3U73U

Crystal structure of stabilized human upar mutant in complex with atf
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
280
structure length
269
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTCSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMCHIDVSCCTKSGCNHPDLDVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator surface receptor
publication title Crystal structure of the urokinase receptor in a ligand-free form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase receptor
total genus 59
structure length 269
sequence length 280
ec nomenclature
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u73U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u73U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u73U02
1FSCA 3KFDE 4QTIU 2PJYC 2ERAA 1JGKA 1ES7B 3KFDI 1CODA 5IMYC 2H64B 1M9ZA 2GOOC 3BT2U 1F94A 1HAJA 2CDXA 2MJ4A 1IK8A 1NTNA 5DU1A 1BXPA 2QJ9C 1QKEA 1FSSB 2LA1A 1QM7A 4ZQYA 1ONJA 1CDQA 1QKDA 2NBTA 2FD6U 2HLRA 1CCQA 1L4WA 1FASA 4RUDA 4IYEA 2BHIA 4AEAA 2JQPA 4BIKB 1KC4A 1NXBA 2H8UA 3NEQA 1LX5B 1KBSA 1H0JA 2I9BE 1I02A 1HAAA 3NH7A 1W6BA 2H7ZB 1IDGA 4OM4A 3LAQU 1KBAA 1IDLA 1S4YA 1B41B 1CTXA 4HQPF 1MAHF 5IMTD 1KS6A 5DZ5A 2HLQA 2CTXA 1RL5A 1IKCA 2QJAC 1CXNA 1MR6A 1VB0A 1TFSA 1NEAA 3EVSC 5EBXA 2MUPA 4XJJA 1ERAA 1PLOA 1CDTA 1ERGA 1COEA 1XT3A 2H7ZA 2H64C 4DO8A 1TGXA 2LCRA 1IDIA 4BDTB 4FAOE 1BTEA 1FF4A 2H62D 3U73U 1DRSA 1CRFA 2L03A 1HC9B 2PJYB 2JVEA 3NDSA 1CHVS 2MFAA 2CCXA 1ABTA 1TXAA 1G6MA 3PLCA 1JE9A 1CREA 2UX2A 3HH7A 2H62C 2UWRA 1KTZB 1LXHA 2GOOB 3FEVA 1CXOA 2MHYA 1FRAA 1V6PA 1UG4A 2VLWA 3ERAA 1YWHA 1CVOA 1IQ9A 2QC1A 1REWC 1CB9A 2MJ0A 3EBXA 4P7UA 1NYSA 4OM5A 2MUOA 3BT1U 1FFJA 1HOYA 1KL8A 1KU6B 1KBTA 1HC9A 1NTXA 1CDSA 1F8UB 2H5FA 3U74U 1LXGA 1RGJA 1KXIA 1TXBA 1ZADA 4LFTA 2CRSA 1KFHA 5DO6A 3VTSA 1IDHA 1JBDA 2X8BB 1IJCA 2N99A 2K3GA 1CDRA 4EY8B 4FAOC 1LJZA 1NYUA 2J8BA 2OFSA 2MJYA 1NORA 1LSIA 6EBXA 2QJBC 3QB4B 4UY2C 2L5SA 2CRTA 2ABXA 2BTXA
chains in the Genus database with same CATH superfamily
