3U6FA

Mouse trex1 d200n mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
217
Chain Sequence
PHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENSQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQARKSYSLGSIYTRLYWQAPTDSHTAEGNVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
molecule keywords Three prime repair exonuclease 1
total genus 69
structure length 217
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u6fA01
4Z4GA 3DI6A 4Q0BA 3LANA 4O0JA 1K6YA 1QQCA 2NUBA 3ZSOA 1QSSA 3VQEA 1TGOA 4Z4CA 5D3GA 3OYGA 1S9EA 4Q5VA 2RN2A 3DM2A 5DK5A 1IG9A 3AA3A 3BGRA 4KHUA 2QXFA 4OKJA 2YNFA 3TAEA 4PWDA 3HPOA 3UIQA 4CESA 3LWLA 4HHTA 1L3UA 2BGGA 4M41A 3TAFA 4J2EA 3V1RA 4TSXA 5HRSA 4N41A 2X78A 2FBTA 4DQIA 4CEQA 2O4GA 2Z1JA 3LP1A 4LH5A 4CK2A 4KI6A 2DTUA 1BHLA 1NK8A 4PY5A 3LPUA 4CHPA 1T8EA 1QE1A 2ETJA 2EHGA 4I9LA 4JS4A 4KHNA 3QLHA 3SUOA 3HSTB 2YHAA 4IDKA 4KTWA 3T19A 2G8WA 4Z4FA 1KVAA 3V9XA 4FVMA 2HHSA 1S5JA 3QEXA 4DTXA 2PYJA 3NAEA 2Y1JA 1VK0A 4FJ5A 4FJLA 4DFPA 4DQRA 2FBXA 4OJRA 4F3OA 1TK5A 4CJFA 3HM9A 5HRRA 4KAZA 4LH4A 3LALA 4NCGA 2HMIA 1VSDA 3AVMA 2X6NA 5KI6A 3V9UA 1SV5A 2Z1HA 3TI0A 2WOMA 1BI4B 3K2PA 5K14A 4OPJA 4B8CA 3IS9A 1TKDA 4M3YA 2HHTA 3SNNA 1JLFA 1TL1A 4GW6A 4RW7A 4FM1A 4F2RA 1XHZA 1RTJA 3NGIA 3LZJA 3ULDA 1KFDA 1C0MA 3NCIA 1SL2A 4OLBA 2QKKA 4CJKA 3OYDA 4RW8A 4DMNA 4NCAA 2E4LA 1REVA 3KLIA 1B9DA 4FM2A 1X9SA 1T7PA 4KTZA 1TKZA 1JKHA 4I2QA 4CFBA 3CFPA 1TV6A 4OLAA 1QSLA 3VA3A 2OZSA 1NJXA 1BCMA 4B08A 5HRPA 5J2PA 4B9LA 2IS3A 4DTJA 1LAWA 4I9QA 1WLJA 1J53A 5E41A 3RR8A 4CGHA 4DTRA 3L2UA 1EX4A 1TKXA 3ZSYA 4FJ7A 4BWJA 4AHSA 3QEWA 4B9VA 1WSHA 1BQNA 1C6VA 4CJWA 3NF8A 4KKOA 1RT2A 1VSHA 3KTQA 3TAPA 3KIOA 3ZSWA 4KB0A 3KLHA 3K5NA 5SZTA 4O0IA 5C25A 3PX0A 3AA5X 3P5JA 3SV4A 2BDPA 2A1RA 4FCYA 3VQ5A 4FK0A 3RMCA 1GOBA 5FRMA 4N47A 4CJ3A 1BL3A 1QTMA 4Z4HA 4HTUA 2YKMA 3SQ0A 4BDPA 3OYAA 4KHQA 2KZMA 1ZBIA 3PX6A 1RDDA 2X6SA 4LSLA 1KRPA 4QOZB 3HT3A 4R5PA 3SUQA 3PO5A 3HPHA 3MECA 5HRNA 1JLEA 2B4JA 4CJTA 2OZMA 1NK9A 4IG3A 3CFRA 3HP9A 2OA8A 3HO1A 1A5VA 4JRQA 1I39A 3NGYA 2PZSA 1C0UA 2HHXA 1B9FA 1ASUA 1ZBHA 4CCHA 3ZT3A 1NKEA 1VSFA 4BDYA 3OYNA 4KFBA 4ZTFA 4W5QA 1ZBUA 2YHBA 3HXMA 4N76A 4KREA 3L2RA 3OYEA 4DFJA 3THVA 1RT3A 4BDZA 2WONA 4H8KA 1IKWA 1EXQA 4B3OA 3TAGA 5J1EA 4BE2A 1S9GA 4FW2A 4KPYA 1YTUA 4FJNA 4GVMA 3VQAA 1WSIA 1W0HA 4CEFA 3V1QA 4FM0A 2FC0A 1U48A 4B9TA 4FJXA 1WAJA 1KVCA 1NK7A 4ELTA 4KHWA 3MXMA 4CGFA 2YKNA 3VQPA 3MEEA 4DQQA 2KZZA 1HYVA 1EKEA 3SCXA 3V9WA 1BQMA 3RR7A 4BE0A 1ZYQA 4ICLA 3K57A 3PV8A 1FK9A 1IKYA 3AVAA 3VQ6A 2BANA 3AO2A 1WNSA 3SYZA 3V9ZA 4LY7A 4NYNA 1LWFA 1UAXA 3KD5E 3MEGA 3K5OA 5J2QA 4HUEA 1QSYA 3T1AA 3MXJA 3QEPA 2G8HA 4FK2A 3S3MA 4O55A 3RMDA 4M3WA 5JS2A 1B92A 1KFSA 1XI1A 5J2MA 2HHQA 1JL2A 4DLEA 1I3AA 4CJUA 1Y97A 3I0RA 3V4IA 3DLKA 1XHXA 4DFKA 3HK2A 3L3UA 3DLRA 2XRIA 4AHUA 3OS1A 4O44A 3WNGA 2RKIA 1HPZA 1RT7A 2LSNA 1CZBA 3D45A 1TAUA 3HL8A 1JLGA 1VSKA 4Z0UA 1TVRA 4B8AB 4FJ9A 1LWEA 3O4QA 1FXXA 2HNYA 3ALYA 3HVRA 4AHVA 3RRGA 3OVNA 3PX4A 4FJIA 2AJQA 4M3UA 3G10A 1SKWA 1NOZA 3RMAA 1J9AA 2XHBA 3EZ5A 3OYIA 4EZ9A 4E0DA 3VQ7A 1HNIA 3AVFA 4CEAA 3SQ1A 1X9MA 4M42A 2DFEA 2Z1GA 2ZQBA 3M8RA 3K5MA 3ZT2A 5KRSA 3NBPA 4OKKA 3BDPA 4DSFA 3QNNA 1NK5A 1BCOA 3S9HA 4L8RB 2KTQA 1ZBLA 2XO7A 4B9UA 4CGJA 1YTAA 4YFUA 3ZT4A 3SI6A 1JLQA 3LP3A 1BGXT 1DLOA 2P51A 3OS0A 3OYMA 3MXIA 3RRHA 3A2FA 3WNEA 3KKSA 3IAYA 1WSJA 3SV3A 2EX3A 4HCBA 4F8RA 1CZ9A 4W5RA 4DTOA 2HB5A 4KO0A 2VWJA 4BACA 2F8TA 1LV5A 2QK9A 2QKBA 1RT4A 4O5BA 3G0ZA 3O3GA 4C8KA 4FLXA 1KCFA 3CYMA 3M8SA 4E7HA 2GUIA 1T03A 1Q8IA 3B6OA 3K58A 1RDBA 4DTSA 4M3XA 4FLZA 4K8XA 4KTQA 4F2SA 3VQCA 3OYJA 4DSEA 1IO2A 1IKXA 4HCCA 4DU4A 2HHUA 4DQSA 1XWLA 3ZT1A 4DLGA 3C6UA 3U6FA 1RBUA 3C94A 1RT1A 1VSMA 1WSFA 2DFHA 3ITHA 3D0PA 3C95A 2OPRA 3DRRA 1Q9YA 4E7JA 3DLHA 2D0AA 2OPPA 1LW2A 3WNFA 4DU1A 4OGEA 5CY4A 3VA0A 2R7YA 1UA1A 4JLHA 3KD1E 4M3RA 3AVJA 3NF9A 4PA1A 2F96A 2ZE2A 3I8DA 3KLGA 3OJSA 1RTIA 3AVIA 3NH1A 1FKOA 1X9WA 1KSPA 1BIUA 4J2DA 1HMVA 3L2QA 4FLTA 1SKRA 1HRHA 1J54A 4CFCA 4CF0A 3SUPA 1HYSA 1JXEA 3AVNA 4CEDA 1NJZA 1KLNA 3ZCMA 3LDSA 3SQ4A 3KKRA 4DWIA 3DLEA 5CYMA 4CEOA 1Q9XA 1J5OA 4IBNA 3B6PA 3I0SA 3V1OA 1KLMA 4KHSA 4Z4IA 1JL1A 1NKBA 1DTTA 2I5JA 2KFNA 4HVJA 1F21A 1C1AA 4E7LA 3L8BA 1VSIA 3TANA 4EZ6A 2KFZA 1R0AA 4MFBA 2HVHA 3SZ2A 3CM5A 1TL3A 4DTMA 3ZSXA 4FJMA 2OPSA 2D5RA 3RWUA 3ZSZA 3AVKA 4B9SA 1RCHA 2HVIA 3JSMA 4DS4A 1D9DA 1IH7A 2GV9A 1A5XA 4CF2A 1Z25A 3DOKA 4FLWA 4AHRA 3LZIA 3AVLA 4E3SA 3KLEA 4FJGA 4RW4A 4BWMA 1KVBA 3F73A 1U47A 3IRXA 3ASMA 1SUQA 1RT6A 2IGIA 4KV8A 1D9FA 3QEVA 2VWKA 1NK6A 4Y1CA 1S1TA 3VN5A 3ZSQA 3KK1A 4HUGA 4FK4A 1NJWA 4CFAA 4DG1A 3AVGA 3L2VA 1LW0A 3VQ9A 5HP1A 3FFIA 2PY5A 4J2BA 4DSKA 3QESA 2HHVA 2DY4A 3DOLA 1JLAA 2D0CA 2VG5A 1W9HA 3QIOA 2XY6A 4FJKA 3CFOA 1EP4A 1WN7A 4FLYA 4DFMA 3AA2A 4DTPA 1S1XA 1WSGA 3DYAA 1LWCA 3V9SA 3O4NA 4JS5A 2D0BA 3CQ8A 4CECA 4DF4A 4CIFA 4DTNA 1RBSA 1G15A 2IDOA 1RBTA 4NYFA 4OVLA 4AILC 1A5WA 1HNVA 1UOCA 1SL0A 3OYHA 3PY8A 3K59A 3WNHA 5FDLA 5I42A 4PUOA 3HP6A 2E6LA 3TAMA 4CJEA 4DQPA 4DSIA 3HJFA 4CERA 3AO4A 3TARA 4W5NA 4AH9A 3NDKA 4C8OA 4IFYA 1HQUA 3DLGA 1N5YA 1GOCA 1VRUA 1RTDA 1WSEA 1U49A 2Y1IA 2BE2A 3HVTA 4H4OA 4FW1A 5CZ2A 1IKVA 3E01A 4WE1A 3QIPA 4CHQA 4CK3A 3NH0A 3MEDA 3NE6A 3RTVA 4E7IA 1NJYA 2ATQA 2OYQA 2JGUA 3HPGA 3OYKA 1ZBFA 5KRTA 4FJHA 1RBRA 1L5UA 1RT5A 2A1SA 4E1MA 3OYCA 4HUFA 2KQ2A 2F8SA 4ELVA 4EP5A 1D5AA 4IFVA 4IG0A 3TR8A 1NOYA 4FYDA 4N5SA 2G8FA 2YNHA 1O1WA 4CJRA 3ZSRA 4H4MA 4UQGA 2HNZA 3QERA 1VSLA 1CLQA 1ITGA 1ASWA 1YT3A 4YNQA 2B5JA 3S3NA 2DFFA 1RNHA 1RTHA 3SJJA 4FZYA 1QHTA 1C1BA 3NF7A 3LAKA 3HYFA 3EYZA 2IAJA 3AVHA 1JLBA 1L3TA 1N6QA 4XIUA 4FLVA 3PO4A 1VSEA 1TK0A 5DMRA 4ID5A 4CF9A 5C24A 1SKSA 2XY8A 5FROA 2RF2A 4CHNA 1XC9A 1ASVA 3SPYA 3M8PA 5HROA 2ITGA 4PQUA 4ZHRA 4CGIA 3JYTA 4IKFA 1UWBA 4RW9A 4CJPA 1RDCA 1X1PA 3LP0A 3VQ4A 4CIGA 4BE1A 4RW6A 3ZSVA 2G8KA 1TK8A 2Q3SA 1KTQA 2P5GA 3ZT0A 3AVBA 4OKEA 1FKPA 3KK3A 5JS1A 4FXDA 4CGGA 4CF8A 1U45A 4DSLA 4I7FA 4F3TA 4CE9A 1NK0A 4FLUA 2KW4A 4CJQA 1VSJA 3LPTA 1YVUA 3V6DA 4CEEA 4CEZA 1VRTA 3VQQA 3MAQA 4B9NA 3OJUA 3QNOA 1S6QA 1RBVA 2HNDA 4C8MA 2YNIA 1RILA 3LWMA 5FRNA 3F9KA 4M3ZA 3NFAA 3QO9A 3AO1A 4E19A 5T7BA 4W5TA 3T3FA 4FJ8A 4KHYA 2XY5A 4FJJA 2IOCA 3KK2A 5CYQA 1U4BA 3KJVA 4ELUA 4CJLA 3QETA 1UA0A 2E6MA 3K5LA 4QCLA 1TAQA 4DSJA 4O4GA 5CZ1A 4Y1DA 3DMJA 3OS2A 2P5OA 3AV9A 4GMJB 1CXQA 3H08A 3SPZA 1JXBA 4QAGA 3P83D 3S3OA 4G1QA 4C8NA 4M45A 4CF1A 4NCBA 3PUFA 1S1VA 5J2NA 3AVCA 4OGCA 1BI4A 4E1NA 1BISA 3U3YA 3NF6A 4CJ5A 5C42A 2IC3A 4AHCA 4ZTJA 3O3FA 4CK1A 1GOAA 5HBMA 4C8LA 1S1UA 2OPQA 2RPIA 3P1GA 4CEBA 3LP2A 3U3GA 4JRPA 2O4IA 1HQEA 1TKTA 3L2WA 5I3UA 2YV0X 1NKCA 2G8VA 2FBVA 2VG7A 3SUNA 1HJRA 3DRPA 4CFDA 2YNGA 3AO5A 2VG6A 3M8QA 1HYZA 4KRFA 3VQ8A 3O3HA 2HHWA 3SQ2A 2Z1IA 4Z4EA 4RG8A 3DRSA 4N56A 2JLEA 4I2PA 3CM6A 1L3SA 1C1CA 1S6PA 5KGXA 1C0TA 5SWMA 3TWHA 1NK4A 2HW3A 4CIEA 1T05A 4FZXC 4DU3A 3TAQA 3OYFA 4OPKA 4KI4A 2G8UA 3OY9A 1MU2A 3QINA 1CXUA 3IG1A 3NGZA 4CJSA 1EETA 3AO3A 3NHGA 4CHZA 3L3VA 4DS5A 3AA4A 5KGWA 2W42A 4LD0A 3C6TA 1U04A 4CJ4A 4F4KA 4LSNA 3NH2A 1WAFA 2G8IA 4CHOA 1LAVA 3VQDA 3EY1A 3V81A 4DTUA 4B9MA 3VQBA 2X74A 4W5OA 4K8ZA 1QS4A 4EP4A 3RMBA 3OYBA 5KTQA 2ZD1A 1L3VA 1Z26A 1JLCA 4CGDA 3QEIA 2P1JA 4E7KA 4MQ3A 1D8YA 4CHYA 4CJVA 4J2AA 3LAMA 4FZZA 4AHTA 3KLFA 2FBYA 4ID1A 2B6AA 3ISNC 2PYLA 1BIZA 3OYLA 4KB1A 3TABA 4DF8A 2XY7A 5HLFA 5EU7A 4E89A 3CG7A 3DLBA 2GBZA 1SL1A 4M3TA 1S1WA 1RDAA 1DTQA
chains in the Genus database with same CATH superfamily
4Q0BA 4O0JA 1QSSA 3VQEA 1N8RO 1TGOA 3D2EB 4X66K 3OYGA 1S9EA 5AZIA 4B3MK 4FWPA 2P9UA 4CBUA 3VEZA 4PWDA 3UIQA 4CESA 2BGGA 4J2EA 3V1RA 4TSXA 3A5NC 4IO8A 3ENHA 4JKAA 5AR0A 1QHAA 4PY5A 1QE1A 4I9LA 3QLHA 3CHWA 3SUOA 2YHAA 4IDKA 5BN8A 3V9XA 3QEXA 1VK0A 2OTLN 2RE2A 4CJFA 5HRRA 3G71N 1VSDA 3AVMA 4B1WB 4H0VB 1SV5A 2Z1HA 3MWPA 1TKDA 1BI4B 1IBMK 5ELZA 1JLFA 1KAYA 1TL1A 4F2RA 3F2KA 1W97L 3P38A 2W6LA 4CJKA 3OYDA 4RW8A 2I7NA 3C6HA 3UKRB 3RVCA 4I2QA 4CFBA 3CFPA 1QSLA 3VA3A 1NJXA 1Z05A 5HRPA 1ILYA 4I9QA 4DTRA 1HNWK 1LCUA 4B1UB 3MDQA 5AQUA 4AHSA 3QEWA 4B9VA 1WSHA 3NF8A 1RT2A 3K5NA 4DR3K 3AA5X 3HRGA 3P5JA 4FK0A 4Z4HA 5AQZA 3H1QA 5AQOA 1KD1O 2E5LK 3PX6A 1ZC6A 4QOZB 4R5PA 1NMDA 2D1KA 4CJTA 2ZM6K 2OZMA 2QWMA 3HP9A 3A8YA 4JRQA 4DV4K 1C0UA 1VSFA 3CXCM 4BRCA 3A0IX 3CQYA 2YHBA 3TSQA 3L2RA 1IJJA 5AFUH 3OYEA 4DFJA 3LM9A 1RT3A 2NRVA 3N4PA 5KQDA 1EXQA 1S9GA 1S22A 4YDUA 4EFHA 4CEFA 4WFNL 2FC0A 4ELTA 3ZYYX 3MEEA 4DQQA 4K42A 1BOTO 1EKEA 2QWOA 3HOTA 1BQMA 3MMVA 3K57A 1FK9A 3AVAA 4O8KA 2BANA 3AO2A 4CZIA 3V9ZA 1W2BM 2D4WA 1QSYA 3T1AA 3MXJA 4A2AA 3IMXA 3VEVA 2P9SB 3AAPA 1NBWA 1B92A 1XI1A 2HHQA 5AQSA 2PFUA 3I0RA 1OKJA 3DLRA 2XRIA 4AHUA 1HPZA 1RT7A 1VSKA 4Z0UA 4B8AB 4MDBA 1LWEA 3HVRA 4FJIA 4M3YA 4WF9L 1YIJN 3RSEB 3D2FA 4E0DA 1HNIA 2I7PA 2ZJQL 2Z1GA 4AF1A 4BRDA 3ZT2A 5KRSA 3NBPA 3ID6A 3S9HA 3E9LA 2XO7A 