3U6FA

Mouse trex1 d200n mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
217
Chain Sequence
PHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENSQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQARKSYSLGSIYTRLYWQAPTDSHTAEGNVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
total genus 69
structure length 217
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u6fA01
1I3AA 1IKVA 4DFJA 4DS4A 1D5AA 4CJKA 4CEAA 2VG5A 2HB5A 2O4GA 2Z1JA 3DM2A 4E0DA 2DTUA 1HYSA 1S1WA 3QEPA 2G8HA 1F21A 1RDDA 1B92A 4KRFA 1RBRA 5DK5A 4MQ3A 4OVLA 4DFPA 4CEDA 2OZSA 2HNDA 4LSNA 3NF9A 3MEDA 2G8WA 3T19A 3D45A 3HP6A 4DLGA 3VQ5A 3RRGA 2B5JA 1EX4A 1HYVA 3OYMA 1VSIA 3H08A 1IKXA 3U6FA 3LAMA 4DTUA 2IDOA 4ZHRA 3OJUA 2HHTA 1NKEA 2YKNA 4AHUA 1JLCA 5FDLA 1NOYA 3HL8A 1RT6A 3QETA 4FM2A 4QOZB 3KLIA 3K5NA 1LAVA 1YTAA 1RT7A 4Q5VA 1VSHA 1WLJA 3SUQA 1WSJA 2Z1GA 1NK4A 4DSJA 3SQ2A 1CLQA 3AO4A 4DTPA 5HRNA 4Z4CA 4PWDA 1QSSA 4W5QA 1TKZA 4OPKA 4RW8A 3SQ0A 4JRPA 4ZTFA 3PY8A 1SKWA 3KLFA 4E1NA 4M3ZA 2F8TA 1KLMA 2XO7A 4DSLA 4B08A 2BDPA 4Y1CA 4BACA 2VWKA 4FJLA 4FJMA 4B8CA 1RTJA 3TAMA 5HRPA 3U3YA 3TAQA 3KK3A 3WNGA 2P5OA 1CZBA 1X1PA 3KJVA 1Q9YA 2PYJA 4NCBA 3VQBA 4CEEA 5CYQA 4E7LA 2OPRA 4LH5A 1BCOA 1HNIA 4DTNA 3VQPA 3OVNA 4RG8A 1UOCA 1U04A 4AH9A 4CIGA 3DLRA 4H8KA 4O5BA 4E7HA 3DLBA 3KTQA 4KHWA 4M45A 3CFPA 3AVCA 1T8EA 4KAZA 1FK9A 4KHQA 4BDZA 4CF9A 3F9KA 4FJGA 1JL1A 4AHSA 1KVCA 3VQQA 1RNHA 4M3RA 3SPYA 3PX6A 2EHGA 3P5JA 3NH2A 2D0CA 4KI6A 4M42A 2IS3A 5J1EA 4O4GA 1WSGA 3ASMA 3O4QA 2IAJA 4HHTA 3VN5A 4CGJA 5SWMA 4I9LA 1TK8A 2HHVA 2XY5A 3SCXA 3K5LA 4E3SA 3RR8A 1S6PA 1XWLA 3ZSRA 3NAEA 4LY7A 3CQ8A 4EZ6A 1BISA 3HP9A 1J53A 3NH1A 3AVBA 3CFRA 3TABA 3AVFA 5KRSA 1NKCA 4EZ9A 1KTQA 5KRTA 3TAFA 3OYAA 4CEBA 4DQSA 1BHLA 3ALYA 3MECA 4CIFA 1HJRA 1R0AA 4FK4A 2P1JA 2VG6A 1S5JA 4HCBA 1I39A 2ZE2A 4DSEA 3RMCA 1N5YA 1KVBA 1T05A 2Z1HA 4FLYA 3MXIA 3WNFA 1ASVA 1RTHA 1CXUA 1RDBA 4IG3A 1L3VA 1C6VA 2HW3A 1C0UA 4BDYA 1ASUA 3C95A 3PO5A 3AVKA 3ZCMA 3V9ZA 2ZQBA 3NF8A 4E7JA 5C24A 1L3TA 3NF6A 4AILC 3KKSA 3KD5E 3V9UA 2E6MA 3QINA 1NK8A 3KK2A 3KLHA 1QHTA 3ZT0A 2D0BA 1RT4A 4FZZA 2RN2A 1FKPA 2BANA 2X6NA 1D9DA 1Q8IA 3OYEA 4B8AB 3OY9A 5KI6A 3LZJA 1HQUA 4KV8A 1SL2A 4J2EA 2X6SA 4FYDA 4CK2A 4NCAA 3C94A 3SQ1A 4F3TA 4O44A 3LPUA 4CEZA 4CF8A 4IKFA 3QO9A 4GVMA 3CYMA 4TSXA 3AO5A 3OYGA 4W5TA 1NK7A 1W9HA 4KPYA 4FJ9A 1S1XA 1ZBIA 2F8SA 4DG1A 4OKKA 3O3GA 4JS5A 4DTOA 1RTDA 4DQPA 4PUOA 5K14A 1VRTA 3L3VA 1RBUA 1A5VA 4CF2A 1A5XA 4M3TA 4CECA 4E89A 3NF7A 1TK5A 1WSIA 3MEGA 4I2QA 3DYAA 4FK0A 1IH7A 4KHSA 1BQNA 1S9GA 3OJSA 2WOMA 1CZ9A 3L2QA 1JXBA 5DMRA 2GBZA 1JLAA 3QEWA 3P1GA 4DS5A 4FM0A 3VQDA 4B9UA 2GUIA 1FXXA 2YHAA 4CF0A 3S3OA 1ZBFA 3NHGA 4NYNA 4DU1A 1U49A 3P83D 4WE1A 4N5SA 1NKBA 2KFZA 4DF8A 3DLHA 1RT5A 4CK3A 4N47A 1SKRA 1UWBA 2Q3SA 4DTMA 3AO3A 3OS1A 3K5MA 1K6YA 4IFVA 4PQUA 3ISNC 3V1RA 4B9SA 1NJZA 1VSMA 4FJ5A 2RPIA 4FCYA 1KLNA 1L3UA 1SUQA 3CM6A 3IS9A 3LALA 3ZSWA 1NK6A 2ETJA 1RBVA 3K2PA 4H4MA 3O3HA 3QIOA 3V9SA 3MEEA 4HVJA 3B6OA 3RR7A 2O4IA 3OYLA 1NJYA 1REVA 4O0IA 1VSDA 3DMJA 4M3WA 3G10A 3OYNA 1UA0A 3SV4A 1L3SA 3I0RA 1BL3A 3FFIA 4RW7A 3V81A 3VQ7A 3LWMA 1NJXA 4E7IA 1GOAA 4RW9A 4CE9A 3S3MA 3TANA 3AVHA 4Z4GA 1LW2A 3KLEA 3I8DA 4DQIA 2Y1IA 4N76A 3L2UA 3LP2A 1XC9A 2IGIA 3L8BA 2AJQA 3JYTA 3E01A 4DQQA 5I42A 3KK1A 2HNYA 2DFEA 4XIUA 4KI4A 4FZYA 4BE2A 1ZYQA 2OPSA 1IKWA 4Z0UA 3AVLA 3SNNA 1RT1A 3MXJA 1NK9A 4B9VA 1QE1A 5CZ2A 5KTQA 2XY8A 3OYKA 4DWIA 4C8MA 4KREA 3L2WA 2G8FA 1LW0A 3VQCA 1VRUA 3V4IA 1JLGA 1QS4A 3LP1A 3QEXA 2KZZA 2WONA 1NOZA 1WNSA 4C8NA 1HNVA 3VQ8A 3RRHA 3OYCA 4B9NA 4CHQA 4BE0A 3PX4A 1BGXT 1WSEA 1TV6A 2YKMA 3NCIA 2D0AA 2KW4A 3ZSYA 2PZSA 4B3OA 1VSJA 4M3XA 2B6AA 3B6PA 3MXMA 3DLEA 3DRRA 1EP4A 1JLQA 2I5JA 3AVJA 2XHBA 3KKRA 1TK0A 4BE1A 1TKDA 2QK9A 4CJSA 3HPHA 3HPGA 4UQGA 4ELVA 4F8RA 1EXQA 2RF2A 3O3FA 1LV5A 3AVMA 4RW4A 2OA8A 1BIUA 1BQMA 3NE6A 3SUNA 4CFDA 4FLTA 1U47A 5JS1A 1RDAA 1WAFA 4Z4HA 4FLWA 4KKOA 3LDSA 4IDKA 3QEIA 2JLEA 1RTIA 1IKYA 3SUOA 2KQ2A 1EKEA 3PV8A 3QLHA 4E1MA 5HLFA 3UIQA 2EX3A 4AHTA 4MFBA 3L2VA 2VWJA 4M41A 2YV0X 3ZSOA 1LWCA 1MU2A 4CJLA 2E4LA 3VQ9A 4E7KA 1HPZA 1LAWA 4R5PA 4B9LA 4BWMA 1NK0A 4I9QA 4DQRA 4FLZA 2HHXA 4FK2A 1ZBHA 4I7FA 4J2DA 2XY6A 4CJWA 1IO2A 3DOKA 4CGIA 2QKKA 3LP3A 1S6QA 4I2PA 1ZBUA 4DSKA 4FLXA 3CFOA 4CJRA 1VK0A 5EU7A 4QCLA 4E19A 2YNFA 3AO1A 1VSFA 1JLFA 1KFDA 2VG7A 5C42A 1Q9XA 2G8KA 4DU4A 2JGUA 3SYZA 1Z26A 4Y1DA 4AHCA 3VA3A 4M3UA 3HO1A 3WNEA 5E41A 1JLBA 1J9AA 4OPJA 4HUEA 4YFUA 3AV9A 1A5WA 2YHBA 1RBSA 3IG1A 4BDPA 4FJJA 1WAJA 4FJ8A 1C1AA 4HCCA 4ELTA 3NBPA 1QSYA 2X74A 1HYZA 4CCHA 3BDPA 4KTQA 2GV9A 4CK1A 3V9WA 3TAGA 2HHSA 1HQEA 4KTWA 5I3UA 1X9WA 3LAKA 3IAYA 4KFBA 1UAXA 3M8RA 1KRPA 4M3YA 3M8QA 4DMNA 1DTQA 3HVRA 4ELUA 3VQ6A 3AO2A 3HYFA 2ITGA 3OS0A 3HJFA 1B9FA 1ITGA 5HRSA 4HUGA 3KLGA 3THVA 1J5OA 2F96A 1JKHA 3V1OA 4JS4A 1TAUA 3AA3A 3HM9A 4FJIA 2RKIA 2IOCA 3CG7A 1KCFA 3HK2A 4LSLA 3EZ5A 4FLVA 1EETA 3KIOA 4CJEA 3LZIA 3S3NA 5FRNA 4OKEA 3TR8A 1X9MA 3OYBA 4KTZA 4FJXA 2HNZA 1X9SA 5D3GA 1C1CA 3K59A 4CJ3A 2QKBA 2FBXA 3BGRA 1RCHA 1VSKA 3VQAA 3O4NA 4G1QA 4ZTJA 2BGGA 4CHPA 4DSIA 3JSMA 1C0TA 3LPTA 4BWJA 4CHNA 5J2PA 4HUFA 3QNOA 1YT3A 1B9DA 3I0SA 3AVGA 4GMJB 4KO0A 4B9MA 3ZSVA 1VSLA 4DSFA 4IG0A 4LD0A 4KB1A 3SZ2A 3C6TA 2R7YA 2HVIA 4O55A 1Y97A 1XI1A 1TVRA 2A1SA 4L8RB 1LWEA 4C8KA 1S9EA 4FM1A 3ZSZA 1KSPA 3SJJA 1TGOA 3V1QA 4CFCA 4FJNA 2HHQA 2DY4A 3HPOA 4Z4FA 3L2RA 3SQ4A 2P5GA 1U4BA 4YNQA 1YTUA 3QEVA 1QSLA 2ZD1A 4KHYA 3TI0A 1XHZA 3OS2A 4CF1A 4CJ5A 4OKJA 5HBMA 3K58A 1D9FA 3G0ZA 3HVTA 4ID5A 5SZTA 3AVNA 1N6QA 2E6LA 1RBTA 1TL1A 3ZSQA 3NDKA 3NFAA 3RMAA 3TAPA 4CEFA 2LSNA 4CEQA 1WN7A 4H4OA 4AHRA 2KFNA 4OLAA 3ZSXA 3RTVA 4CFAA 2BE2A 2FBYA 2XRIA 4JRQA 4FW1A 3K57A 1TKXA 2YNIA 1FKOA 1S1UA 4QAGA 3ZT1A 4CJ4A 5KGXA 4DLEA 4FJ7A 1HMVA 2HHWA 1NK5A 4CJFA 1JLEA 2D5RA 1LWFA 4CFBA 1BI4B 1Z25A 2OZMA 4DTRA 3M8SA 1S1VA 2KZMA 4DTSA 1QTMA 1UA1A 1JXEA 2XY7A 1BIZA 5CY4A 3AVIA 3ZT2A 4CESA 3K5OA 3PX0A 1T7PA 4KHUA 4W5OA 3QERA 1C0MA 4OJRA 2G8UA 3LWLA 4FJKA 4Q0BA 3DLGA 1QQCA 1VSEA 3U3GA 5J2MA 3RMDA 4JLHA 4C8OA 3IRXA 1DTTA 3DI6A 2HHUA 4DU3A 4CJTA 3OYFA 2OYQA 4J2AA 3AA4A 4W5RA 1T03A 1ASWA 3QNNA 5HRRA 4B9TA 4K8XA 2B4JA 5T7BA 4HTUA 1TL3A 4CHYA 3OYJA 4DTXA 4DFKA 4OGCA 4FJHA 2KTQA 5FRMA 4O0JA 3S9HA 1D8YA 5CZ1A 1DLOA 1TKTA 3SI6A 5KGWA 3PO4A 2IC3A 3ZT4A 3LANA 2Y1JA 1CXQA 4FXDA 1KVAA 4DF4A 2HMIA 2DFHA 5JS2A 4CGHA 3NGIA 3D0PA 1BCMA 1HRHA 1YVUA 4ID1A 3ULDA 2QXFA 4CERA 3QESA 4CEOA 3VQ4A 4Z4IA 4FLUA 1RT2A 3DRSA 3L3UA 2NUBA 3TWHA 4KB0A 1WSHA 5CYMA 3ZT3A 4CHOA 4CJUA 1U48A 4RW6A 4EP4A 1SKSA 4NCGA 2DFFA 2YNHA 4CJPA 4EP5A 5HP1A 1ZBLA 2P51A 3M8PA 4CGFA 3EY1A 4OLBA 4AHVA 1JL2A 1RT3A 2OPPA 4K8ZA 4CGDA 2FBVA 4F2SA 3LP0A 3AA2A 1NJWA 3T1AA 3DRPA 1XHXA 1C1BA 4IBNA 4OGEA 5FROA 2PYLA 3SUPA 3NGYA 1W0HA 3AA5X 3OYDA 2Z1IA 3C6UA 3SV3A 3VA0A 3VQEA 3HSTB 2FC0A 3RMBA 4N41A 2FBTA 2HVHA 4CJQA 5J2QA 1GOBA 3V6DA 1G15A 5C25A 3CM5A 4F4KA 3PUFA 4PY5A 3OYIA 3QIPA 4Z4EA 1O1WA 4FW2A 3A2FA 2A1RA 1SL1A 2G8VA 4F2RA 5J2NA 4J2BA 1SL0A 1BI4A 4CJVA 4FZXC 2YNGA 4LH4A 4F3OA 3TARA 1RDCA 4C8LA 3AVAA 3T3FA 3NGZA 1IG9A 4DTJA 5HROA 2OPQA 3NH0A 1WSFA 3HXMA 4PA1A 3OYHA 3V9XA 4N56A 1RILA 2W42A 3EYZA 2G8IA 4GW6A 3WNHA 4FVMA 4KHNA 2PY5A 3DLKA 4DFMA 1KFSA 4NYFA 1U45A 4CHZA 3MAQA 2ATQA 1L5UA 1GOCA 3TAEA 3RWUA 4CIEA 1TAQA 3DOLA 1J54A 4W5NA 4IFYA 1SV5A 2X78A 3ITHA 3KD1E 3HT3A 4ICLA 1S1TA 3SPZA 4CGGA 3F73A
chains in the Genus database with same CATH superfamily
2DPNA 5HOOA 3CCLN 3Q7BA 1ESVA 4IJNA 2BTFA 1XNQK 4DS4A 4CJKA 2DTUA 4E0DA 1HKGA 1HYSA 3QEPA 1F21A 2HBKA 5H1SQ 4CEDA 1WBDA 3T19A 1OH5A 5JLFA 2OTJN 3T69A 4DTUA 2D1KA 4H5VA 2HHTA 3MN9A 4HWIA 4AHUA 5FDLA 3LDOA 1NOYA 4H5NA 4QOZB 3THXB 1LAVA 1YTAA 1RT7A 1WLJA 3O1WA 4DSJA 5AQVA 5EVZA 4DR3K 2HMPA 1ZC6A 4RW8A 4JRPA 3PY8A 3WXLA 3JAMO 3KLFA 3EKSA 1KLMA 2XO7A 4B08A 5AJ3K 1Z6RA 2VWKA 5GAHP 3CCVN 5F1XA 3TAMA 5F0XA 3WNGA 5E26A 5CYQA 2O8CA 3LDQA 2VYPA 3BF1A 3VQPA 3OVNA 4A62A 4CIGA 1N8RO 4DHYA 4O5BA 3HI0A 3TSPA 3CFPA 4YDUC 4KAZA 4IEIA 4KHQA 4BDZA 4FJGA 1KVCA 5ADXA 3P38A 2EHGA 2D0CA 5AFUH 5J1EA 1NWKA 3NVMA 1WSGA 3AARA 3O4QA 5AQWA 2QEXN 3EL2A 2HHVA 4I9LA 4U7BA 4NO7A 2FF3B 2F9TA 2VQEK 1J53A 3CFRA 3AVBA 1NKCA 4EZ9A 2E2PA 1KTQA 2P9SB 3UB5A 2QXLA 1HJRA 1SS6A 2P1JA 2VG6A 1S5JA 2V52B 1WBBA 4JD2B 4XH1A 2Z1HA 1T05A 3WNFA 4CZEA 3HOSA 1RTHA 3PIPL 4JKGA 1C0UA 3MCAB 4WQ5A 4JKFA 3EE8A 4JI2K 5C10A 4X62K 3IFRA 3RVCA 3NF8A 5C24A 1L3TA 3ZYYX 3QFUA 5AQHA 4B1VA 1X3MA 3OYEA 3OY9A 3WEEB 4BR9A 3K9KA 4J2EA 2X6SA 4YHHK 3C94A 2E2QA 3WUHA 1RDUA 4O44A 5TKWA 3LPUA 3RSEA 4CF8A 2JWKA 4JI6K 1QVFM 2QWNA 4DTOA 3AGRA 3HM8A 3CCSN 1SZ2A 4M7XA 1A5XA 4GY2B 4KHSA 1NGDA 3DYAA 1IH7A 3N4QA 2WOMA 4YOXA 1CZ9A 5AQIA 4DS5A 4FM0A 2GUIA 1FXXA 3H6EA 3S3OA 5FPNA 4NYNA 4BRLA 1XMOK 4N5SA 4YOUA 1KQSM 3M3ZA 4BRCA 4JI8K 3M5RA 4CK3A 1UWBA 4WFBL 1P90A 3G25A 4IFVA 4M7YA 3D2EB 4DKWA 