 A;  1G71 A;  2OO9 A;  3RGP A;  1FNN A;  4JI1 M;  3QWL A;  3L28 A;  2XFS A;  5DNY A;  3U6M A;  3U6O A;  1HT2 E;  2BWB A;  1K3W A;  4WW0 A;  3PXG A;  1SXJ C;  3U61 A;  1NVM A;  4EIW A;  3GO8 A;  4IBC A;  1LV7 A;  4OW0 A;  3C3E A;  2XZU A;  3GPY A;  4P17 A;  3BGE A;  1IBM M;  1TH4 A;  1VEG A;  2JUJ A;  1G41 A;  2W82 A;  2MR9 A;  3H4J A;  1IY2 A;  3HU3 A;  3IHP A;  2FFJ A;  3GRR A;  4WP2 A;  1G8P A;  5ITU A;  3U61 B;  4G4Q A;  2MGW A;  4MGZ E;  3TWK A;  4LF5 M;  3VKH A;  3KXE C;  3TWL A;  4YHH M;  3FUV A;  3J7B A;  1XMQ M;  4GH9 A;  2QPA A;  3VK7 A;  3KOZ E;  4NOO B;  1R2Y A;  4L6V 6;  3RC8 A;  1DGG A;  1WGL A;  1GKI A;  1N78 A;  1WJ7 A;  3DA1 A;  4X65 M;  1R4G A;  5KQD A;  1IFY A;  1Z6T A;  2DAE A;  2DAK A;  3U6S A;  1X37 A;  1N33 M;  2F5Q A;  3J81 S;  1GAB A;  3A98 B;  1JQJ C;  4HEO A;  4RKU F;  3GQ4 A;  2ZM6 M;  2F4V M;  3R9X B;  3K1J A;  4QNR A;  2QHO B;  2LXE A;  4KLN A;  1MJG M;  3AL0 C;  3T6P A;  3VDP A;  3TWM A;  1OTR A;  1DGH A;  1IY1 A;  3I4Y A;  3KOW E;  4Q7J A;  3GPU A;  1QAM A;  1J7K A;  2M60 A;  2Z4S A;  2J7N A;  3UZU A;  3FD9 A;  2K47 A;  1C1K A;  4LJ4 A;  4FCW A;  2LHC A;  5IRE B;  1VDL A;  2XEP A;  5ITX A;  1D0M A;  3B9P A;  3TE6 A;  4LFC M;  2EO2 A;  4OVZ A;  3J7A S;  4AKG A;  2RRU A;  1FJG M;  4LJ5 A;  3L26 A;  1DGH B;  1T43 A;  2WSC F;  4M0D A;  3OTO M;  4IBJ A;  2DAI A;  1K3X A;  3KP1 E;  1GVN A;  4DR1 M;  2XSZ A;  2CHG A;  2VF7 A;  3IEC A;  4JI3 M;  3QAU A;  3L25 A;  1DGF A;  1RU3 A;  3E4R A;  2DKL A;  5C1B A;  4PDI A;  5BR8 M;  1TDZ A;  2KXE A;  3GLI B;  1IN8 A;  1Z5A A;  2R4E A;  3HU2 A;  2UUA M;  4OVZ B;  4DV1 M;  2C98 A;  1XXH A;  2KEB A;  2R18 A;  5H37 D;  4LJ6 A;  2CHQ A;  2Y21 A;  1I4W A;  3CF0 A;  4MH0 E;  4R3D A;  5E26 A;  3RGS A;  4JI2 M;  2P5T A;  3VK8 A;  1DV0 A;  3J2P B;  3U5Z A;  3U6C A;  2CWB A;  2XH9 A;  3T1Y M;  1QQW A;  4LF4 M;  1QAQ A;  4QOS A;  1GL6 A;  3SFZ A;  2DZO B;  1AIP C;  5JI3 E;  4FCV A;  4D81 A;  2DHR A;  2ZTD A;  2Q2E B;  4M9X A;  3U6L A;  2JXN A;  3F92 A;  1XXH B;  4GC5 A;  2EKF A;  2L7H A;  3E46 A;  3ZQJ A;  3U5Z B;  4QNM A;  3KOY E;  3NWL A;  4B3S M;  2I7N A;  1OFH A;  3FTE A;  3EIE A;  3SC3 A;  3KS8 A;  5A2Q S;  4GHL A;  2KHH A;  4JV5 M;  2UXD M;  4JI0 M;  4RNA A;  1VG5 A;  1NSF A;  3EIH A;  3B7N A;  4AKI A;  