4CGJA 1XNRK 1OVQA 1JLQA 1BGXT 4HWIA 2J4RA 5AQVA 3RRHA 3IAYA 3SV3A 2EX3A 4W5RA 2QWPA 2F8TA 2QK9A 3IKMA 3G0ZA 4C8KA 5HOOA 4OLAA 1KCFA 1T03A 4M3XA 3B6OA 2ZF5O 1ZBSA 2P9KA 4DSEA 1Q81O 3QFPA 3H3NO 4DU4A 3VEYA 5M1QA 2QEXN 3K9JA 4DLGA 2A41A 3C6UA 1RT1A 1Q9YA 3D0PA 4E7JA 2OPPA 1XNQK 1LW2A 3WNFA 4DU1A 1OH7A 2R7YA 3TSPA 4CZLA 3ULEA 4JLHA 4K41A 3KD1E 4U67L 3GL1A 4PA1A 2F96A 3I8DA 3KLGA 1RTIA 3AVIA 3NH1A 1YITN 1KSPA 1BIUA 4J2DA 4FLTA 1J54A 3TTCA 4CF0A 2UXCK 1HYSA 4CEDA 3ZCMA 3LDSA 3WUHA 3SQ4A 1J5OA 4IBNA 3ZEUB 2NRWA 3V1OA 1HJOA 1KQSM 1JL1A 5BN9A 2I5JA 2CGLA 4GV9A 3WXMB 3TANA 3CC7N 2KFZA 2HVHA 4MLEA 4FJMA 3ULEB 3ZSZA 3AVKA 4B9SA 2HVIA 4DS4A 1IH7A 2YX6A 3QICA 2GV9A 3DOKA 1YAGA 2HBKA 2YCHA 1KAZA 3GE1A 1KVBA 1RT6A 1NGFA 3QEVA 3ZSQA 4FK4A 3THWA 4CZGA 3L2VA 1LW0A 3VQ9A 4GY2B 5EY4A 5KQ8A 2D0CA 3QIOA 2XY6A 3CFOA 4BRNA 4FLYA 3SBGA 3DYAA 3O4NA 4DKWA 4CIFA 3CPEA 1RBSA 4PL7A 3UKUA 4AILC 1HNVA 3K59A 5I42A 4KH6A 4QS8A 3AO4A 4KH4A 3VENA 3M6GA 3S41A 3NDKA 4C8OA 2YHXA 1VRUA 1WSEA 2WC9A 3HVTA 3MCAB 4FW1A 2NRXA 4CK3A 3RTVA 3DWLA 1OH6A 2ATQA 3SAGA 2JGUA 4A61A 3OYKA 5KRTA 3K0SA 4A2BA 1RT5A 4HUFA 2F8SA 1D5AA 4IFVA 3SK3A 4FYDA 4JI6K 3D6RA 3H45C 1O1WA 1CLQA 3S3NA 1RNHA 5M1OA 1E4FT 1U2VA 3NF7A 3H46O 1NLVA 3CCSN 3EYZA 3AVHA 1R59O 4XIUA 4FLVA 1TK0A 3W0LA 4DV5K 2A40A 5DMRA 2QI2A 1LOTB 4ID5A 5B8HA 3VPZA 2XY8A 4CHNA 5HROA 3M8PA 2ITGA 1VQ4N 5KPRA 1X1PA 4BE1A 4RW6A 4JKHA 2G8KA 2Q0UA 2P5GA 4B1YB 4OKEA 1FKPA 5JS1A 4FXDA 4AM7A 4F3TA 1XMQK 5JICA 4FLUA 2KW4A 1VSJA 4B9QA 4XH5A 3V6DA 3A5OC 3MAQA 1S6QA 1RILA 3O80A 1VAZA 3QO9A 4E19A 4FJJA 3KJVA 4BGAA 4BR5A 4Y1DA 3OS2A 4GMJB 4BRFA 4IDHA 3PUFA 1RDUA 4OGCA 1EQYA 2YHWA 1KXPA 1XUPO 3U3YA 3NF6A 4CJ5A 2IC3A 1K8KB 5E84A 5KPZA 5EVZA 1Q82O 4IEEA 1HQEA 2UUAK 3L2WA 3UB5A 2G8VA 2FBVA 2VYPA 4B1XB 4OPAA 1EWRA 1BO5O 2Z1IA 4FOEA 3DRSA 2P9SA 3I56N 4MDAA 1YI2N 4BG9A 1C1CA 2GWJA 2Q36A 5SWMA 1VQPN 2Q1NA 3OBWA 4I6MA 1MU2A 3WQUA 3QINA 3IG1A 4PKGA 4CJSA 4JI0K 1P90A 3NVKA 4CHZA 3L3VA 3MCPA 3FZFA 4LD0A 4JKGB 3NH2A 4JKCA 3TTFA 5KPTA 3R8EA 3SBTA 4X62K 4W5OA 1QS4A 4LF7K 3OYBA 3D2FB 2ZD1A 2HBJA 4CHYA 4CZHA 1BIZA 3T7ZA 2GX9A 4C1NK 2GBZA 5AZJA 1SAZA 3K5MA 1H1VA 4GKJK 3R1XA 3LANA 2NUBA 4BQZA 2D0PA 4Q5VA 4MO4A 5LL6Z 3BGRA 2P9LA 4JKGA 3TAEA 2WBNA 4HHTA 2RHKA 4FWOA 4NLBA 1VQON 5HRSA 2P9KB 4LH5A 1BHLA 1NK8A 3LPUA 5BPNA 1T8EA 2EHGA 2W41A 3MN7A 3MN9A 1Q18A 3QFUA 3VGLA 1S3XA 2O8EB 5BPMA 1QQMA 3VMFB 1GLBG 3HM9A 1TK5A 4KAZA 4LH4A 3LALA 4NCGA 3WXIA 2HMIA 1GLJO 2FF3B 3O9UA 2HHTA 1HKCA 3O9TA 3NCIA 4IOAL 2BTFA 4DMNA 1ZXOA 2QWLA 1REVA 1X9SA 4LC9B 4KTZA 1C0FA 2V7YA 1G99A 1BCMA 4B08A 4BR2A 2IS3A 4DTJA 1LAWA 2WUSA 5E41A 1J6ZA 4CGHA 4YOUA 5GAHP 3ZSYA 4FJ7A 2O8DA 2KHOA 2O8BA 4CJWA 4KB0A 3TAPA 3KIOA 4EAHD 5C25A 4DUZK 2D0OA 1GOBA 2WTUA 3A5LC 1GLEG 3OYAA 4KHQA 4NO7A 1KRPA 3HT3A 1JLEA 2B4JA 1MA9B 1NG9A 1X3MA 1NK9A 4IG3A 2OA8A 3QBWA 2PZSA 2HHXA 3KHYA 1B9FA 1ASUA 4FWNA 5BRHA 4CCHA 3MWTA 4BDYA 3CJ9A 4ZTFA 3I8BA 4W5QA 1ZBUA 3HXMA 2JWKA 4N76A 5AZIB 4BQLA 4BDZA 1V4TA 3LDQA 1IKWA 3UE5A 4B3OA 3TAGA 5J1EA 4BE2A 1YTUA 4FW2A 4GVMA 4IFEA 1VQLN 2OTJN 5AQYA 1NGEA 4KBOA 3EKUA 5BPLA 1U48A 4FL9A 5C0YA 4FJXA 1WAJA 2QW9A 4KHWA 5AJ3K 3VQPA 3IFRA 3V9WA 1ZYQA 4ICLA 1MWMA 3VQ6A 5C15A 4LY7A 2QWRA 4BRPA 4CI6A 1QQNA 4JK8A 2G8HA 3S3MA 3OTOK 4XEIA 3LDNA 4M3WA 1J5EK 5AQTA 1KFSA 3VETA 4CJUA 1Y97A 1ESVA 1NJIO 5GAEP 1HNZK 3L3UA 1OVYA 4PKIA 3CJCA 3WNGA 3HL8A 5TKYA 1TVRA 4FJ9A 1BWFO 1FXXA 4AHVA 2AJQA 5AQHA 4M3UA 4BR0A 1SKWA 3LL3A 3FR0A 3J7YP 3EZ5A 4WCEL 4EZ9A 4BGBA 3SQ1A 4ISGA 2CH6A 3CJ1A 5DM6L 4FWQA 4JAXA 3WEEB 4DSFA 3QNNA 1ZBLA 4B9UA 3SI6A 4YFUA 3ZT4A 1DLOA 1N33K 3CC2N 5A2QO 3OYMA 1NGGA 3WNEA 2GELA 1WSJA 3BEXA 4F8RA 5F0XA 3VTHA 2QKBA 1NGBA 3PIOL 1LV5A 4O5BA 1IV0A 1K8KA 2HW3A 2KZZA 2GUIA 2VQFK 1RDBA 1TYQB 4K8XA 3CCEN 2FSKA 3VQCA 3OYJA 2HSTA 1IO2A 1NGDA 2HHUA 4DQSA 3ZT1A 3U6FA 1RBUA 1VSMA 1WSFA 3C95A 2D0AA 4OGEA 3T1YK 4B3TK 1UA1A 4M3RA 3ATVA 5JVHL 5GIPA 1W7AA 1N32K 3VERA 2VCPA 3CMEN 1HRHA 4CFCA 2VQEK 1NJZA 3DXKA 4J8FA 2ASPA 4BG8A 1XMOK 4DWIA 5AQKA 3B6PA 1T44A 4KHSA 3O08A 1NKBA 4HVJA 4E7LA 4M7XA 1VSIA 1GLLO 4B1VA 1RFQA 4MFBA 3SZ2A 4DTMA 2KLAA 3ZSXA 4LF6K 4JK9A 4BRMA 1RCHA 5AQFA 4JI4K 4BRHA 1Z25A 4FLWA 2H3GX 4AHRA 1HUXA 3KLEA 5LJWA 4FJGA 4BWMA 3IRXA 1YVNA 2P9UB 3ASMA 3EL2A 4K25A 2P9NB 1D9FA 4AQYK 2VWKA 4F9OA 2V52B 3VN5A 1M1KO 3E9OA 4CFAA 5HP1A 3TTDA 2PY5A 4J2BA 2HHVA 2O8FA 2VG5A 1W9HA 1EP4A 4H0OA 4JN4A 3FGUA 2VWBA 5AQNA 4JKFA 4YHHK 3GBTA 4X64K 1RGIA 3EN9A 2D0BA 2O8EA 4DR5K 4BR4A 4DTNA 1DEJA 4WQ4C 2IDOA 1RBTA 4OVLA 1A5WA 3OYHA 4ILJA 4PUOA 3AGRA 2E6LA 2VGNA 1MDUB 1HKBA 4LF9K 2A6AA 3DLGA 1N5YA 1GOCA 1U49A 1S72N 1IKVA 4CHQA 3NH0A 3QIPA 4FWKA 3MEDA 3OBYA 4JI8K 2OYQA 1ZBFA 1RBRA 1L5UA 3OYCA 4ELVA 4EP5A 1NOYA 2G8FA 4XH1A 1XQSC 5GAGP 4H4MA 4CJRA 3H6EA 1BUPA 1VSLA 3QERA 1ITGA 4H5RA 1ASWA 4LFBK 2B5JA 4FZYA 3SJJA 1N6QA 4IEIA 4CF9A 3I55N 3KK7A 5C24A 3C65A 5FROA 2RF2A 4PQUA 5AQQA 4IXCA 1NNEA 3F5TA 1P8ZA 1TUYA 4CBXA 3JYTA 4IKFA 3SMSA 3ZEUA 3LP0A 5CR4A 3J81O 2ITMA 2JWLA 1KTQA 4IJAA 3AVBA 3KVGA 3R3LA 3KK3A 4I7FA 3FE1A 3P39A 4FWMA 4CEZA 1DGKN 5FRNA 3ZLJA 5JLHA 3K9KA 1K73O 1JJ2M 3AO1A 3T3FA 4FJ8A 4KHYA 4YOXA 2A42A 3KK2A 1ATNA 3SMPA 4CJLA 3QETA 1UA0A 2E6MA 4BROA 3K5LA 1TAQA 3CPWM 3THWB 3SPZA 4C8NA 4M45A 4CF1A 1S1VA 5J2NA 1SQKA 4YOTA 3H3OB 2F4VK 3O3FA 4C8LA 1S1UA 2RPIA 2NLXA 4CEBA 1TKTA 1BA1A 5I3UA 2YV0X 2IIRA 1SS6A 1IBKK 3VF2A 2VG7A 1EO1A 2YNGA 3IUCA 2VG6A 3M8QA 4RCHA 1HPMA 3SQ2A 4N56A 2JLEA 2IVOA 1S6PA 5KGXA 1NK4A 3ATUA 1CXUA 3O9RA 3NGZA 1JCEA 1EETA 5KGWA 2W42A 2P9PA 3C6TA 5FLXO 4CJ4A 4F4KA 1VQ7N 3CI5A 4LSNA 1WAFA 3F9MA 4CHOA 3VQDA 3V81A 4GV6A 4BR7A 3CCMN 2X74A 2FLOA 5C10A 5M1PA 3ZETB 5KTQA 4H5VA 1Z26A 2QM1A 4JNEA 4K0KK 2P1JA 3SAHA 4E7KA 2E8AA 4CJVA 4GKKK 3CERA 3LAMA 3KLFA 2B6AA 3ISNC 5BR8K 5HLFA 3CG7A 3DLBA 4A59A 1DTQA 4H5WA 2QTDA 4Z4GA 3W3DA 4QS9A 3DXMB 4Z4CA 4JV5K 2RN2A 3DM2A 2QXFA 1YHQN 3HPOA 4YOVA 1TYQA 1VQ5N 2X78A 4CEQA 2O4GA 1K9MO 4KI6A 4CK2A 4CHPA 4JS4A 4KHNA 3HSTB 1X9JA 4KTWA 3T19A 1KC8O 2HHSA 1GLDG 3NVMA 4DTXA 2PYJA 4A5BA 2O8DB 4DQRA 3MN6A 2FBXA 2O8BB 1QZ5A 1ATSA 2X6NA 5KI6A 3V9UA 3QB0A 5K14A 4B8CA 3IS9A 4RW7A 4BC2A 1RTJA 3NGIA 3LZJA 3VOVA 3WT0A 1KFDA 1E4GT 1SL2A 4OLBA 2QKKA 2CGKA 3EO3A 4NCAA 4CW7B 1HNXK 1VQNN 4DHYA 1JKHA 1TV6A 2O8CB 2OZSA 2P9IB 4B9LA 3CIPA 4Z94A 1WLJA 3RR8A 1EX4A 3M1FA 1YF5L 3ZX2A 1BQNA 1YUWA 4KKOA 4CD1A 2BDPA 1HX1A 3SV4A 3RMCA 5FRMA 4N47A 4CJ3A 1BL3A 4BDPA 1Q86O 4PKHA 3THYB 4C23A 4LSLA 3SUQA 3PO5A 3HPHA 3MECA 3ZETA 2IVNA 4DV7K 4DR7K 2UXBK 3LDPA 2UUCK 3CFRA 3HO1A 2Q31A 3TSUA 1I39A 3NGYA 3QMLA 3G25A 2FF6A 5FPDA 5CE3A 1ZBHA 3ZT3A 5AQMA 1N34K 4WQ5A 4JYAK 5ADXA 3OYNA 3L4QA 4KREA 2UUBK 3VF4A 5LY3A 5LMNK 4LF5K 2WONA 3DAWA 4KPYA 4FJNA 3VQAA 3MK6A 1W0HA 4OO1J 4FM0A 4B9TA 2HHHK 1KVCA 4DUYK 3MXMA 1VQ6N 1HYVA 4CVNE 5M1KA 3RR7A 4BE0A 3PV8A 3GDQA 1IKYA 3VGKA 4LF4K 3FZHA 1LWFA 3KD5E 3BP8A 5J2QA 4HUEA 4ISFA 1YXQA 3RMDA 3G4SN 3KWGA 1YJ9N 3DLLL 5J2MA 2ZJPL 1K8AO 3V4IA 1XHXA 3HK2A 3O1WA 3OS1A 2HF4A 3T69A 4O44A 2RKIA 3D45A 1JLGA 3ALYA 3RRGA 3HZ6A 3OVNA 3PX4A 5BR9A 3G10A 2XHBA 2E1ZA 4LFAK 2YJFA 3VQ7A 1VQMN 2ZQBA 4OKKA 3BDPA 2BH1A 3OA9A 1BCOA 2CH5A 4L8RB 2KTQA 1YTAA 2FSNA 4BVOA 4IWVA 3ENBA 4A5AA 3KKSA 2E2PA 5HL7L 4JEPA 5LJVA 2HB5A 4KO0A 2VWJA 4DB3A 5DM7L 3O3GA 4FLXA 3CYMA 3M8SA 4E7HA 3K58A 4DTSA 3VGMA 4FLZA 4F2SA 4EIAA 4JI5K 3MN5A 4WQ5C 1IKXA 3HI0A 5GINA 1BA0A 3SJHA 2PAVA 1DT9A 5M1FA 5CY4A 4JI7K 4NXMK 3CCRN 4H0TB 2ZE2A 3C7NB 3OJSA 3EE9A 1FKOA 1TUUA 2HBMA 2Q97A 1Z6RA 1HMVA 1SKRA 1BDGA 4U7BA 3GG4A 1JXEA 4DR4K 3KKRA 3DLEA 5CYMA 4UY8O 3I0SA 2EWSA 3FLCO 2UYTA 2O8FB 4JHDB 2KFNA 1NGHA 1F21A 1C1AA 5BREA 5FPEA 3O9SA 4H0PA 1R0AA 4AM6A 3CM5A 2QWNA 3M3ZA 1NWKA 2D5RA 3E9PA 3DJCA 3TU5A 3JSMA 1D9DA 3T1HK 2ZWHA 1A5XA 4IOCL 3LZIA 1V4SA 4E3SA 3R6MA 3WXLA 4DV3K 1WBDA 2P9LB 4JI2K 1SUQA 4B3SK 3AGKA 1VHXA 4YOYA 5EX5A 3BF1A 1MWKA 2E2QA 1S1TA 3KK1A 4HUGA 4HTLA 4DG1A 3OW2M 5EXWA 4DSKA 3QESA 2DY4A 4FJKA 1WN7A 4IO9L 5AQGA 4DTPA 4G9ZA 1S1XA 3RSEA 2QWQA 2NNWA 3BZKA 3BUZB 4CECA 3BY5A 1G15A 4V19S 1QQOA 4DV6K 1SL0A 3WNHA 2NRZA 3TAMA 4CJEA 4DQPA 3PSFA 4CZMA 4AH9A 4IFYA 2ZGYA 2BE2A 2V7ZA 4BVPA 2Y1IA 4ISEA 5CZ2A 4RWTA 2F7TA 4FOIA 3E01A 4WE1A 3NE6A 4E7IA 4A62A 3CCUN 3SLCA 2A1SA 4E1MA 4GNIA 1N36K 3CETA 4N5SA 4JD2A 3ZSRA 2HNZA 3C7NA 4YNQA 1Q7YO 4FPAA 2E2OA 1BU6O 3EE8A 3HYFA 1NGIA 2IAJA 4H0YB 1U6ZA 3FFKB 1E3MA 3PO4A 1VSEA 4PL8A 1XC9A 3THYA 3SPYA 3AARA 4CGIA 4ZHRA 3Q7BA 3JAMO 4FWRA 4CIGA 4QS7A 2Q3SA 4RTFD 4PHTX 3SAFA 4CGGA 4CF8A 4ILHA 5C2DA 4GVEA 3P31A 3VQQA 4B9NA 3QNOA 2HNDA 1RBVA 4WYBA 2YNIA 4C8MA 5ADXH 1I94K 4M3ZA 3VF6A 4W5TA 5T7BA 2XY5A 4A57A 5JMVA 2IOCA 1U4BA 4ELUA 4DSJA 4O4GA 5CZ1A 4DV1K 4H03B 4O5FA 4BRIA 4DR6K 3AVCA 1BI4A 4E1NA 1WOQA 4AHCA 4EHTA 4ZTJA 1IBLK 4CK1A 2P9NA 4WFBL 5HBMA 2OPQA 3LP2A 1KAXA 3U3GA 4JRPA 2GUPA 2O4IA 3U4LA 2QXLA 3SUNA 4CFDA 1NM1A 3HOSA 1HYZA 4KRFA 3VQ8A 2A5XA 