2ETJA 1RBVA 3K2PA 3O3HA 3QIOA 3B6OA 2FXUA 4JAXA 1NJYA 2QA4N 1GLBG 3G10A 4IOAL 3R8EA 1BL3A 1HR0K 3S41A 4CE9A 4RW9A 1GLCG 3H3NO 1LW2A 1K8AO 4DQIA 4RWTA 2AJQA 4JI7K 4CD1A 3JYTA 5AQLA 4BR2A 4XIUA 4IO9L 4GV3A 4CW7B 4Z0UA 1QE1A 4BRQA 3SAFA 2I7NA 2G8FA 2O8EB 1VRUA 1QS4A 3OYCA 3CJBA 3NCIA 2KW4A 1S72N 1VSJA 4JI1K 3QBWA 5AQTA 2GELA 3UKRB 2WUSA 1U2VB 3O1BA 1RFQA 2BH1A 3TTCA 1TKDA 2QK9A 4CJSA 4JKHA 2VGMA 1EXQA 1BIUA 3THYB 3DJCA 2A42A 5AQJA 5JS1A 4FLWA 4O8KA 2P9IA 1RTIA 1IKYA 3WT0A 3SUOA 1D4XA 2EX3A 5CHIA 4MFBA 2VWJA 1NGAA 3ZSOA 1VQLN 5C2DA 4BC3A 4E7KA 1HPZA 3O9RA 3DAWA 2JWLA 3VEXA 1TUYA 3W0LA 4I7FA 1IO2A 1S6QA 3C7NB 1NGJA 4CJRA 1VK0A 5AZIB 4KH4A 1VSFA 5C42A 2VG7A 3SYZA 4CZMA 4AHCA 5FPMA 1P8ZA 3O4WA 4OPJA 2W41A 3F9MA 1A5WA 2YHBA 2QWRA 1HYZA 3QMLA 1K9MO 4ISGA 4PL8A 1KRPA 4M3YA 1HUXA 1DTQA 4DR5K 4MLHA 3VQ6A 3HYFA 4ISEA 2ITGA 3THVA 5HRSA 3ZX0A 4JI3K 1JKHA 3VOVA 3HM9A 4FJIA 3TTDA 3SBTA 3EZ5A 5GAEP 3KIOA 5FRNA 4KH6A 3ENHA 1C1CA 2D4WA 1RCHA 3NVKA 4ZTJA 2BGGA 2WTUA 2P9LA 4BWJA 3QNOA 3H3OB 3CCEN 4DSFA 4LD0A 3SZ2A 3C6TA 2NNWA 1Q18A 4CBWA 1TGOA 4BROA 4FJNA 3H1QA 2HHQA 3SQ4A 1YTUA 4YNQA 2CH5A 4CF1A 3K58A 3C6AA 4L3QA 4JK9A 4B1YB 2E6LA 3HRGA 3MX5A 3RMAA 4CEQA 3L0QA 4JRQA 1S1UA 4FJ7A 3P39A 3VEZA 5TKYA 1Z25A 4JKEA 2OZMA 4DTRA 1NGHA 3LDPA 2KZMA 3THWB 4BRMA 1JXEA 2XY7A 5CY4A 1T7PA 4OJRA 4FJKA 3DLGA 5J2MA 3OYFA 1ZBSA 2OYQA 4K25A 5HRRA 3DLLL 5AQOA 2E8AA 3EO3A 4CHYA 3OYJA 4DTXA 4DFKA 2KTQA 3ZEUB 4NXNK 4NXMK 1DLOA 2NRZA 1OH7A 4DF4A 4PHTX 2DFHA 3WXKA 2V51B 1BCMA 3BY5A 3ENOA 4GNIA 4ID1A 3SJHA 1QHAA 3DRSA 2NUBA 3MDQA 5M1OA 1WSHA 3VF2A 1U48A 4BRAA 4MO4A 4EP4A 2DFFA 2YNHA 4CJPA 5GINA 1OKJA 4DUYK 4CGFA 3IDHA 3KHYA 1TUUA 1NJWA 3ZX3A 3BZCA 3SV3A 3VA0A 2ZF5O 2FC0A 3OA9A 2HVHA 3H45C 2NRWA 1BO5O 1NMNA 1YJWN 4MDBA 3E9OA 5C25A 4Z4EA 3A2FA 2A1RA 4LFAK 3T1YK 5J2NA 4OX9K 4CJVA 1EQYA 2YNGA 1RDCA 1LCUA 3NGZA 4DTJA 4BG8A 3IKMA 3V9XA 3NH0A 2W42A 2OCEA 3CC7N 3GDQA 1M90O 3DLKA 1KFSA 4CHZA 3MAQA 2WFBA 5DM6L 5LY3A 3HT3A 1S1TA 3CXCM 2QM1A 3F73A 3KWIA 1XNRK 3UKUA 1I3AA 2A5XA 4IOXA 1IKVA 4ISFA 4DFJA 1BDGA 3O08A 4CEAA 2VG5A 2HB5A 3DM2A 1Q7YO 2UXCK 5BN8A 1RDDA 1B92A 3MN7A 1RBRA 3VPZA 4BRNA 5DK5A 4OVLA 4ILJA 4DFPA 4LSNA 3MEDA 3D45A 3FZKA 2B5JA 3J8AA 1M1KO 3OYMA 2P9UA 3ENBA 4JK7A 2IVNA 1NKEA 2YKNA 3I33A 4H5WA 1JLCA 4FM2A 2ZJRL 4JHDA 3VEVA 1WSJA 2Z1GA 4DTPA 5HRNA 3H1VX 4C23A 4W5QA 3FZLA 4ZTFA 3ZX2A 4E1NA 2F8TA 5BR9A 4DSLA 2ITMA 4BACA 4FJMA 5HRPA 1BA0A 3TAQA 3KK3A 2P5OA 4LH5A 1RDWX 4CZFA 3QDKA 4DTNA 3WXJA 4RG8A 5LMUK 2DY4A 4E7HA 3AVCA 2QWOA 3F9KA 3R1XA 1JL1A 3VQQA 1RNHA 3DXKA 3NH2A 4WQ5C 4KI6A 3SAGA 4M42A 4O4GA 4Z94A 2IAJA 5C12A 3H46O 4HHTA 5SWMA 4JKCA 2XY5A 3OBWA 5JMVA 1S6PA 1VQNN 4EZ6A 1BISA 3TABA 3TAFA 4CEBA 4DQSA 3LDNA 2GX9A 1BHLA 3ALYA 3LDLA 3L6QA 1R0AA 1NM1A 3O80A 3VGKA 1LOTB 1I39A 5JVGL 2ZE2A 3RMCA 3VTHA 1ASVA 5M1NA 2V7ZA 3DWLA 3THXA 4IG3A 1L3VA 1C6VA 3CJCA 4BDYA 3C95A 3PO5A 1NMDA 3V9ZA 4E7JA 3VF6A 1BWFO 4AILC 1WB9A 4CD3A 3OTOK 3MX2A 3KK2A 4FZZA 2RN2A 2X6NA 1SL2A 4CZIA 1Y64A 4FYDA 4CK2A 4CEZA 4IKFA 1N33K 4GVMA 4TSXA 1NK7A 5M1KA 4KRFA 1W9HA 1ZBIA 4OKKA 4JS5A 4FPAA 5K14A 3L3VA 5BR8K 1A5VA 5FLXO 4B3RK 4E89A 3NF7A 1TK5A 3MEGA 4I2QA 4WYBA 3CQXA 1BQNA 3FR0A 3P1GA 1KAYA 4LFCK 4PKHA 3U9ZA 3VETA 3DLHA 1RT5A 1QQMA 4JN4A 1SKRA 2Q3SA 3NMUA 2P9SA 1NU0A 3VEWA 3ISNC 4K43A 4B9SA 3CIPA 1VSMA 5BPMA 3IS9A 1NK6A 4H5RA 4JD2A 1Q82O 3VTIA 5BRFA 4BG9A 3OBYA 1REVA 1NGFA 1YJNN 3FFIA 2O8BB 3V81A 1W97L 4H0OA 3S3MA 3TANA 3CHWA 2W6LA 3AVHA 3I8DA 2CGJA 2Y1IA 4N76A 3VMFB 3E01A 4GKKK 1NGCA 1KXPA 4FZYA 2FSJA 1VQ8N 2ZJPL 4IZ9A 1ZYQA 1HJOA 3AVLA 4B9VA 1VHXA 5CZ2A 2NZTA 1LW0A 3V4IA 1JLGA 2WONA 4C8NA 1HNVA 1O13A 3RRHA 3PX4A 1WSEA 2NRVA 2HBLA 3ZSYA 2B6AA 1VQKN 3CPWM 4H0YB 2E1YA 1EP4A 3O5BA 5AQFA 1VQ5N 3HPGA 4O8UA 5LL6Z 5AQZA 2RF2A 4RW4A 1OVQA 3LM2A 4LF6K 3TSQA 4K41A 1ATSA 3WXIA 3A5OC 4M41A 1HPMA 1LWCA 2IVOA 1JCGA 2E4LA 4R5PA 4BWMA 4I9QA 4DQRA 1MDUB 4BGBA 2YX6A 1ZBHA 3D2FA 4FOEA 4CGIA 1YF5L 5AQUA 3P4IA 2QKKA 4QCLA 2HF4A 4E19A 2YNFA 3O6WA 3AO1A 3Q7CA 1JLFA 5M1QA 2G8KA 4DU4A 1Z26A 1OVYA 2ASOA 3VA3A 3HO1A 3SBGA 4HUEA 4G9ZA 3UE5A 4YFUA 3KK7A 4BDPA 4DV3K 4ELTA 2O8EA 3BDPA 2GV9A 4CK1A 2O8DB 3TAGA 1HQEA 2HBJA 3IAYA 3QICA 3DXMB 2KKZA 3M8QA 3VGLA 5IT9O 3GE1A 1XUPO 3OS0A 4FWNA 4HUGA 3UKRA 1U2VA 2QWPA 4LF5K 4A59A 3V1OA 4JS4A 1TAUA 3AA3A 2IOCA 4LSLA 3PSFA 4CJEA 3LZIA 4OKEA 3TR8A 1X9MA 2UUCK 1HKCA 2HNZA 3VERA 5BRDA 1X9SA 4CJ3A 1NLVA 1VSKA 3VQAA 2NRTA 4G1QA 4CHPA 4DSIA 3HSCA 3JSMA 1C0TA 4CHNA 1FJGK 4HUFA 3AVGA 4KO0A 2YI1A 1IBLK 3ZSVA 2E5LK 1NGGA 1HNXK 1Y97A 4UY8O 1LWEA 2CH6A 4C8KA 4FM1A 4F9OA 4FSVA 1KSPA 1NNEA 1MWMA 3L2RA 4A2BA 2ZD1A 3C7NA 1GLJO 3A8YA 4CJ5A 5HBMA 5AZIA 1D9FA 3G0ZA 3HVTA 1NGIA 5SZTA 3AVNA 1KAZA 1ATRA 3TAPA 4AHRA 3ZSXA 5HL7L 3K57A 4Q0BA 1FKOA 1NK5A 1JLEA 2D5RA 3CJ1A 4CFBA 1BI4B 3PX0A 4CESA 3K9JA 3J81O 4C8OA 4JLHA 3G4SN 1DTTA 3DI6A 1JCEA 1BOTO 3AA4A 4GVEA 1RGIA 3I8BA 4O0JA 4BVOA 1TKTA 5KGWA 3PO4A 3LANA 2Y1JA 1CXQA 4FXDA 2HMIA 5AZJB 1H1VA 3D0PA 3ULDA 4DV5K 1YVUA 3QESA 4CERA 1C0FA 4FWOA 4IO8A 4BRFA 1RT2A 3L3UA 3EZWA 4CHOA 4CJUA 1GLDG 4B1WB 4RTFD 1J6ZA 1N34K 2P51A 3M8PA 4AHVA 1JL2A 1RT3A 2OPPA 2QWMA 4DR4K 3LP0A 3DRPA 1XHXA 1C1BA 4IBNA 5BRHA 4X65K 5FROA 1DKGD 2P9PB 3OYDA 4FOIA 2Z1IA 3C6UA 2PFUA 3RMBA 2FBTA 5J2QA 1G15A 3G71N 3CM5A 4BRKA 4PY5A 3R6MA 4FW2A 4F2RA 4J2BA 3PSIA 3CCQN 4IXCA 4FZXC 3LM9A 4H0PA 4C8LA 3T3FA 2EWSA 3HXMA 1WSFA 2QWQA 3WNHA 4KHNA 4WF9L 2KZZA 1U45A 4M3ZA 3EEQA 1TAQA 4W5NA 4IFYA 3ITHA 3CMAN 1IBMK 2PYLA 4OPHA 3SPZA 1YXQA 3ZEUA 4X64K 1I94K 4IJAA 4FVUA 1D5AA 2Z1JA 3KVGA 4NLCA 3NF9A 2G8WA 2NRHA 1VAZA 1EX4A 1T3VA 4H03B 2IIRA 3BZKA 1VSIA 1IKXA 2NRXA 3U6FA 3LAMA 3VESA 3OJUA 1SQKA 3QETA 5DM7L 4PKIA 4Q5VA 1VSHA 1NK4A 3SQ2A 1CLQA 3AO4A 3E9LA 4Z4CA 1YHQN 4PWDA 1TKZA 3C65A 3FFKB 1V4TA 5M1PA 3AAQA 1SKWA 3JS6A 2BDPA 4Y1CA 4FJLA 4B8CA 3U3YA 5AQXA 1CZBA 4WFNL 3KJVA 2PYJA 1K8KB 4NCBA 3CJ9A 3VEOA 5AR0A 4A5BA 1HNIA 2ZM6K 4BC2A 4AH9A 4BRPA 3KTQA 4DR1K 3DLBA 4KHWA 4M45A 1T8EA 4AHSA 3O9QA 4FO0A 2F4VK 3SPYA 3PX6A 3P5JA 4QS9A 2KHOA 2IS3A 4IFEA 4DUZK 3ASMA 4B3MK 4AM7A 3VN5A 5EOYA 3SCXA 4MLEA 2W6KA 5C15A 1IV0A 5AQRA 1XWLA 4FPBA 3NAEA 4LY7A 3HP9A 3NH1A 4JKAA 3AVFA 5KRSA 2RHKA 5KRTA 3OYAA 5BPLA 3MECA 4FK4A 2WBNA 2P9LB 3KWGA 1KVBA 3FZHA 2RE2A 3FE1A 1MWKA 4YORA 1CXUA 3VF4A 3U9DA 3HBTA 2HW3A 1X3NA 1ASUA 2QWLA 2E1ZA 2ZQBA 1QZ5A 3KKSA 3KD5E 1NK8A 1QHTA 3ZT0A 1RT4A 2BANA 1HQUA 3P31A 4NCAA 3SAHA 2AA4A 1BG3A 3CYMA 3AO5A 3OYGA 4W5TA 1S1XA 2F8SA 3O3GA 4DQPA 2HHUA 1VRTA 1RBUA 4BC5A 4CF2A 1GLAG 4CECA 5AQYA 2P9NB 1WSIA 2WC9A 5BREA 3L2QA 1JXBA 3QEWA 2GBZA 1EO1A 4B9UA 2YHAA 3O9UA 4CF0A 3NHGA 1VQ7N 1EWQA 2QTDA 2KFZA 1BU6O 4DF8A 4LF9K 5E84A 3FZMA 4DTMA 3K5MA 1K6YA 4PQUA 5EXWA 1NJZA 1XC3A 3O9TA 4FJ5A 1NGEA 4BQZA 4B3SK 1L3UA 2P9KB 3ZETB 3ZSWA 4BRGA 4HVJA 1HNWK 2O4IA 3OYLA 2Q2RA 3TSUA 1VSDA 3DMJA 4DV6K 3OYNA 1UA0A 3SV4A 1L3SA 3M6GA 4RW7A 3BP8A 1GOAA 4LF4K 3WXMB 4DV7K 4CBUA 4Z4GA 4DV0K 5AFUA 3L2UA 3LP2A 4LF8K 1XC9A 1YJ9N 3LL3A 4AF1A 3D6RA 5I42A 2HNYA 1NJIO 2OPSA 1IKWA 3SNNA 3MWPA 1RT1A 1NK9A 4CVNE 5KTQA 3OYKA 4C8MA 5CR4A 2ASMA 3QEXA 1NOZA 1WNSA 3VQ8A 4FWSA 1Q86O 2UYTA 4BE0A 2O8FB 1BGXT 1TV6A 2D0AA 2PZSA 4JI5K 5ELZA 3MXMA 3DLEA 2OANA 1JLQA 1E4GT 3AVJA 2XHBA 3KKRA 1TK0A 4BE1A 3HPHA 1ZXOA 1IBKK 2OA8A 3PIOL 1BQMA 1HLUA 3SUNA 4FLTA 1WAFA 4Z4HA 2A41A 3LDSA 4IDKA 2A40A 3L4IA 2KQ2A 1EKEA 3QLHA 4EFHA 4E1MA 3UIQA 4AHTA 1TYQB 2YV0X 5JLHA 2KLAA 1MU2A 4CJLA 2OTLN 3VQ9A 1LAWA 1NK0A 3KZBA 3IMXA 4FK2A 4J2DA 2O8BA 4XEIA 3MMVA 4ILHA 3M1FA 1VQMN 3LP3A 1ZBUA 2ZGYA 3TTFA 3CFOA 5EU7A 4WQ4C 3CI5A 5FPDA 2JGUA 2AP1A 3E9PA 3F2KA 4M3UA 3WNEA 5E41A 1JLBA 2J4RA 2HBMA 1J9AA 5AQQA 2A6AA 5AQKA 3AV9A 5A2QO 4DB3A 3IG1A 1WAJA 4HCCA 3NBPA 1QSYA 1XQSC 4CCHA 1W2BM 4OO1J 2HHSA 4KTWA 5I3UA 2IVPA 1X9WA 1CZAN 4KFBA 3M8RA 5F2RA 4ELUA 3MN5A 1B9FA 1YVNA 3KLGA 1T6DA 1EETA 2YJEA 4FJXA 4KTZA 3ATUA 5D3GA 2FBXA 3GG4A 1HKBA 3O4NA 4IWVA 2H3GX 2GUPA 3BEXA 1YT3A 3I0SA 4B9MA 4JI0K 4GMJB 4B3TK 2NLXA 2F9WA 4IG0A 4IOCL 1QQOA 1W7AA 4O55A 4NLBA 1YI2N 1TVRA 2A1SA 4L8RB 1S9EA 3V1QA 4Z4FA 2P5GA 1U4BA 4WFAL 4KHYA 3MK6A 5JVHL 3TI0A 3OS2A 3SLCA 4OKJA 1YAGA 3WEEA 5KPTA 1TL1A 4EIAA 2Q0UA 2KFNA 4OLAA 2BE2A 1TKXA 5KGXA 4QAGA 3ULEB 3ZT1A 4CJ4A 4U67L 3O9SA 2HHWA 4CJ7A 4CJFA 1EWRA 3CCUN 2O8DA 1S1VA 1QTMA 2PAVA 1UA1A 3DXMA 3AVIA 4KHUA 1E4FT 2G8UA 3RMDA 3U3GA 4DQ8A 5KQDA 3IRXA 4H0TB 2QW9A 4DU3A 4CJTA 4J2AA 1K73O 4W5RA 1T03A 1ASWA 3O8MA 3QNNA 4B9TA 4K8XA 5T7BA 5MLCQ 1TL3A 3U8XA 4I6MB 4PKGA 1IJJA 4HTUA 4JNEA 1FW6A 2YJFA 4OGCA 4C1NI 1Q81O 4JYAK 4JEPA 3S9HA 4A57A 5CZ1A 3D2EA 4BGAA 2IC3A 3ZT4A 5KPRA 3L4QA 1XMQK 4BREA 4EHUA 4CZGA 3CD6N 4KB0A 3ZT3A 3CF5L 4NCGA 3OW2M 3AY9A 4KH5A 4Y0WA 4JKBA 4EP5A 3J80O 4KHPK 1E3MA 4F2SA 4YOVA 4BR4A 3AA2A 2GEMA 3T1AA 4OGEA 3T7ZA 3AA5X 3R9PA 4CBXA 3HSTB 4BQLA 4BRDA 2Q1NA 4BRHA 3V6DA 3PUFA 3OYIA 3QB0A 3VGMA 1SL0A 1BI4A 3SMPA 