2G5G X;  4MGH A;  2V1C A;  3BOS A;  4L15 A;  1MN3 A;  4IBB A;  1KYI A;  3C9P A;  3KSJ A;  4F1I A;  2WZJ A;  3B89 A;  1EFU B;  3E21 A;  4OU7 A;  1HNZ M;  5ITT A;  3AOE C;  3HX3 A;  2QP9 X;  2F5O A;  1N32 M;  3I51 A;  1PJJ A;  2UUC M;  4LF9 M;  3UJN A;  3SYL A;  3FRH A;  1VQ1 A;  2NQ8 C;  4JI7 M;  1J5E M;  1G4A E;  2M5Z A;  4B7G A;  4QOZ C;  2Z7J A;  2CP8 A;  5FTN A;  4AKH A;  1LTM A;  1YE9 A;  3GRV A;  3VFD A;  3ZH9 B;  4LFB M;  1GJS A;  1OQY A;  3RC3 A;  1OFI A;  3SBJ A;  5FSW A;  2DNA A;  3I01 M;  4B7F A;  1QAO A;  1Z5C A;  3D8L A;  4MM3 B;  3C3D A;  1JR3 E;  5EP1 A;  3DOA A;  2LVN C;  1OAO C;  3ZCB B;  4DV3 M;  1JR3 A;  5FTL A;  2HL7 A;  1XHB A;  3NBI A;  3KVW A;  2QZ4 A;  4DUY M;  3U6P A;  4CHD A;  2DI0 A;  4L16 A;  1IN4 A;  1Q02 A;  3HHX A;  3BXW A;  3Q8X A;  4B3R M;  1EIJ A;  3GPX A;  1HQY E;  4BBA A;  4LCB A;  1SXJ E;  3B74 A;  3SMS A;  2F5N A;  1XMO M;  4YY3 M;  2OQ4 A;  4DR4 M;  1SXJ A;  2ZAO A;  4ANR A;  2C96 A;  3FTF A;  3GLG E;  4GC9 A;  1QAN A;  1NJF A;  1L2B A;  3GLG A;  2F5P A;  1K82 A;  4LF6 M;  1GJT A;  4CHT B;  1YLA A;  3LVW A;  4M9Z A;  5DYI A;  2C5R A;  1KSF X;  2QBY A;  2DAM A;  4G4N A;  3Q8G A;  2MJ5 B;  4FD2 A;  2UU9 M;  1SXJ B;  4PCZ A;  1G3I A;  2C99 A;  2EUC A;  2O5R A;  3KW6 A;  4CJ6 A;  4PD2 A;  2AHM A;  4MGK E;  4NL4 H;  2J7O A;  1D0K A;  3PVS A;  4AG6 A;  3UK6 A;  1W5T A;  1AUA A;  4BB9 A;  2R0I A;  1TH2 A;  4AI6 A;  5KPR A;  1NHW C;  3SYK A;  2QBY B;  3RE8 A;  4PDG A;  3SHF A;  3GRY A;  3E9S A;  4NXM M;  4CIS A;  3HJ8 A;  2JNH A;  1QZM A;  2D7H A;  3K8Z A;  4QHS A;  1OIP A;  1NY6 A;  2CHV A;  2DWL A;  2WSF F;  3PNV A;  2BJV A;  1Q3B A;  4G4R A;  4BLC A;  1L2C A;  3I04 M;  1QZE A;  5EP4 A;  2WSE F;  2JY8 A;  4GRI A;  5LMU M;  3L2A A;  5KO3 A;  4HL4 A;  1N34 M;  3JR4 A;  5FTK A;  2VQF M;  3K2L A;  2QQ8 A;  2FNA A;  3W0F A;  5ITY A;  2KRU A;  3D8B A;  1Q39 A;  3LMM A;  2G8L A;  3MK6 A;  1C7Y A;  2HHH M;  1GO5 A;  3KP0 E;  4LJ9 A;  1OIZ A;  7CAT A;  3CTW B;  3KFU G;  5IT9 S;  3R8F A;  1WHC A;  1UFZ A;  4GEW A;  4IBD A;  4DR6 M;  1N75 A;  1QUS A;  1PRB A;  1HR0 M;  1HQC A;  2RGH A;  2JY6 B;  2CV2 A;  1IM2 A;  2DHY A;  2K9D A;  3K9P A;  4REZ A;  2CFO A;  1IN7 A;  1ZAE A;  1EE8 A;  3H4M A;  3ILK A;  1L1Z A;  3GQ5 A;  2ZTC A;  2JY7 A;  1E9S