2HHWA 2ZJRL 3JXUA 2FSJA 2F9TA 4FPBA 1XC3A 1C0TA 4CIEA 5BRFA 3TAQA 4KI4A 4OPKA 2G8UA 1YJNN 2E2NA 5AQRA 3AO3A 3LDOA 1O13A 5AQJA 3A5MC 4BY9C 4DS5A 1U04A 2KKZA 3TPQA 3CF5L 1RDWX 1JCFA 3U9ZA 3EY1A 2E1YA 1GLAG 4DTUA 3VQBA 4K8ZA 3FZMA 4EP4A 4CGDA 4MQ3A 1D8YA 2Q2RA 4FZZA 4AHTA 3OHRA 2FBYA 4ID1A 3CCVN 2UU9K 3FZLA 1WUAA 2XY7A 5AQIA 4M3TA 1S1WA 1RDAA 3DI6A 3ZSOA 1K6YA 1QQCA 3J80O 1NMNA 3NMUA 5D3GA 2YJEA 4YOWA 5DK5A 3N4QA 1IG9A 3E66A 3AA3A 4KHUA 4OKJA 2YNFA 4NLCA 3VESA 3HTVA 2E88A 3LWLA 1L3UA 4M41A 5TKWA 5AQXA 3TAFA 4CZJA 4N41A 2FBTA 4KHPK 4DQIA 5IWAK 2Z1JA 3LP1A 2DTUA 4BRQA 2ETJA 5FPNA 5H1SQ 4Z4FA 2G8WA 1KVAA 3KZBA 4FVMA 1S5JA 3NAEA 2Y1JA 4FJ5A 3ZX0A 4FJLA 4DFPA 4JI1K 4OJRA 4F3OA 3TI0A 2WOMA 5F1XA 3K2PA 4OPJA 4CZFA 3SNNA 4GW6A 4FM1A 2E20A 4BC5A 1XHZA 3ULDA 3DXKB 1C0MA 4DQ8A 2HMPA 3D7EO 2E4LA 4NXNK 3L6QA 3KLIA 4LF8K 1B9DA 3CJAA 4FM2A 1T7PA 4JK7A 1TKZA 3CJ7A 4JHDA 1OH5A 4M7YA 5J2PA 3AY9A 1J53A 4CD3A 3L2UA 1TKXA 4B3RK 5JVGL 4BWJA 1VQ8N 4JKDA 2AA4A 1C6VA 1VSHA 3KTQA 3ZSWA 3KLHA 5SZTA 4O0IA 4DR2K 3PX0A 2A1RA 4FCYA 3VQ5A 3G6EN 5GADP 1QTMA 4FO0A 2YKMA 4H5TA 4HTUA 3SQ0A 2KZMA 1ZBIA 1RDDA 2X6SA 3M5RA 4DCHA 1NGCA 2GEMA 5HRNA 2QA4N 3J8AA 1ATRA 4O8UA 3CCQN 5C2FA 1A5VA 2BUPA 1QVFM 4BREA 1JCGA 3CCJN 1NKEA 3JS6A 5AQWA 2HOEA 1YJWN 3EZWA 4KFBA 3DXMA 1QZ6A 1NGAA 3THVA 4H8KA 3C0BA 3PSIA 3KWIA 3L0QA 1FW6A 1WSIA 3V1QA 4DR1K 1HR0K 2V51B 1NK7A 4JI3K 4CGFA 2YKNA 4JKBA 4XH4A 4DV2K 3ID8A 3SCXA 4FWLA 4BRLA 1WNSA 4MO5A 3SYZA 1WB9A 4NYNA 1UAXA 3MEGA 3K5OA 4Y0WA 3QEPA 4FK2A 4O55A 3E1YA 4CZKA 3HM8A 5JS2A 5EOYA 1JL2A 4DLEA 5MLCQ 1I3AA 2HBLA 2OCEA 3DLKA 1D4XA 4DFKA 4I6MB 2FXUA 2NRRA 3Q7CA 2LSNA 1CZBA 1TAUA 2P9IA 3O4QA 2HNYA 1NOZA 3RMAA 2DPNA 1J9AA 3OYIA 1X9MA 3AVFA 4CEAA 4M42A 2DFEA 1HKGA 3M8RA 1NK5A 4FWSA 4JKEA 3U9DA 3LP3A 2P51A 3OS0A 3CCLN 4MLHA 3MXIA 1HLUA 1M90O 3U8XA 3A2FA 3MX2A 2WFBA 4HCBA 1CZ9A 4DTOA 4BACA 1WBBA 4NB4A 1RT4A 3O5BA 4CBWA 1Q8IA 3H1VX 5FPMA 4KTQA 4OPHA 5F2RA 2PBDA 3CC4N 4HCCA 2OANA 1XWLA 3C94A 3ITHA 2DFHA 2OPRA 3DRRA 3DLHA 3QBXA 1IG8A 2YHYA 3VA0A 4FSVA 3MX5A 2A3ZA 3AVJA 3WXJA 3NF9A 4GV3A 2GWKA 3EEQA 4BC3A 4E1JA 4H5NA 1X9WA 4CZEA 3L2QA 3ZX3A 2P9PB 3SUPA 3AVNA 4ILGB 1KLNA 4YDUC 1Q9XA 4CEOA 4K43A 3UKRA 2VGMA 1KLMA 4Z4IA 1DTTA 4CJ7A 3L8BA 4EZ6A 4B1ZA 4YORA 1TL3A 3VTIA 3J7ZO 4H0XB 2OPSA 3RWUA 5AFUA 4CF2A 4IZ9A 3AVLA 3P4IA 1VQKN 4RW4A 2NZTA 5CHIA 3F73A 1GLCG 1U47A 4KV8A 2IGIA 1NK6A 4Y1CA 4BRGA 1SZ2A 1NJWA 3AVGA 3FFIA 4BC4A 3DOLA 1JLAA 3LDLA 4IJNA 3LM2A 4DFMA 3AA2A 2AP1A 1NGJA 1WSGA 4OX9K 1LWCA 1Y64A 3V9SA 4JS5A 3ENOA 3CQ8A 2F9WA 3J7AP 4DF4A 4BR9A 4NYFA 3THXB 1UOCA 3PY8A 5FDLA 3HP6A 3WEEA 4DSIA 3HJFA 4CERA 5C12A 3PLAA 3TARA 4W5NA 1HQUA 3C6AA 1RTDA 4R79A 4H4OA 4X65K 1NJYA 3HBTA 3HPGA 4FJHA 3EKSA 2O8CA 1QVGM 3QDKA 2KQ2A 5M1NA 5AQPA 1DKGD 4IG0A 3TR8A 1T3VA 3R9PA 2YNHA 3CMAN 4UQGA 4DV0K 1T6DA 1YT3A 2DFFA 1RTHA 3O6WA 3UKUB 1QHTA 1C1BA 1C0GA 3THXA 3CQXA 5E26A 3LAKA 1L3TA 1JLBA 5IT9O 5AZJB 1SKSA 1CZAN 2Q0RA 1ASVA 1T6CA 2NRTA 2HF3A 1UWBA 3D2EA 4RW9A 1RDCA 4CJPA 3VQ4A 4LFCK 3ZSVA 1TK8A 3ZT0A 1VQ9N 4IOXA 1U45A 4DSLA 3BZCA 4CE9A 3CD6N 1NK0A 4CJQA 3LPTA 1YVUA 4CEEA 1VRTA 1GLFO 3BF3A 3OJUA 3WQTA 5I9EB 3LWMA 3F9KA 3NFAA 1U2VB 3VEOA 2ZGZA 5CYQA 1X3NA 3O1BA 3VEWA 4QCLA 2YI1A 2P5OA 3DMJA 3AV9A 5BRDA 1CXQA 3H08A 4M63C 1JXBA 4QAGA 3P83D 3S3OA 4G1QA 2ASMA 4NCBA 1BISA 5C42A 1NU0A 1GOAA 3P1GA 3AAQA 2UXDK 1NKCA 4YY3K 3VEXA 4WFAL 1HJRA 4WQ4A 3DRPA 1BG3A 3AO5A 3O3HA 3O9QA 4Z4EA 4RG8A 5JLFA 4I2PA 3CM6A 3FZKA 1L3SA 3TWHA 1T05A 4FZXC 4DU3A 3OYFA 2ASOA 3OY9A 2W6KA 4C1NI 4BRAA 5GIOA 3NHGA 3AA4A 3L4IA 2IVPA 3PIPL 4FVUA 3HSCA 5AQLA 1EWQA 4KH5A 5LMUK 2G8IA 1LAVA 2GTDA 3I33A 4B9MA 2W40A 3O8MA 3RMBA 3IDHA 1L3VA 1JLCA 3B8AX 4L3QA 3QEIA 2CGJA 3GOIA 4J2AA 3WXKA 4BRKA 2PYLA 3CJBA 3OYLA 3TABA 1OH8A 3O4WA 4DF8A 4KB1A 1FJGK 5EU7A 4E89A 2NRHA 4EHUA 1SL1A 4JD2B
chains in the Genus database with same CATH topology
4Z4GA 3DI6A 4Q0BA 3LANA 4O0JA 1K6YA 1QQCA 2NUBA 3ZSOA 1QSSA 3VQEA 1TGOA 4Z4CA 5D3GA 3OYGA 1S9EA 4Q5VA 2RN2A 3DM2A 5DK5A 1IG9A 3AA3A 3BGRA 4KHUA 2QXFA 4OKJA 2YNFA 3TAEA 4PWDA 3HPOA 3UIQA 4CESA 3LWLA 4HHTA 1L3UA 2BGGA 4M41A 3TAFA 4J2EA 3V1RA 4TSXA 5HRSA 4N41A 2X78A 2FBTA 4DQIA 4CEQA 2O4GA 2Z1JA 3LP1A 4LH5A 4CK2A 4KI6A 2DTUA 1BHLA 1NK8A 4PY5A 3LPUA 4CHPA 1T8EA 1QE1A 2ETJA 2EHGA 4I9LA 4JS4A 4KHNA 3QLHA 3SUOA 3HSTB 2YHAA 4IDKA 4KTWA 3T19A 2G8WA 4Z4FA 1KVAA 3V9XA 4FVMA 2HHSA 1S5JA 3QEXA 4DTXA 2PYJA 3NAEA 2Y1JA 1VK0A 4FJ5A 4FJLA 4DFPA 4DQRA 2FBXA 4OJRA 4F3OA 1TK5A 4CJFA 3HM9A 5HRRA 4KAZA 4LH4A 3LALA 4NCGA 2HMIA 1VSDA 3AVMA 2X6NA 5KI6A 3V9UA 1SV5A 2Z1HA 3TI0A 2WOMA 1BI4B 3K2PA 5K14A 4OPJA 4B8CA 3IS9A 1TKDA 4M3YA 2HHTA 3SNNA 1JLFA 1TL1A 4GW6A 4RW7A 4FM1A 4F2RA 1XHZA 1RTJA 3NGIA 3LZJA 3ULDA 1KFDA 1C0MA 3NCIA 1SL2A 4OLBA 2QKKA 4CJKA 3OYDA 4RW8A 4DMNA 4NCAA 2E4LA 1REVA 3KLIA 1B9DA 4FM2A 1X9SA 1T7PA 4KTZA 1TKZA 1JKHA 4I2QA 4CFBA 3CFPA 1TV6A 4OLAA 1QSLA 3VA3A 2OZSA 1NJXA 1BCMA 4B08A 5HRPA 5J2PA 4B9LA 2IS3A 4DTJA 1LAWA 4I9QA 1WLJA 1J53A 5E41A 3RR8A 4CGHA 4DTRA 3L2UA 1EX4A 1TKXA 3ZSYA 4FJ7A 4BWJA 4AHSA 3QEWA 4B9VA 1WSHA 1BQNA 1C6VA 4CJWA 3NF8A 4KKOA 1RT2A 1VSHA 3KTQA 3TAPA 3KIOA 3ZSWA 4KB0A 3KLHA 3K5NA 5SZTA 4O0IA 5C25A 3PX0A 3AA5X 3P5JA 3SV4A 2BDPA 2A1RA 4FCYA 3VQ5A 4FK0A 3RMCA 1GOBA 5FRMA 4N47A 4CJ3A 1BL3A 1QTMA 4Z4HA 4HTUA 2YKMA 3SQ0A 4BDPA 3OYAA 4KHQA 2KZMA 1ZBIA 3PX6A 1RDDA 2X6SA 4LSLA 1KRPA 4QOZB 3HT3A 4R5PA 3SUQA 3PO5A 3HPHA 3MECA 5HRNA 1JLEA 2B4JA 4CJTA 2OZMA 1NK9A 4IG3A 3CFRA 3HP9A 2OA8A 3HO1A 1A5VA 4JRQA 1I39A 3NGYA 2PZSA 1C0UA 2HHXA 1B9FA 1ASUA 1ZBHA 4CCHA 3ZT3A 1NKEA 1VSFA 4BDYA 3OYNA 4KFBA 4ZTFA 4W5QA 1ZBUA 2YHBA 3HXMA 4N76A 4KREA 3L2RA 3OYEA 4DFJA 3THVA 1RT3A 4BDZA 2WONA 4H8KA 1IKWA 1EXQA 4B3OA 3TAGA 5J1EA 4BE2A 1S9GA 4FW2A 4KPYA 1YTUA 4FJNA 4GVMA 3VQAA 1WSIA 1W0HA 4CEFA 3V1QA 4FM0A 2FC0A 1U48A 4B9TA 4FJXA 1WAJA 1KVCA 1NK7A 4ELTA 4KHWA 3MXMA 4CGFA 2YKNA 3VQPA 3MEEA 4DQQA 2KZZA 1HYVA 1EKEA 3SCXA 3V9WA 1BQMA 3RR7A 4BE0A 1ZYQA 4ICLA 3K57A 3PV8A 1FK9A 1IKYA 3AVAA 3VQ6A 2BANA 3AO2A 1WNSA 3SYZA 3V9ZA 4LY7A 4NYNA 1LWFA 1UAXA 3KD5E 3MEGA 3K5OA 5J2QA 4HUEA 1QSYA 3T1AA 3MXJA 3QEPA 2G8HA 4FK2A 3S3MA 4O55A 3RMDA 4M3WA 5JS2A 1B92A 1KFSA 1XI1A 5J2MA 2HHQA 1JL2A 4DLEA 1I3AA 4CJUA 1Y97A 3I0RA 3V4IA 3DLKA 1XHXA 4DFKA 3HK2A 3L3UA 3DLRA 2XRIA 4AHUA 3OS1A 4O44A 3WNGA 2RKIA 1HPZA 1RT7A 2LSNA 1CZBA 3D45A 1TAUA 3HL8A 1JLGA 1VSKA 4Z0UA 1TVRA 4B8AB 4FJ9A 1LWEA 3O4QA 1FXXA 2HNYA 3ALYA 3HVRA 4AHVA 3RRGA 3OVNA 3PX4A 4FJIA 2AJQA 4M3UA 3G10A 1SKWA 1NOZA 3RMAA 1J9AA 2XHBA 3EZ5A 3OYIA 4EZ9A 4E0DA 3VQ7A 1HNIA 3AVFA 4CEAA 3SQ1A 1X9MA 4M42A 2DFEA 2Z1GA 2ZQBA 3M8RA 3K5MA 3ZT2A 5KRSA 3NBPA 4OKKA 3BDPA 4DSFA 3QNNA 1NK5A 1BCOA 3S9HA 4L8RB 2KTQA 1ZBLA 2XO7A 4B9UA 4CGJA 1YTAA 4YFUA 3ZT4A 3SI6A 1JLQA 3LP3A 1BGXT 1DLOA 2P51A 3OS0A 3OYMA 3MXIA 3RRHA 3A2FA 3WNEA 3KKSA 3IAYA 1WSJA 3SV3A 2EX3A 4HCBA 4F8RA 1CZ9A 4W5RA 4DTOA 2HB5A 4KO0A 2VWJA 4BACA 2F8TA 1LV5A 2QK9A 2QKBA 1RT4A 4O5BA 3G0ZA 3O3GA 4C8KA 4FLXA 1KCFA 3CYMA 3M8SA 4E7HA 2GUIA 1T03A 1Q8IA 3B6OA 3K58A 1RDBA 4DTSA 4M3XA 4FLZA 4K8XA 4KTQA 4F2SA 3VQCA 3OYJA 4DSEA 1IO2A 1IKXA 4HCCA 4DU4A 2HHUA 4DQSA 1XWLA 3ZT1A 4DLGA 3C6UA 3U6FA 1RBUA 3C94A 1RT1A 1VSMA 1WSFA 2DFHA 3ITHA 3D0PA 3C95A 2OPRA 3DRRA 1Q9YA 4E7JA 3DLHA 2D0AA 2OPPA 1LW2A 3WNFA 4DU1A 4OGEA 5CY4A 3VA0A 2R7YA 1UA1A 4JLHA 3KD1E 4M3RA 3AVJA 3NF9A 4PA1A 2F96A 2ZE2A 3I8DA 3KLGA 3OJSA 1RTIA 3AVIA 3NH1A 1FKOA 1X9WA 1KSPA 1BIUA 4J2DA 1HMVA 3L2QA 4FLTA 1SKRA 1HRHA 1J54A 4CFCA 4CF0A 3SUPA 1HYSA 1JXEA 3AVNA 4CEDA 1NJZA 1KLNA 3ZCMA 3LDSA 3SQ4A 3KKRA 4DWIA 3DLEA 5CYMA 4CEOA 1Q9XA 1J5OA 4IBNA 3B6PA 3I0SA 3V1OA 1KLMA 4KHSA 4Z4IA 1JL1A 1NKBA 1DTTA 2I5JA 2KFNA 4HVJA 1F21A 1C1AA 4E7LA 3L8BA 1VSIA 3TANA 4EZ6A 2KFZA 1R0AA 4MFBA 2HVHA 3SZ2A 3CM5A 1TL3A 4DTMA 3ZSXA 4FJMA 2OPSA 2D5RA 3RWUA 3ZSZA 3AVKA 4B9SA 1RCHA 2HVIA 3JSMA 4DS4A 1D9DA 1IH7A 2GV9A 1A5XA 4CF2A 1Z25A 3DOKA 4FLWA 4AHRA 3LZIA 3AVLA 4E3SA 3KLEA 4FJGA 4RW4A 4BWMA 1KVBA 3F73A 1U47A 3IRXA 3ASMA 1SUQA 1RT6A 2IGIA 4KV8A 1D9FA 3QEVA 2VWKA 1NK6A 4Y1CA 1S1TA 3VN5A 3ZSQA 3KK1A 4HUGA 4FK4A 1NJWA 4CFAA 4DG1A 3AVGA 3L2VA 1LW0A 3VQ9A 5HP1A 3FFIA 2PY5A 4J2BA 4DSKA 3QESA 2HHVA 2DY4A 3DOLA 1JLAA 2D0CA 2VG5A 1W9HA 3QIOA 2XY6A 4FJKA 3CFOA 1EP4A 1WN7A 4FLYA 4DFMA 3AA2A 4DTPA 1S1XA 1WSGA 3DYAA 1LWCA 3V9SA 3O4NA 4JS5A 2D0BA 3CQ8A 4CECA 4DF4A 4CIFA 4DTNA 1RBSA 1G15A 2IDOA 1RBTA 4NYFA 4OVLA 4AILC 1A5WA 1HNVA 1UOCA 1SL0A 3OYHA 3PY8A 3K59A 3WNHA 5FDLA 5I42A 4PUOA 3HP6A 2E6LA 3TAMA 4CJEA 4DQPA 4DSIA 3HJFA 4CERA 3AO4A 3TARA 4W5NA 4AH9A 3NDKA 4C8OA 4IFYA 1HQUA 3DLGA 1N5YA 1GOCA 1VRUA 1RTDA 1WSEA 1U49A 2Y1IA 2BE2A 3HVTA 4H4OA 4FW1A 5CZ2A 1IKVA 3E01A 4WE1A 3QIPA 4CHQA 4CK3A 3NH0A 3MEDA 3NE6A 3RTVA 4E7IA 1NJYA 2ATQA 2OYQA 2JGUA 3HPGA 3OYKA 1ZBFA 5KRTA 4FJHA 1RBRA 1L5UA 1RT5A 2A1SA 4E1MA 3OYCA 4HUFA 2KQ2A 2F8SA 4ELVA 4EP5A 1D5AA 4IFVA 4IG0A 