2I7PA 4EAHD 3CPEA 3W3DA 1WUAA 1YITN 3HOTA 1IG9A 2YHWA 2O8CB 1X9JA 4N56A 1RILA 3EYZA 3PLAA 4XH5A 4EHTA 4NYFA 5BN9A 1GOCA 3CQYA 3RWUA 3DOLA 3D7EO 4WQ4A 1HX1A 3KD1E 4BR7A 4ICLA 4CGGA 3THYA 5GAGP 4H5TA 3CC4N 2ZWHA 2ZGZA 3ZLJA 5AZJA 1NGBA 2O4GA 1S1WA 3A5LC 2G8HA 4C1NK 3A5MC 4BR0A 2CGLA 4MQ3A 2OZSA 1OH6A 2HNDA 3HP6A 4DLGA 3VQ5A 3RRGA 1HYVA 3CCMN 4FWPA 3H08A 1S22A 4LFBK 2YHXA 2IDOA 3E1YA 4ZHRA 4JI4K 4V19S 2D0PA 3WQTA 5GIPA 1Z05A 3HL8A 1RT6A 5AQGA 2E2OA 3CCRN 3KLIA 3K5NA 4M63C 4JKGB 3SUQA 2P9PA 4PL7A 1QSSA 1GLFO 4OPKA 3SQ0A 4HTLA 3D2FB 5LMNK 2UXBK 2VWBA 1RTJA 2GWJA 1V4SA 1VQ4N 4K0KK 1X1PA 5AQNA 5EX5A 1Q9YA 3VQBA 4CEEA 4E7LA 2OPRA 3RSEB 1BCOA 4ILGB 1UOCA 1U04A 2E88A 3DLRA 4H8KA 1FK9A 3A0IX 4CF9A 4M3RA 3K0SA 3VENA 2BUPA 2VQFK 5CE3A 4CGJA 1TK8A 4E1JA 3ID8A 2Q97A 4RCHA 3K5LA 4E3SA 1VQON 3J7YP 3RR8A 3ZSRA 3CQ8A 5AQMA 5LJWA 1GLLO 5ADXH 4CIFA 2UUBK 5GIOA 4HCBA 4DSEA 1N5YA 4FLYA 3MXIA 4YDUA 4LF7K 3B8AX 1RDBA 3MN6A 3AVKA 3U4LA 3ZCMA 3CERA 3NF6A 3V9UA 3GL1A 2E6MA 3QINA 4FL9A 3KLHA 2D0BA 1FKPA 1D9DA 1Q8IA 5B8HA 4B8AB 5KI6A 3THWA 4B1UB 3LZJA 3FGUA 4KV8A 4DR7K 1K8KA 1NG9A 1N32K 3SQ1A 4F3TA 3QO9A 2HF3A 4KPYA 4FJ9A 2Q36A 4DG1A 1RTDA 4PUOA 3CETA 1ILYA 1BA1A 4A61A 4M3TA 4GV9A 3QBXA 4FK0A 3OJSA 1S9GA 5DMRA 1JLAA 4MDAA 3VQDA 2HHHK 1ZBFA 4DU1A 1U49A 3P83D 4WE1A 4DR2K 1NKBA 3C6HA 1YUWA 4YY3K 1JCFA 3SMSA 4N47A 3AO3A 3BF3A 3OS1A 2A3ZA 2CGKA 3V1RA 4CZHA 4K42A 2P9IB 5C2FA 2RPIA 4FCYA 1KLNA 1SUQA 3CM6A 3LALA 5KPZA 1QQNA 4QS7A 1DGKN 4H4MA 4A5AA 3MCPA 3V9SA 3MEEA 5BPNA 3RR7A 1T44A 4O0IA 4M3WA 4B9QA 4JV5K 3I0RA 3TU5A 3VQ7A 3LWMA 1NJXA 4E7IA 3ATVA 4FWQA 1MA9B 2YHYA 4FWKA 3KLEA 2IGIA 3L8BA 4DQQA 3KK1A 2DFEA 4KI4A 4BE2A 3EKUA 5C0YA 3ID6A 3MXJA 3J7ZO 4DV1K 3I55N 2XY8A 4H0VB 3CC2N 3HZ6A 4YOWA 4DWIA 4KREA 3L2WA 3VQCA 4CZJA 1JJ2M 3LP1A 4JKDA 4FWLA 3T1HK 4B9NA 4CHQA 1NBWA 2P9NA 2YKMA 5GADP 4B3OA 2PBDA 4M3XA 3B6PA 1QVGM 1KC8O 3DRRA 2I5JA 4BY9C 1YIJN 5LJVA 4UQGA 3E66A 1U6ZA 4ELVA 4F8RA 4B1ZA 3O3FA 1LV5A 3AVMA 3MWTA 3NE6A 4CFDA 1U47A 5KQ8A 1RDAA 1SAZA 4KKOA 2VGNA 3QEIA 3CJAA 2JLEA 2P9KA 3ZETA 3PV8A 5HLFA 4X66K 3L2VA 4FWMA 4QS8A 4IEEA 4YOTA 5M1FA 2NRRA 4B9LA 1VQ9N 1GLEG 3EN9A 4FLZA 2HHXA 1KD1O 2XY6A 2FSNA 1R59O 4CJWA 3DOKA 5AQPA 3R3LA 4I2PA 3QFPA 3G6EN 4DSKA 4FLXA 4YOYA 1Q9XA 1KFDA 3CMEN 4DR6K 4Y1DA 3GBTA 1VQ6N 2VCPA 4BR5A 4A2AA 4WCEL 1RBSA 4FJJA 4FJ8A 2V7YA 2Q0RA 1C1AA 4DV2K 3EE9A 2X74A 4OPAA 4KTQA 3V9WA 3LAKA 2FSKA 4GKJK 1UAXA 2O8FA 3SK3A 3CJ7A 4DMNA 3HVRA 4R79A 3AO2A 3HJFA 1ITGA 1J5OA 2F96A 4KBOA 2FF6A 5IWAK 3F5TA 2RKIA 3CG7A 1KCFA 3HK2A 4FLVA 3S3NA 3OYBA 5EY4A 1C0GA 3K59A 2FLOA 2QKBA 4B1XB 3BGRA 2GTDA 3IUCA 2E2NA 3LPTA 5J2PA 3FZFA 1B9DA 2Q31A 2UXDK 2F7TA 4CZKA 1ATNA 1VSLA 1J5EK 4KB1A 1TYQA 4H0XB 2R7YA 2HVIA 1XI1A 2UU9K 3ZSZA 3SJJA 1QZ6A 4CFCA 3HPOA 3JXUA 3QEVA 1QSLA 3I56N 1XHZA 4ID5A 4MO5A 4JK8A 1N6QA 1RBTA 2YCHA 3ZSQA 3NDKA 3NFAA 4BC4A 4CEFA 2LSNA 1WN7A 4H4OA 1S3XA 3RTVA 4DCHA 4CFAA 2FBYA 2XRIA 4FW1A 2YNIA 4DLEA 2E20A 1HMVA 4GV6A 3AAPA 4AQYK 1LWFA 1T6CA 3M8SA 1DT9A 2ASPA 4DTSA 1BIZA 3J7AP 3ZT2A 3K5OA 2GWKA 4W5OA 3QERA 1C0MA 3LWLA 1QQCA 1VSEA 3BUZB 5FPEA 5I9EB 4XH4A 3VEYA 4AM6A 2B4JA 2W40A 5JICA 3AGKA 2ZJQL 4FJHA 4CZLA 5AQSA 5FRMA 1D8YA 4BVPA 3SI6A 3UKUB 1KAXA 1KVAA 1IG8A 5JS2A 4CGHA 3NGIA 2D0OA 1HRHA 1G99A 2QXFA 4Z4IA 4CEOA 3VQ4A 4FLUA 2QI2A 4CI6A 3TWHA 5CYMA 4DV4K 4RW6A 1SKSA 1BUPA 2P9UB 1DEJA 3TPQA 5HP1A 1ZBLA 4IDHA 3EY1A 4OLBA 4K8ZA 4CGDA 2FBVA 4JHDB 3SUPA 3NGYA 3WQUA 1W0HA 3VQEA 1N36K 4N41A 4CJQA 1GOBA 1VQPN 4F4KA 3N4PA 4O5FA 3ULEA 3QIPA 1O1WA 1SL1A 2G8VA 3GOIA 4NB4A 3OHRA 1OH8A 4LH4A 4F3OA 3TARA 3AVAA 2HSTA 2UUAK 4LC9B 5HROA 2OPQA 1HNZK 4J8FA 4BRIA 4PA1A 3OYHA 2G8IA 4GW6A 1WOQA 3C0BA 4FVMA 2PY5A 4DFMA 3FLCO 2ATQA 3A5NC 3TAEA 4FWRA 1L5UA 4CIEA 1J54A 2HOEA 1SV5A 2X78A 4I6MA 3DXKB 3HTVA 3CCJN
chains in the Genus database with same CATH topology
1I3AA 1IKVA 4DFJA 4DS4A 1D5AA 4CJKA 4CEAA 2VG5A 2HB5A 2O4GA 2Z1JA 3DM2A 4E0DA 2DTUA 1HYSA 1S1WA 3QEPA 2G8HA 1F21A 1RDDA 1B92A 4KRFA 1RBRA 5DK5A 4MQ3A 4OVLA 4DFPA 4CEDA 2OZSA 2HNDA 4LSNA 3NF9A 3MEDA 2G8WA 3T19A 3D45A 3HP6A 4DLGA 3VQ5A 3RRGA 2B5JA 1EX4A 1HYVA 3OYMA 1VSIA 3H08A 1IKXA 3U6FA 3LAMA 4DTUA 2IDOA 4ZHRA 3OJUA 2HHTA 1NKEA 2YKNA 4AHUA 1JLCA 5FDLA 1NOYA 3HL8A 1RT6A 3QETA 4FM2A 4QOZB 3KLIA 3K5NA 1LAVA 1YTAA 1RT7A 4Q5VA 1VSHA 1WLJA 3SUQA 1WSJA 2Z1GA 1NK4A 4DSJA 3SQ2A 1CLQA 3AO4A 4DTPA 5HRNA 4Z4CA 4PWDA 1QSSA 4W5QA 1TKZA 4OPKA 4RW8A 3SQ0A 4JRPA 4ZTFA 3PY8A 1SKWA 3KLFA 4E1NA 4M3ZA 2F8TA 1KLMA 2XO7A 4DSLA 4B08A 2BDPA 4Y1CA 4BACA 2VWKA 4FJLA 4FJMA 4B8CA 1RTJA 3TAMA 5HRPA 3U3YA 3TAQA 3KK3A 3WNGA 2P5OA 1CZBA 1X1PA 3KJVA 1Q9YA 2PYJA 4NCBA 3VQBA 4CEEA 5CYQA 4E7LA 2OPRA 4LH5A 1BCOA 1HNIA 4DTNA 3VQPA 3OVNA 4RG8A 1UOCA 1U04A 4AH9A 4CIGA 3DLRA 4H8KA 4O5BA 4E7HA 3DLBA 3KTQA 4KHWA 4M45A 3CFPA 3AVCA 1T8EA 4KAZA 1FK9A 4KHQA 4BDZA 4CF9A 3F9KA 4FJGA 1JL1A 4AHSA 1KVCA 3VQQA 1RNHA 4M3RA 3SPYA 3PX6A 2EHGA 3P5JA 3NH2A 2D0CA 4KI6A 4M42A 2IS3A 5J1EA 4O4GA 1WSGA 3ASMA 3O4QA 2IAJA 4HHTA 3VN5A 4CGJA 5SWMA 4I9LA 1TK8A 2HHVA 2XY5A 3SCXA 3K5LA 4E3SA 3RR8A 1S6PA 1XWLA 3ZSRA 3NAEA 4LY7A 3CQ8A 4EZ6A 1BISA 3HP9A 1J53A 3NH1A 3AVBA 3CFRA 3TABA 3AVFA 5KRSA 1NKCA 4EZ9A 1KTQA 5KRTA 3TAFA 3OYAA 4CEBA 4DQSA 1BHLA 3ALYA 3MECA 4CIFA 1HJRA 1R0AA 4FK4A 2P1JA 2VG6A 1S5JA 4HCBA 1I39A 2ZE2A 4DSEA 3RMCA 1N5YA 1KVBA 1T05A 2Z1HA 4FLYA 3MXIA 3WNFA 1ASVA 1RTHA 1CXUA 1RDBA 4IG3A 1L3VA 1C6VA 2HW3A 1C0UA 4BDYA 1ASUA 3C95A 3PO5A 3AVKA 3ZCMA 3V9ZA 2ZQBA 3NF8A 4E7JA 5C24A 1L3TA 3NF6A 4AILC 3KKSA 3KD5E 3V9UA 2E6MA 3QINA 1NK8A 3KK2A 3KLHA 1QHTA 3ZT0A 2D0BA 1RT4A 4FZZA 2RN2A 1FKPA 2BANA 2X6NA 1D9DA 1Q8IA 3OYEA 4B8AB 3OY9A 5KI6A 3LZJA 1HQUA 4KV8A 1SL2A 4J2EA 2X6SA 4FYDA 4CK2A 4NCAA 3C94A 3SQ1A 4F3TA 4O44A 3LPUA 4CEZA 4CF8A 4IKFA 3QO9A 4GVMA 3CYMA 4TSXA 3AO5A 3OYGA 4W5TA 1NK7A 1W9HA 4KPYA 4FJ9A 1S1XA 1ZBIA 2F8SA 4DG1A 4OKKA 3O3GA 4JS5A 4DTOA 1RTDA 4DQPA 4PUOA 5K14A 1VRTA 3L3VA 1RBUA 1A5VA 4CF2A 1A5XA 4M3TA 4CECA 4E89A 3NF7A 1TK5A 1WSIA 3MEGA 4I2QA 3DYAA 4FK0A 1IH7A 4KHSA 1BQNA 1S9GA 3OJSA 2WOMA 1CZ9A 3L2QA 1JXBA 5DMRA 2GBZA 1JLAA 3QEWA 3P1GA 4DS5A 4FM0A 3VQDA 4B9UA 2GUIA 1FXXA 2YHAA 4CF0A 3S3OA 1ZBFA 3NHGA 4NYNA 4DU1A 1U49A 3P83D 4WE1A 4N5SA 1NKBA 2KFZA 4DF8A 3DLHA 1RT5A 4CK3A 4N47A 1SKRA 1UWBA 2Q3SA 4DTMA 3AO3A 3OS1A 3K5MA 1K6YA 4IFVA 4PQUA 3ISNC 3V1RA 4B9SA 1NJZA 1VSMA 4FJ5A 2RPIA 4FCYA 1KLNA 1L3UA 1SUQA 3CM6A 3IS9A 3LALA 3ZSWA 1NK6A 2ETJA 1RBVA 3K2PA 4H4MA 3O3HA 3QIOA 3V9SA 3MEEA 4HVJA 3B6OA 3RR7A 2O4IA 3OYLA 1NJYA 1REVA 4O0IA 1VSDA 3DMJA 4M3WA 3G10A 3OYNA 1UA0A 3SV4A 1L3SA 3I0RA 1BL3A 3FFIA 4RW7A 3V81A 3VQ7A 3LWMA 1NJXA 4E7IA 1GOAA 4RW9A 4CE9A 3S3MA 3TANA 3AVHA 4Z4GA 1LW2A 3KLEA 3I8DA 4DQIA 2Y1IA 4N76A 3L2UA 3LP2A 1XC9A 2IGIA 3L8BA 2AJQA 3JYTA 3E01A 4DQQA 5I42A 3KK1A 2HNYA 2DFEA 4XIUA 4KI4A 4FZYA 4BE2A 1ZYQA 2OPSA 1IKWA 4Z0UA 3AVLA 3SNNA 1RT1A 3MXJA 1NK9A 4B9VA 1QE1A 5CZ2A 5KTQA 2XY8A 3OYKA 4DWIA 4C8MA 4KREA 3L2WA 2G8FA 1LW0A 3VQCA 1VRUA 3V4IA 1JLGA 1QS4A 3LP1A 3QEXA 2KZZA 2WONA 1NOZA 1WNSA 4C8NA 1HNVA 3VQ8A 3RRHA 3OYCA 4B9NA 4CHQA 4BE0A 3PX4A 1BGXT 1WSEA 1TV6A 2YKMA 3NCIA 2D0AA 2KW4A 3ZSYA 2PZSA 4B3OA 1VSJA 4M3XA 2B6AA 3B6PA 3MXMA 3DLEA 3DRRA 1EP4A 1JLQA 2I5JA 3AVJA 2XHBA 3KKRA 1TK0A 4BE1A 1TKDA 2QK9A 4CJSA 3HPHA 3HPGA 4UQGA 4ELVA 4F8RA 1EXQA 2RF2A 3O3FA 1LV5A 3AVMA 4RW4A 2OA8A 1BIUA 1BQMA 3NE6A 3SUNA 4CFDA 4FLTA 1U47A 5JS1A 1RDAA 1WAFA 4Z4HA 4FLWA 4KKOA 3LDSA 4IDKA 3QEIA 2JLEA 1RTIA 1IKYA 3SUOA 2KQ2A 1EKEA 3PV8A 3QLHA 4E1MA 5HLFA 3UIQA 2EX3A 4AHTA 4MFBA 3L2VA 2VWJA 4M41A 2YV0X 3ZSOA 1LWCA 1MU2A 4CJLA 2E4LA 3VQ9A 4E7KA 1HPZA 1LAWA 4R5PA 4B9LA 4BWMA 1NK0A 4I9QA 4DQRA 4FLZA 2HHXA 4FK2A 1ZBHA 4I7FA 4J2DA 2XY6A 4CJWA 1IO2A 3DOKA 4CGIA 2QKKA 3LP3A 1S6QA 4I2PA 1ZBUA 4DSKA 4FLXA 3CFOA 4CJRA 1VK0A 5EU7A 4QCLA 4E19A 2YNFA 3AO1A 1VSFA 1JLFA 1KFDA 2VG7A 5C42A 1Q9XA 2G8KA 4DU4A 2JGUA 3SYZA 1Z26A 4Y1DA 4AHCA 3VA3A 4M3UA 3HO1A 3WNEA 5E41A 1JLBA 1J9AA 4OPJA 4HUEA 4YFUA 3AV9A 1A5WA 2YHBA 1RBSA 3IG1A 4BDPA 4FJJA 1WAJA 4FJ8A 1C1AA 4HCCA 4ELTA 3NBPA 1QSYA 2X74A 1HYZA 4CCHA 3BDPA 4KTQA 2GV9A 4CK1A 3V9WA 3TAGA 2HHSA 1HQEA 4KTWA 5I3UA 1X9WA 3LAKA 3IAYA 4KFBA 1UAXA 3M8RA 1KRPA 4M3YA 3M8QA 4DMNA 1DTQA 3HVRA 4ELUA 3VQ6A 3AO2A 3HYFA 2ITGA 3OS0A 3HJFA 1B9FA 1ITGA 5HRSA 4HUGA 3KLGA 3THVA 1J5OA 2F96A 1JKHA 3V1OA 4JS4A 1TAUA 3AA3A 3HM9A 4FJIA 2RKIA 2IOCA 3CG7A 1KCFA 3HK2A 4LSLA 3EZ5A 4FLVA 1EETA 3KIOA 4CJEA 3LZIA 3S3NA 5FRNA 4OKEA 3TR8A 1X9MA 3OYBA 4KTZA 4FJXA 2HNZA 1X9SA 5D3GA 1C1CA 3K59A 4CJ3A 2QKBA 2FBXA 3BGRA 1RCHA 1VSKA 3VQAA 3O4NA 4G1QA 4ZTJA 2BGGA 4CHPA 4DSIA 3JSMA 1C0TA 3LPTA 4BWJA 4CHNA 5J2PA 4HUFA 3QNOA 1YT3A 1B9DA 3I0SA 3AVGA 4GMJB 4KO0A 4B9MA 3ZSVA 1VSLA 4DSFA 4IG0A 4LD0A 4KB1A 3SZ2A 3C6TA 2R7YA 2HVIA 4O55A 1Y97A 1XI1A 1TVRA 2A1SA 4L8RB 1LWEA 4C8KA 1S9EA 4FM1A 3ZSZA 1KSPA 3SJJA 1TGOA 3V1QA 4CFCA 4FJNA 2HHQA 2DY4A 