A;  3FKE A;  2Y0Q A;  3W67 A;  1NJG A;  1OJL A;  3A42 A;  3J27 B;  2FH0 A;  3A46 A;  3HGI A;  4NRW A;  3GP1 A;  4X64 M;  2XZF A;  1PJT A;  5DYG A;  3TL4 X;  1MW5 A;  2L09 A;  1R6B X;  4FWG A;  4GKK M;  1S3S A;  2L2D A;  4G6Z A;  4GIT A;  1HNW M;  1ZQ9 A;  1N77 A;  3PFI A;  2F5S A;  3KDS E;  3CGW A;  5C18 A;  1V92 A;  4KO8 A;  1XC8 A;  2BJW A;  4RF0 A;  1TF0 B;  1IXR C;  1V34 A;  3THG A;  2LBC A;  2XFT A;  3RFW A;  4KT0 F;  1NV8 A;  4XGI A;  4CGY B;  2CV0 A;  3AV0 A;  4L8R C;  1H6U A;  1L1T A;  1D2N A;  2I7P A;  2XF3 A;  3T38 A;  3KS4 A;  5KQ8 A;  2XLJ A;  3K9O A;  4D80 A;  3LVV A;  3WHL A;  2R65 A;  3L27 A;  4IJE A;  2LVO C;  5E6J A;  4PT5 A;  4W5W A;  3B7Q A;  4II7 A;  1L2D A;  2Z8Y M;  2B3T A;  3QYB A;  1PM5 A;  1DGB A;  4LZZ A;  3FTD A;  3DFZ A;  1WIV A;  2YFQ A;  1YSY A;  1IN6 A;  4NSR A;  3CTD A;  1KFV A;  3GPP A;  4JN6 A;  4L78 A;  1UM8 A;  2DEN A;  4LG2 A;  2FOI C;  2LH0 A;  3BBZ A;  4AZF A;  3KSX A;  4K0K M;  2APL A;  4LGY A;  1V33 A;  4L4U A;  2KZS A;  3AOE A;  4LGM A;  2Z3X A;  4R7G A;  3AKZ A;  3GLF E;  1TR8 A;  3CF2 A;  4IJF A;  2XSZ D;  1IN5 A;  1IQP A;  1NHG C;  1VEK A;  2A5Y B;  5BPV A;  3GLF A;  2CUZ A;  2GQF A;  2XGN A;  3GLH E;  2OOA A;  1OKS A;  5EXS A;  1NV9 A;  2X49 A;  4M9S A;  3SAW A;  2O01 F;  4B3M M;  4IBI A;  3GLH A;  2RGO A;  2E5L M;  3A45 A;  2L7I A;  2KW0 A;  3FYC A;  1WGN A;  2VF8 A;  1NNU C;  2X8A A;  2YR0 A;  1Z5B A;  4I4L A;  2YQZ A;  3W0L B;  4Z6Y A;  3GQ3 A;  3FTC A;  3GLF B;  4KOD A;  3AFH A;  3U6Q A;  4LZJ A;  4B7H A;  1F4I A;  1P3Q Q;  4DV2 M;  3ES5 A;  3T1H M;  3GLH B;  2HCB A;  2G3Q A;  2KNA A;  4I5S A;  4G4O A;  2Z4R A;  1MX0 A;  4X66 M;  4M0W A;  3HHY A;  3HHZ A;  1GLN A;  1IY0 A;  5EXX A;  3NBX X;  2DWN A;  1TGU A;  2DWM A;  4JI5 M;  3FYD A;  2LVQ D;  4DV0 M;  2ZBK B; 
#chains in the Genus database with same CATH homology
 1J09 A;  2C9O A;  5JI2 E;  3UMM A;  3SMP A;  3U60 A;  1N36 M;  2D7G A;  2R45 A;  4DV6 M;  4Z8X A;  1ORY B;  4DR2 M;  3GLG B;  3MJ5 A;  3FUW A;  1WXQ A;  3VDU A;  2UUB M;  4GHA A;  5KPZ A;  4B08 A;  3FUU A;  5FLX S;  4LRS A;  5EXT A;  4JYA M;  2D7E A;  3U60 B;  4LJ8 A;  4I8O A;  3L29 A;  4HLQ A;  3HJS A;  2QEN A;  2ERC A;  3HHW A;  4MGY E;  3J80 S;  5ITR A;  2V1U A;  4LRT A;  2C9C A;  5EP3 A;  2BNK