3TR8A 1NOYA 4FYDA 4N5SA 2G8FA 2YNHA 1O1WA 4CJRA 3ZSRA 4H4MA 4UQGA 2HNZA 3QERA 1VSLA 1CLQA 1ITGA 1ASWA 1YT3A 4YNQA 2B5JA 3S3NA 2DFFA 1RNHA 1RTHA 3SJJA 4FZYA 1QHTA 1C1BA 3NF7A 3LAKA 3HYFA 3EYZA 2IAJA 3AVHA 1JLBA 1L3TA 1N6QA 4XIUA 4FLVA 3PO4A 1VSEA 1TK0A 5DMRA 4ID5A 4CF9A 5C24A 1SKSA 2XY8A 5FROA 2RF2A 4CHNA 1XC9A 1ASVA 3SPYA 3M8PA 5HROA 2ITGA 4PQUA 4ZHRA 4CGIA 3JYTA 4IKFA 1UWBA 4RW9A 4CJPA 1RDCA 1X1PA 3LP0A 3VQ4A 4CIGA 4BE1A 4RW6A 3ZSVA 2G8KA 1TK8A 2Q3SA 1KTQA 2P5GA 3ZT0A 3AVBA 4OKEA 1FKPA 3KK3A 5JS1A 4FXDA 4CGGA 4CF8A 1U45A 4DSLA 4I7FA 4F3TA 4CE9A 1NK0A 4FLUA 2KW4A 4CJQA 1VSJA 3LPTA 1YVUA 3V6DA 4CEEA 4CEZA 1VRTA 3VQQA 3MAQA 4B9NA 3OJUA 3QNOA 1S6QA 1RBVA 2HNDA 4C8MA 2YNIA 1RILA 3LWMA 5FRNA 3F9KA 4M3ZA 3NFAA 3QO9A 3AO1A 4E19A 5T7BA 4W5TA 3T3FA 4FJ8A 4KHYA 2XY5A 4FJJA 2IOCA 3KK2A 5CYQA 1U4BA 3KJVA 4ELUA 4CJLA 3QETA 1UA0A 2E6MA 3K5LA 4QCLA 1TAQA 4DSJA 4O4GA 5CZ1A 4Y1DA 3DMJA 3OS2A 2P5OA 3AV9A 4GMJB 1CXQA 3H08A 3SPZA 1JXBA 4QAGA 3P83D 3S3OA 4G1QA 4C8NA 4M45A 4CF1A 4NCBA 3PUFA 1S1VA 5J2NA 3AVCA 4OGCA 1BI4A 4E1NA 1BISA 3U3YA 3NF6A 4CJ5A 5C42A 2IC3A 4AHCA 4ZTJA 3O3FA 4CK1A 1GOAA 5HBMA 4C8LA 1S1UA 2OPQA 2RPIA 3P1GA 4CEBA 3LP2A 3U3GA 4JRPA 2O4IA 1HQEA 1TKTA 3L2WA 5I3UA 2YV0X 1NKCA 2G8VA 2FBVA 2VG7A 3SUNA 1HJRA 3DRPA 4CFDA 2YNGA 3AO5A 2VG6A 3M8QA 1HYZA 4KRFA 3VQ8A 3O3HA 2HHWA 3SQ2A 2Z1IA 4Z4EA 4RG8A 3DRSA 4N56A 2JLEA 4I2PA 3CM6A 1L3SA 1C1CA 1S6PA 5KGXA 1C0TA 5SWMA 3TWHA 1NK4A 2HW3A 4CIEA 1T05A 4FZXC 4DU3A 3TAQA 3OYFA 4OPKA 4KI4A 2G8UA 3OY9A 1MU2A 3QINA 1CXUA 3IG1A 3NGZA 4CJSA 1EETA 3AO3A 3NHGA 4CHZA 3L3VA 4DS5A 3AA4A 5KGWA 2W42A 4LD0A 3C6TA 1U04A 4CJ4A 4F4KA 4LSNA 3NH2A 1WAFA 2G8IA 4CHOA 1LAVA 3VQDA 3EY1A 3V81A 4DTUA 4B9MA 3VQBA 2X74A 4W5OA 4K8ZA 1QS4A 4EP4A 3RMBA 3OYBA 5KTQA 2ZD1A 1L3VA 1Z26A 1JLCA 4CGDA 3QEIA 2P1JA 4E7KA 4MQ3A 1D8YA 4CHYA 4CJVA 4J2AA 3LAMA 4FZZA 4AHTA 3KLFA 2FBYA 4ID1A 2B6AA 3ISNC 2PYLA 1BIZA 3OYLA 4KB1A 3TABA 4DF8A 2XY7A 5HLFA 5EU7A 4E89A 3CG7A 3DLBA 2GBZA 1SL1A 4M3TA 1S1WA 1RDAA 1DTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4G A;  3DI6 A;  4Q0B A;  3LAN A;  4O0J A;  1K6Y A;  1QQC A;  2NUB A;  3ZSO A;  1QSS A;  3VQE A;  1TGO A;  4Z4C A;  5D3G A;  3OYG A;  1S9E A;  4Q5V A;  2RN2 A;  3DM2 A;  5DK5 A;  1IG9 A;  3AA3 A;  3BGR A;  4KHU A;  2QXF A;  4OKJ A;  2YNF A;  3TAE A;  4PWD A;  3HPO A;  3UIQ A;  4CES A;  3LWL A;  4HHT A;  1L3U A;  2BGG A;  4M41 A;  3TAF A;  4J2E A;  3V1R A;  4TSX A;  5HRS A;  4N41 A;  2X78 A;  2FBT A;  4DQI A;  4CEQ A;  2O4G A;  2Z1J A;  3LP1 A;  4LH5 A;  4CK2 A;  4KI6 A;  2DTU A;  1BHL A;  1NK8 A;  4PY5 A;  3LPU A;  4CHP A;  1T8E A;  1QE1 A;  2ETJ A;  2EHG A;  4I9L A;  4JS4 A;  4KHN A;  3QLH A;  3SUO A;  3HST B;  2YHA A;  4IDK A;  4KTW A;  3T19 A;  2G8W A;  4Z4F A;  1KVA A;  3V9X A;  4FVM A;  2HHS A;  1S5J A;  3QEX A;  4DTX A;  2PYJ A;  3NAE A;  2Y1J A;  1VK0 A;  4FJ5 A;  4FJL A;  4DFP A;  4DQR A;  2FBX A;  4OJR A;  4F3O A;  1TK5 A;  4CJF A;  3HM9 A;  5HRR A;  4KAZ A;  4LH4 A;  3LAL A;  4NCG A;  2HMI A;  1VSD A;  3AVM A;  2X6N A;  5KI6 A;  3V9U A;  1SV5 A;  2Z1H A;  3TI0 A;  2WOM A;  1BI4 B;  3K2P A;  5K14 A;  4OPJ A;  4B8C A;  3IS9 A;  1TKD A;  4M3Y A;  2HHT A;  3SNN A;  1JLF A;  1TL1 A;  4GW6 A;  4RW7 A;  4FM1 A;  4F2R A;  1XHZ A;  1RTJ A;  3NGI A;  3LZJ A;  3ULD A;  1KFD A;  1C0M A;  3NCI A;  1SL2 A;  4OLB A;  2QKK A;  4CJK A;  3OYD A;  4RW8 A;  4DMN A;  4NCA A;  2E4L A;  1REV A;  3KLI A;  1B9D A;  4FM2 A;  1X9S A;  1T7P A;  4KTZ A;  1TKZ A;  1JKH A;  4I2Q A;  4CFB A;  3CFP A;  1TV6 A;  4OLA A;  1QSL A;  3VA3 A;  2OZS A;  1NJX A;  1BCM A;  4B08 A;  5HRP A;  5J2P A;  4B9L A;  2IS3 A;  4DTJ A;  1LAW A;  4I9Q A;  1WLJ A;  1J53 A;  5E41 A;  3RR8 A;  4CGH A;  4DTR A;  3L2U A;  1EX4 A;  1TKX A;  3ZSY A;  4FJ7 A;  4BWJ A;  4AHS A;  3QEW A;  4B9V A;  1WSH A;  1BQN A;  1C6V A;  4CJW A;  3NF8 A;  4KKO A;  1RT2 A;  1VSH A;  3KTQ A;  3TAP A;  3KIO A;  3ZSW A;  4KB0 A;  3KLH A;  3K5N A;  5SZT A;  4O0I A;  5C25 A;  3PX0 A;  3AA5 X;  3P5J A;  3SV4 A;  2BDP A;  2A1R A;  4FCY A;  3VQ5 A;  4FK0 A;  3RMC A;  1GOB A;  5FRM A;  4N47 A;  4CJ3 A;  1BL3 A;  1QTM A;  4Z4H A;  4HTU A;  2YKM A;  3SQ0 A;  4BDP A;  3OYA A;  4KHQ A;  2KZM A;  1ZBI A;  3PX6 A;  1RDD A;  2X6S A;  4LSL A;  1KRP A;  4QOZ B;  3HT3 A;  4R5P A;  3SUQ A;  3PO5 A;  3HPH A;  3MEC A;  5HRN A;  1JLE A;  2B4J A;  4CJT A;  2OZM A;  1NK9 A;  4IG3 A;  3CFR A;  3HP9 A;  2OA8 A;  3HO1 A;  1A5V A;  4JRQ A;  1I39 A;  3NGY A;  2PZS A;  1C0U A;  2HHX A;  1B9F A;  1ASU A;  1ZBH A;  4CCH A;  3ZT3 A;  1NKE A;  1VSF A;  4BDY A;  3OYN A;  4KFB A;  4ZTF A;  4W5Q A;  1ZBU A;  2YHB A;  3HXM A;  4N76 A;  4KRE A;  3L2R A;  3OYE A;  4DFJ A;  3THV A;  1RT3 A;  4BDZ A;  2WON A;  4H8K A;  1IKW A;  1EXQ A;  4B3O A;  3TAG A;  5J1E A;  4BE2 A;  1S9G A;  4FW2 A;  4KPY A;  1YTU A;  4FJN A;  4GVM A;  3VQA A;  1WSI A;  1W0H A;  4CEF A;  3V1Q A;  4FM0 A;  2FC0 A;  1U48 A;  4B9T A;  4FJX A;  1WAJ A;  1KVC A;  1NK7 A;  4ELT A;  4KHW A;  3MXM A;  4CGF A;  2YKN A;  3VQP A;  3MEE A;  4DQQ A;  2KZZ A;  1HYV A;  1EKE A;  3SCX A;  3V9W A;  1BQM A;  3RR7 A;  4BE0 A;  1ZYQ A;  4ICL A;  3K57 A;  3PV8 A;  1FK9 A;  1IKY A;  3AVA A;  3VQ6 A;  2BAN A;  3AO2 A;  1WNS A;  3SYZ A;  3V9Z A;  4LY7 A;  4NYN A;  1LWF A;  1UAX A;  3KD5 E;  3MEG A;  3K5O A;  5J2Q A;  4HUE A;  1QSY A;  3T1A A;  3MXJ A;  3QEP A;  2G8H A;  4FK2 A;  3S3M A;  4O55 A;  3RMD A;  4M3W A;  5JS2 A;  1B92 A;  1KFS A;  1XI1 A;  5J2M A;  2HHQ A;  1JL2 A;  4DLE A;  1I3A A;  4CJU A;  1Y97 A;  3I0R A;  3V4I A;  3DLK A;  1XHX A;  4DFK A;  3HK2 A;  3L3U A;  3DLR A;  2XRI A;  4AHU A;  3OS1 A;  4O44 A;  3WNG A;  2RKI A;  1HPZ A;  1RT7 A;  2LSN A;  1CZB A;  3D45 A;  1TAU A;  3HL8 A;  1JLG A;  1VSK A;  4Z0U A;  1TVR A;  4B8A B;  4FJ9 A;  1LWE A;  3O4Q A;  1FXX A;  2HNY A;  3ALY A;  3HVR A;  4AHV A;  3RRG A;  3OVN A;  3PX4 A;  4FJI A;  2AJQ A;  4M3U A;  3G10 A;  1SKW A;  1NOZ A;  3RMA A;  1J9A A;  2XHB A;  3EZ5 A;  3OYI A;  4EZ9 A;  4E0D A;  3VQ7 A;  1HNI A;  3AVF A;  4CEA A;  3SQ1 A;  1X9M A;  4M42 A;  2DFE A;  2Z1G A;  2ZQB A;  3M8R A;  3K5M A;  3ZT2 A;  5KRS A;  3NBP A;  4OKK A;  3BDP A;  4DSF A;  3QNN A;  1NK5 A;  1BCO A;  3S9H A;  4L8R B;  2KTQ A;  1ZBL A;  2XO7 A;  4B9U A;  4CGJ A;  1YTA A;  4YFU A;  3ZT4 A;  3SI6 A;  1JLQ A;  3LP3 A;  1BGX T;  1DLO A;  2P51 A;  3OS0 A;  3OYM A;  3MXI A;  3RRH A;  3A2F A;  3WNE A;  3KKS A;  3IAY A;  1WSJ A;  3SV3 A;  2EX3 A;  4HCB A;  4F8R A;  1CZ9 A;  4W5R A;  4DTO A;  2HB5 A;  4KO0 A;  2VWJ A;  4BAC A;  2F8T A;  1LV5 A;  2QK9 A;  2QKB A;  1RT4 A;  4O5B A;  3G0Z A;  3O3G A;  4C8K A;  4FLX A;  1KCF A;  3CYM A;  3M8S A;  4E7H A;  2GUI A;  1T03 A;  1Q8I A;  3B6O A;  3K58 A;  1RDB A;  4DTS A;  4M3X A;  4FLZ A;  4K8X A;  4KTQ A;  4F2S A;  3VQC A;  3OYJ A;  4DSE A;  1IO2 A;  1IKX A;  4HCC A;  4DU4 A;  2HHU A;  4DQS A;  1XWL A;  3ZT1 A;  4DLG A;  3C6U A;  3U6F A;  1RBU A;  3C94 A;  1RT1 A;  1VSM A;  1WSF A;  2DFH A;  3ITH A;  3D0P A;  3C95 A;  2OPR A;  3DRR A;  1Q9Y A;  4E7J A;  3DLH A;  2D0A A;  2OPP A;  1LW2 A;  3WNF A;  4DU1 A;  4OGE A;  5CY4 A;  3VA0 A;  2R7Y A;  1UA1 A;  4JLH A;  3KD1 E;  4M3R A;  3AVJ A;  3NF9 A;  4PA1 A;  2F96 A;  2ZE2 A;  3I8D A;  3KLG A;  3OJS A;  1RTI A;  3AVI A;  3NH1 A;  1FKO A;  1X9W A;  1KSP A;  1BIU A;  4J2D A;  1HMV A;  3L2Q A;  4FLT A;  1SKR A;  1HRH A;  1J54 A;  4CFC A;  4CF0 A;  3SUP A;  1HYS A;  1JXE A;  3AVN A;  4CED A;  1NJZ A;  1KLN A;  3ZCM A;  3LDS A;  3SQ4 A;  3KKR A;  4DWI A;  3DLE A;  5CYM A;  4CEO A;  1Q9X A;  1J5O A;  4IBN A;  3B6P A;  3I0S A;  3V1O A;  1KLM A;  4KHS A;  4Z4I A;  1JL1 A;  1NKB A;  1DTT A;  2I5J A;  2KFN A;  4HVJ A;  1F21 A;  1C1A A;  4E7L A;  3L8B A;  1VSI A;  3TAN A;  4EZ6 A;  2KFZ A;  1R0A A;  4MFB A;  2HVH A;  3SZ2 A;  3CM5 A;  1TL3 A;  4DTM A;  3ZSX A;  4FJM A;  2OPS A;  2D5R A;  3RWU A;  3ZSZ A;  3AVK A;  4B9S A;  1RCH A;  2HVI A;  3JSM A;  4DS4 A;  1D9D A;  1IH7 A;  2GV9 A;  1A5X A;  4CF2 A;  1Z25 A;  3DOK A;  4FLW A;  4AHR A;  3LZI A;  3AVL A;  4E3S A;  3KLE A;  4FJG A;  4RW4 A;  4BWM A;  1KVB A;  3F73 A;  1U47 A;  3IRX A;  3ASM A;  1SUQ A;  1RT6 A;  2IGI A;  4KV8 A;  1D9F A;  3QEV A;  2VWK A;  1NK6 A;  4Y1C A;  1S1T A;  3VN5 A;  3ZSQ A;  3KK1 A;  4HUG A;  4FK4 A;  1NJW A;  4CFA A;  4DG1 A;  3AVG A;  3L2V A;  1LW0 A;  3VQ9 A;  5HP1 A;  3FFI A;  2PY5 A;  4J2B A;  4DSK A;  3QES A;  2HHV A;  2DY4 A;  3DOL A;  1JLA A;  2D0C A;  2VG5 A;  1W9H A;  3QIO A;  2XY6 A;  4FJK A;  3CFO A;  1EP4 A;  1WN7 A;  4FLY A;  4DFM A;  3AA2 A;  4DTP A;  1S1X A;  1WSG A;  3DYA A;  1LWC A;  3V9S A;  3O4N A;  4JS5 A;  2D0B A;  3CQ8 A;  4CEC A;  4DF4 A;  4CIF A;  4DTN A;  1RBS A;  1G15 A;  2IDO A;  1RBT A;  4NYF A;  4OVL A;  4AIL C;  1A5W A;  1HNV A;  1UOC A;  1SL0 A;  3OYH A;  