1FSCA 3KFDE 4QTIU 2PJYC 2ERAA 1JGKA 1ES7B 3KFDI 1CODA 5IMYC 2H64B 1M9ZA 2GOOC 3BT2U 1F94A 1HAJA 2CDXA 2MJ4A 1IK8A 1NTNA 5DU1A 1BXPA 2QJ9C 1QKEA 1FSSB 2LA1A 1QM7A 4ZQYA 1ONJA 1CDQA 1QKDA 2NBTA 4KSNA 2FD6U 2HLRA 1CCQA 1L4WA 1FASA 4RUDA 4IYEA 2BHIA 4AEAA 2JQPA 4BIKB 1KC4A 1NXBA 2H8UA 3NEQA 1LX5B 1KBSA 1H0JA 2I9BE 1I02A 1HAAA 3NH7A 1W6BA 2H7ZB 1IDGA 4OM4A 3LAQU 1KBAA 1IDLA 1S4YA 1B41B 1CTXA 4HQPF 1MAHF 5IMTD 1KS6A 5DZ5A 2HLQA 2CTXA 1RL5A 1IKCA 2QJAC 1CXNA 1MR6A 1VB0A 1TFSA 1NEAA 3EVSC 5EBXA 2MUPA 4XJJA 1ERAA 1PLOA 1CDTA 1ERGA 1COEA 1XT3A 2H7ZA 2H64C 4DO8A 1TGXA 2LCRA 1IDIA 4BDTB 4FAOE 1BTEA 1FF4A 2H62D 3U73U 1DRSA 1CRFA 2L03A 1HC9B 2PJYB 2JVEA 3NDSA 1CHVS 2MFAA 2CCXA 1ABTA 1TXAA 1G6MA 3PLCA 1JE9A 1CREA 2UX2A 3HH7A 2H62C 2UWRA 1KTZB 1LXHA 2GOOB 3FEVA 1CXOA 2MHYA 1FRAA 1V6PA 1UG4A 2VLWA 3ERAA 1YWHA 1CVOA 1IQ9A 2QC1A 1REWC 1CB9A 2MJ0A 3EBXA 4P7UA 1NYSA 4OM5A 2MUOA 3BT1U 1FFJA 1HOYA 1KL8A 1KU6B 1KBTA 1HC9A 1NTXA 1CDSA 1F8UB 2H5FA 3U74U 1LXGA 1RGJA 1KXIA 1TXBA 1ZADA 4LFTA 2CRSA 1KFHA 5DO6A 3VTSA 1IDHA 1JBDA 2X8BB 1IJCA 2N99A 2K3GA 1CDRA 4EY8B 4FAOC 1LJZA 1NYUA 2J8BA 2OFSA 2MJYA 1NORA 1LSIA 6EBXA 2QJBC 3QB4B 4UY2C 2L5SA 2CRTA 2ABXA 2BTXA
chains in the Genus database with same CATH topology
1FSCA 3KFDE 4QTIU 2PJYC 2ERAA 1JGKA 1ES7B 3KFDI 1CODA 5IMYC 2H64B 1M9ZA 2GOOC 3BT2U 1F94A 1HAJA 2CDXA 2MJ4A 1IK8A 1NTNA 5DU1A 1BXPA 2QJ9C 1QKEA 1FSSB 2LA1A 1QM7A 4ZQYA 1ONJA 1CDQA 1QKDA 2NBTA 4KSNA 2FD6U 2HLRA 1CCQA 1L4WA 1FASA 4RUDA 4IYEA 2BHIA 4AEAA 2JQPA 4BIKB 1KC4A 1NXBA 2H8UA 3NEQA 1LX5B 1KBSA 1H0JA 2I9BE 1I02A 1HAAA 3NH7A 1W6BA 2H7ZB 1IDGA 4OM4A 3LAQU 1KBAA 1IDLA 1S4YA 1B41B 1CTXA 4HQPF 1MAHF 5IMTD 1KS6A 5DZ5A 2HLQA 2CTXA 1RL5A 1IKCA 2QJAC 1CXNA 1MR6A 1VB0A 1TFSA 1NEAA 3EVSC 5EBXA 2MUPA 4XJJA 1ERAA 1PLOA 1CDTA 1ERGA 1COEA 1XT3A 2H7ZA 2H64C 4DO8A 1TGXA 2LCRA 1IDIA 4BDTB 4FAOE 1BTEA 1FF4A 2H62D 3U73U 1DRSA 1CRFA 2L03A 1HC9B 2PJYB 2JVEA 3NDSA 1CHVS 2MFAA 2CCXA 1ABTA 1TXAA 1G6MA 3PLCA 1JE9A 1CREA 