A;  2OPF A;  3IG5 A;  4RF1 A;  4DV5 M;  1XWI A;  1IXS B;  4KHP M;  2HKJ A;  5EXP A;  1HNX M;  4JI8 M;  4IBF A;  1IXZ A;  2VQE M;  3SHG B;  1L8Q A;  4GKJ M;  1JR3 D;  3GRU A;  1HT1 E;  1NY5 A;  3CF6 E;  4AG5 A;  1PJI A;  1NNJ A;  4X62 M;  2UXB M;  3M6A A;  3LQR A;  3ZC7 B;  3TPZ A;  3SAU A;  4FVM A;  5EQT A;  1R2Z A;  2KRK A;  3IG8 A;  1IBK M;  1SXJ D;  4IBK A;  4WUR A;  8CAT A;  5IZ7 D;  4DR5 M;  4LF7 M;  3U6D A;  5FTM A;  4AW4 A;  5FTJ A;  2DXI A;  1TH3 A;  2FE8 A;  3AOG A;  4S12 A;  1GL7 A;  4B3T M;  2GNO A;  3DZD A;  1XNQ M;  2CEA A;  5ITX E;  2V6Z M;  4DUZ M;  4JI6 M;  1Q3C A;  3K92 A;  4MGI E;  5ITQ A;  2QW6 A;  3GLI E;  4P16 A;  3GLI A;  4FCT A;  4FWD A;  4OX9 M;  4LFA M;  1DO2 A;  3HJQ A;  4DV7 M;  4FWH A;  4DR3 M;  1R7R A;  4LJ7 A;  1Z59 A;  4GMQ A;  3AJI B;  2Y0T A;  3SAV A;  1XNR M;  4NSO B;  3FUX A;  4GIP A;  1XXH E;  2Y20 A;  2X4A A;  4I81 A;  1MU5 A;  2R46 A;  4LJA A;  4MB7 A;  5EJC A;  2R4J A;  2ZAN A;  3MHV C;  2EA0 A;  4IBE A;  3U6E A;  2QCU A;  2KA6 B;  3I4V A;  3SAS A;  2R62 A;  2LWX A;  2CV1 A;  4JXJ A;  4XBO A;  1E32 A;  2DVW B;  3C58 A;  4AQY M;  1IBL M;  2LNH C;  4JI4 M;  4NRV A;  3JAM S;  3VKG A;  4TUW A;  2KZU A;  2L6O A;  4ITQ A;  1A5T A;  3TQS A;  5GKN A;  3KOX E;  4LF8 M;  3FUT A;  3M7G A;  4D82 A;  2YNM D;  5LMN M;  3HKP A;  2R9G A;  1G59 A;  3SAR A;  5IWA M;  4A3V B;  1T3T A;  3HWS A;  4NXN M;  5KPT A;  4IIW A;  2UXC M;  4DR7 M;  4IBG A;  3JR5 A;  2JA2 A;  3PNY A;  2DZN B;  1DO0 A;  2H1R A;  3LQQ A;  1QVR A;  4DV4 M;  3VLF B;  2DWZ B;  4LY6 A;  5F3W A;  1I94 M;  1YUB A;  2VII A;  2RKO A;  1VDD A;  2CE7 A;  1W5S A;  4ZPX A;  1TDH A;  3WHK A;  5EP2 A;  3SAT A;  1E94 E;  1E9R A;  1QYR A;  3HU1 A;  4QHT A;  3UGJ A;  3M0E A;  3T15 A;  2ZAM A;  4FW9 A;  3RGP A;  1FNN A;  4JI1 M;  3QWL A;  3L28 A;  2XFS A;  5DNY A;  3U6M A;  3U6O A;  1HT2 E;  1K3W A;  4WW0 A;  3PXG A;  1SXJ C;  3U61 A;  1NVM A;  4EIW A;  3GO8 A;  4IBC A;  1LV7 A;  4OW0 A;  2XZU A;  3GPY A;  3BGE A;  1IBM M;  1TH4 A;  1G41 A;  2W82 A;  3HU3 A;  1IY2 A;  2FFJ A;  3GRR A;  1G8P A;  5ITU A;  3U61 B;  4G4Q A;  4MGZ E;  3TWK A;  4LF5 M;  3VKH A;  3KXE C;  3TWL A;  4YHH M;  3FUV A;  3J7B A;  1XMQ M;  4GH9 A;  2QPA A;  3VK7 A;  3KOZ E;  4NOO B;  1R2Y A;  3RC8 A;  1DGG A;  1GKI A;  