3PY8 A;  3K59 A;  3WNH A;  5FDL A;  5I42 A;  4PUO A;  3HP6 A;  2E6L A;  3TAM A;  4CJE A;  4DQP A;  4DSI A;  3HJF A;  4CER A;  3AO4 A;  3TAR A;  4W5N A;  4AH9 A;  3NDK A;  4C8O A;  4IFY A;  1HQU A;  3DLG A;  1N5Y A;  1GOC A;  1VRU A;  1RTD A;  1WSE A;  1U49 A;  2Y1I A;  2BE2 A;  3HVT A;  4H4O A;  4FW1 A;  5CZ2 A;  1IKV A;  3E01 A;  4WE1 A;  3QIP A;  4CHQ A;  4CK3 A;  3NH0 A;  3MED A;  3NE6 A;  3RTV A;  4E7I A;  1NJY A;  2ATQ A;  2OYQ A;  2JGU A;  3HPG A;  3OYK A;  1ZBF A;  5KRT A;  4FJH A;  1RBR A;  1L5U A;  1RT5 A;  2A1S A;  4E1M A;  3OYC A;  4HUF A;  2KQ2 A;  2F8S A;  4ELV A;  4EP5 A;  1D5A A;  4IFV A;  4IG0 A;  3TR8 A;  1NOY A;  4FYD A;  4N5S A;  2G8F A;  2YNH A;  1O1W A;  4CJR A;  3ZSR A;  4H4M A;  4UQG A;  2HNZ A;  3QER A;  1VSL A;  1CLQ A;  1ITG A;  1ASW A;  1YT3 A;  4YNQ A;  2B5J A;  3S3N A;  2DFF A;  1RNH A;  1RTH A;  3SJJ A;  4FZY A;  1QHT A;  1C1B A;  3NF7 A;  3LAK A;  3HYF A;  3EYZ A;  2IAJ A;  3AVH A;  1JLB A;  1L3T A;  1N6Q A;  4XIU A;  4FLV A;  3PO4 A;  1VSE A;  1TK0 A;  5DMR A;  4ID5 A;  4CF9 A;  5C24 A;  1SKS A;  2XY8 A;  5FRO A;  2RF2 A;  4CHN A;  1XC9 A;  1ASV A;  3SPY A;  3M8P A;  5HRO A;  2ITG A;  4PQU A;  4ZHR A;  4CGI A;  3JYT A;  4IKF A;  1UWB A;  4RW9 A;  4CJP A;  1RDC A;  1X1P A;  3LP0 A;  3VQ4 A;  4CIG A;  4BE1 A;  4RW6 A;  3ZSV A;  2G8K A;  1TK8 A;  2Q3S A;  1KTQ A;  2P5G A;  3ZT0 A;  3AVB A;  4OKE A;  1FKP A;  3KK3 A;  5JS1 A;  4FXD A;  4CGG A;  4CF8 A;  1U45 A;  4DSL A;  4I7F A;  4F3T A;  4CE9 A;  1NK0 A;  4FLU A;  2KW4 A;  4CJQ A;  1VSJ A;  3LPT A;  1YVU A;  3V6D A;  4CEE A;  4CEZ A;  1VRT A;  3VQQ A;  3MAQ A;  4B9N A;  3OJU A;  3QNO A;  1S6Q A;  1RBV A;  2HND A;  4C8M A;  2YNI A;  1RIL A;  3LWM A;  5FRN A;  3F9K A;  4M3Z A;  3NFA A;  3QO9 A;  3AO1 A;  4E19 A;  5T7B A;  4W5T A;  3T3F A;  4FJ8 A;  4KHY A;  2XY5 A;  4FJJ A;  2IOC A;  3KK2 A;  5CYQ A;  1U4B A;  3KJV A;  4ELU A;  4CJL A;  3QET A;  1UA0 A;  2E6M A;  3K5L A;  4QCL A;  1TAQ A;  4DSJ A;  4O4G A;  5CZ1 A;  4Y1D A;  3DMJ A;  3OS2 A;  2P5O A;  3AV9 A;  4GMJ B;  1CXQ A;  3H08 A;  3SPZ A;  1JXB A;  4QAG A;  3P83 D;  3S3O A;  4G1Q A;  4C8N A;  4M45 A;  4CF1 A;  4NCB A;  3PUF A;  1S1V A;  5J2N A;  3AVC A;  4OGC A;  1BI4 A;  4E1N A;  1BIS A;  3U3Y A;  3NF6 A;  4CJ5 A;  5C42 A;  2IC3 A;  4AHC A;  4ZTJ A;  3O3F A;  4CK1 A;  1GOA A;  5HBM A;  4C8L A;  1S1U A;  2OPQ A;  2RPI A;  3P1G A;  4CEB A;  3LP2 A;  3U3G A;  4JRP A;  2O4I A;  1HQE A;  1TKT A;  3L2W A;  5I3U A;  2YV0 X;  1NKC A;  2G8V A;  2FBV A;  2VG7 A;  3SUN A;  1HJR A;  3DRP A;  4CFD A;  2YNG A;  3AO5 A;  2VG6 A;  3M8Q A;  1HYZ A;  4KRF A;  3VQ8 A;  3O3H A;  2HHW A;  3SQ2 A;  2Z1I A;  4Z4E A;  4RG8 A;  3DRS A;  4N56 A;  2JLE A;  4I2P A;  3CM6 A;  1L3S A;  1C1C A;  1S6P A;  5KGX A;  1C0T A;  5SWM A;  3TWH A;  1NK4 A;  2HW3 A;  4CIE A;  1T05 A;  4FZX C;  4DU3 A;  3TAQ A;  3OYF A;  4OPK A;  4KI4 A;  2G8U A;  3OY9 A;  1MU2 A;  3QIN A;  1CXU A;  3IG1 A;  3NGZ A;  4CJS A;  1EET A;  3AO3 A;  3NHG A;  4CHZ A;  3L3V A;  4DS5 A;  3AA4 A;  5KGW A;  2W42 A;  4LD0 A;  3C6T A;  1U04 A;  4CJ4 A;  4F4K A;  4LSN A;  3NH2 A;  1WAF A;  2G8I A;  4CHO A;  1LAV A;  3VQD A;  3EY1 A;  3V81 A;  4DTU A;  4B9M A;  3VQB A;  2X74 A;  4W5O A;  4K8Z A;  1QS4 A;  4EP4 A;  3RMB A;  3OYB A;  5KTQ A;  2ZD1 A;  1L3V A;  1Z26 A;  1JLC A;  4CGD A;  3QEI A;  2P1J A;  4E7K A;  4MQ3 A;  1D8Y A;  4CHY A;  4CJV A;  4J2A A;  3LAM A;  4FZZ A;  4AHT A;  3KLF A;  2FBY A;  4ID1 A;  2B6A A;  3ISN C;  2PYL A;  1BIZ A;  3OYL A;  4KB1 A;  3TAB A;  4DF8 A;  2XY7 A;  5HLF A;  5EU7 A;  4E89 A;  3CG7 A;  3DLB A;  2GBZ A;  1SL1 A;  4M3T A;  1S1W A;  1RDA A;  1DTQ A; 
#chains in the Genus database with same CATH topology
 4Q0B A;  4O0J A;  1QSS A;  3VQE A;  1N8R O;  1TGO A;  3D2E B;  4X66 K;  3OYG A;  1S9E A;  5AZI A;  4B3M K;  4FWP A;  2P9U A;  4CBU A;  3VEZ A;  4PWD A;  3UIQ A;  4CES A;  2BGG A;  4J2E A;  3V1R A;  4TSX A;  3A5N C;  4IO8 A;  3ENH A;  4JKA A;  5AR0 A;  1QHA A;  4PY5 A;  1QE1 A;  4I9L A;  3QLH A;  3CHW A;  3SUO A;  2YHA A;  4IDK A;  5BN8 A;  3V9X A;  3QEX A;  1VK0 A;  2OTL N;  2RE2 A;  4CJF A;  5HRR A;  3G71 N;  1VSD A;  3AVM A;  4B1W B;  4H0V B;  1SV5 A;  2Z1H A;  3MWP A;  1TKD A;  1BI4 B;  1IBM K;  5ELZ A;  1JLF A;  1KAY A;  1TL1 A;  4F2R A;  3F2K A;  1W97 L;  3P38 A;  2W6L A;  4CJK A;  3OYD A;  4RW8 A;  2I7N A;  3C6H A;  3UKR B;  3RVC A;  4I2Q A;  4CFB A;  3CFP A;  1QSL A;  3VA3 A;  1NJX A;  1Z05 A;  5HRP A;  1ILY A;  4I9Q A;  4DTR A;  1HNW K;  1LCU A;  4B1U B;  3MDQ A;  5AQU A;  4AHS A;  3QEW A;  4B9V A;  1WSH A;  3NF8 A;  1RT2 A;  3K5N A;  4DR3 K;  3AA5 X;  3HRG A;  3P5J A;  4FK0 A;  4Z4H A;  5AQZ A;  3H1Q A;  5AQO A;  1KD1 O;  2E5L K;  3PX6 A;  1ZC6 A;  4QOZ B;  4R5P A;  1NMD A;  2D1K A;  4CJT A;  2ZM6 K;  2OZM A;  2QWM A;  3HP9 A;  3A8Y A;  4JRQ A;  4DV4 K;  1C0U A;  1VSF A;  3CXC M;  4BRC A;  3A0I X;  3CQY A;  2YHB A;  3TSQ A;  3L2R A;  1IJJ A;  5AFU H;  3OYE A;  4DFJ A;  3LM9 A;  1RT3 A;  2NRV A;  3N4P A;  5KQD A;  1EXQ A;  1S9G A;  1S22 A;  4YDU A;  4EFH A;  4CEF A;  4WFN L;  2FC0 A;  4ELT A;  3ZYY X;  3MEE A;  4DQQ A;  4K42 A;  1BOT O;  1EKE A;  2QWO A;  3HOT A;  1BQM A;  3MMV A;  3K57 A;  1FK9 A;  3AVA A;  4O8K A;  2BAN A;  3AO2 A;  4CZI A;  3V9Z A;  1W2B M;  2D4W A;  1QSY A;  3T1A A;  3MXJ A;  4A2A A;  3IMX A;  3VEV A;  2P9S B;  3AAP A;  1NBW A;  1B92 A;  1XI1 A;  2HHQ A;  5AQS A;  2PFU A;  3I0R A;  1OKJ A;  3DLR A;  2XRI A;  4AHU A;  1HPZ A;  1RT7 A;  1VSK A;  4Z0U A;  4B8A B;  4MDB A;  1LWE A;  3HVR A;  4FJI A;  4M3Y A;  4WF9 L;  1YIJ N;  3RSE B;  3D2F A;  4E0D A;  1HNI A;  2I7P A;  2ZJQ L;  2Z1G A;  4AF1 A;  4BRD A;  3ZT2 A;  5KRS A;  3NBP A;  3ID6 A;  3S9H A;  3E9L A;  2XO7 A;  4CGJ A;  1XNR K;  1OVQ A;  1JLQ A;  1BGX T;  4HWI A;  2J4R A;  5AQV A;  3RRH A;  3IAY A;  3SV3 A;  2EX3 A;  4W5R A;  2QWP A;  2F8T A;  2QK9 A;  3IKM A;  3G0Z A;  4C8K A;  5HOO A;  4OLA A;  1KCF A;  1T03 A;  4M3X A;  3B6O A;  2ZF5 O;  1ZBS A;  2P9K A;  4DSE A;  1Q81 O;  3QFP A;  3H3N O;  4DU4 A;  3VEY A;  5M1Q A;  2QEX N;  3K9J A;  4DLG A;  2A41 A;  3C6U A;  1RT1 A;  1Q9Y A;  3D0P A;  4E7J A;  2OPP A;  1XNQ K;  1LW2 A;  3WNF A;  4DU1 A;  1OH7 A;  2R7Y A;  3TSP A;  4CZL A;  3ULE A;  4JLH A;  4K41 A;  3KD1 E;  4U67 L;  3GL1 A;  4PA1 A;  2F96 A;  3I8D A;  3KLG A;  1RTI A;  3AVI A;  3NH1 A;  1YIT N;  1KSP A;  1BIU A;  4J2D A;  4FLT A;  1J54 A;  3TTC A;  4CF0 A;  2UXC K;  1HYS A;  4CED A;  3ZCM A;  3LDS A;  3WUH A;  3SQ4 A;  1J5O A;  4IBN A;  3ZEU B;  2NRW A;  3V1O A;  1HJO A;  1KQS M;  1JL1 A;  5BN9 A;  2I5J A;  2CGL A;  4GV9 A;  3WXM B;  3TAN A;  3CC7 N;  2KFZ A;  2HVH A;  4MLE A;  4FJM A;  3ULE B;  3ZSZ A;  3AVK A;  4B9S A;  2HVI A;  4DS4 A;  1IH7 A;  2YX6 A;  3QIC A;  2GV9 A;  3DOK A;  1YAG A;  2HBK A;  2YCH A;  1KAZ A;  3GE1 A;  1KVB A;  1RT6 A;  1NGF A;  3QEV A;  3ZSQ A;  4FK4 A;  3THW A;  4CZG A;  3L2V A;  1LW0 A;  3VQ9 A;  4GY2 B;  5EY4 A;  5KQ8 A;  2D0C A;  3QIO A;  2XY6 A;  3CFO A;  4BRN A;  4FLY A;  3SBG A;  3DYA A;  3O4N A;  4DKW A;  4CIF A;  3CPE A;  1RBS A;  4PL7 A;  3UKU A;  4AIL C;  1HNV A;  3K59 A;  5I42 A;  4KH6 A;  4QS8 A;  3AO4 A;  4KH4 A;  3VEN A;  3M6G A;  3S41 A;  3NDK A;  4C8O A;  2YHX A;  1VRU A;  1WSE A;  2WC9 A;  3HVT A;  3MCA B;  4FW1 A;  2NRX A;  4CK3 A;  3RTV A;  3DWL A;  1OH6 A;  2ATQ A;  3SAG A;  2JGU A;  4A61 A;  3OYK A;  5KRT A;  3K0S A;  4A2B A;  1RT5 A;  4HUF A;  2F8S A;  1D5A A;  4IFV A;  3SK3 A;  4FYD A;  4JI6 K;  3D6R A;  3H45 C;  1O1W A;  1CLQ A;  3S3N A;  1RNH A;  5M1O A;  1E4F T;  1U2V A;  3NF7 A;  3H46 O;  1NLV A;  3CCS N;  3EYZ A;  3AVH A;  1R59 O;  4XIU A;  4FLV A;  1TK0 A;  3W0L A;  4DV5 K;  2A40 A;  5DMR A;  2QI2 A;  1LOT B;  4ID5 A;  5B8H A;  3VPZ A;  2XY8 A;  4CHN A;  5HRO A;  3M8P A;  2ITG A;  1VQ4 N;  5KPR A;  1X1P A;  4BE1 A;  4RW6 A;  4JKH A;  2G8K A;  2Q0U A;  2P5G A;  4B1Y B;  4OKE A;  1FKP A;  5JS1 A;  4FXD A;  4AM7 A;  4F3T A;  1XMQ K;  5JIC A;  4FLU A;  2KW4 A;  1VSJ A;  4B9Q A;  4XH5 A;  3V6D A;  3A5O C;  3MAQ A;  1S6Q A;  1RIL A;  3O80 A;  1VAZ A;  3QO9 A;  4E19 A;  4FJJ A;  3KJV A;  4BGA A;  4BR5 A;  4Y1D A;  3OS2 A;  4GMJ B;  4BRF A;  4IDH A;  3PUF A;  1RDU A;  4OGC A;  1EQY A;  2YHW A;  1KXP A;  1XUP O;  3U3Y A;  3NF6 A;  4CJ5 A;  2IC3 A;  1K8K B;  5E84 A;  5KPZ A;  5EVZ A;  1Q82 O;  4IEE A;  1HQE A;  2UUA K;  3L2W A;  3UB5 A;  2G8V A;  2FBV A;  2VYP A;  4B1X B;  4OPA A;  1EWR A;  1BO5 O;  2Z1I A;  4FOE A;  3DRS A;  2P9S A;  3I56 N;  4MDA A;  1YI2 N;  4BG9 A;  1C1C A;  2GWJ A;  2Q36 A;  5SWM A;  1VQP N;  2Q1N A;  3OBW A;  4I6M A;  1MU2 A;  3WQU A;  3QIN A;  3IG1 A;  4PKG A;  4CJS A;  4JI0 K;  1P90 A;  3NVK A;  4CHZ A;  3L3V A;  3MCP A;  3FZF A;  4LD0 A;  4JKG B;  3NH2 A;  4JKC A;  3TTF A;  5KPT A;  3R8E A;  