3HPOA 4Z4FA 3L2RA 3SQ4A 2P5GA 1U4BA 4YNQA 1YTUA 3QEVA 1QSLA 2ZD1A 4KHYA 3TI0A 1XHZA 3OS2A 4CF1A 4CJ5A 4OKJA 5HBMA 3K58A 1D9FA 3G0ZA 3HVTA 4ID5A 5SZTA 3AVNA 1N6QA 2E6LA 1RBTA 1TL1A 3ZSQA 3NDKA 3NFAA 3RMAA 3TAPA 4CEFA 2LSNA 4CEQA 1WN7A 4H4OA 4AHRA 2KFNA 4OLAA 3ZSXA 3RTVA 4CFAA 2BE2A 2FBYA 2XRIA 4JRQA 4FW1A 3K57A 1TKXA 2YNIA 1FKOA 1S1UA 4QAGA 3ZT1A 4CJ4A 5KGXA 4DLEA 4FJ7A 1HMVA 2HHWA 1NK5A 4CJFA 1JLEA 2D5RA 1LWFA 4CFBA 1BI4B 1Z25A 2OZMA 4DTRA 3M8SA 1S1VA 2KZMA 4DTSA 1QTMA 1UA1A 1JXEA 2XY7A 1BIZA 5CY4A 3AVIA 3ZT2A 4CESA 3K5OA 3PX0A 1T7PA 4KHUA 4W5OA 3QERA 1C0MA 4OJRA 2G8UA 3LWLA 4FJKA 4Q0BA 3DLGA 1QQCA 1VSEA 3U3GA 5J2MA 3RMDA 4JLHA 4C8OA 3IRXA 1DTTA 3DI6A 2HHUA 4DU3A 4CJTA 3OYFA 2OYQA 4J2AA 3AA4A 4W5RA 1T03A 1ASWA 3QNNA 5HRRA 4B9TA 4K8XA 2B4JA 5T7BA 4HTUA 1TL3A 4CHYA 3OYJA 4DTXA 4DFKA 4OGCA 4FJHA 2KTQA 5FRMA 4O0JA 3S9HA 1D8YA 5CZ1A 1DLOA 1TKTA 3SI6A 5KGWA 3PO4A 2IC3A 3ZT4A 3LANA 2Y1JA 1CXQA 4FXDA 1KVAA 4DF4A 2HMIA 2DFHA 5JS2A 4CGHA 3NGIA 3D0PA 1BCMA 1HRHA 1YVUA 4ID1A 3ULDA 2QXFA 4CERA 3QESA 4CEOA 3VQ4A 4Z4IA 4FLUA 1RT2A 3DRSA 3L3UA 2NUBA 3TWHA 4KB0A 1WSHA 5CYMA 3ZT3A 4CHOA 4CJUA 1U48A 4RW6A 4EP4A 1SKSA 4NCGA 2DFFA 2YNHA 4CJPA 4EP5A 5HP1A 1ZBLA 2P51A 3M8PA 4CGFA 3EY1A 4OLBA 4AHVA 1JL2A 1RT3A 2OPPA 4K8ZA 4CGDA 2FBVA 4F2SA 3LP0A 3AA2A 1NJWA 3T1AA 3DRPA 1XHXA 1C1BA 4IBNA 4OGEA 5FROA 2PYLA 3SUPA 3NGYA 1W0HA 3AA5X 3OYDA 2Z1IA 3C6UA 3SV3A 3VA0A 3VQEA 3HSTB 2FC0A 3RMBA 4N41A 2FBTA 2HVHA 4CJQA 5J2QA 1GOBA 3V6DA 1G15A 5C25A 3CM5A 4F4KA 3PUFA 4PY5A 3OYIA 3QIPA 4Z4EA 1O1WA 4FW2A 3A2FA 2A1RA 1SL1A 2G8VA 4F2RA 5J2NA 4J2BA 1SL0A 1BI4A 4CJVA 4FZXC 2YNGA 4LH4A 4F3OA 3TARA 1RDCA 4C8LA 3AVAA 3T3FA 3NGZA 1IG9A 4DTJA 5HROA 2OPQA 3NH0A 1WSFA 3HXMA 4PA1A 3OYHA 3V9XA 4N56A 1RILA 2W42A 3EYZA 2G8IA 4GW6A 3WNHA 4FVMA 4KHNA 2PY5A 3DLKA 4DFMA 1KFSA 4NYFA 1U45A 4CHZA 3MAQA 2ATQA 1L5UA 1GOCA 3TAEA 3RWUA 4CIEA 1TAQA 3DOLA 1J54A 4W5NA 4IFYA 1SV5A 2X78A 3ITHA 3KD1E 3HT3A 4ICLA 1S1TA 3SPZA 4CGGA 3F73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3A A;  1IKV A;  4DFJ A;  4DS4 A;  1D5A A;  4CJK A;  4CEA A;  2VG5 A;  2HB5 A;  2O4G A;  2Z1J A;  3DM2 A;  4E0D A;  2DTU A;  1HYS A;  1S1W A;  3QEP A;  2G8H A;  1F21 A;  1RDD A;  1B92 A;  4KRF A;  1RBR A;  5DK5 A;  4MQ3 A;  4OVL A;  4DFP A;  4CED A;  2OZS A;  2HND A;  4LSN A;  3NF9 A;  3MED A;  2G8W A;  3T19 A;  3D45 A;  3HP6 A;  4DLG A;  3VQ5 A;  3RRG A;  2B5J A;  1EX4 A;  1HYV A;  3OYM A;  1VSI A;  3H08 A;  1IKX A;  3U6F A;  3LAM A;  4DTU A;  2IDO A;  4ZHR A;  3OJU A;  2HHT A;  1NKE A;  2YKN A;  4AHU A;  1JLC A;  5FDL A;  1NOY A;  3HL8 A;  1RT6 A;  3QET A;  4FM2 A;  4QOZ B;  3KLI A;  3K5N A;  1LAV A;  1YTA A;  1RT7 A;  4Q5V A;  1VSH A;  1WLJ A;  3SUQ A;  1WSJ A;  2Z1G A;  1NK4 A;  4DSJ A;  3SQ2 A;  1CLQ A;  3AO4 A;  4DTP A;  5HRN A;  4Z4C A;  4PWD A;  1QSS A;  4W5Q A;  1TKZ A;  4OPK A;  4RW8 A;  3SQ0 A;  4JRP A;  4ZTF A;  3PY8 A;  1SKW A;  3KLF A;  4E1N A;  4M3Z A;  2F8T A;  1KLM A;  2XO7 A;  4DSL A;  4B08 A;  2BDP A;  4Y1C A;  4BAC A;  2VWK A;  4FJL A;  4FJM A;  4B8C A;  1RTJ A;  3TAM A;  5HRP A;  3U3Y A;  3TAQ A;  3KK3 A;  3WNG A;  2P5O A;  1CZB A;  1X1P A;  3KJV A;  1Q9Y A;  2PYJ A;  4NCB A;  3VQB A;  4CEE A;  5CYQ A;  4E7L A;  2OPR A;  4LH5 A;  1BCO A;  1HNI A;  4DTN A;  3VQP A;  3OVN A;  4RG8 A;  1UOC A;  1U04 A;  4AH9 A;  4CIG A;  3DLR A;  4H8K A;  4O5B A;  4E7H A;  3DLB A;  3KTQ A;  4KHW A;  4M45 A;  3CFP A;  3AVC A;  1T8E A;  4KAZ A;  1FK9 A;  4KHQ A;  4BDZ A;  4CF9 A;  3F9K A;  4FJG A;  1JL1 A;  4AHS A;  1KVC A;  3VQQ A;  1RNH A;  4M3R A;  3SPY A;  3PX6 A;  2EHG A;  3P5J A;  3NH2 A;  2D0C A;  4KI6 A;  4M42 A;  2IS3 A;  5J1E A;  4O4G A;  1WSG A;  3ASM A;  3O4Q A;  2IAJ A;  4HHT A;  3VN5 A;  4CGJ A;  5SWM A;  4I9L A;  1TK8 A;  2HHV A;  2XY5 A;  3SCX A;  3K5L A;  4E3S A;  3RR8 A;  1S6P A;  1XWL A;  3ZSR A;  3NAE A;  4LY7 A;  3CQ8 A;  4EZ6 A;  1BIS A;  3HP9 A;  1J53 A;  3NH1 A;  3AVB A;  3CFR A;  3TAB A;  3AVF A;  5KRS A;  1NKC A;  4EZ9 A;  1KTQ A;  5KRT A;  3TAF A;  3OYA A;  4CEB A;  4DQS A;  1BHL A;  3ALY A;  3MEC A;  4CIF A;  1HJR A;  1R0A A;  4FK4 A;  2P1J A;  2VG6 A;  1S5J A;  4HCB A;  1I39 A;  2ZE2 A;  4DSE A;  3RMC A;  1N5Y A;  1KVB A;  1T05 A;  2Z1H A;  4FLY A;  3MXI A;  3WNF A;  1ASV A;  1RTH A;  1CXU A;  1RDB A;  4IG3 A;  1L3V A;  1C6V A;  2HW3 A;  1C0U A;  4BDY A;  1ASU A;  3C95 A;  3PO5 A;  3AVK A;  3ZCM A;  3V9Z A;  2ZQB A;  3NF8 A;  4E7J A;  5C24 A;  1L3T A;  3NF6 A;  4AIL C;  3KKS A;  3KD5 E;  3V9U A;  2E6M A;  3QIN A;  1NK8 A;  3KK2 A;  3KLH A;  1QHT A;  3ZT0 A;  2D0B A;  1RT4 A;  4FZZ A;  2RN2 A;  1FKP A;  2BAN A;  2X6N A;  1D9D A;  1Q8I A;  3OYE A;  4B8A B;  3OY9 A;  5KI6 A;  3LZJ A;  1HQU A;  4KV8 A;  1SL2 A;  4J2E A;  2X6S A;  4FYD A;  4CK2 A;  4NCA A;  3C94 A;  3SQ1 A;  4F3T A;  4O44 A;  3LPU A;  4CEZ A;  4CF8 A;  4IKF A;  3QO9 A;  4GVM A;  3CYM A;  4TSX A;  3AO5 A;  3OYG A;  4W5T A;  1NK7 A;  1W9H A;  4KPY A;  4FJ9 A;  1S1X A;  1ZBI A;  2F8S A;  4DG1 A;  4OKK A;  3O3G A;  4JS5 A;  4DTO A;  1RTD A;  4DQP A;  4PUO A;  5K14 A;  1VRT A;  3L3V A;  1RBU A;  1A5V A;  4CF2 A;  1A5X A;  4M3T A;  4CEC A;  4E89 A;  3NF7 A;  1TK5 A;  1WSI A;  3MEG A;  4I2Q A;  3DYA A;  4FK0 A;  1IH7 A;  4KHS A;  1BQN A;  1S9G A;  3OJS A;  2WOM A;  1CZ9 A;  3L2Q A;  1JXB A;  5DMR A;  2GBZ A;  1JLA A;  3QEW A;  3P1G A;  4DS5 A;  4FM0 A;  3VQD A;  4B9U A;  2GUI A;  1FXX A;  2YHA A;  4CF0 A;  3S3O A;  1ZBF A;  3NHG A;  4NYN A;  4DU1 A;  1U49 A;  3P83 D;  4WE1 A;  4N5S A;  1NKB A;  2KFZ A;  4DF8 A;  3DLH A;  1RT5 A;  4CK3 A;  4N47 A;  1SKR A;  1UWB A;  2Q3S A;  4DTM A;  3AO3 A;  3OS1 A;  3K5M A;  1K6Y A;  4IFV A;  4PQU A;  3ISN C;  3V1R A;  4B9S A;  1NJZ A;  1VSM A;  4FJ5 A;  2RPI A;  4FCY A;  1KLN A;  1L3U A;  1SUQ A;  3CM6 A;  3IS9 A;  3LAL A;  3ZSW A;  1NK6 A;  2ETJ A;  1RBV A;  3K2P A;  4H4M A;  3O3H A;  3QIO A;  3V9S A;  3MEE A;  4HVJ A;  3B6O A;  3RR7 A;  2O4I A;  3OYL A;  1NJY A;  1REV A;  4O0I A;  1VSD A;  3DMJ A;  4M3W A;  3G10 A;  3OYN A;  1UA0 A;  3SV4 A;  1L3S A;  3I0R A;  1BL3 A;  3FFI A;  4RW7 A;  3V81 A;  3VQ7 A;  3LWM A;  1NJX A;  4E7I A;  1GOA A;  4RW9 A;  4CE9 A;  3S3M A;  3TAN A;  3AVH A;  4Z4G A;  1LW2 A;  3KLE A;  3I8D A;  4DQI A;  2Y1I A;  4N76 A;  3L2U A;  3LP2 A;  1XC9 A;  2IGI A;  3L8B A;  2AJQ A;  3JYT A;  3E01 A;  4DQQ A;  5I42 A;  3KK1 A;  2HNY A;  2DFE A;  4XIU A;  4KI4 A;  4FZY A;  4BE2 A;  1ZYQ A;  2OPS A;  1IKW A;  4Z0U A;  3AVL A;  3SNN A;  1RT1 A;  3MXJ A;  1NK9 A;  4B9V A;  1QE1 A;  5CZ2 A;  5KTQ A;  2XY8 A;  3OYK A;  4DWI A;  4C8M A;  4KRE A;  3L2W A;  2G8F A;  1LW0 A;  3VQC A;  1VRU A;  3V4I A;  1JLG A;  1QS4 A;  3LP1 A;  3QEX A;  2KZZ A;  2WON A;  1NOZ A;  1WNS A;  4C8N A;  1HNV A;  3VQ8 A;  3RRH A;  3OYC A;  4B9N A;  4CHQ A;  4BE0 A;  3PX4 A;  1BGX T;  1WSE A;  1TV6 A;  2YKM A;  3NCI A;  2D0A A;  2KW4 A;  3ZSY A;  2PZS A;  4B3O A;  1VSJ A;  4M3X A;  2B6A A;  3B6P A;  3MXM A;  3DLE A;  3DRR A;  1EP4 A;  1JLQ A;  2I5J A;  3AVJ A;  2XHB A;  3KKR A;  1TK0 A;  4BE1 A;  1TKD A;  2QK9 A;  4CJS A;  3HPH A;  3HPG A;  4UQG A;  4ELV A;  4F8R A;  1EXQ A;  2RF2 A;  3O3F A;  1LV5 A;  3AVM A;  4RW4 A;  2OA8 A;  1BIU A;  1BQM A;  3NE6 A;  3SUN A;  4CFD A;  4FLT A;  1U47 A;  5JS1 A;  1RDA A;  1WAF A;  4Z4H A;  4FLW A;  4KKO A;  3LDS A;  4IDK A;  3QEI A;  2JLE A;  1RTI A;  1IKY A;  3SUO A;  2KQ2 A;  1EKE A;  3PV8 A;  3QLH A;  4E1M A;  5HLF A;  3UIQ A;  2EX3 A;  4AHT A;  4MFB A;  3L2V A;  2VWJ A;  4M41 A;  2YV0 X;  3ZSO A;  1LWC A;  1MU2 A;  4CJL A;  2E4L A;  3VQ9 A;  4E7K A;  1HPZ A;  1LAW A;  4R5P A;  4B9L A;  4BWM A;  1NK0 A;  4I9Q A;  4DQR A;  4FLZ A;  2HHX A;  4FK2 A;  1ZBH A;  4I7F A;  4J2D A;  2XY6 A;  4CJW A;  1IO2 A;  3DOK A;  4CGI A;  2QKK A;  3LP3 A;  1S6Q A;  4I2P A;  1ZBU A;  4DSK A;  4FLX A;  3CFO A;  4CJR A;  1VK0 A;  5EU7 A;  4QCL A;  4E19 A;  2YNF A;  3AO1 A;  1VSF A;  1JLF A;  1KFD A;  2VG7 A;  5C42 A;  1Q9X A;  2G8K A;  4DU4 A;  2JGU A;  3SYZ A;  1Z26 A;  4Y1D A;  4AHC A;  3VA3 A;  4M3U A;  3HO1 A;  3WNE A;  5E41 A;  1JLB A;  1J9A A;  4OPJ A;  4HUE A;  4YFU A;  3AV9 A;  1A5W A;  2YHB A;  1RBS A;  3IG1 A;  4BDP A;  4FJJ A;  1WAJ A;  4FJ8 A;  1C1A A;  4HCC A;  4ELT A;  3NBP A;  1QSY A;  2X74 A;  1HYZ A;  4CCH A;  3BDP A;  4KTQ A;  2GV9 A;  4CK1 A;  3V9W A;  3TAG A;  2HHS A;  1HQE A;  4KTW A;  5I3U A;  1X9W A;  3LAK A;  3IAY A;  4KFB A;  1UAX A;  3M8R A;  1KRP A;  4M3Y A;  3M8Q A;  4DMN A;  1DTQ A;  3HVR A;  4ELU A;  3VQ6 A;  3AO2 A;  3HYF A;  2ITG A;  3OS0 A;  3HJF A;  1B9F A;  1ITG A;  5HRS A;  4HUG A;  3KLG A;  3THV A;  1J5O A;  2F96 A;  1JKH A;  3V1O A;  4JS4 A;  1TAU A;  3AA3 A;  3HM9 A;  4FJI A;  2RKI A;  2IOC A;  3CG7 A;  1KCF A;  3HK2 A;  4LSL A;  3EZ5 A;  4FLV A;  1EET A;  3KIO A;  4CJE A;  