2UX2A 3HH7A 2H62C 2UWRA 1KTZB 1LXHA 2GOOB 3FEVA 1CXOA 2MHYA 1FRAA 1V6PA 1UG4A 2VLWA 3ERAA 1YWHA 1CVOA 1IQ9A 2QC1A 1REWC 1CB9A 2MJ0A 3EBXA 4P7UA 1NYSA 4OM5A 2MUOA 3BT1U 1FFJA 1HOYA 1KL8A 1KU6B 1KBTA 1HC9A 1NTXA 1CDSA 1F8UB 2H5FA 3U74U 1LXGA 1RGJA 1KXIA 1TXBA 1ZADA 4LFTA 2CRSA 1KFHA 5DO6A 3VTSA 1IDHA 1JBDA 2X8BB 1IJCA 2N99A 2K3GA 1CDRA 4EY8B 4FAOC 1LJZA 1NYUA 2J8BA 2OFSA 2MJYA 1NORA 1LSIA 6EBXA 2QJBC 3QB4B 4UY2C 2L5SA 2CRTA 2ABXA 2BTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSC A;  3KFD E;  4QTI U;  2PJY C;  2ERA A;  1JGK A;  1ES7 B;  3KFD I;  1COD A;  5IMY C;  2H64 B;  1M9Z A;  2GOO C;  3BT2 U;  1F94 A;  1HAJ A;  2CDX A;  2MJ4 A;  1IK8 A;  1NTN A;  5DU1 A;  1BXP A;  2QJ9 C;  1QKE A;  1FSS B;  2LA1 A;  1QM7 A;  4ZQY A;  1ONJ A;  1CDQ A;  1QKD A;  2NBT A;  2FD6 U;  2HLR A;  1CCQ A;  1L4W A;  1FAS A;  4RUD A;  4IYE A;  2BHI A;  4AEA A;  2JQP A;  4BIK B;  1KC4 A;  1NXB A;  2H8U A;  3NEQ A;  1LX5 B;  1KBS A;  1H0J A;  2I9B E;  1I02 A;  1HAA A;  3NH7 A;  1W6B A;  2H7Z B;  1IDG A;  4OM4 A;  3LAQ U;  1KBA A;  1IDL A;  1S4Y A;  1B41 B;  1CTX A;  4HQP F;  1MAH F;  5IMT D;  1KS6 A;  5DZ5 A;  2HLQ A;  2CTX A;  1RL5 A;  1IKC A;  2QJA C;  1CXN A;  1MR6 A;  1VB0 A;  1TFS A;  1NEA A;  3EVS C;  5EBX A;  2MUP A;  4XJJ A;  1ERA A;  1PLO A;  1CDT A;  1ERG A;  1COE A;  1XT3 A;  2H7Z A;  2H64 C;  4DO8 A;  1TGX A;  2LCR A;  1IDI A;  4BDT B;  4FAO E;  1BTE A;  1FF4 A;  2H62 D;  3U73 U;  1DRS A;  1CRF A;  2L03 A;  1HC9 B;  2PJY B;  2JVE A;  3NDS A;  1CHV S;  2MFA A;  2CCX A;  1ABT A;  1TXA A;  1G6M A;  3PLC A;  1JE9 A;  1CRE A;  2UX2 A;  3HH7 A;  2H62 C;  2UWR A;  1KTZ B;  1LXH A;  2GOO B;  3FEV A;  1CXO A;  2MHY A;  1FRA A;  1V6P A;  1UG4 A;  2VLW A;  3ERA A;  1YWH A;  1CVO A;  1IQ9 A;  2QC1 A;  1REW C;  1CB9 A;  2MJ0 A;  3EBX A;  4P7U A;  1NYS A;  4OM5 A;  2MUO A;  3BT1 U;  1FFJ A;  1HOY A;  1KL8 A;  1KU6 B;  1KBT A;  1HC9 A;  1NTX A;  1CDS A;  1F8U B;  2H5F A;  3U74 U;  1LXG A;  1RGJ A;  1KXI A;  1TXB A;  1ZAD A;  4LFT A;  2CRS A;  1KFH A;  5DO6 A;  3VTS A;  1IDH A;  1JBD A;  2X8B B;  1IJC A;  2N99 A;  2K3G A;  1CDR A;  4EY8 B;  4FAO C;  1LJZ A;  1NYU A;  2J8B A;  2OFS A;  2MJY A;  1NOR A;  1LSI A;  6EBX A;  2QJB C;  3QB4 B;  4UY2 C;  2L5S A;  2CRT A;  2ABX A;  2BTX A; 