3SBT A;  4X62 K;  4W5O A;  1QS4 A;  4LF7 K;  3OYB A;  3D2F B;  2ZD1 A;  2HBJ A;  4CHY A;  4CZH A;  1BIZ A;  3T7Z A;  2GX9 A;  4C1N K;  2GBZ A;  5AZJ A;  1SAZ A;  3K5M A;  1H1V A;  4GKJ K;  3R1X A;  3LAN A;  2NUB A;  4BQZ A;  2D0P A;  4Q5V A;  4MO4 A;  5LL6 Z;  3BGR A;  2P9L A;  4JKG A;  3TAE A;  2WBN A;  4HHT A;  2RHK A;  4FWO A;  4NLB A;  1VQO N;  5HRS A;  2P9K B;  4LH5 A;  1BHL A;  1NK8 A;  3LPU A;  5BPN A;  1T8E A;  2EHG A;  2W41 A;  3MN7 A;  3MN9 A;  1Q18 A;  3QFU A;  3VGL A;  1S3X A;  2O8E B;  5BPM A;  1QQM A;  3VMF B;  1GLB G;  3HM9 A;  1TK5 A;  4KAZ A;  4LH4 A;  3LAL A;  4NCG A;  3WXI A;  2HMI A;  1GLJ O;  2FF3 B;  3O9U A;  2HHT A;  1HKC A;  3O9T A;  3NCI A;  4IOA L;  2BTF A;  4DMN A;  1ZXO A;  2QWL A;  1REV A;  1X9S A;  4LC9 B;  4KTZ A;  1C0F A;  2V7Y A;  1G99 A;  1BCM A;  4B08 A;  4BR2 A;  2IS3 A;  4DTJ A;  1LAW A;  2WUS A;  5E41 A;  1J6Z A;  4CGH A;  4YOU A;  5GAH P;  3ZSY A;  4FJ7 A;  2O8D A;  2KHO A;  2O8B A;  4CJW A;  4KB0 A;  3TAP A;  3KIO A;  4EAH D;  5C25 A;  4DUZ K;  2D0O A;  1GOB A;  2WTU A;  3A5L C;  1GLE G;  3OYA A;  4KHQ A;  4NO7 A;  1KRP A;  3HT3 A;  1JLE A;  2B4J A;  1MA9 B;  1NG9 A;  1X3M A;  1NK9 A;  4IG3 A;  2OA8 A;  3QBW A;  2PZS A;  2HHX A;  3KHY A;  1B9F A;  1ASU A;  4FWN A;  5BRH A;  4CCH A;  3MWT A;  4BDY A;  3CJ9 A;  4ZTF A;  3I8B A;  4W5Q A;  1ZBU A;  3HXM A;  2JWK A;  4N76 A;  5AZI B;  4BQL A;  4BDZ A;  1V4T A;  3LDQ A;  1IKW A;  3UE5 A;  4B3O A;  3TAG A;  5J1E A;  4BE2 A;  1YTU A;  4FW2 A;  4GVM A;  4IFE A;  1VQL N;  2OTJ N;  5AQY A;  1NGE A;  4KBO A;  3EKU A;  5BPL A;  1U48 A;  4FL9 A;  5C0Y A;  4FJX A;  1WAJ A;  2QW9 A;  4KHW A;  5AJ3 K;  3VQP A;  3IFR A;  3V9W A;  1ZYQ A;  4ICL A;  1MWM A;  3VQ6 A;  5C15 A;  4LY7 A;  2QWR A;  4BRP A;  4CI6 A;  1QQN A;  4JK8 A;  2G8H A;  3S3M A;  3OTO K;  4XEI A;  3LDN A;  4M3W A;  1J5E K;  5AQT A;  1KFS A;  3VET A;  4CJU A;  1Y97 A;  1ESV A;  1NJI O;  5GAE P;  1HNZ K;  3L3U A;  1OVY A;  4PKI A;  3CJC A;  3WNG A;  3HL8 A;  5TKY A;  1TVR A;  4FJ9 A;  1BWF O;  1FXX A;  4AHV A;  2AJQ A;  5AQH A;  4M3U A;  4BR0 A;  1SKW A;  3LL3 A;  3FR0 A;  3J7Y P;  3EZ5 A;  4WCE L;  4EZ9 A;  4BGB A;  3SQ1 A;  4ISG A;  2CH6 A;  3CJ1 A;  5DM6 L;  4FWQ A;  4JAX A;  3WEE B;  4DSF A;  3QNN A;  1ZBL A;  4B9U A;  3SI6 A;  4YFU A;  3ZT4 A;  1DLO A;  1N33 K;  3CC2 N;  5A2Q O;  3OYM A;  1NGG A;  3WNE A;  2GEL A;  1WSJ A;  3BEX A;  4F8R A;  5F0X A;  3VTH A;  2QKB A;  1NGB A;  3PIO L;  1LV5 A;  4O5B A;  1IV0 A;  1K8K A;  2HW3 A;  2KZZ A;  2GUI A;  2VQF K;  1RDB A;  1TYQ B;  4K8X A;  3CCE N;  2FSK A;  3VQC A;  3OYJ A;  2HST A;  1IO2 A;  1NGD A;  2HHU A;  4DQS A;  3ZT1 A;  3U6F A;  1RBU A;  1VSM A;  1WSF A;  3C95 A;  2D0A A;  4OGE A;  3T1Y K;  4B3T K;  1UA1 A;  4M3R A;  3ATV A;  5JVH L;  5GIP A;  1W7A A;  1N32 K;  3VER A;  2VCP A;  3CME N;  1HRH A;  4CFC A;  2VQE K;  1NJZ A;  3DXK A;  4J8F A;  2ASP A;  4BG8 A;  1XMO K;  4DWI A;  5AQK A;  3B6P A;  1T44 A;  4KHS A;  3O08 A;  1NKB A;  4HVJ A;  4E7L A;  4M7X A;  1VSI A;  1GLL O;  4B1V A;  1RFQ A;  4MFB A;  3SZ2 A;  4DTM A;  2KLA A;  3ZSX A;  4LF6 K;  4JK9 A;  4BRM A;  1RCH A;  5AQF A;  4JI4 K;  4BRH A;  1Z25 A;  4FLW A;  2H3G X;  4AHR A;  1HUX A;  3KLE A;  5LJW A;  4FJG A;  4BWM A;  3IRX A;  1YVN A;  2P9U B;  3ASM A;  3EL2 A;  4K25 A;  2P9N B;  1D9F A;  4AQY K;  2VWK A;  4F9O A;  2V52 B;  3VN5 A;  1M1K O;  3E9O A;  4CFA A;  5HP1 A;  3TTD A;  2PY5 A;  4J2B A;  2HHV A;  2O8F A;  2VG5 A;  1W9H A;  1EP4 A;  4H0O A;  4JN4 A;  3FGU A;  2VWB A;  5AQN A;  4JKF A;  4YHH K;  3GBT A;  4X64 K;  1RGI A;  3EN9 A;  2D0B A;  2O8E A;  4DR5 K;  4BR4 A;  4DTN A;  1DEJ A;  4WQ4 C;  2IDO A;  1RBT A;  4OVL A;  1A5W A;  3OYH A;  4ILJ A;  4PUO A;  3AGR A;  2E6L A;  2VGN A;  1MDU B;  1HKB A;  4LF9 K;  2A6A A;  3DLG A;  1N5Y A;  1GOC A;  1U49 A;  1S72 N;  1IKV A;  4CHQ A;  3NH0 A;  3QIP A;  4FWK A;  3MED A;  3OBY A;  4JI8 K;  2OYQ A;  1ZBF A;  1RBR A;  1L5U A;  3OYC A;  4ELV A;  4EP5 A;  1NOY A;  2G8F A;  4XH1 A;  1XQS C;  5GAG P;  4H4M A;  4CJR A;  3H6E A;  1BUP A;  1VSL A;  3QER A;  1ITG A;  4H5R A;  1ASW A;  4LFB K;  2B5J A;  4FZY A;  3SJJ A;  1N6Q A;  4IEI A;  4CF9 A;  3I55 N;  3KK7 A;  5C24 A;  3C65 A;  5FRO A;  2RF2 A;  4PQU A;  5AQQ A;  4IXC A;  1NNE A;  3F5T A;  1P8Z A;  1TUY A;  4CBX A;  3JYT A;  4IKF A;  3SMS A;  3ZEU A;  3LP0 A;  5CR4 A;  3J81 O;  2ITM A;  2JWL A;  1KTQ A;  4IJA A;  3AVB A;  3KVG A;  3R3L A;  3KK3 A;  4I7F A;  3FE1 A;  3P39 A;  4FWM A;  4CEZ A;  1DGK N;  5FRN A;  3ZLJ A;  5JLH A;  3K9K A;  1K73 O;  1JJ2 M;  3AO1 A;  3T3F A;  4FJ8 A;  4KHY A;  4YOX A;  2A42 A;  3KK2 A;  1ATN A;  3SMP A;  4CJL A;  3QET A;  1UA0 A;  2E6M A;  4BRO A;  3K5L A;  1TAQ A;  3CPW M;  3THW B;  3SPZ A;  4C8N A;  4M45 A;  4CF1 A;  1S1V A;  5J2N A;  1SQK A;  4YOT A;  3H3O B;  2F4V K;  3O3F A;  4C8L A;  1S1U A;  2RPI A;  2NLX A;  4CEB A;  1TKT A;  1BA1 A;  5I3U A;  2YV0 X;  2IIR A;  1SS6 A;  1IBK K;  3VF2 A;  2VG7 A;  1EO1 A;  2YNG A;  3IUC A;  2VG6 A;  3M8Q A;  4RCH A;  1HPM A;  3SQ2 A;  4N56 A;  2JLE A;  2IVO A;  1S6P A;  5KGX A;  1NK4 A;  3ATU A;  1CXU A;  3O9R A;  3NGZ A;  1JCE A;  1EET A;  5KGW A;  2W42 A;  2P9P A;  3C6T A;  5FLX O;  4CJ4 A;  4F4K A;  1VQ7 N;  3CI5 A;  4LSN A;  1WAF A;  3F9M A;  4CHO A;  3VQD A;  3V81 A;  4GV6 A;  4BR7 A;  3CCM N;  2X74 A;  2FLO A;  5C10 A;  5M1P A;  3ZET B;  5KTQ A;  4H5V A;  1Z26 A;  2QM1 A;  4JNE A;  4K0K K;  2P1J A;  3SAH A;  4E7K A;  2E8A A;  4CJV A;  4GKK K;  3CER A;  3LAM A;  3KLF A;  2B6A A;  3ISN C;  5BR8 K;  5HLF A;  3CG7 A;  3DLB A;  4A59 A;  1DTQ A;  4H5W A;  2QTD A;  4Z4G A;  3W3D A;  4QS9 A;  3DXM B;  4Z4C A;  4JV5 K;  2RN2 A;  3DM2 A;  2QXF A;  1YHQ N;  3HPO A;  4YOV A;  1TYQ A;  1VQ5 N;  2X78 A;  4CEQ A;  2O4G A;  1K9M O;  4KI6 A;  4CK2 A;  4CHP A;  4JS4 A;  4KHN A;  3HST B;  1X9J A;  4KTW A;  3T19 A;  1KC8 O;  2HHS A;  1GLD G;  3NVM A;  4DTX A;  2PYJ A;  4A5B A;  2O8D B;  4DQR A;  3MN6 A;  2FBX A;  2O8B B;  1QZ5 A;  1ATS A;  2X6N A;  5KI6 A;  3V9U A;  3QB0 A;  5K14 A;  4B8C A;  3IS9 A;  4RW7 A;  4BC2 A;  1RTJ A;  3NGI A;  3LZJ A;  3VOV A;  3WT0 A;  1KFD A;  1E4G T;  1SL2 A;  4OLB A;  2QKK A;  2CGK A;  3EO3 A;  4NCA A;  4CW7 B;  1HNX K;  1VQN N;  4DHY A;  1JKH A;  1TV6 A;  2O8C B;  2OZS A;  2P9I B;  4B9L A;  3CIP A;  4Z94 A;  1WLJ A;  3RR8 A;  1EX4 A;  3M1F A;  1YF5 L;  3ZX2 A;  1BQN A;  1YUW A;  4KKO A;  4CD1 A;  2BDP A;  1HX1 A;  3SV4 A;  3RMC A;  5FRM A;  4N47 A;  4CJ3 A;  1BL3 A;  4BDP A;  1Q86 O;  4PKH A;  3THY B;  4C23 A;  4LSL A;  3SUQ A;  3PO5 A;  3HPH A;  3MEC A;  3ZET A;  2IVN A;  4DV7 K;  4DR7 K;  2UXB K;  3LDP A;  2UUC K;  3CFR A;  3HO1 A;  2Q31 A;  3TSU A;  1I39 A;  3NGY A;  3QML A;  3G25 A;  2FF6 A;  5FPD A;  5CE3 A;  1ZBH A;  3ZT3 A;  5AQM A;  1N34 K;  4WQ5 A;  4JYA K;  5ADX A;  3OYN A;  3L4Q A;  4KRE A;  2UUB K;  3VF4 A;  5LY3 A;  5LMN K;  4LF5 K;  2WON A;  3DAW A;  4KPY A;  4FJN A;  3VQA A;  3MK6 A;  1W0H A;  4OO1 J;  4FM0 A;  4B9T A;  2HHH K;  1KVC A;  4DUY K;  3MXM A;  1VQ6 N;  1HYV A;  4CVN E;  5M1K A;  3RR7 A;  4BE0 A;  3PV8 A;  3GDQ A;  1IKY A;  3VGK A;  4LF4 K;  3FZH A;  1LWF A;  3KD5 E;  3BP8 A;  5J2Q A;  4HUE A;  4ISF A;  1YXQ A;  3RMD A;  3G4S N;  3KWG A;  1YJ9 N;  3DLL L;  5J2M A;  2ZJP L;  1K8A O;  3V4I A;  1XHX A;  3HK2 A;  3O1W A;  3OS1 A;  2HF4 A;  3T69 A;  4O44 A;  2RKI A;  3D45 A;  1JLG A;  3ALY A;  3RRG A;  3HZ6 A;  3OVN A;  3PX4 A;  5BR9 A;  3G10 A;  2XHB A;  2E1Z A;  4LFA K;  2YJF A;  3VQ7 A;  1VQM N;  2ZQB A;  4OKK A;  3BDP A;  2BH1 A;  3OA9 A;  1BCO A;  2CH5 A;  4L8R B;  2KTQ A;  1YTA A;  2FSN A;  4BVO A;  4IWV A;  3ENB A;  4A5A A;  3KKS A;  2E2P A;  5HL7 L;  4JEP A;  5LJV A;  2HB5 A;  4KO0 A;  2VWJ A;  4DB3 A;  5DM7 L;  3O3G A;  4FLX A;  3CYM A;  3M8S A;  4E7H A;  3K58 A;  4DTS A;  3VGM A;  4FLZ A;  4F2S A;  4EIA A;  4JI5 K;  3MN5 A;  4WQ5 C;  1IKX A;  3HI0 A;  5GIN A;  1BA0 A;  3SJH A;  2PAV A;  1DT9 A;  5M1F A;  5CY4 A;  4JI7 K;  4NXM K;  3CCR N;  4H0T B;  2ZE2 A;  3C7N B;  3OJS A;  3EE9 A;  1FKO A;  1TUU A;  2HBM A;  2Q97 A;  1Z6R A;  1HMV A;  1SKR A;  1BDG A;  4U7B A;  3GG4 A;  1JXE A;  4DR4 K;  3KKR A;  3DLE A;  5CYM A;  4UY8 O;  3I0S A;  2EWS A;  3FLC O;  2UYT A;  2O8F B;  4JHD B;  2KFN A;  1NGH A;  1F21 A;  1C1A A;  5BRE A;  5FPE A;  3O9S A;  4H0P A;  1R0A A;  4AM6 A;  3CM5 A;  2QWN A;  3M3Z A;  1NWK A;  2D5R A;  3E9P A;  3DJC A;  3TU5 A;  3JSM A;  1D9D A;  3T1H K;  2ZWH A;  1A5X A;  4IOC L;  3LZI A;  1V4S A;  4E3S A;  3R6M A;  3WXL A;  4DV3 K;  1WBD A;  2P9L B;  4JI2 K;  1SUQ A;  4B3S K;  3AGK A;  1VHX A;  4YOY A;  5EX5 A;  3BF1 A;  1MWK A;  2E2Q A;  1S1T A;  3KK1 A;  4HUG A;  4HTL A;  4DG1 A;  3OW2 M;  5EXW A;  4DSK A;  3QES A;  2DY4 A;  4FJK A;  1WN7 A;  4IO9 L;  5AQG A;  4DTP A;  4G9Z A;  