3LZI A;  3S3N A;  5FRN A;  4OKE A;  3TR8 A;  1X9M A;  3OYB A;  4KTZ A;  4FJX A;  2HNZ A;  1X9S A;  5D3G A;  1C1C A;  3K59 A;  4CJ3 A;  2QKB A;  2FBX A;  3BGR A;  1RCH A;  1VSK A;  3VQA A;  3O4N A;  4G1Q A;  4ZTJ A;  2BGG A;  4CHP A;  4DSI A;  3JSM A;  1C0T A;  3LPT A;  4BWJ A;  4CHN A;  5J2P A;  4HUF A;  3QNO A;  1YT3 A;  1B9D A;  3I0S A;  3AVG A;  4GMJ B;  4KO0 A;  4B9M A;  3ZSV A;  1VSL A;  4DSF A;  4IG0 A;  4LD0 A;  4KB1 A;  3SZ2 A;  3C6T A;  2R7Y A;  2HVI A;  4O55 A;  1Y97 A;  1XI1 A;  1TVR A;  2A1S A;  4L8R B;  1LWE A;  4C8K A;  1S9E A;  4FM1 A;  3ZSZ A;  1KSP A;  3SJJ A;  1TGO A;  3V1Q A;  4CFC A;  4FJN A;  2HHQ A;  2DY4 A;  3HPO A;  4Z4F A;  3L2R A;  3SQ4 A;  2P5G A;  1U4B A;  4YNQ A;  1YTU A;  3QEV A;  1QSL A;  2ZD1 A;  4KHY A;  3TI0 A;  1XHZ A;  3OS2 A;  4CF1 A;  4CJ5 A;  4OKJ A;  5HBM A;  3K58 A;  1D9F A;  3G0Z A;  3HVT A;  4ID5 A;  5SZT A;  3AVN A;  1N6Q A;  2E6L A;  1RBT A;  1TL1 A;  3ZSQ A;  3NDK A;  3NFA A;  3RMA A;  3TAP A;  4CEF A;  2LSN A;  4CEQ A;  1WN7 A;  4H4O A;  4AHR A;  2KFN A;  4OLA A;  3ZSX A;  3RTV A;  4CFA A;  2BE2 A;  2FBY A;  2XRI A;  4JRQ A;  4FW1 A;  3K57 A;  1TKX A;  2YNI A;  1FKO A;  1S1U A;  4QAG A;  3ZT1 A;  4CJ4 A;  5KGX A;  4DLE A;  4FJ7 A;  1HMV A;  2HHW A;  1NK5 A;  4CJF A;  1JLE A;  2D5R A;  1LWF A;  4CFB A;  1BI4 B;  1Z25 A;  2OZM A;  4DTR A;  3M8S A;  1S1V A;  2KZM A;  4DTS A;  1QTM A;  1UA1 A;  1JXE A;  2XY7 A;  1BIZ A;  5CY4 A;  3AVI A;  3ZT2 A;  4CES A;  3K5O A;  3PX0 A;  1T7P A;  4KHU A;  4W5O A;  3QER A;  1C0M A;  4OJR A;  2G8U A;  3LWL A;  4FJK A;  4Q0B A;  3DLG A;  1QQC A;  1VSE A;  3U3G A;  5J2M A;  3RMD A;  4JLH A;  4C8O A;  3IRX A;  1DTT A;  3DI6 A;  2HHU A;  4DU3 A;  4CJT A;  3OYF A;  2OYQ A;  4J2A A;  3AA4 A;  4W5R A;  1T03 A;  1ASW A;  3QNN A;  5HRR A;  4B9T A;  4K8X A;  2B4J A;  5T7B A;  4HTU A;  1TL3 A;  4CHY A;  3OYJ A;  4DTX A;  4DFK A;  4OGC A;  4FJH A;  2KTQ A;  5FRM A;  4O0J A;  3S9H A;  1D8Y A;  5CZ1 A;  1DLO A;  1TKT A;  3SI6 A;  5KGW A;  3PO4 A;  2IC3 A;  3ZT4 A;  3LAN A;  2Y1J A;  1CXQ A;  4FXD A;  1KVA A;  4DF4 A;  2HMI A;  2DFH A;  5JS2 A;  4CGH A;  3NGI A;  3D0P A;  1BCM A;  1HRH A;  1YVU A;  4ID1 A;  3ULD A;  2QXF A;  4CER A;  3QES A;  4CEO A;  3VQ4 A;  4Z4I A;  4FLU A;  1RT2 A;  3DRS A;  3L3U A;  2NUB A;  3TWH A;  4KB0 A;  1WSH A;  5CYM A;  3ZT3 A;  4CHO A;  4CJU A;  1U48 A;  4RW6 A;  4EP4 A;  1SKS A;  4NCG A;  2DFF A;  2YNH A;  4CJP A;  4EP5 A;  5HP1 A;  1ZBL A;  2P51 A;  3M8P A;  4CGF A;  3EY1 A;  4OLB A;  4AHV A;  1JL2 A;  1RT3 A;  2OPP A;  4K8Z A;  4CGD A;  2FBV A;  4F2S A;  3LP0 A;  3AA2 A;  1NJW A;  3T1A A;  3DRP A;  1XHX A;  1C1B A;  4IBN A;  4OGE A;  5FRO A;  2PYL A;  3SUP A;  3NGY A;  1W0H A;  3AA5 X;  3OYD A;  2Z1I A;  3C6U A;  3SV3 A;  3VA0 A;  3VQE A;  3HST B;  2FC0 A;  3RMB A;  4N41 A;  2FBT A;  2HVH A;  4CJQ A;  5J2Q A;  1GOB A;  3V6D A;  1G15 A;  5C25 A;  3CM5 A;  4F4K A;  3PUF A;  4PY5 A;  3OYI A;  3QIP A;  4Z4E A;  1O1W A;  4FW2 A;  3A2F A;  2A1R A;  1SL1 A;  2G8V A;  4F2R A;  5J2N A;  4J2B A;  1SL0 A;  1BI4 A;  4CJV A;  4FZX C;  2YNG A;  4LH4 A;  4F3O A;  3TAR A;  1RDC A;  4C8L A;  3AVA A;  3T3F A;  3NGZ A;  1IG9 A;  4DTJ A;  5HRO A;  2OPQ A;  3NH0 A;  1WSF A;  3HXM A;  4PA1 A;  3OYH A;  3V9X A;  4N56 A;  1RIL A;  2W42 A;  3EYZ A;  2G8I A;  4GW6 A;  3WNH A;  4FVM A;  4KHN A;  2PY5 A;  3DLK A;  4DFM A;  1KFS A;  4NYF A;  1U45 A;  4CHZ A;  3MAQ A;  2ATQ A;  1L5U A;  1GOC A;  3TAE A;  3RWU A;  4CIE A;  1TAQ A;  3DOL A;  1J54 A;  4W5N A;  4IFY A;  1SV5 A;  2X78 A;  3ITH A;  3KD1 E;  3HT3 A;  4ICL A;  1S1T A;  3SPZ A;  4CGG A;  3F73 A; 
#chains in the Genus database with same CATH topology
 2DPN A;  5HOO A;  3CCL N;  3Q7B A;  1ESV A;  4IJN A;  2BTF A;  1XNQ K;  4DS4 A;  4CJK A;  2DTU A;  4E0D A;  1HKG A;  1HYS A;  3QEP A;  1F21 A;  2HBK A;  5H1S Q;  4CED A;  1WBD A;  3T19 A;  1OH5 A;  5JLF A;  2OTJ N;  3T69 A;  4DTU A;  2D1K A;  4H5V A;  2HHT A;  3MN9 A;  4HWI A;  4AHU A;  5FDL A;  3LDO A;  1NOY A;  4H5N A;  4QOZ B;  3THX B;  1LAV A;  1YTA A;  1RT7 A;  1WLJ A;  3O1W A;  4DSJ A;  5AQV A;  5EVZ A;  4DR3 K;  2HMP A;  1ZC6 A;  4RW8 A;  4JRP A;  3PY8 A;  3WXL A;  3JAM O;  3KLF A;  3EKS A;  1KLM A;  2XO7 A;  4B08 A;  5AJ3 K;  1Z6R A;  2VWK A;  5GAH P;  3CCV N;  5F1X A;  3TAM A;  5F0X A;  3WNG A;  5E26 A;  5CYQ A;  2O8C A;  3LDQ A;  2VYP A;  3BF1 A;  3VQP A;  3OVN A;  4A62 A;  4CIG A;  1N8R O;  4DHY A;  4O5B A;  3HI0 A;  3TSP A;  3CFP A;  4YDU C;  4KAZ A;  4IEI A;  4KHQ A;  4BDZ A;  4FJG A;  1KVC A;  5ADX A;  3P38 A;  2EHG A;  2D0C A;  5AFU H;  5J1E A;  1NWK A;  3NVM A;  1WSG A;  3AAR A;  3O4Q A;  5AQW A;  2QEX N;  3EL2 A;  2HHV A;  4I9L A;  4U7B A;  4NO7 A;  2FF3 B;  2F9T A;  2VQE K;  1J53 A;  3CFR A;  3AVB A;  1NKC A;  4EZ9 A;  2E2P A;  1KTQ A;  2P9S B;  3UB5 A;  2QXL A;  1HJR A;  1SS6 A;  2P1J A;  2VG6 A;  1S5J A;  2V52 B;  1WBB A;  4JD2 B;  4XH1 A;  2Z1H A;  1T05 A;  3WNF A;  4CZE A;  3HOS A;  1RTH A;  3PIP L;  4JKG A;  1C0U A;  3MCA B;  4WQ5 A;  4JKF A;  3EE8 A;  4JI2 K;  5C10 A;  4X62 K;  3IFR A;  3RVC A;  3NF8 A;  5C24 A;  1L3T A;  3ZYY X;  3QFU A;  5AQH A;  4B1V A;  1X3M A;  3OYE A;  3OY9 A;  3WEE B;  4BR9 A;  3K9K A;  4J2E A;  2X6S A;  4YHH K;  3C94 A;  2E2Q A;  3WUH A;  1RDU A;  4O44 A;  5TKW A;  3LPU A;  3RSE A;  4CF8 A;  2JWK A;  4JI6 K;  1QVF M;  2QWN A;  4DTO A;  3AGR A;  3HM8 A;  3CCS N;  1SZ2 A;  4M7X A;  1A5X A;  4GY2 B;  4KHS A;  1NGD A;  3DYA A;  1IH7 A;  3N4Q A;  2WOM A;  4YOX A;  1CZ9 A;  5AQI A;  4DS5 A;  4FM0 A;  2GUI A;  1FXX A;  3H6E A;  3S3O A;  5FPN A;  4NYN A;  4BRL A;  1XMO K;  4N5S A;  4YOU A;  1KQS M;  3M3Z A;  4BRC A;  4JI8 K;  3M5R A;  4CK3 A;  1UWB A;  4WFB L;  1P90 A;  3G25 A;  4IFV A;  4M7Y A;  3D2E B;  4DKW A;  2ETJ A;  1RBV A;  3K2P A;  3O3H A;  3QIO A;  3B6O A;  2FXU A;  4JAX A;  1NJY A;  2QA4 N;  1GLB G;  3G10 A;  4IOA L;  3R8E A;  1BL3 A;  1HR0 K;  3S41 A;  4CE9 A;  4RW9 A;  1GLC G;  3H3N O;  1LW2 A;  1K8A O;  4DQI A;  4RWT A;  2AJQ A;  4JI7 K;  4CD1 A;  3JYT A;  5AQL A;  4BR2 A;  4XIU A;  4IO9 L;  4GV3 A;  4CW7 B;  4Z0U A;  1QE1 A;  4BRQ A;  3SAF A;  2I7N A;  2G8F A;  2O8E B;  1VRU A;  1QS4 A;  3OYC A;  3CJB A;  3NCI A;  2KW4 A;  1S72 N;  1VSJ A;  4JI1 K;  3QBW A;  5AQT A;  2GEL A;  3UKR B;  2WUS A;  1U2V B;  3O1B A;  1RFQ A;  2BH1 A;  3TTC A;  1TKD A;  2QK9 A;  4CJS A;  4JKH A;  2VGM A;  1EXQ A;  1BIU A;  3THY B;  3DJC A;  2A42 A;  5AQJ A;  5JS1 A;  4FLW A;  4O8K A;  2P9I A;  1RTI A;  1IKY A;  3WT0 A;  3SUO A;  1D4X A;  2EX3 A;  5CHI A;  4MFB A;  2VWJ A;  1NGA A;  3ZSO A;  1VQL N;  5C2D A;  4BC3 A;  4E7K A;  1HPZ A;  3O9R A;  3DAW A;  2JWL A;  3VEX A;  1TUY A;  3W0L A;  4I7F A;  1IO2 A;  1S6Q A;  3C7N B;  1NGJ A;  4CJR A;  1VK0 A;  5AZI B;  4KH4 A;  1VSF A;  5C42 A;  2VG7 A;  3SYZ A;  4CZM A;  4AHC A;  5FPM A;  1P8Z A;  3O4W A;  4OPJ A;  2W41 A;  3F9M A;  1A5W A;  2YHB A;  2QWR A;  1HYZ A;  3QML A;  1K9M O;  4ISG A;  4PL8 A;  1KRP A;  4M3Y A;  1HUX A;  1DTQ A;  4DR5 K;  4MLH A;  3VQ6 A;  3HYF A;  4ISE A;  2ITG A;  3THV A;  5HRS A;  3ZX0 A;  4JI3 K;  1JKH A;  3VOV A;  3HM9 A;  4FJI A;  3TTD A;  3SBT A;  3EZ5 A;  5GAE P;  3KIO A;  5FRN A;  4KH6 A;  3ENH A;  1C1C A;  2D4W A;  1RCH A;  3NVK A;  4ZTJ A;  2BGG A;  2WTU A;  2P9L A;  4BWJ A;  3QNO A;  3H3O B;  3CCE N;  4DSF A;  4LD0 A;  3SZ2 A;  3C6T A;  2NNW A;  1Q18 A;  4CBW A;  1TGO A;  4BRO A;  4FJN A;  3H1Q A;  2HHQ A;  3SQ4 A;  1YTU A;  4YNQ A;  2CH5 A;  4CF1 A;  3K58 A;  3C6A A;  4L3Q A;  4JK9 A;  4B1Y B;  2E6L A;  3HRG A;  3MX5 A;  3RMA A;  4CEQ A;  3L0Q A;  4JRQ A;  1S1U A;  4FJ7 A;  3P39 A;  3VEZ A;  5TKY A;  1Z25 A;  4JKE A;  2OZM A;  4DTR A;  1NGH A;  3LDP A;  2KZM A;  3THW B;  4BRM A;  1JXE A;  2XY7 A;  5CY4 A;  1T7P A;  4OJR A;  4FJK A;  3DLG A;  5J2M A;  3OYF A;  1ZBS A;  2OYQ A;  4K25 A;  5HRR A;  3DLL L;  5AQO A;  2E8A A;  3EO3 A;  4CHY A;  3OYJ A;  4DTX A;  4DFK A;  2KTQ A;  3ZEU B;  4NXN K;  4NXM K;  1DLO A;  2NRZ A;  1OH7 A;  4DF4 A;  4PHT X;  2DFH A;  3WXK A;  2V51 B;  1BCM A;  3BY5 A;  3ENO A;  4GNI A;  4ID1 A;  3SJH A;  1QHA A;  3DRS A;  2NUB A;  3MDQ A;  5M1O A;  1WSH A;  3VF2 A;  1U48 A;  4BRA A;  4MO4 A;  4EP4 A;  2DFF A;  2YNH A;  4CJP A;  5GIN A;  1OKJ A;  4DUY K;  4CGF A;  3IDH A;  3KHY A;  1TUU A;  1NJW A;  3ZX3 A;  3BZC A;  3SV3 A;  3VA0 A;  2ZF5 O;  2FC0 A;  3OA9 A;  2HVH A;  3H45 C;  2NRW A;  1BO5 O;  1NMN A;  1YJW N;  4MDB A;  3E9O A;  5C25 A;  4Z4E A;  3A2F A;  2A1R A;  4LFA K;  3T1Y K;  5J2N A;  4OX9 K;  4CJV A;  1EQY A;  2YNG A;  1RDC A;  1LCU A;  3NGZ A;  4DTJ A;  4BG8 A;  3IKM A;  3V9X A;  3NH0 A;  2W42 A;  2OCE A;  3CC7 N;  3GDQ A;  1M90 O;  3DLK A;  1KFS A;  4CHZ A;  3MAQ A;  2WFB A;  5DM6 L;  5LY3 A;  3HT3 A;  1S1T A;  3CXC M;  2QM1 A;  