#chains in the Genus database with same CATH topology
 1FSC A;  3KFD E;  4QTI U;  2PJY C;  2ERA A;  1JGK A;  1ES7 B;  3KFD I;  1COD A;  5IMY C;  2H64 B;  1M9Z A;  2GOO C;  3BT2 U;  1F94 A;  1HAJ A;  2CDX A;  2MJ4 A;  1IK8 A;  1NTN A;  5DU1 A;  1BXP A;  2QJ9 C;  1QKE A;  1FSS B;  2LA1 A;  1QM7 A;  4ZQY A;  1ONJ A;  1CDQ A;  1QKD A;  2NBT A;  4KSN A;  2FD6 U;  2HLR A;  1CCQ A;  1L4W A;  1FAS A;  4RUD A;  4IYE A;  2BHI A;  4AEA A;  2JQP A;  4BIK B;  1KC4 A;  1NXB A;  2H8U A;  3NEQ A;  1LX5 B;  1KBS A;  1H0J A;  2I9B E;  1I02 A;  1HAA A;  3NH7 A;  1W6B A;  2H7Z B;  1IDG A;  4OM4 A;  3LAQ U;  1KBA A;  1IDL A;  1S4Y A;  1B41 B;  1CTX A;  4HQP F;  1MAH F;  5IMT D;  1KS6 A;  5DZ5 A;  2HLQ A;  2CTX A;  1RL5 A;  1IKC A;  2QJA C;  1CXN A;  1MR6 A;  1VB0 A;  1TFS A;  1NEA A;  3EVS C;  5EBX A;  2MUP A;  4XJJ A;  1ERA A;  1PLO A;  1CDT A;  1ERG A;  1COE A;  1XT3 A;  2H7Z A;  2H64 C;  4DO8 A;  1TGX A;  2LCR A;  1IDI A;  4BDT B;  4FAO E;  1BTE A;  1FF4 A;  2H62 D;  3U73 U;  1DRS A;  1CRF A;  2L03 A;  1HC9 B;  2PJY B;  2JVE A;  3NDS A;  1CHV S;  2MFA A;  2CCX A;  1ABT A;  1TXA A;  1G6M A;  3PLC A;  1JE9 A;  1CRE A;  2UX2 A;  3HH7 A;  2H62 C;  2UWR A;  1KTZ B;  1LXH A;  2GOO B;  3FEV A;  1CXO A;  2MHY A;  1FRA A;  1V6P A;  1UG4 A;  2VLW A;  3ERA A;  1YWH A;  1CVO A;  1IQ9 A;  2QC1 A;  1REW C;  1CB9 A;  2MJ0 A;  3EBX A;  4P7U A;  1NYS A;  4OM5 A;  2MUO A;  3BT1 U;  1FFJ A;  1HOY A;  1KL8 A;  1KU6 B;  1KBT A;  1HC9 A;  1NTX A;  1CDS A;  1F8U B;  2H5F A;  3U74 U;  1LXG A;  1RGJ A;  1KXI A;  1TXB A;  1ZAD A;  4LFT A;  2CRS A;  1KFH A;  5DO6 A;  3VTS A;  1IDH A;  1JBD A;  2X8B B;  1IJC A;  2N99 A;  2K3G A;  1CDR A;  4EY8 B;  4FAO C;  1LJZ A;  1NYU A;  2J8B A;  2OFS A;  2MJY A;  1NOR A;  1LSI A;  6EBX A;  2QJB C;  3QB4 B;  4UY2 C;  2L5S A;  2CRT A;  2ABX A;  2BTX A; 