1S1X A;  3RSE A;  2QWQ A;  2NNW A;  3BZK A;  3BUZ B;  4CEC A;  3BY5 A;  1G15 A;  4V19 S;  1QQO A;  4DV6 K;  1SL0 A;  3WNH A;  2NRZ A;  3TAM A;  4CJE A;  4DQP A;  3PSF A;  4CZM A;  4AH9 A;  4IFY A;  2ZGY A;  2BE2 A;  2V7Z A;  4BVP A;  2Y1I A;  4ISE A;  5CZ2 A;  4RWT A;  2F7T A;  4FOI A;  3E01 A;  4WE1 A;  3NE6 A;  4E7I A;  4A62 A;  3CCU N;  3SLC A;  2A1S A;  4E1M A;  4GNI A;  1N36 K;  3CET A;  4N5S A;  4JD2 A;  3ZSR A;  2HNZ A;  3C7N A;  4YNQ A;  1Q7Y O;  4FPA A;  2E2O A;  1BU6 O;  3EE8 A;  3HYF A;  1NGI A;  2IAJ A;  4H0Y B;  1U6Z A;  3FFK B;  1E3M A;  3PO4 A;  1VSE A;  4PL8 A;  1XC9 A;  3THY A;  3SPY A;  3AAR A;  4CGI A;  4ZHR A;  3Q7B A;  3JAM O;  4FWR A;  4CIG A;  4QS7 A;  2Q3S A;  4RTF D;  4PHT X;  3SAF A;  4CGG A;  4CF8 A;  4ILH A;  5C2D A;  4GVE A;  3P31 A;  3VQQ A;  4B9N A;  3QNO A;  2HND A;  1RBV A;  4WYB A;  2YNI A;  4C8M A;  5ADX H;  1I94 K;  4M3Z A;  3VF6 A;  4W5T A;  5T7B A;  2XY5 A;  4A57 A;  5JMV A;  2IOC A;  1U4B A;  4ELU A;  4DSJ A;  4O4G A;  5CZ1 A;  4DV1 K;  4H03 B;  4O5F A;  4BRI A;  4DR6 K;  3AVC A;  1BI4 A;  4E1N A;  1WOQ A;  4AHC A;  4EHT A;  4ZTJ A;  1IBL K;  4CK1 A;  2P9N A;  4WFB L;  5HBM A;  2OPQ A;  3LP2 A;  1KAX A;  3U3G A;  4JRP A;  2GUP A;  2O4I A;  3U4L A;  2QXL A;  3SUN A;  4CFD A;  1NM1 A;  3HOS A;  1HYZ A;  4KRF A;  3VQ8 A;  2A5X A;  2HHW A;  2ZJR L;  3JXU A;  2FSJ A;  2F9T A;  4FPB A;  1XC3 A;  1C0T A;  4CIE A;  5BRF A;  3TAQ A;  4KI4 A;  4OPK A;  2G8U A;  1YJN N;  2E2N A;  5AQR A;  3AO3 A;  3LDO A;  1O13 A;  5AQJ A;  3A5M C;  4BY9 C;  4DS5 A;  1U04 A;  2KKZ A;  3TPQ A;  3CF5 L;  1RDW X;  1JCF A;  3U9Z A;  3EY1 A;  2E1Y A;  1GLA G;  4DTU A;  3VQB A;  4K8Z A;  3FZM A;  4EP4 A;  4CGD A;  4MQ3 A;  1D8Y A;  2Q2R A;  4FZZ A;  4AHT A;  3OHR A;  2FBY A;  4ID1 A;  3CCV N;  2UU9 K;  3FZL A;  1WUA A;  2XY7 A;  5AQI A;  4M3T A;  1S1W A;  1RDA A;  3DI6 A;  3ZSO A;  1K6Y A;  1QQC A;  3J80 O;  1NMN A;  3NMU A;  5D3G A;  2YJE A;  4YOW A;  5DK5 A;  3N4Q A;  1IG9 A;  3E66 A;  3AA3 A;  4KHU A;  4OKJ A;  2YNF A;  4NLC A;  3VES A;  3HTV A;  2E88 A;  3LWL A;  1L3U A;  4M41 A;  5TKW A;  5AQX A;  3TAF A;  4CZJ A;  4N41 A;  2FBT A;  4KHP K;  4DQI A;  5IWA K;  2Z1J A;  3LP1 A;  2DTU A;  4BRQ A;  2ETJ A;  5FPN A;  5H1S Q;  4Z4F A;  2G8W A;  1KVA A;  3KZB A;  4FVM A;  1S5J A;  3NAE A;  2Y1J A;  4FJ5 A;  3ZX0 A;  4FJL A;  4DFP A;  4JI1 K;  4OJR A;  4F3O A;  3TI0 A;  2WOM A;  5F1X A;  3K2P A;  4OPJ A;  4CZF A;  3SNN A;  4GW6 A;  4FM1 A;  2E20 A;  4BC5 A;  1XHZ A;  3ULD A;  3DXK B;  1C0M A;  4DQ8 A;  2HMP A;  3D7E O;  2E4L A;  4NXN K;  3L6Q A;  3KLI A;  4LF8 K;  1B9D A;  3CJA A;  4FM2 A;  1T7P A;  4JK7 A;  1TKZ A;  3CJ7 A;  4JHD A;  1OH5 A;  4M7Y A;  5J2P A;  3AY9 A;  1J53 A;  4CD3 A;  3L2U A;  1TKX A;  4B3R K;  5JVG L;  4BWJ A;  1VQ8 N;  4JKD A;  2AA4 A;  1C6V A;  1VSH A;  3KTQ A;  3ZSW A;  3KLH A;  5SZT A;  4O0I A;  4DR2 K;  3PX0 A;  2A1R A;  4FCY A;  3VQ5 A;  3G6E N;  5GAD P;  1QTM A;  4FO0 A;  2YKM A;  4H5T A;  4HTU A;  3SQ0 A;  2KZM A;  1ZBI A;  1RDD A;  2X6S A;  3M5R A;  4DCH A;  1NGC A;  2GEM A;  5HRN A;  2QA4 N;  3J8A A;  1ATR A;  4O8U A;  3CCQ N;  5C2F A;  1A5V A;  2BUP A;  1QVF M;  4BRE A;  1JCG A;  3CCJ N;  1NKE A;  3JS6 A;  5AQW A;  2HOE A;  1YJW N;  3EZW A;  4KFB A;  3DXM A;  1QZ6 A;  1NGA A;  3THV A;  4H8K A;  3C0B A;  3PSI A;  3KWI A;  3L0Q A;  1FW6 A;  1WSI A;  3V1Q A;  4DR1 K;  1HR0 K;  2V51 B;  1NK7 A;  4JI3 K;  4CGF A;  2YKN A;  4JKB A;  4XH4 A;  4DV2 K;  3ID8 A;  3SCX A;  4FWL A;  4BRL A;  1WNS A;  4MO5 A;  3SYZ A;  1WB9 A;  4NYN A;  1UAX A;  3MEG A;  3K5O A;  4Y0W A;  3QEP A;  4FK2 A;  4O55 A;  3E1Y A;  4CZK A;  3HM8 A;  5JS2 A;  5EOY A;  1JL2 A;  4DLE A;  5MLC Q;  1I3A A;  2HBL A;  2OCE A;  3DLK A;  1D4X A;  4DFK A;  4I6M B;  2FXU A;  2NRR A;  3Q7C A;  2LSN A;  1CZB A;  1TAU A;  2P9I A;  3O4Q A;  2HNY A;  1NOZ A;  3RMA A;  2DPN A;  1J9A A;  3OYI A;  1X9M A;  3AVF A;  4CEA A;  4M42 A;  2DFE A;  1HKG A;  3M8R A;  1NK5 A;  4FWS A;  4JKE A;  3U9D A;  3LP3 A;  2P51 A;  3OS0 A;  3CCL N;  4MLH A;  3MXI A;  1HLU A;  1M90 O;  3U8X A;  3A2F A;  3MX2 A;  2WFB A;  4HCB A;  1CZ9 A;  4DTO A;  4BAC A;  1WBB A;  4NB4 A;  1RT4 A;  3O5B A;  4CBW A;  1Q8I A;  3H1V X;  5FPM A;  4KTQ A;  4OPH A;  5F2R A;  2PBD A;  3CC4 N;  4HCC A;  2OAN A;  1XWL A;  3C94 A;  3ITH A;  2DFH A;  2OPR A;  3DRR A;  3DLH A;  3QBX A;  1IG8 A;  2YHY A;  3VA0 A;  4FSV A;  3MX5 A;  2A3Z A;  3AVJ A;  3WXJ A;  3NF9 A;  4GV3 A;  2GWK A;  3EEQ A;  4BC3 A;  4E1J A;  4H5N A;  1X9W A;  4CZE A;  3L2Q A;  3ZX3 A;  2P9P B;  3SUP A;  3AVN A;  4ILG B;  1KLN A;  4YDU C;  1Q9X A;  4CEO A;  4K43 A;  3UKR A;  2VGM A;  1KLM A;  4Z4I A;  1DTT A;  4CJ7 A;  3L8B A;  4EZ6 A;  4B1Z A;  4YOR A;  1TL3 A;  3VTI A;  3J7Z O;  4H0X B;  2OPS A;  3RWU A;  5AFU A;  4CF2 A;  4IZ9 A;  3AVL A;  3P4I A;  1VQK N;  4RW4 A;  2NZT A;  5CHI A;  3F73 A;  1GLC G;  1U47 A;  4KV8 A;  2IGI A;  1NK6 A;  4Y1C A;  4BRG A;  1SZ2 A;  1NJW A;  3AVG A;  3FFI A;  4BC4 A;  3DOL A;  1JLA A;  3LDL A;  4IJN A;  3LM2 A;  4DFM A;  3AA2 A;  2AP1 A;  1NGJ A;  1WSG A;  4OX9 K;  1LWC A;  1Y64 A;  3V9S A;  4JS5 A;  3ENO A;  3CQ8 A;  2F9W A;  3J7A P;  4DF4 A;  4BR9 A;  4NYF A;  3THX B;  1UOC A;  3PY8 A;  5FDL A;  3HP6 A;  3WEE A;  4DSI A;  3HJF A;  4CER A;  5C12 A;  3PLA A;  3TAR A;  4W5N A;  1HQU A;  3C6A A;  1RTD A;  4R79 A;  4H4O A;  4X65 K;  1NJY A;  3HBT A;  3HPG A;  4FJH A;  3EKS A;  2O8C A;  1QVG M;  3QDK A;  2KQ2 A;  5M1N A;  5AQP A;  1DKG D;  4IG0 A;  3TR8 A;  1T3V A;  3R9P A;  2YNH A;  3CMA N;  4UQG A;  4DV0 K;  1T6D A;  1YT3 A;  2DFF A;  1RTH A;  3O6W A;  3UKU B;  1QHT A;  1C1B A;  1C0G A;  3THX A;  3CQX A;  5E26 A;  3LAK A;  1L3T A;  1JLB A;  5IT9 O;  5AZJ B;  1SKS A;  1CZA N;  2Q0R A;  1ASV A;  1T6C A;  2NRT A;  2HF3 A;  1UWB A;  3D2E A;  4RW9 A;  1RDC A;  4CJP A;  3VQ4 A;  4LFC K;  3ZSV A;  1TK8 A;  3ZT0 A;  1VQ9 N;  4IOX A;  1U45 A;  4DSL A;  3BZC A;  4CE9 A;  3CD6 N;  1NK0 A;  4CJQ A;  3LPT A;  1YVU A;  4CEE A;  1VRT A;  1GLF O;  3BF3 A;  3OJU A;  3WQT A;  5I9E B;  3LWM A;  3F9K A;  3NFA A;  1U2V B;  3VEO A;  2ZGZ A;  5CYQ A;  1X3N A;  3O1B A;  3VEW A;  4QCL A;  2YI1 A;  2P5O A;  3DMJ A;  3AV9 A;  5BRD A;  1CXQ A;  3H08 A;  4M63 C;  1JXB A;  4QAG A;  3P83 D;  3S3O A;  4G1Q A;  2ASM A;  4NCB A;  1BIS A;  5C42 A;  1NU0 A;  1GOA A;  3P1G A;  3AAQ A;  2UXD K;  1NKC A;  4YY3 K;  3VEX A;  4WFA L;  1HJR A;  4WQ4 A;  3DRP A;  1BG3 A;  3AO5 A;  3O3H A;  3O9Q A;  4Z4E A;  4RG8 A;  5JLF A;  4I2P A;  3CM6 A;  3FZK A;  1L3S A;  3TWH A;  1T05 A;  4FZX C;  4DU3 A;  3OYF A;  2ASO A;  3OY9 A;  2W6K A;  4C1N I;  4BRA A;  5GIO A;  3NHG A;  3AA4 A;  3L4I A;  2IVP A;  3PIP L;  4FVU A;  3HSC A;  5AQL A;  1EWQ A;  4KH5 A;  5LMU K;  2G8I A;  1LAV A;  2GTD A;  3I33 A;  4B9M A;  2W40 A;  3O8M A;  3RMB A;  3IDH A;  1L3V A;  1JLC A;  3B8A X;  4L3Q A;  3QEI A;  2CGJ A;  3GOI A;  4J2A A;  3WXK A;  4BRK A;  2PYL A;  3CJB A;  3OYL A;  3TAB A;  1OH8 A;  3O4W A;  4DF8 A;  4KB1 A;  1FJG K;  5EU7 A;  4E89 A;  2NRH A;  4EHU A;  1SL1 A;  4JD2 B; 
#chains in the Genus database with same CATH homology
 4Z4G A;  3DI6 A;  4Q0B A;  3LAN A;  4O0J A;  1K6Y A;  1QQC A;  2NUB A;  3ZSO A;  1QSS A;  3VQE A;  1TGO A;  4Z4C A;  5D3G A;  3OYG A;  1S9E A;  4Q5V A;  2RN2 A;  3DM2 A;  5DK5 A;  1IG9 A;  3AA3 A;  3BGR A;  4KHU A;  2QXF A;  4OKJ A;  2YNF A;  3TAE A;  4PWD A;  3HPO A;  3UIQ A;  4CES A;  3LWL A;  4HHT A;  1L3U A;  2BGG A;  4M41 A;  3TAF A;  4J2E A;  3V1R A;  4TSX A;  5HRS A;  4N41 A;  2X78 A;  2FBT A;  4DQI A;  4CEQ A;  2O4G A;  2Z1J A;  3LP1 A;  4LH5 A;  4CK2 A;  4KI6 A;  2DTU A;  1BHL A;  1NK8 A;  4PY5 A;  3LPU A;  4CHP A;  1T8E A;  1QE1 A;  2ETJ A;  2EHG A;  4I9L A;  4JS4 A;  4KHN A;  3QLH A;  3SUO A;  3HST B;  2YHA A;  4IDK A;  4KTW A;  3T19 A;  2G8W A;  4Z4F A;  1KVA A;  3V9X A;  4FVM A;  2HHS A;  1S5J A;  3QEX A;  4DTX A;  2PYJ A;  3NAE A;  2Y1J A;  1VK0 A;  4FJ5 A;  4FJL A;  4DFP A;  4DQR A;  2FBX A;  4OJR A;  4F3O A;  1TK5 A;  4CJF A;  3HM9 A;  5HRR A;  4KAZ A;  4LH4 A;  3LAL A;  4NCG A;  2HMI A;  1VSD A;  3AVM A;  2X6N A;  5KI6 A;  3V9U A;  1SV5 A;  2Z1H A;  3TI0 A;  2WOM A;  1BI4 B;  3K2P A;  5K14 A;  4OPJ A;  4B8C A;  3IS9 A;  1TKD A;  4M3Y A;  2HHT A;  3SNN A;  1JLF A;  1TL1 A;  4GW6 A;  4RW7 A;  4FM1 A;  4F2R A;  1XHZ A;  1RTJ A;  3NGI A;  3LZJ A;  3ULD A;  1KFD A;  1C0M A;  3NCI A;  1SL2 A;  4OLB A;  2QKK A;  4CJK A;  3OYD A;  4RW8 A;  4DMN A;  4NCA A;  2E4L A;  1REV A;  3KLI A;  1B9D A;  4FM2 A;  1X9S A;  1T7P A;  4KTZ A;  1TKZ A;  1JKH A;  4I2Q A;  4CFB A;  3CFP A;  1TV6 A;  4OLA A;  1QSL A;  3VA3 A;  2OZS A;  1NJX A;  1BCM A;  4B08 A;  5HRP A;  5J2P A;  4B9L A;  2IS3 A;  4DTJ A;  1LAW A;  4I9Q A;  1WLJ A;  1J53 A;  5E41 A;  3RR8 A;  4CGH