3F73 A;  3KWI A;  1XNR K;  3UKU A;  1I3A A;  2A5X A;  4IOX A;  1IKV A;  4ISF A;  4DFJ A;  1BDG A;  3O08 A;  4CEA A;  2VG5 A;  2HB5 A;  3DM2 A;  1Q7Y O;  2UXC K;  5BN8 A;  1RDD A;  1B92 A;  3MN7 A;  1RBR A;  3VPZ A;  4BRN A;  5DK5 A;  4OVL A;  4ILJ A;  4DFP A;  4LSN A;  3MED A;  3D45 A;  3FZK A;  2B5J A;  3J8A A;  1M1K O;  3OYM A;  2P9U A;  3ENB A;  4JK7 A;  2IVN A;  1NKE A;  2YKN A;  3I33 A;  4H5W A;  1JLC A;  4FM2 A;  2ZJR L;  4JHD A;  3VEV A;  1WSJ A;  2Z1G A;  4DTP A;  5HRN A;  3H1V X;  4C23 A;  4W5Q A;  3FZL A;  4ZTF A;  3ZX2 A;  4E1N A;  2F8T A;  5BR9 A;  4DSL A;  2ITM A;  4BAC A;  4FJM A;  5HRP A;  1BA0 A;  3TAQ A;  3KK3 A;  2P5O A;  4LH5 A;  1RDW X;  4CZF A;  3QDK A;  4DTN A;  3WXJ A;  4RG8 A;  5LMU K;  2DY4 A;  4E7H A;  3AVC A;  2QWO A;  3F9K A;  3R1X A;  1JL1 A;  3VQQ A;  1RNH A;  3DXK A;  3NH2 A;  4WQ5 C;  4KI6 A;  3SAG A;  4M42 A;  4O4G A;  4Z94 A;  2IAJ A;  5C12 A;  3H46 O;  4HHT A;  5SWM A;  4JKC A;  2XY5 A;  3OBW A;  5JMV A;  1S6P A;  1VQN N;  4EZ6 A;  1BIS A;  3TAB A;  3TAF A;  4CEB A;  4DQS A;  3LDN A;  2GX9 A;  1BHL A;  3ALY A;  3LDL A;  3L6Q A;  1R0A A;  1NM1 A;  3O80 A;  3VGK A;  1LOT B;  1I39 A;  5JVG L;  2ZE2 A;  3RMC A;  3VTH A;  1ASV A;  5M1N A;  2V7Z A;  3DWL A;  3THX A;  4IG3 A;  1L3V A;  1C6V A;  3CJC A;  4BDY A;  3C95 A;  3PO5 A;  1NMD A;  3V9Z A;  4E7J A;  3VF6 A;  1BWF O;  4AIL C;  1WB9 A;  4CD3 A;  3OTO K;  3MX2 A;  3KK2 A;  4FZZ A;  2RN2 A;  2X6N A;  1SL2 A;  4CZI A;  1Y64 A;  4FYD A;  4CK2 A;  4CEZ A;  4IKF A;  1N33 K;  4GVM A;  4TSX A;  1NK7 A;  5M1K A;  4KRF A;  1W9H A;  1ZBI A;  4OKK A;  4JS5 A;  4FPA A;  5K14 A;  3L3V A;  5BR8 K;  1A5V A;  5FLX O;  4B3R K;  4E89 A;  3NF7 A;  1TK5 A;  3MEG A;  4I2Q A;  4WYB A;  3CQX A;  1BQN A;  3FR0 A;  3P1G A;  1KAY A;  4LFC K;  4PKH A;  3U9Z A;  3VET A;  3DLH A;  1RT5 A;  1QQM A;  4JN4 A;  1SKR A;  2Q3S A;  3NMU A;  2P9S A;  1NU0 A;  3VEW A;  3ISN C;  4K43 A;  4B9S A;  3CIP A;  1VSM A;  5BPM A;  3IS9 A;  1NK6 A;  4H5R A;  4JD2 A;  1Q82 O;  3VTI A;  5BRF A;  4BG9 A;  3OBY A;  1REV A;  1NGF A;  1YJN N;  3FFI A;  2O8B B;  3V81 A;  1W97 L;  4H0O A;  3S3M A;  3TAN A;  3CHW A;  2W6L A;  3AVH A;  3I8D A;  2CGJ A;  2Y1I A;  4N76 A;  3VMF B;  3E01 A;  4GKK K;  1NGC A;  1KXP A;  4FZY A;  2FSJ A;  1VQ8 N;  2ZJP L;  4IZ9 A;  1ZYQ A;  1HJO A;  3AVL A;  4B9V A;  1VHX A;  5CZ2 A;  2NZT A;  1LW0 A;  3V4I A;  1JLG A;  2WON A;  4C8N A;  1HNV A;  1O13 A;  3RRH A;  3PX4 A;  1WSE A;  2NRV A;  2HBL A;  3ZSY A;  2B6A A;  1VQK N;  3CPW M;  4H0Y B;  2E1Y A;  1EP4 A;  3O5B A;  5AQF A;  1VQ5 N;  3HPG A;  4O8U A;  5LL6 Z;  5AQZ A;  2RF2 A;  4RW4 A;  1OVQ A;  3LM2 A;  4LF6 K;  3TSQ A;  4K41 A;  1ATS A;  3WXI A;  3A5O C;  4M41 A;  1HPM A;  1LWC A;  2IVO A;  1JCG A;  2E4L A;  4R5P A;  4BWM A;  4I9Q A;  4DQR A;  1MDU B;  4BGB A;  2YX6 A;  1ZBH A;  3D2F A;  4FOE A;  4CGI A;  1YF5 L;  5AQU A;  3P4I A;  2QKK A;  4QCL A;  2HF4 A;  4E19 A;  2YNF A;  3O6W A;  3AO1 A;  3Q7C A;  1JLF A;  5M1Q A;  2G8K A;  4DU4 A;  1Z26 A;  1OVY A;  2ASO A;  3VA3 A;  3HO1 A;  3SBG A;  4HUE A;  4G9Z A;  3UE5 A;  4YFU A;  3KK7 A;  4BDP A;  4DV3 K;  4ELT A;  2O8E A;  3BDP A;  2GV9 A;  4CK1 A;  2O8D B;  3TAG A;  1HQE A;  2HBJ A;  3IAY A;  3QIC A;  3DXM B;  2KKZ A;  3M8Q A;  3VGL A;  5IT9 O;  3GE1 A;  1XUP O;  3OS0 A;  4FWN A;  4HUG A;  3UKR A;  1U2V A;  2QWP A;  4LF5 K;  4A59 A;  3V1O A;  4JS4 A;  1TAU A;  3AA3 A;  2IOC A;  4LSL A;  3PSF A;  4CJE A;  3LZI A;  4OKE A;  3TR8 A;  1X9M A;  2UUC K;  1HKC A;  2HNZ A;  3VER A;  5BRD A;  1X9S A;  4CJ3 A;  1NLV A;  1VSK A;  3VQA A;  2NRT A;  4G1Q A;  4CHP A;  4DSI A;  3HSC A;  3JSM A;  1C0T A;  4CHN A;  1FJG K;  4HUF A;  3AVG A;  4KO0 A;  2YI1 A;  1IBL K;  3ZSV A;  2E5L K;  1NGG A;  1HNX K;  1Y97 A;  4UY8 O;  1LWE A;  2CH6 A;  4C8K A;  4FM1 A;  4F9O A;  4FSV A;  1KSP A;  1NNE A;  1MWM A;  3L2R A;  4A2B A;  2ZD1 A;  3C7N A;  1GLJ O;  3A8Y A;  4CJ5 A;  5HBM A;  5AZI A;  1D9F A;  3G0Z A;  3HVT A;  1NGI A;  5SZT A;  3AVN A;  1KAZ A;  1ATR A;  3TAP A;  4AHR A;  3ZSX A;  5HL7 L;  3K57 A;  4Q0B A;  1FKO A;  1NK5 A;  1JLE A;  2D5R A;  3CJ1 A;  4CFB A;  1BI4 B;  3PX0 A;  4CES A;  3K9J A;  3J81 O;  4C8O A;  4JLH A;  3G4S N;  1DTT A;  3DI6 A;  1JCE A;  1BOT O;  3AA4 A;  4GVE A;  1RGI A;  3I8B A;  4O0J A;  4BVO A;  1TKT A;  5KGW A;  3PO4 A;  3LAN A;  2Y1J A;  1CXQ A;  4FXD A;  2HMI A;  5AZJ B;  1H1V A;  3D0P A;  3ULD A;  4DV5 K;  1YVU A;  3QES A;  4CER A;  1C0F A;  4FWO A;  4IO8 A;  4BRF A;  1RT2 A;  3L3U A;  3EZW A;  4CHO A;  4CJU A;  1GLD G;  4B1W B;  4RTF D;  1J6Z A;  1N34 K;  2P51 A;  3M8P A;  4AHV A;  1JL2 A;  1RT3 A;  2OPP A;  2QWM A;  4DR4 K;  3LP0 A;  3DRP A;  1XHX A;  1C1B A;  4IBN A;  5BRH A;  4X65 K;  5FRO A;  1DKG D;  2P9P B;  3OYD A;  4FOI A;  2Z1I A;  3C6U A;  2PFU A;  3RMB A;  2FBT A;  5J2Q A;  1G15 A;  3G71 N;  3CM5 A;  4BRK A;  4PY5 A;  3R6M A;  4FW2 A;  4F2R A;  4J2B A;  3PSI A;  3CCQ N;  4IXC A;  4FZX C;  3LM9 A;  4H0P A;  4C8L A;  3T3F A;  2EWS A;  3HXM A;  1WSF A;  2QWQ A;  3WNH A;  4KHN A;  4WF9 L;  2KZZ A;  1U45 A;  4M3Z A;  3EEQ A;  1TAQ A;  4W5N A;  4IFY A;  3ITH A;  3CMA N;  1IBM K;  2PYL A;  4OPH A;  3SPZ A;  1YXQ A;  3ZEU A;  4X64 K;  1I94 K;  4IJA A;  4FVU A;  1D5A A;  2Z1J A;  3KVG A;  4NLC A;  3NF9 A;  2G8W A;  2NRH A;  1VAZ A;  1EX4 A;  1T3V A;  4H03 B;  2IIR A;  3BZK A;  1VSI A;  1IKX A;  2NRX A;  3U6F A;  3LAM A;  3VES A;  3OJU A;  1SQK A;  3QET A;  5DM7 L;  4PKI A;  4Q5V A;  1VSH A;  1NK4 A;  3SQ2 A;  1CLQ A;  3AO4 A;  3E9L A;  4Z4C A;  1YHQ N;  4PWD A;  1TKZ A;  3C65 A;  3FFK B;  1V4T A;  5M1P A;  3AAQ A;  1SKW A;  3JS6 A;  2BDP A;  4Y1C A;  4FJL A;  4B8C A;  3U3Y A;  5AQX A;  1CZB A;  4WFN L;  3KJV A;  2PYJ A;  1K8K B;  4NCB A;  3CJ9 A;  3VEO A;  5AR0 A;  4A5B A;  1HNI A;  2ZM6 K;  4BC2 A;  4AH9 A;  4BRP A;  3KTQ A;  4DR1 K;  3DLB A;  4KHW A;  4M45 A;  1T8E A;  4AHS A;  3O9Q A;  4FO0 A;  2F4V K;  3SPY A;  3PX6 A;  3P5J A;  4QS9 A;  2KHO A;  2IS3 A;  4IFE A;  4DUZ K;  3ASM A;  4B3M K;  4AM7 A;  3VN5 A;  5EOY A;  3SCX A;  4MLE A;  2W6K A;  5C15 A;  1IV0 A;  5AQR A;  1XWL A;  4FPB A;  3NAE A;  4LY7 A;  3HP9 A;  3NH1 A;  4JKA A;  3AVF A;  5KRS A;  2RHK A;  5KRT A;  3OYA A;  5BPL A;  3MEC A;  4FK4 A;  2WBN A;  2P9L B;  3KWG A;  1KVB A;  3FZH A;  2RE2 A;  3FE1 A;  1MWK A;  4YOR A;  1CXU A;  3VF4 A;  3U9D A;  3HBT A;  2HW3 A;  1X3N A;  1ASU A;  2QWL A;  2E1Z A;  2ZQB A;  1QZ5 A;  3KKS A;  3KD5 E;  1NK8 A;  1QHT A;  3ZT0 A;  1RT4 A;  2BAN A;  1HQU A;  3P31 A;  4NCA A;  3SAH A;  2AA4 A;  1BG3 A;  3CYM A;  3AO5 A;  3OYG A;  4W5T A;  1S1X A;  2F8S A;  3O3G A;  4DQP A;  2HHU A;  1VRT A;  1RBU A;  4BC5 A;  4CF2 A;  1GLA G;  4CEC A;  5AQY A;  2P9N B;  1WSI A;  2WC9 A;  5BRE A;  3L2Q A;  1JXB A;  3QEW A;  2GBZ A;  1EO1 A;  4B9U A;  2YHA A;  3O9U A;  4CF0 A;  3NHG A;  1VQ7 N;  1EWQ A;  2QTD A;  2KFZ A;  1BU6 O;  4DF8 A;  4LF9 K;  5E84 A;  3FZM A;  4DTM A;  3K5M A;  1K6Y A;  4PQU A;  5EXW A;  1NJZ A;  1XC3 A;  3O9T A;  4FJ5 A;  1NGE A;  4BQZ A;  4B3S K;  1L3U A;  2P9K B;  3ZET B;  3ZSW A;  4BRG A;  4HVJ A;  1HNW K;  2O4I A;  3OYL A;  2Q2R A;  3TSU A;  1VSD A;  3DMJ A;  4DV6 K;  3OYN A;  1UA0 A;  3SV4 A;  1L3S A;  3M6G A;  4RW7 A;  3BP8 A;  1GOA A;  4LF4 K;  3WXM B;  4DV7 K;  4CBU A;  4Z4G A;  4DV0 K;  5AFU A;  3L2U A;  3LP2 A;  4LF8 K;  1XC9 A;  1YJ9 N;  3LL3 A;  4AF1 A;  3D6R A;  5I42 A;  2HNY A;  1NJI O;  2OPS A;  1IKW A;  3SNN A;  3MWP A;  1RT1 A;  1NK9 A;  4CVN E;  5KTQ A;  3OYK A;  4C8M A;  5CR4 A;  2ASM A;  3QEX A;  1NOZ A;  1WNS A;  3VQ8 A;  4FWS A;  1Q86 O;  2UYT A;  4BE0 A;  2O8F B;  1BGX T;  1TV6 A;  2D0A A;  2PZS A;  4JI5 K;  5ELZ A;  3MXM A;  3DLE A;  2OAN A;  1JLQ A;  1E4G T;  3AVJ A;  2XHB A;  3KKR A;  1TK0 A;  4BE1 A;  3HPH A;  1ZXO A;  1IBK K;  2OA8 A;  3PIO L;  1BQM A;  1HLU A;  3SUN A;  4FLT A;  1WAF A;  4Z4H A;  2A41 A;  3LDS A;  4IDK A;  2A40 A;  3L4I A;  2KQ2 A;  1EKE A;  3QLH A;  4EFH A;  4E1M A;  3UIQ A;  4AHT A;  1TYQ B;  2YV0 X;  5JLH A;  2KLA A;  1MU2 A;  4CJL A;  2OTL N;  3VQ9 A;  1LAW A;  1NK0 A;  3KZB A;  3IMX A;  4FK2 A;  4J2D A;  2O8B A;  4XEI A;  3MMV A;  4ILH A;  3M1F A;  1VQM N;  3LP3 A;  1ZBU A;  2ZGY A;  3TTF A;  3CFO A;  5EU7 A;  4WQ4 C;  3CI5 A;  5FPD A;  2JGU A;  2AP1 A;  3E9P A;  3F2K A;  4M3U A;  3WNE A;  5E41 A;  1JLB A;  2J4R A;  2HBM A;  1J9A A;  5AQQ A;  2A6A A;  5AQK A;  3AV9 A;  5A2Q O;  4DB3 A;  3IG1 A;  1WAJ A;  4HCC A;  3NBP A;  1QSY A;  1XQS C;  4CCH A;  1W2B M;  4OO1 J;  2HHS A;  4KTW A;  5I3U A;  2IVP A;  1X9W A;  1CZA N;  4KFB A;  3M8R A;  5F2R A;  4ELU A;  3MN5 A;  1B9F A;  1YVN A;  3KLG A;  1T6D A;  1EET A;  2YJE A;  4FJX A;  4KTZ A;  3ATU A;  5D3G A;  2FBX A;  3GG4 A;  1HKB A;  3O4N A;  4IWV A;  2H3G X;  2GUP A;  3BEX A;  1YT3 