3U73U

Crystal structure of stabilized human upar mutant in complex with atf
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
280
structure length
269
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTCSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMCHIDVSCCTKSGCNHPDLDVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the urokinase receptor in a ligand-free form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase receptor
molecule keywords Urokinase plasminogen activator surface receptor
total genus 59
structure length 269
sequence length 280
ec nomenclature
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u73U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u73U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u73U02
4AEAA 2MJYA 1HAJA 1KC4A 1CDQA 5EBXA 2CCXA 1IKCA 1KXIA 1IQ9A 3BT2U 3QB4B 4QTIU 1G6MA 1M9ZA 1HOYA 1NYSA 2PJYB 3EBXA 2BHIA 3ERAA 1LXHA 1S4YA 1ES7B 1IK8A 1CODA 1RGJA 1NTNA 2J8BA 2H8UA 1COEA 2CRTA 5IMYC 1IDGA 4RUDA 2K3GA 1V6PA 1NEAA 1LX5B 1NXBA 2LCRA 3LAQU 1JE9A 4ZQYA 1YWHA 2CDXA 1H0JA 2H62C 2MJ0A 3U73U 1VB0A 1HAAA 3NEQA 1JBDA 2CTXA 2I9BE 2QC1A 5DO6A 3PLCA 3VTSA 1IDHA 2MUOA 1CVOA 1QKDA 5IMTD 4P7UA 1I02A 4DO8A 1CXNA 1MAHF 3KFDE 1ERGA 3FEVA 1MR6A 4OM4A 2NBTA 3EVSC 3BT1U 1QKEA 2HLRA 1LSIA 1FRAA 1FF4A 4UY2C 4BIKB 2QJBC 1NORA 2H7ZA 3KFDI 3HH7A 4HQPF 2FD6U 2MHYA 2LA1A 2JVEA 4EY8B 1ONJA 1NYUA 1F8UB 4IYEA 2MFAA 3NH7A 1CHVS 2ERAA 1CDTA 1KBAA 1REWC 5DZ5A 1FASA 4FAOC 1B41B 1KBSA 2L5SA 1F94A 1L4WA 1KU6B 2X8BB 4OM5A 1KS6A 2VLWA 2JQPA 1FSCA 1HC9A 2BTXA 1CRFA 1IDLA 2ABXA 2H62D 1CREA 1ZADA 4FAOE 1FFJA 4LFTA 1PLOA 2UWRA 1BXPA 1KL8A 2L03A 1CCQA 2QJAC 2H64C 1TXBA 2H7ZB 5DU1A 1IDIA 1TFSA 1KTZB 1FSSB 4XJJA 2GOOB 2OFSA 1LJZA 2PJYC 2QJ9C 2UX2A 2MUPA 1KBTA 1RL5A 1TGXA 3U74U 1CXOA 3NDSA 1QM7A 6EBXA 2GOOC 1UG4A 2N99A 4BDTB 2H5FA 1ABTA 1CDRA 1TXAA 1CB9A 1W6BA 1DRSA 1CTXA 1NTXA 1LXGA 1IJCA 1BTEA 1XT3A 1CDSA 2CRSA 1KFHA 1HC9B 2H64B 2HLQA 2MJ4A 1JGKA 1ERAA
chains in the Genus database with same CATH superfamily