A;  4DTR A;  3L2U A;  1EX4 A;  1TKX A;  3ZSY A;  4FJ7 A;  4BWJ A;  4AHS A;  3QEW A;  4B9V A;  1WSH A;  1BQN A;  1C6V A;  4CJW A;  3NF8 A;  4KKO A;  1RT2 A;  1VSH A;  3KTQ A;  3TAP A;  3KIO A;  3ZSW A;  4KB0 A;  3KLH A;  3K5N A;  5SZT A;  4O0I A;  5C25 A;  3PX0 A;  3AA5 X;  3P5J A;  3SV4 A;  2BDP A;  2A1R A;  4FCY A;  3VQ5 A;  4FK0 A;  3RMC A;  1GOB A;  5FRM A;  4N47 A;  4CJ3 A;  1BL3 A;  1QTM A;  4Z4H A;  4HTU A;  2YKM A;  3SQ0 A;  4BDP A;  3OYA A;  4KHQ A;  2KZM A;  1ZBI A;  3PX6 A;  1RDD A;  2X6S A;  4LSL A;  1KRP A;  4QOZ B;  3HT3 A;  4R5P A;  3SUQ A;  3PO5 A;  3HPH A;  3MEC A;  5HRN A;  1JLE A;  2B4J A;  4CJT A;  2OZM A;  1NK9 A;  4IG3 A;  3CFR A;  3HP9 A;  2OA8 A;  3HO1 A;  1A5V A;  4JRQ A;  1I39 A;  3NGY A;  2PZS A;  1C0U A;  2HHX A;  1B9F A;  1ASU A;  1ZBH A;  4CCH A;  3ZT3 A;  1NKE A;  1VSF A;  4BDY A;  3OYN A;  4KFB A;  4ZTF A;  4W5Q A;  1ZBU A;  2YHB A;  3HXM A;  4N76 A;  4KRE A;  3L2R A;  3OYE A;  4DFJ A;  3THV A;  1RT3 A;  4BDZ A;  2WON A;  4H8K A;  1IKW A;  1EXQ A;  4B3O A;  3TAG A;  5J1E A;  4BE2 A;  1S9G A;  4FW2 A;  4KPY A;  1YTU A;  4FJN A;  4GVM A;  3VQA A;  1WSI A;  1W0H A;  4CEF A;  3V1Q A;  4FM0 A;  2FC0 A;  1U48 A;  4B9T A;  4FJX A;  1WAJ A;  1KVC A;  1NK7 A;  4ELT A;  4KHW A;  3MXM A;  4CGF A;  2YKN A;  3VQP A;  3MEE A;  4DQQ A;  2KZZ A;  1HYV A;  1EKE A;  3SCX A;  3V9W A;  1BQM A;  3RR7 A;  4BE0 A;  1ZYQ A;  4ICL A;  3K57 A;  3PV8 A;  1FK9 A;  1IKY A;  3AVA A;  3VQ6 A;  2BAN A;  3AO2 A;  1WNS A;  3SYZ A;  3V9Z A;  4LY7 A;  4NYN A;  1LWF A;  1UAX A;  3KD5 E;  3MEG A;  3K5O A;  5J2Q A;  4HUE A;  1QSY A;  3T1A A;  3MXJ A;  3QEP A;  2G8H A;  4FK2 A;  3S3M A;  4O55 A;  3RMD A;  4M3W A;  5JS2 A;  1B92 A;  1KFS A;  1XI1 A;  5J2M A;  2HHQ A;  1JL2 A;  4DLE A;  1I3A A;  4CJU A;  1Y97 A;  3I0R A;  3V4I A;  3DLK A;  1XHX A;  4DFK A;  3HK2 A;  3L3U A;  3DLR A;  2XRI A;  4AHU A;  3OS1 A;  4O44 A;  3WNG A;  2RKI A;  1HPZ A;  1RT7 A;  2LSN A;  1CZB A;  3D45 A;  1TAU A;  3HL8 A;  1JLG A;  1VSK A;  4Z0U A;  1TVR A;  4B8A B;  4FJ9 A;  1LWE A;  3O4Q A;  1FXX A;  2HNY A;  3ALY A;  3HVR A;  4AHV A;  3RRG A;  3OVN A;  3PX4 A;  4FJI A;  2AJQ A;  4M3U A;  3G10 A;  1SKW A;  1NOZ A;  3RMA A;  1J9A A;  2XHB A;  3EZ5 A;  3OYI A;  4EZ9 A;  4E0D A;  3VQ7 A;  1HNI A;  3AVF A;  4CEA A;  3SQ1 A;  1X9M A;  4M42 A;  2DFE A;  2Z1G A;  2ZQB A;  3M8R A;  3K5M A;  3ZT2 A;  5KRS A;  3NBP A;  4OKK A;  3BDP A;  4DSF A;  3QNN A;  1NK5 A;  1BCO A;  3S9H A;  4L8R B;  2KTQ A;  1ZBL A;  2XO7 A;  4B9U A;  4CGJ A;  1YTA A;  4YFU A;  3ZT4 A;  3SI6 A;  1JLQ A;  3LP3 A;  1BGX T;  1DLO A;  2P51 A;  3OS0 A;  3OYM A;  3MXI A;  3RRH A;  3A2F A;  3WNE A;  3KKS A;  3IAY A;  1WSJ A;  3SV3 A;  2EX3 A;  4HCB A;  4F8R A;  1CZ9 A;  4W5R A;  4DTO A;  2HB5 A;  4KO0 A;  2VWJ A;  4BAC A;  2F8T A;  1LV5 A;  2QK9 A;  2QKB A;  1RT4 A;  4O5B A;  3G0Z A;  3O3G A;  4C8K A;  4FLX A;  1KCF A;  3CYM A;  3M8S A;  4E7H A;  2GUI A;  1T03 A;  1Q8I A;  3B6O A;  3K58 A;  1RDB A;  4DTS A;  4M3X A;  4FLZ A;  4K8X A;  4KTQ A;  4F2S A;  3VQC A;  3OYJ A;  4DSE A;  1IO2 A;  1IKX A;  4HCC A;  4DU4 A;  2HHU A;  4DQS A;  1XWL A;  3ZT1 A;  4DLG A;  3C6U A;  3U6F A;  1RBU A;  3C94 A;  1RT1 A;  1VSM A;  1WSF A;  2DFH A;  3ITH A;  3D0P A;  3C95 A;  2OPR A;  3DRR A;  1Q9Y A;  4E7J A;  3DLH A;  2D0A A;  2OPP A;  1LW2 A;  3WNF A;  4DU1 A;  4OGE A;  5CY4 A;  3VA0 A;  2R7Y A;  1UA1 A;  4JLH A;  3KD1 E;  4M3R A;  3AVJ A;  3NF9 A;  4PA1 A;  2F96 A;  2ZE2 A;  3I8D A;  3KLG A;  3OJS A;  1RTI A;  3AVI A;  3NH1 A;  1FKO A;  1X9W A;  1KSP A;  1BIU A;  4J2D A;  1HMV A;  3L2Q A;  4FLT A;  1SKR A;  1HRH A;  1J54 A;  4CFC A;  4CF0 A;  3SUP A;  1HYS A;  1JXE A;  3AVN A;  4CED A;  1NJZ A;  1KLN A;  3ZCM A;  3LDS A;  3SQ4 A;  3KKR A;  4DWI A;  3DLE A;  5CYM A;  4CEO A;  1Q9X A;  1J5O A;  4IBN A;  3B6P A;  3I0S A;  3V1O A;  1KLM A;  4KHS A;  4Z4I A;  1JL1 A;  1NKB A;  1DTT A;  2I5J A;  2KFN A;  4HVJ A;  1F21 A;  1C1A A;  4E7L A;  3L8B A;  1VSI A;  3TAN A;  4EZ6 A;  2KFZ A;  1R0A A;  4MFB A;  2HVH A;  3SZ2 A;  3CM5 A;  1TL3 A;  4DTM A;  3ZSX A;  4FJM A;  2OPS A;  2D5R A;  3RWU A;  3ZSZ A;  3AVK A;  4B9S A;  1RCH A;  2HVI A;  3JSM A;  4DS4 A;  1D9D A;  1IH7 A;  2GV9 A;  1A5X A;  4CF2 A;  1Z25 A;  3DOK A;  4FLW A;  4AHR A;  3LZI A;  3AVL A;  4E3S A;  3KLE A;  4FJG A;  4RW4 A;  4BWM A;  1KVB A;  3F73 A;  1U47 A;  3IRX A;  3ASM A;  1SUQ A;  1RT6 A;  2IGI A;  4KV8 A;  1D9F A;  3QEV A;  2VWK A;  1NK6 A;  4Y1C A;  1S1T A;  3VN5 A;  3ZSQ A;  3KK1 A;  4HUG A;  4FK4 A;  1NJW A;  4CFA A;  4DG1 A;  3AVG A;  3L2V A;  1LW0 A;  3VQ9 A;  5HP1 A;  3FFI A;  2PY5 A;  4J2B A;  4DSK A;  3QES A;  2HHV A;  2DY4 A;  3DOL A;  1JLA A;  2D0C A;  2VG5 A;  1W9H A;  3QIO A;  2XY6 A;  4FJK A;  3CFO A;  1EP4 A;  1WN7 A;  4FLY A;  4DFM A;  3AA2 A;  4DTP A;  1S1X A;  1WSG A;  3DYA A;  1LWC A;  3V9S A;  3O4N A;  4JS5 A;  2D0B A;  3CQ8 A;  4CEC A;  4DF4 A;  4CIF A;  4DTN A;  1RBS A;  1G15 A;  2IDO A;  1RBT A;  4NYF A;  4OVL A;  4AIL C;  1A5W A;  1HNV A;  1UOC A;  1SL0 A;  3OYH A;  3PY8 A;  3K59 A;  3WNH A;  5FDL A;  5I42 A;  4PUO A;  3HP6 A;  2E6L A;  3TAM A;  4CJE A;  4DQP A;  4DSI A;  3HJF A;  4CER A;  3AO4 A;  3TAR A;  4W5N A;  4AH9 A;  3NDK A;  4C8O A;  4IFY A;  1HQU A;  3DLG A;  1N5Y A;  1GOC A;  1VRU A;  1RTD A;  1WSE A;  1U49 A;  2Y1I A;  2BE2 A;  3HVT A;  4H4O A;  4FW1 A;  5CZ2 A;  1IKV A;  3E01 A;  4WE1 A;  3QIP A;  4CHQ A;  4CK3 A;  3NH0 A;  3MED A;  3NE6 A;  3RTV A;  4E7I A;  1NJY A;  2ATQ A;  2OYQ A;  2JGU A;  3HPG A;  3OYK A;  1ZBF A;  5KRT A;  4FJH A;  1RBR A;  1L5U A;  1RT5 A;  2A1S A;  4E1M A;  3OYC A;  4HUF A;  2KQ2 A;  2F8S A;  4ELV A;  4EP5 A;  1D5A A;  4IFV A;  4IG0 A;  3TR8 A;  1NOY A;  4FYD A;  4N5S A;  2G8F A;  2YNH A;  1O1W A;  4CJR A;  3ZSR A;  4H4M A;  4UQG A;  2HNZ A;  3QER A;  1VSL A;  1CLQ A;  1ITG A;  1ASW A;  1YT3 A;  4YNQ A;  2B5J A;  3S3N A;  2DFF A;  1RNH A;  1RTH A;  3SJJ A;  4FZY A;  1QHT A;  1C1B A;  3NF7 A;  3LAK A;  3HYF A;  3EYZ A;  2IAJ A;  3AVH A;  1JLB A;  1L3T A;  1N6Q A;  4XIU A;  4FLV A;  3PO4 A;  1VSE A;  1TK0 A;  5DMR A;  4ID5 A;  4CF9 A;  5C24 A;  1SKS A;  2XY8 A;  5FRO A;  2RF2 A;  4CHN A;  1XC9 A;  1ASV A;  3SPY A;  3M8P A;  5HRO A;  2ITG A;  4PQU A;  4ZHR A;  4CGI A;  3JYT A;  4IKF A;  1UWB A;  4RW9 A;  4CJP A;  1RDC A;  1X1P A;  3LP0 A;  3VQ4 A;  4CIG A;  4BE1 A;  4RW6 A;  3ZSV A;  2G8K A;  1TK8 A;  2Q3S A;  1KTQ A;  2P5G A;  3ZT0 A;  3AVB A;  4OKE A;  1FKP A;  3KK3 A;  5JS1 A;  4FXD A;  4CGG A;  4CF8 A;  1U45 A;  4DSL A;  4I7F A;  4F3T A;  4CE9 A;  1NK0 A;  4FLU A;  2KW4 A;  4CJQ A;  1VSJ A;  3LPT A;  1YVU A;  3V6D A;  4CEE A;  4CEZ A;  1VRT A;  3VQQ A;  3MAQ A;  4B9N A;  3OJU A;  3QNO A;  1S6Q A;  1RBV A;  2HND A;  4C8M A;  2YNI A;  1RIL A;  3LWM A;  5FRN A;  3F9K A;  4M3Z A;  3NFA A;  3QO9 A;  3AO1 A;  4E19 A;  5T7B A;  4W5T A;  3T3F A;  4FJ8 A;  4KHY A;  2XY5 A;  4FJJ A;  2IOC A;  3KK2 A;  5CYQ A;  1U4B A;  3KJV A;  4ELU A;  4CJL A;  3QET A;  1UA0 A;  2E6M A;  3K5L A;  4QCL A;  1TAQ A;  4DSJ A;  4O4G A;  5CZ1 A;  4Y1D A;  3DMJ A;  3OS2 A;  2P5O A;  3AV9 A;  4GMJ B;  1CXQ A;  3H08 A;  3SPZ A;  1JXB A;  4QAG A;  3P83 D;  3S3O A;  4G1Q A;  4C8N A;  4M45 A;  4CF1 A;  4NCB A;  3PUF A;  1S1V A;  5J2N A;  3AVC A;  4OGC A;  1BI4 A;  4E1N A;  1BIS A;  3U3Y A;  3NF6 A;  4CJ5 A;  5C42 A;  2IC3 A;  4AHC A;  4ZTJ A;  3O3F A;  4CK1 A;  1GOA A;  5HBM A;  4C8L A;  1S1U A;  2OPQ A;  2RPI A;  3P1G A;  4CEB A;  3LP2 A;  3U3G A;  4JRP A;  2O4I A;  1HQE A;  1TKT A;  3L2W A;  5I3U A;  2YV0 X;  1NKC A;  2G8V A;  2FBV A;  2VG7 A;  3SUN A;  1HJR A;  3DRP A;  4CFD A;  2YNG A;  3AO5 A;  2VG6 A;  3M8Q A;  1HYZ A;  4KRF A;  3VQ8 A;  3O3H A;  2HHW A;  3SQ2 A;  2Z1I A;  4Z4E A;  4RG8 A;  3DRS A;  4N56 A;  2JLE A;  4I2P A;  3CM6 A;  1L3S A;  1C1C A;  1S6P A;  5KGX A;  1C0T A;  5SWM A;  3TWH A;  1NK4 A;  2HW3 A;  4CIE A;  1T05 A;  4FZX C;  4DU3 A;  3TAQ A;  3OYF A;  4OPK A;  4KI4 A;  2G8U A;  3OY9 A;  1MU2 A;  3QIN A;  1CXU A;  3IG1 A;  3NGZ A;  4CJS A;  1EET A;  3AO3 A;  3NHG A;  4CHZ A;  3L3V A;  4DS5 A;  3AA4 A;  5KGW A;  2W42 A;  4LD0 A;  3C6T A;  1U04 A;  4CJ4 A;  4F4K A;  4LSN A;  3NH2 A;  1WAF A;  2G8I A;  4CHO A;  1LAV A;  3VQD A;  3EY1 A;  3V81 A;  4DTU A;  4B9M A;  3VQB A;  2X74 A;  4W5O A;  4K8Z A;  1QS4 A;  4EP4 A;  3RMB A;  3OYB A;  5KTQ A;  2ZD1 A;  1L3V A;  1Z26 A;  1JLC A;  4CGD A;  3QEI A;  2P1J A;  4E7K A;  4MQ3 A;  1D8Y A;  4CHY A;  4CJV A;  4J2A A;  3LAM A;  4FZZ A;  4AHT A;  3KLF A;  2FBY A;  4ID1 A;  2B6A A;  3ISN C;  2PYL A;  1BIZ A;  3OYL A;  4KB1 A;  3TAB A;  4DF8 A;  2XY7 A;  5HLF A;  5EU7 A;  4E89 A;  3CG7 A;  3DLB A;  2GBZ A;  1SL1 A;  4M3T A;  1S1W A;  1RDA A;  1DTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...