A;  3I0S A;  4B9M A;  4JI0 K;  4GMJ B;  4B3T K;  2NLX A;  2F9W A;  4IG0 A;  4IOC L;  1QQO A;  1W7A A;  4O55 A;  4NLB A;  1YI2 N;  1TVR A;  2A1S A;  4L8R B;  1S9E A;  3V1Q A;  4Z4F A;  2P5G A;  1U4B A;  4WFA L;  4KHY A;  3MK6 A;  5JVH L;  3TI0 A;  3OS2 A;  3SLC A;  4OKJ A;  1YAG A;  3WEE A;  5KPT A;  1TL1 A;  4EIA A;  2Q0U A;  2KFN A;  4OLA A;  2BE2 A;  1TKX A;  5KGX A;  4QAG A;  3ULE B;  3ZT1 A;  4CJ4 A;  4U67 L;  3O9S A;  2HHW A;  4CJ7 A;  4CJF A;  1EWR A;  3CCU N;  2O8D A;  1S1V A;  1QTM A;  2PAV A;  1UA1 A;  3DXM A;  3AVI A;  4KHU A;  1E4F T;  2G8U A;  3RMD A;  3U3G A;  4DQ8 A;  5KQD A;  3IRX A;  4H0T B;  2QW9 A;  4DU3 A;  4CJT A;  4J2A A;  1K73 O;  4W5R A;  1T03 A;  1ASW A;  3O8M A;  3QNN A;  4B9T A;  4K8X A;  5T7B A;  5MLC Q;  1TL3 A;  3U8X A;  4I6M B;  4PKG A;  1IJJ A;  4HTU A;  4JNE A;  1FW6 A;  2YJF A;  4OGC A;  4C1N I;  1Q81 O;  4JYA K;  4JEP A;  3S9H A;  4A57 A;  5CZ1 A;  3D2E A;  4BGA A;  2IC3 A;  3ZT4 A;  5KPR A;  3L4Q A;  1XMQ K;  4BRE A;  4EHU A;  4CZG A;  3CD6 N;  4KB0 A;  3ZT3 A;  3CF5 L;  4NCG A;  3OW2 M;  3AY9 A;  4KH5 A;  4Y0W A;  4JKB A;  4EP5 A;  3J80 O;  4KHP K;  1E3M A;  4F2S A;  4YOV A;  4BR4 A;  3AA2 A;  2GEM A;  3T1A A;  4OGE A;  3T7Z A;  3AA5 X;  3R9P A;  4CBX A;  3HST B;  4BQL A;  4BRD A;  2Q1N A;  4BRH A;  3V6D A;  3PUF A;  3OYI A;  3QB0 A;  3VGM A;  1SL0 A;  1BI4 A;  3SMP A;  2I7P A;  4EAH D;  3CPE A;  3W3D A;  1WUA A;  1YIT N;  3HOT A;  1IG9 A;  2YHW A;  2O8C B;  1X9J A;  4N56 A;  1RIL A;  3EYZ A;  3PLA A;  4XH5 A;  4EHT A;  4NYF A;  5BN9 A;  1GOC A;  3CQY A;  3RWU A;  3DOL A;  3D7E O;  4WQ4 A;  1HX1 A;  3KD1 E;  4BR7 A;  4ICL A;  4CGG A;  3THY A;  5GAG P;  4H5T A;  3CC4 N;  2ZWH A;  2ZGZ A;  3ZLJ A;  5AZJ A;  1NGB A;  2O4G A;  1S1W A;  3A5L C;  2G8H A;  4C1N K;  3A5M C;  4BR0 A;  2CGL A;  4MQ3 A;  2OZS A;  1OH6 A;  2HND A;  3HP6 A;  4DLG A;  3VQ5 A;  3RRG A;  1HYV A;  3CCM N;  4FWP A;  3H08 A;  1S22 A;  4LFB K;  2YHX A;  2IDO A;  3E1Y A;  4ZHR A;  4JI4 K;  4V19 S;  2D0P A;  3WQT A;  5GIP A;  1Z05 A;  3HL8 A;  1RT6 A;  5AQG A;  2E2O A;  3CCR N;  3KLI A;  3K5N A;  4M63 C;  4JKG B;  3SUQ A;  2P9P A;  4PL7 A;  1QSS A;  1GLF O;  4OPK A;  3SQ0 A;  4HTL A;  3D2F B;  5LMN K;  2UXB K;  2VWB A;  1RTJ A;  2GWJ A;  1V4S A;  1VQ4 N;  4K0K K;  1X1P A;  5AQN A;  5EX5 A;  1Q9Y A;  3VQB A;  4CEE A;  4E7L A;  2OPR A;  3RSE B;  1BCO A;  4ILG B;  1UOC A;  1U04 A;  2E88 A;  3DLR A;  4H8K A;  1FK9 A;  3A0I X;  4CF9 A;  4M3R A;  3K0S A;  3VEN A;  2BUP A;  2VQF K;  5CE3 A;  4CGJ A;  1TK8 A;  4E1J A;  3ID8 A;  2Q97 A;  4RCH A;  3K5L A;  4E3S A;  1VQO N;  3J7Y P;  3RR8 A;  3ZSR A;  3CQ8 A;  5AQM A;  5LJW A;  1GLL O;  5ADX H;  4CIF A;  2UUB K;  5GIO A;  4HCB A;  4DSE A;  1N5Y A;  4FLY A;  3MXI A;  4YDU A;  4LF7 K;  3B8A X;  1RDB A;  3MN6 A;  3AVK A;  3U4L A;  3ZCM A;  3CER A;  3NF6 A;  3V9U A;  3GL1 A;  2E6M A;  3QIN A;  4FL9 A;  3KLH A;  2D0B A;  1FKP A;  1D9D A;  1Q8I A;  5B8H A;  4B8A B;  5KI6 A;  3THW A;  4B1U B;  3LZJ A;  3FGU A;  4KV8 A;  4DR7 K;  1K8K A;  1NG9 A;  1N32 K;  3SQ1 A;  4F3T A;  3QO9 A;  2HF3 A;  4KPY A;  4FJ9 A;  2Q36 A;  4DG1 A;  1RTD A;  4PUO A;  3CET A;  1ILY A;  1BA1 A;  4A61 A;  4M3T A;  4GV9 A;  3QBX A;  4FK0 A;  3OJS A;  1S9G A;  5DMR A;  1JLA A;  4MDA A;  3VQD A;  2HHH K;  1ZBF A;  4DU1 A;  1U49 A;  3P83 D;  4WE1 A;  4DR2 K;  1NKB A;  3C6H A;  1YUW A;  4YY3 K;  1JCF A;  3SMS A;  4N47 A;  3AO3 A;  3BF3 A;  3OS1 A;  2A3Z A;  2CGK A;  3V1R A;  4CZH A;  4K42 A;  2P9I B;  5C2F A;  2RPI A;  4FCY A;  1KLN A;  1SUQ A;  3CM6 A;  3LAL A;  5KPZ A;  1QQN A;  4QS7 A;  1DGK N;  4H4M A;  4A5A A;  3MCP A;  3V9S A;  3MEE A;  5BPN A;  3RR7 A;  1T44 A;  4O0I A;  4M3W A;  4B9Q A;  4JV5 K;  3I0R A;  3TU5 A;  3VQ7 A;  3LWM A;  1NJX A;  4E7I A;  3ATV A;  4FWQ A;  1MA9 B;  2YHY A;  4FWK A;  3KLE A;  2IGI A;  3L8B A;  4DQQ A;  3KK1 A;  2DFE A;  4KI4 A;  4BE2 A;  3EKU A;  5C0Y A;  3ID6 A;  3MXJ A;  3J7Z O;  4DV1 K;  3I55 N;  2XY8 A;  4H0V B;  3CC2 N;  3HZ6 A;  4YOW A;  4DWI A;  4KRE A;  3L2W A;  3VQC A;  4CZJ A;  1JJ2 M;  3LP1 A;  4JKD A;  4FWL A;  3T1H K;  4B9N A;  4CHQ A;  1NBW A;  2P9N A;  2YKM A;  5GAD P;  4B3O A;  2PBD A;  4M3X A;  3B6P A;  1QVG M;  1KC8 O;  3DRR A;  2I5J A;  4BY9 C;  1YIJ N;  5LJV A;  4UQG A;  3E66 A;  1U6Z A;  4ELV A;  4F8R A;  4B1Z A;  3O3F A;  1LV5 A;  3AVM A;  3MWT A;  3NE6 A;  4CFD A;  1U47 A;  5KQ8 A;  1RDA A;  1SAZ A;  4KKO A;  2VGN A;  3QEI A;  3CJA A;  2JLE A;  2P9K A;  3ZET A;  3PV8 A;  5HLF A;  4X66 K;  3L2V A;  4FWM A;  4QS8 A;  4IEE A;  4YOT A;  5M1F A;  2NRR A;  4B9L A;  1VQ9 N;  1GLE G;  3EN9 A;  4FLZ A;  2HHX A;  1KD1 O;  2XY6 A;  2FSN A;  1R59 O;  4CJW A;  3DOK A;  5AQP A;  3R3L A;  4I2P A;  3QFP A;  3G6E N;  4DSK A;  4FLX A;  4YOY A;  1Q9X A;  1KFD A;  3CME N;  4DR6 K;  4Y1D A;  3GBT A;  1VQ6 N;  2VCP A;  4BR5 A;  4A2A A;  4WCE L;  1RBS A;  4FJJ A;  4FJ8 A;  2V7Y A;  2Q0R A;  1C1A A;  4DV2 K;  3EE9 A;  2X74 A;  4OPA A;  4KTQ A;  3V9W A;  3LAK A;  2FSK A;  4GKJ K;  1UAX A;  2O8F A;  3SK3 A;  3CJ7 A;  4DMN A;  3HVR A;  4R79 A;  3AO2 A;  3HJF A;  1ITG A;  1J5O A;  2F96 A;  4KBO A;  2FF6 A;  5IWA K;  3F5T A;  2RKI A;  3CG7 A;  1KCF A;  3HK2 A;  4FLV A;  3S3N A;  3OYB A;  5EY4 A;  1C0G A;  3K59 A;  2FLO A;  2QKB A;  4B1X B;  3BGR A;  2GTD A;  3IUC A;  2E2N A;  3LPT A;  5J2P A;  3FZF A;  1B9D A;  2Q31 A;  2UXD K;  2F7T A;  4CZK A;  1ATN A;  1VSL A;  1J5E K;  4KB1 A;  1TYQ A;  4H0X B;  2R7Y A;  2HVI A;  1XI1 A;  2UU9 K;  3ZSZ A;  3SJJ A;  1QZ6 A;  4CFC A;  3HPO A;  3JXU A;  3QEV A;  1QSL A;  3I56 N;  1XHZ A;  4ID5 A;  4MO5 A;  4JK8 A;  1N6Q A;  1RBT A;  2YCH A;  3ZSQ A;  3NDK A;  3NFA A;  4BC4 A;  4CEF A;  2LSN A;  1WN7 A;  4H4O A;  1S3X A;  3RTV A;  4DCH A;  4CFA A;  2FBY A;  2XRI A;  4FW1 A;  2YNI A;  4DLE A;  2E20 A;  1HMV A;  4GV6 A;  3AAP A;  4AQY K;  1LWF A;  1T6C A;  3M8S A;  1DT9 A;  2ASP A;  4DTS A;  1BIZ A;  3J7A P;  3ZT2 A;  3K5O A;  2GWK A;  4W5O A;  3QER A;  1C0M A;  3LWL A;  1QQC A;  1VSE A;  3BUZ B;  5FPE A;  5I9E B;  4XH4 A;  3VEY A;  4AM6 A;  2B4J A;  2W40 A;  5JIC A;  3AGK A;  2ZJQ L;  4FJH A;  4CZL A;  5AQS A;  5FRM A;  1D8Y A;  4BVP A;  3SI6 A;  3UKU B;  1KAX A;  1KVA A;  1IG8 A;  5JS2 A;  4CGH A;  3NGI A;  2D0O A;  1HRH A;  1G99 A;  2QXF A;  4Z4I A;  4CEO A;  3VQ4 A;  4FLU A;  2QI2 A;  4CI6 A;  3TWH A;  5CYM A;  4DV4 K;  4RW6 A;  1SKS A;  1BUP A;  2P9U B;  1DEJ A;  3TPQ A;  5HP1 A;  1ZBL A;  4IDH A;  3EY1 A;  4OLB A;  4K8Z A;  4CGD A;  2FBV A;  4JHD B;  3SUP A;  3NGY A;  3WQU A;  1W0H A;  3VQE A;  1N36 K;  4N41 A;  4CJQ A;  1GOB A;  1VQP N;  4F4K A;  3N4P A;  4O5F A;  3ULE A;  3QIP A;  1O1W A;  1SL1 A;  2G8V A;  3GOI A;  4NB4 A;  3OHR A;  1OH8 A;  4LH4 A;  4F3O A;  3TAR A;  3AVA A;  2HST A;  2UUA K;  4LC9 B;  5HRO A;  2OPQ A;  1HNZ K;  4J8F A;  4BRI A;  4PA1 A;  3OYH A;  2G8I A;  4GW6 A;  1WOQ A;  3C0B A;  4FVM A;  2PY5 A;  4DFM A;  3FLC O;  2ATQ A;  3A5N C;  3TAE A;  4FWR A;  1L5U A;  4CIE A;  1J54 A;  2HOE A;  1SV5 A;  2X78 A;  4I6M A;  3DXK B;  3HTV A;  3CCJ N; 
#chains in the Genus database with same CATH homology
 1I3A A;  1IKV A;  4DFJ A;  4DS4 A;  1D5A A;  4CJK A;  4CEA A;  2VG5 A;  2HB5 A;  2O4G A;  2Z1J A;  3DM2 A;  4E0D A;  2DTU A;  1HYS A;  1S1W A;  3QEP A;  2G8H A;  1F21 A;  1RDD A;  1B92 A;  4KRF A;  1RBR A;  5DK5 A;  4MQ3 A;  4OVL A;  4DFP A;  4CED A;  2OZS A;  2HND A;  4LSN A;  3NF9 A;  3MED A;  2G8W A;  3T19 A;  3D45 A;  3HP6 A;  4DLG A;  3VQ5 A;  3RRG A;  2B5J A;  1EX4 A;  1HYV A;  3OYM A;  1VSI A;  3H08 A;  1IKX A;  3U6F A;  3LAM A;  4DTU A;  2IDO A;  4ZHR A;  3OJU A;  2HHT A;  1NKE A;  2YKN A;  4AHU A;  1JLC A;  5FDL A;  1NOY A;  3HL8 A;  1RT6 A;  3QET A;  4FM2 A;  4QOZ B;  3KLI A;  3K5N A;  1LAV A;  1YTA A;  1RT7 A;  4Q5V A;  1VSH A;  1WLJ A;  3SUQ A;  1WSJ A;  2Z1G A;  1NK4 A;  4DSJ A;  3SQ2 A;  1CLQ A;  3AO4 A;  4DTP A;  5HRN A;  4Z4C A;  4PWD A;  1QSS A;  4W5Q A;  1TKZ A;  4OPK A;  4RW8 A;  3SQ0 A;  4JRP A;  4ZTF A;  3PY8 A;  1SKW A;  3KLF A;  4E1N A;  4M3Z A;  2F8T A;  1KLM A;  2XO7 A;  4DSL A;  4B08 A;  2BDP A;  4Y1C A;  4BAC A;  2VWK A;  4FJL A;  4FJM A;  4B8C A;  1RTJ A;  3TAM A;  5HRP A;  3U3Y A;  3TAQ A;  3KK3 A;  3WNG A;  2P5O A;  1CZB A;  1X1P A;  3KJV A;  1Q9Y A;  2PYJ A;  4NCB A;  3VQB A;  4CEE A;  5CYQ A;  4E7L A;  2OPR A;  4LH5 A;  1BCO A;  1HNI A;  4DTN A;  3VQP A;  3OVN A;  4RG8 A;  1UOC A;  1U04 A;  4AH9 A;  4CIG A;  3DLR A;  4H8K A;  4O5B A;  4E7H A;  3DLB A;  3KTQ A;  4KHW A;  4M45 A;  3CFP A;  3AVC A;  1T8E A;  4KAZ A;  1FK9 A;  4KHQ A;  4BDZ A;  4CF9 A;  3F9K A;  4FJG A;  1JL1 A;  4AHS A;  1KVC A;  3VQQ A;  1RNH A;  4M3R A;  3SPY A;  3PX6 A;  2EHG A;  3P5J A;  3NH2 A;  2D0C A;  4KI6 A;  4M42 A;  2IS3 A;  5J1E A;  4O4G A;  1WSG A;  3ASM