#chains in the Genus database with same CATH homology
 1FSC A;  3KFD E;  4QTI U;  2PJY C;  2ERA A;  1JGK A;  1ES7 B;  3KFD I;  1COD A;  5IMY C;  2H64 B;  1M9Z A;  2GOO C;  3BT2 U;  1F94 A;  1HAJ A;  2CDX A;  2MJ4 A;  1IK8 A;  1NTN A;  5DU1 A;  1BXP A;  2QJ9 C;  1QKE A;  1FSS B;  2LA1 A;  1QM7 A;  4ZQY A;  1ONJ A;  1CDQ A;  1QKD A;  2NBT A;  4KSN A;  2FD6 U;  2HLR A;  1CCQ A;  1L4W A;  1FAS A;  4RUD A;  4IYE A;  2BHI A;  4AEA A;  2JQP A;  4BIK B;  1KC4 A;  1NXB A;  2H8U A;  3NEQ A;  1LX5 B;  1KBS A;  1H0J A;  2I9B E;  1I02 A;  1HAA A;  3NH7 A;  1W6B A;  2H7Z B;  1IDG A;  4OM4 A;  3LAQ U;  1KBA A;  1IDL A;  1S4Y A;  1B41 B;  1CTX A;  4HQP F;  1MAH F;  5IMT D;  1KS6 A;  5DZ5 A;  2HLQ A;  2CTX A;  1RL5 A;  1IKC A;  2QJA C;  1CXN A;  1MR6 A;  1VB0 A;  1TFS A;  1NEA A;  3EVS C;  5EBX A;  2MUP A;  4XJJ A;  1ERA A;  1PLO A;  1CDT A;  1ERG A;  1COE A;  1XT3 A;  2H7Z A;  2H64 C;  4DO8 A;  1TGX A;  2LCR A;  1IDI A;  4BDT B;  4FAO E;  1BTE A;  1FF4 A;  2H62 D;  3U73 U;  1DRS A;  1CRF A;  2L03 A;  1HC9 B;  2PJY B;  2JVE A;  3NDS A;  1CHV S;  2MFA A;  2CCX A;  1ABT A;  1TXA A;  1G6M A;  3PLC A;  1JE9 A;  1CRE A;  2UX2 A;  3HH7 A;  2H62 C;  2UWR A;  1KTZ B;  1LXH A;  2GOO B;  3FEV A;  1CXO A;  2MHY A;  1FRA A;  1V6P A;  1UG4 A;  2VLW A;  3ERA A;  1YWH A;  1CVO A;  1IQ9 A;  2QC1 A;  1REW C;  1CB9 A;  2MJ0 A;  3EBX A;  4P7U A;  1NYS A;  4OM5 A;  2MUO A;  3BT1 U;  1FFJ A;  1HOY A;  1KL8 A;  1KU6 B;  1KBT A;  1HC9 A;  1NTX A;  1CDS A;  1F8U B;  2H5F A;  3U74 U;  1LXG A;  1RGJ A;  1KXI A;  1TXB A;  1ZAD A;  4LFT A;  2CRS A;  1KFH A;  5DO6 A;  3VTS A;  1IDH A;  1JBD A;  2X8B B;  1IJC A;  2N99 A;  2K3G A;  1CDR A;  4EY8 B;  4FAO C;  1LJZ A;  1NYU A;  2J8B A;  2OFS A;  2MJY A;  1NOR A;  1LSI A;  6EBX A;  2QJB C;  3QB4 B;  4UY2 C;  2L5S A;  2CRT A;  2ABX A;  2BTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...