1N78 A;  3DA1 A;  4X65 M;  5KQD A;  1Z6T A;  3U6S A;  1X37 A;  1N33 M;  2F5Q A;  3J81 S;  3A98 B;  1JQJ C;  3GQ4 A;  2ZM6 M;  2F4V M;  3R9X B;  3K1J A;  4QNR A;  2LXE A;  4KLN A;  3AL0 C;  3VDP A;  3I4Y A;  1DGH A;  1IY1 A;  3KOW E;  3GPU A;  1QAM A;  1J7K A;  2M60 A;  2Z4S A;  2J7N A;  3UZU A;  3FD9 A;  2K47 A;  1C1K A;  4LJ4 A;  4FCW A;  5IRE B;  2XEP A;  5ITX A;  4AKG A;  3B9P A;  3TE6 A;  4LFC M;  2EO2 A;  4OVZ A;  3J7A S;  1FJG M;  4LJ5 A;  3L26 A;  1DGH B;  4M0D A;  3OTO M;  4IBJ A;  1K3X A;  3KP1 E;  1GVN A;  4DR1 M;  2XSZ A;  2CHG A;  4JI3 M;  3QAU A;  3L25 A;  1DGF A;  3E4R A;  5BR8 M;  5C1B A;  4PDI A;  1TDZ A;  2KXE A;  3GLI B;  1IN8 A;  1Z5A A;  2R4E A;  3HU2 A;  2UUA M;  4OVZ B;  4DV1 M;  2C98 A;  1XXH A;  2KEB A;  2R18 A;  5H37 D;  4LJ6 A;  2CHQ A;  2Y21 A;  1I4W A;  3CF0 A;  4MH0 E;  4R3D A;  5E26 A;  3RGS A;  4JI2 M;  2P5T A;  3VK8 A;  3J2P B;  3U5Z A;  3U6C A;  2XH9 A;  3T1Y M;  1QQW A;  4LF4 M;  1QAQ A;  4QOS A;  1GL6 A;  3SFZ A;  2DZO B;  5JI3 E;  4FCV A;  4D81 A;  2DHR A;  2Q2E B;  4M9X A;  3U6L A;  1XXH B;  4GC5 A;  2L7H A;  3U5Z B;  4QNM A;  3KOY E;  3NWL A;  4B3S M;  2I7N A;  1OFH A;  3FTE A;  3EIE A;  3SC3 A;  3KS8 A;  5A2Q S;  4GHL A;  4JV5 M;  2UXD M;  4JI0 M;  4RNA A;  1NSF A;  3EIH A;  4AKI A;  2G5G X;  4MGH A;  2V1C A;  3BOS A;  4L15 A;  4IBB A;  1KYI A;  3KSJ A;  4OU7 A;  1HNZ M;  5ITT A;  3AOE C;  2QP9 X;  2F5O A;  1N32 M;  3I51 A;  1PJJ A;  2UUC M;  4LF9 M;  3UJN A;  3SYL A;  2NQ8 C;  4JI7 M;  1J5E M;  1G4A E;  2M5Z A;  4B7G A;  4QOZ C;  2Z7J A;  5FTN A;  4AKH A;  1YE9 A;  3GRV A;  3VFD A;  3ZH9 B;  4LFB M;  3RC3 A;  1OFI A;  3SBJ A;  5FSW A;  4B7F A;  1QAO A;  1Z5C A;  3D8L A;  4MM3 B;  1JR3 E;  5EP1 A;  3DOA A;  3ZCB B;  4DV3 M;  1JR3 A;  5FTL A;  2HL7 A;  1XHB A;  3NBI A;  3KVW A;  2QZ4 A;  4DUY M;  3U6P A;  4CHD A;  4L16 A;  1IN4 A;  3HHX A;  3Q8X A;  4B3R M;  3GPX A;  1HQY E;  4BBA A;  4LCB A;  1SXJ E;  2F5N A;  3SMS A;  1XMO M;  4YY3 M;  2OQ4 A;  4DR4 M;  1SXJ A;  2ZAO A;  2C96 A;  3FTF A;  3GLG E;  4GC9 A;  1QAN A;  1NJF A;  1L2B A;  3GLG A;  2F5P A;  1K82 A;  4LF6 M;  4CHT B;  3LVW A;  4M9Z A;  5DYI A;  2C5R A;  1KSF X;  2QBY A;  4G4N A;  4FD2 A;  2UU9 M;  1SXJ B;  4PCZ A;  1G3I A;  2C99 A;  2EUC A;  2O5R A;  3KW6 A;  4PD2 