A;  3O4Q A;  2IAJ A;  4HHT A;  3VN5 A;  4CGJ A;  5SWM A;  4I9L A;  1TK8 A;  2HHV A;  2XY5 A;  3SCX A;  3K5L A;  4E3S A;  3RR8 A;  1S6P A;  1XWL A;  3ZSR A;  3NAE A;  4LY7 A;  3CQ8 A;  4EZ6 A;  1BIS A;  3HP9 A;  1J53 A;  3NH1 A;  3AVB A;  3CFR A;  3TAB A;  3AVF A;  5KRS A;  1NKC A;  4EZ9 A;  1KTQ A;  5KRT A;  3TAF A;  3OYA A;  4CEB A;  4DQS A;  1BHL A;  3ALY A;  3MEC A;  4CIF A;  1HJR A;  1R0A A;  4FK4 A;  2P1J A;  2VG6 A;  1S5J A;  4HCB A;  1I39 A;  2ZE2 A;  4DSE A;  3RMC A;  1N5Y A;  1KVB A;  1T05 A;  2Z1H A;  4FLY A;  3MXI A;  3WNF A;  1ASV A;  1RTH A;  1CXU A;  1RDB A;  4IG3 A;  1L3V A;  1C6V A;  2HW3 A;  1C0U A;  4BDY A;  1ASU A;  3C95 A;  3PO5 A;  3AVK A;  3ZCM A;  3V9Z A;  2ZQB A;  3NF8 A;  4E7J A;  5C24 A;  1L3T A;  3NF6 A;  4AIL C;  3KKS A;  3KD5 E;  3V9U A;  2E6M A;  3QIN A;  1NK8 A;  3KK2 A;  3KLH A;  1QHT A;  3ZT0 A;  2D0B A;  1RT4 A;  4FZZ A;  2RN2 A;  1FKP A;  2BAN A;  2X6N A;  1D9D A;  1Q8I A;  3OYE A;  4B8A B;  3OY9 A;  5KI6 A;  3LZJ A;  1HQU A;  4KV8 A;  1SL2 A;  4J2E A;  2X6S A;  4FYD A;  4CK2 A;  4NCA A;  3C94 A;  3SQ1 A;  4F3T A;  4O44 A;  3LPU A;  4CEZ A;  4CF8 A;  4IKF A;  3QO9 A;  4GVM A;  3CYM A;  4TSX A;  3AO5 A;  3OYG A;  4W5T A;  1NK7 A;  1W9H A;  4KPY A;  4FJ9 A;  1S1X A;  1ZBI A;  2F8S A;  4DG1 A;  4OKK A;  3O3G A;  4JS5 A;  4DTO A;  1RTD A;  4DQP A;  4PUO A;  5K14 A;  1VRT A;  3L3V A;  1RBU A;  1A5V A;  4CF2 A;  1A5X A;  4M3T A;  4CEC A;  4E89 A;  3NF7 A;  1TK5 A;  1WSI A;  3MEG A;  4I2Q A;  3DYA A;  4FK0 A;  1IH7 A;  4KHS A;  1BQN A;  1S9G A;  3OJS A;  2WOM A;  1CZ9 A;  3L2Q A;  1JXB A;  5DMR A;  2GBZ A;  1JLA A;  3QEW A;  3P1G A;  4DS5 A;  4FM0 A;  3VQD A;  4B9U A;  2GUI A;  1FXX A;  2YHA A;  4CF0 A;  3S3O A;  1ZBF A;  3NHG A;  4NYN A;  4DU1 A;  1U49 A;  3P83 D;  4WE1 A;  4N5S A;  1NKB A;  2KFZ A;  4DF8 A;  3DLH A;  1RT5 A;  4CK3 A;  4N47 A;  1SKR A;  1UWB A;  2Q3S A;  4DTM A;  3AO3 A;  3OS1 A;  3K5M A;  1K6Y A;  4IFV A;  4PQU A;  3ISN C;  3V1R A;  4B9S A;  1NJZ A;  1VSM A;  4FJ5 A;  2RPI A;  4FCY A;  1KLN A;  1L3U A;  1SUQ A;  3CM6 A;  3IS9 A;  3LAL A;  3ZSW A;  1NK6 A;  2ETJ A;  1RBV A;  3K2P A;  4H4M A;  3O3H A;  3QIO A;  3V9S A;  3MEE A;  4HVJ A;  3B6O A;  3RR7 A;  2O4I A;  3OYL A;  1NJY A;  1REV A;  4O0I A;  1VSD A;  3DMJ A;  4M3W A;  3G10 A;  3OYN A;  1UA0 A;  3SV4 A;  1L3S A;  3I0R A;  1BL3 A;  3FFI A;  4RW7 A;  3V81 A;  3VQ7 A;  3LWM A;  1NJX A;  4E7I A;  1GOA A;  4RW9 A;  4CE9 A;  3S3M A;  3TAN A;  3AVH A;  4Z4G A;  1LW2 A;  3KLE A;  3I8D A;  4DQI A;  2Y1I A;  4N76 A;  3L2U A;  3LP2 A;  1XC9 A;  2IGI A;  3L8B A;  2AJQ A;  3JYT A;  3E01 A;  4DQQ A;  5I42 A;  3KK1 A;  2HNY A;  2DFE A;  4XIU A;  4KI4 A;  4FZY A;  4BE2 A;  1ZYQ A;  2OPS A;  1IKW A;  4Z0U A;  3AVL A;  3SNN A;  1RT1 A;  3MXJ A;  1NK9 A;  4B9V A;  1QE1 A;  5CZ2 A;  5KTQ A;  2XY8 A;  3OYK A;  4DWI A;  4C8M A;  4KRE A;  3L2W A;  2G8F A;  1LW0 A;  3VQC A;  1VRU A;  3V4I A;  1JLG A;  1QS4 A;  3LP1 A;  3QEX A;  2KZZ A;  2WON A;  1NOZ A;  1WNS A;  4C8N A;  1HNV A;  3VQ8 A;  3RRH A;  3OYC A;  4B9N A;  4CHQ A;  4BE0 A;  3PX4 A;  1BGX T;  1WSE A;  1TV6 A;  2YKM A;  3NCI A;  2D0A A;  2KW4 A;  3ZSY A;  2PZS A;  4B3O A;  1VSJ A;  4M3X A;  2B6A A;  3B6P A;  3MXM A;  3DLE A;  3DRR A;  1EP4 A;  1JLQ A;  2I5J A;  3AVJ A;  2XHB A;  3KKR A;  1TK0 A;  4BE1 A;  1TKD A;  2QK9 A;  4CJS A;  3HPH A;  3HPG A;  4UQG A;  4ELV A;  4F8R A;  1EXQ A;  2RF2 A;  3O3F A;  1LV5 A;  3AVM A;  4RW4 A;  2OA8 A;  1BIU A;  1BQM A;  3NE6 A;  3SUN A;  4CFD A;  4FLT A;  1U47 A;  5JS1 A;  1RDA A;  1WAF A;  4Z4H A;  4FLW A;  4KKO A;  3LDS A;  4IDK A;  3QEI A;  2JLE A;  1RTI A;  1IKY A;  3SUO A;  2KQ2 A;  1EKE A;  3PV8 A;  3QLH A;  4E1M A;  5HLF A;  3UIQ A;  2EX3 A;  4AHT A;  4MFB A;  3L2V A;  2VWJ A;  4M41 A;  2YV0 X;  3ZSO A;  1LWC A;  1MU2 A;  4CJL A;  2E4L A;  3VQ9 A;  4E7K A;  1HPZ A;  1LAW A;  4R5P A;  4B9L A;  4BWM A;  1NK0 A;  4I9Q A;  4DQR A;  4FLZ A;  2HHX A;  4FK2 A;  1ZBH A;  4I7F A;  4J2D A;  2XY6 A;  4CJW A;  1IO2 A;  3DOK A;  4CGI A;  2QKK A;  3LP3 A;  1S6Q A;  4I2P A;  1ZBU A;  4DSK A;  4FLX A;  3CFO A;  4CJR A;  1VK0 A;  5EU7 A;  4QCL A;  4E19 A;  2YNF A;  3AO1 A;  1VSF A;  1JLF A;  1KFD A;  2VG7 A;  5C42 A;  1Q9X A;  2G8K A;  4DU4 A;  2JGU A;  3SYZ A;  1Z26 A;  4Y1D A;  4AHC A;  3VA3 A;  4M3U A;  3HO1 A;  3WNE A;  5E41 A;  1JLB A;  1J9A A;  4OPJ A;  4HUE A;  4YFU A;  3AV9 A;  1A5W A;  2YHB A;  1RBS A;  3IG1 A;  4BDP A;  4FJJ A;  1WAJ A;  4FJ8 A;  1C1A A;  4HCC A;  4ELT A;  3NBP A;  1QSY A;  2X74 A;  1HYZ A;  4CCH A;  3BDP A;  4KTQ A;  2GV9 A;  4CK1 A;  3V9W A;  3TAG A;  2HHS A;  1HQE A;  4KTW A;  5I3U A;  1X9W A;  3LAK A;  3IAY A;  4KFB A;  1UAX A;  3M8R A;  1KRP A;  4M3Y A;  3M8Q A;  4DMN A;  1DTQ A;  3HVR A;  4ELU A;  3VQ6 A;  3AO2 A;  3HYF A;  2ITG A;  3OS0 A;  3HJF A;  1B9F A;  1ITG A;  5HRS A;  4HUG A;  3KLG A;  3THV A;  1J5O A;  2F96 A;  1JKH A;  3V1O A;  4JS4 A;  1TAU A;  3AA3 A;  3HM9 A;  4FJI A;  2RKI A;  2IOC A;  3CG7 A;  1KCF A;  3HK2 A;  4LSL A;  3EZ5 A;  4FLV A;  1EET A;  3KIO A;  4CJE A;  3LZI A;  3S3N A;  5FRN A;  4OKE A;  3TR8 A;  1X9M A;  3OYB A;  4KTZ A;  4FJX A;  2HNZ A;  1X9S A;  5D3G A;  1C1C A;  3K59 A;  4CJ3 A;  2QKB A;  2FBX A;  3BGR A;  1RCH A;  1VSK A;  3VQA A;  3O4N A;  4G1Q A;  4ZTJ A;  2BGG A;  4CHP A;  4DSI A;  3JSM A;  1C0T A;  3LPT A;  4BWJ A;  4CHN A;  5J2P A;  4HUF A;  3QNO A;  1YT3 A;  1B9D A;  3I0S A;  3AVG A;  4GMJ B;  4KO0 A;  4B9M A;  3ZSV A;  1VSL A;  4DSF A;  4IG0 A;  4LD0 A;  4KB1 A;  3SZ2 A;  3C6T A;  2R7Y A;  2HVI A;  4O55 A;  1Y97 A;  1XI1 A;  1TVR A;  2A1S A;  4L8R B;  1LWE A;  4C8K A;  1S9E A;  4FM1 A;  3ZSZ A;  1KSP A;  3SJJ A;  1TGO A;  3V1Q A;  4CFC A;  4FJN A;  2HHQ A;  2DY4 A;  3HPO A;  4Z4F A;  3L2R A;  3SQ4 A;  2P5G A;  1U4B A;  4YNQ A;  1YTU A;  3QEV A;  1QSL A;  2ZD1 A;  4KHY A;  3TI0 A;  1XHZ A;  3OS2 A;  4CF1 A;  4CJ5 A;  4OKJ A;  5HBM A;  3K58 A;  1D9F A;  3G0Z A;  3HVT A;  4ID5 A;  5SZT A;  3AVN A;  1N6Q A;  2E6L A;  1RBT A;  1TL1 A;  3ZSQ A;  3NDK A;  3NFA A;  3RMA A;  3TAP A;  4CEF A;  2LSN A;  4CEQ A;  1WN7 A;  4H4O A;  4AHR A;  2KFN A;  4OLA A;  3ZSX A;  3RTV A;  4CFA A;  2BE2 A;  2FBY A;  2XRI A;  4JRQ A;  4FW1 A;  3K57 A;  1TKX A;  2YNI A;  1FKO A;  1S1U A;  4QAG A;  3ZT1 A;  4CJ4 A;  5KGX A;  4DLE A;  4FJ7 A;  1HMV A;  2HHW A;  1NK5 A;  4CJF A;  1JLE A;  2D5R A;  1LWF A;  4CFB A;  1BI4 B;  1Z25 A;  2OZM A;  4DTR A;  3M8S A;  1S1V A;  2KZM A;  4DTS A;  1QTM A;  1UA1 A;  1JXE A;  2XY7 A;  1BIZ A;  5CY4 A;  3AVI A;  3ZT2 A;  4CES A;  3K5O A;  3PX0 A;  1T7P A;  4KHU A;  4W5O A;  3QER A;  1C0M A;  4OJR A;  2G8U A;  3LWL A;  4FJK A;  4Q0B A;  3DLG A;  1QQC A;  1VSE A;  3U3G A;  5J2M A;  3RMD A;  4JLH A;  4C8O A;  3IRX A;  1DTT A;  3DI6 A;  2HHU A;  4DU3 A;  4CJT A;  3OYF A;  2OYQ A;  4J2A A;  3AA4 A;  4W5R A;  1T03 A;  1ASW A;  3QNN A;  5HRR A;  4B9T A;  4K8X A;  2B4J A;  5T7B A;  4HTU A;  1TL3 A;  4CHY A;  3OYJ A;  4DTX A;  4DFK A;  4OGC A;  4FJH A;  2KTQ A;  5FRM A;  4O0J A;  3S9H A;  1D8Y A;  5CZ1 A;  1DLO A;  1TKT A;  3SI6 A;  5KGW A;  3PO4 A;  2IC3 A;  3ZT4 A;  3LAN A;  2Y1J A;  1CXQ A;  4FXD A;  1KVA A;  4DF4 A;  2HMI A;  2DFH A;  5JS2 A;  4CGH A;  3NGI A;  3D0P A;  1BCM A;  1HRH A;  1YVU A;  4ID1 A;  3ULD A;  2QXF A;  4CER A;  3QES A;  4CEO A;  3VQ4 A;  4Z4I A;  4FLU A;  1RT2 A;  3DRS A;  3L3U A;  2NUB A;  3TWH A;  4KB0 A;  1WSH A;  5CYM A;  3ZT3 A;  4CHO A;  4CJU A;  1U48 A;  4RW6 A;  4EP4 A;  1SKS A;  4NCG A;  2DFF A;  2YNH A;  4CJP A;  4EP5 A;  5HP1 A;  1ZBL A;  2P51 A;  3M8P A;  4CGF A;  3EY1 A;  4OLB A;  4AHV A;  1JL2 A;  1RT3 A;  2OPP A;  4K8Z A;  4CGD A;  2FBV A;  4F2S A;  3LP0 A;  3AA2 A;  1NJW A;  3T1A A;  3DRP A;  1XHX A;  1C1B A;  4IBN A;  4OGE A;  5FRO A;  2PYL A;  3SUP A;  3NGY A;  1W0H A;  3AA5 X;  3OYD A;  2Z1I A;  3C6U A;  3SV3 A;  3VA0 A;  3VQE A;  3HST B;  2FC0 A;  3RMB A;  4N41 A;  2FBT A;  2HVH A;  4CJQ A;  5J2Q A;  1GOB A;  3V6D A;  1G15 A;  5C25 A;  3CM5 A;  4F4K A;  3PUF A;  4PY5 A;  3OYI A;  3QIP A;  4Z4E A;  1O1W A;  4FW2 A;  3A2F A;  2A1R A;  1SL1 A;  2G8V A;  4F2R A;  5J2N A;  4J2B A;  1SL0 A;  1BI4 A;  4CJV A;  4FZX C;  2YNG A;  4LH4 A;  4F3O A;  3TAR A;  1RDC A;  4C8L A;  3AVA A;  3T3F A;  3NGZ A;  1IG9 A;  4DTJ A;  5HRO A;  2OPQ A;  3NH0 A;  1WSF A;  3HXM A;  4PA1 A;  3OYH A;  3V9X A;  4N56 A;  1RIL A;  2W42 A;  3EYZ A;  2G8I A;  4GW6 A;  3WNH A;  4FVM A;  4KHN A;  2PY5 A;  3DLK A;  4DFM A;  1KFS A;  4NYF A;  1U45 A;  4CHZ A;  3MAQ A;  2ATQ A;  1L5U A;  1GOC A;  3TAE A;  3RWU A;  4CIE A;  1TAQ A;  3DOL A;  1J54 A;  4W5N A;  4IFY A;  1SV5 A;  2X78 A;  3ITH A;  3KD1 E;  3HT3 A;  4ICL A;  1S1T A;  3SPZ A;  4CGG A;  3F73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...