A;  2AHM A;  4MGK E;  4NL4 H;  2J7O A;  3PVS A;  4AG6 A;  3UK6 A;  1W5T A;  4BB9 A;  4AI6 A;  1TH2 A;  5KPR A;  1NHW C;  3SYK A;  2QBY B;  3RE8 A;  4PDG A;  3SHF A;  3GRY A;  3E9S A;  4NXM M;  4CIS A;  3HJ8 A;  1QZM A;  2D7H A;  3K8Z A;  4QHS A;  1NY6 A;  2CHV A;  2DWL A;  3PNV A;  2BJV A;  1Q3B A;  4G4R A;  4BLC A;  1L2C A;  5EP4 A;  4GRI A;  5LMU M;  3L2A A;  5KO3 A;  4HL4 A;  1N34 M;  3JR4 A;  5FTK A;  2VQF M;  3K2L A;  2FNA A;  3W0F A;  5ITY A;  2KRU A;  3D8B A;  1Q39 A;  3LMM A;  2G8L A;  3MK6 A;  2HHH M;  3KP0 E;  4LJ9 A;  7CAT A;  3CTW B;  3KFU G;  5IT9 S;  3R8F A;  4IBD A;  4DR6 M;  1N75 A;  1HR0 M;  1HQC A;  2RGH A;  2CV2 A;  1IM2 A;  4REZ A;  2CFO A;  1IN7 A;  1ZAE A;  1EE8 A;  3H4M A;  3ILK A;  1L1Z A;  3GQ5 A;  1E9S A;  3FKE A;  2Y0Q A;  1NJG A;  1OJL A;  3A42 A;  3J27 B;  3A46 A;  3HGI A;  4NRW A;  3GP1 A;  4X64 M;  2XZF A;  5DYG A;  3TL4 X;  1MW5 A;  2L09 A;  1R6B X;  4FWG A;  4GKK M;  1S3S A;  4G6Z A;  4GIT A;  1HNW M;  1ZQ9 A;  1N77 A;  3PFI A;  2F5S A;  3KDS E;  5C18 A;  4KO8 A;  1XC8 A;  2BJW A;  4RF0 A;  1IXR C;  3THG A;  2XFT A;  3RFW A;  4CGY B;  2CV0 A;  4XGI A;  3AV0 A;  4L8R C;  1H6U A;  1L1T A;  1D2N A;  2I7P A;  2XF3 A;  3T38 A;  3KS4 A;  5KQ8 A;  2XLJ A;  4D80 A;  3LVV A;  3WHL A;  2R65 A;  3L27 A;  4IJE A;  5E6J A;  4PT5 A;  4W5W A;  4II7 A;  1L2D A;  1PM5 A;  1DGB A;  4LZZ A;  3FTD A;  3DFZ A;  2YFQ A;  1YSY A;  1IN6 A;  4NSR A;  3CTD A;  1KFV A;  3GPP A;  4JN6 A;  4L78 A;  1UM8 A;  4LG2 A;  2FOI C;  2LH0 A;  4K0K M;  4AZF A;  3KSX A;  4LGY A;  4L4U A;  2KZS A;  3AOE A;  4LGM A;  2Z3X A;  4R7G A;  3AKZ A;  3GLF E;  3CF2 A;  4IJF A;  3TWM A;  2XSZ D;  1IN5 A;  1IQP A;  1NHG C;  2A5Y B;  5BPV A;  3GLF A;  2CUZ A;  2XGN A;  3GLH E;  3SAW A;  5EXS A;  4B3M M;  2X49 A;  4M9S A;  4IBI A;  3GLH A;  2RGO A;  2E5L M;  3A45 A;  2L7I A;  2KW0 A;  3FYC A;  1NNU C;  2X8A A;  2YR0 A;  1Z5B A;  4I4L A;  2YQZ A;  3W0L B;  4Z6Y A;  3GQ3 A;  3FTC A;  3GLF B;  4KOD A;  3AFH A;  3U6Q A;  4LZJ A;  4B7H A;  4DV2 M;  3ES5 A;  3T1H M;  3GLH B;  2HCB A;  4G4O A;  4I5S A;  2Z4R A;  1MX0 A;  4X66 M;  4M0W A;  3HHY A;  3HHZ A;  1GLN A;  1IY0 A;  5EXX A;  2DWN A;  1TGU A;  2DWM A;  4JI5 M;  3FYD A;  4DV0 M;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...