4AEAA 2MJYA 1HAJA 1KC4A 1CDQA 5EBXA 2CCXA 1IKCA 1KXIA 1IQ9A 4KSNA 3BT2U 3QB4B 4QTIU 1G6MA 1M9ZA 1HOYA 1NYSA 2PJYB 3EBXA 2BHIA 3ERAA 1LXHA 1S4YA 1ES7B 1IK8A 1CODA 1RGJA 1NTNA 2J8BA 2H8UA 1COEA 2CRTA 5IMYC 1IDGA 4RUDA 2K3GA 1V6PA 1NEAA 1LX5B 1NXBA 2LCRA 3LAQU 1JE9A 4ZQYA 1YWHA 2CDXA 1H0JA 2H62C 2MJ0A 3U73U 1VB0A 1HAAA 3NEQA 1JBDA 2CTXA 2I9BE 2QC1A 5DO6A 3PLCA 3VTSA 1IDHA 2MUOA 1CVOA 1QKDA 5IMTD 4P7UA 1I02A 4DO8A 1CXNA 1MAHF 3KFDE 1ERGA 3FEVA 1MR6A 4OM4A 2NBTA 3EVSC 3BT1U 1QKEA 2HLRA 1LSIA 1FRAA 1FF4A 4UY2C 4BIKB 2QJBC 1NORA 2H7ZA 3KFDI 3HH7A 4HQPF 2FD6U 2MHYA 2LA1A 2JVEA 4EY8B 1ONJA 1NYUA 1F8UB 4IYEA 2MFAA 3NH7A 1CHVS 2ERAA 1CDTA 1KBAA 1REWC 5DZ5A 1FASA 4FAOC 1B41B 1KBSA 2L5SA 1F94A 1L4WA 1KU6B 2X8BB 4OM5A 1KS6A 2VLWA 2JQPA 1FSCA 1HC9A 2BTXA 1CRFA 1IDLA 2ABXA 2H62D 1CREA 1ZADA 4FAOE 1FFJA 4LFTA 1PLOA 2UWRA 1BXPA 1KL8A 2L03A 1CCQA 2QJAC 2H64C 1TXBA 2H7ZB 5DU1A 1IDIA 1TFSA 1KTZB 1FSSB 4XJJA 2GOOB 2OFSA 1LJZA 2PJYC 2QJ9C 2UX2A 2MUPA 1KBTA 1RL5A 1TGXA 3U74U 1CXOA 3NDSA 1QM7A 6EBXA 2GOOC 1UG4A 2N99A 4BDTB 2H5FA 1ABTA 1CDRA 1TXAA 1CB9A 1W6BA 1DRSA 1CTXA 1NTXA 1LXGA 1IJCA 1BTEA 1XT3A 1CDSA 2CRSA 1KFHA 1HC9B 2H64B 2HLQA 2MJ4A 1JGKA 1ERAA
chains in the Genus database with same CATH topology
4AEAA 2MJYA 1HAJA 1KC4A 1CDQA 5EBXA 2CCXA 1IKCA 1KXIA 1IQ9A 4KSNA 3BT2U 3QB4B 4QTIU 1G6MA 1M9ZA 1HOYA 1NYSA 2PJYB 3EBXA 2BHIA 3ERAA 1LXHA 1S4YA 1ES7B 1IK8A 1CODA 1RGJA 1NTNA 2J8BA 2H8UA 1COEA 2CRTA 5IMYC 1IDGA 4RUDA 2K3GA 1V6PA 1NEAA 1LX5B 1NXBA 2LCRA 3LAQU 1JE9A 4ZQYA 1YWHA 2CDXA 1H0JA 2H62C 2MJ0A 3U73U 1VB0A 1HAAA 3NEQA 1JBDA 2CTXA 2I9BE 2QC1A 5DO6A 3PLCA 3VTSA 1IDHA 2MUOA 1CVOA 1QKDA 5IMTD 4P7UA 1I02A 4DO8A 1CXNA 1MAHF 3KFDE 1ERGA 3FEVA 1MR6A 4OM4A 2NBTA 3EVSC 3BT1U 1QKEA 2HLRA 1LSIA 1FRAA 1FF4A 4UY2C 4BIKB 2QJBC 1NORA 2H7ZA 3KFDI 3HH7A 4HQPF 2FD6U 2MHYA 2LA1A 2JVEA 4EY8B 1ONJA 1NYUA 1F8UB 4IYEA 2MFAA 3NH7A 1CHVS 2ERAA 1CDTA 1KBAA 1REWC 5DZ5A 1FASA 4FAOC 1B41B 1KBSA 2L5SA 1F94A 1L4WA 1KU6B 2X8BB 4OM5A 1KS6A 2VLWA 2JQPA 1FSCA 1HC9A 2BTXA 1CRFA 1IDLA 2ABXA 2H62D 1CREA 1ZADA 4FAOE 1FFJA 4LFTA 1PLOA 2UWRA 1BXPA 1KL8A 2L03A 1CCQA 2QJAC 2H64C 1TXBA 2H7ZB 5DU1A 1IDIA 1TFSA 1KTZB 1FSSB 4XJJA 2GOOB 2OFSA 1LJZA 2PJYC 2QJ9C 2UX2A 2MUPA 1KBTA 1RL5A 1TGXA 3U74U 1CXOA 3NDSA 1QM7A 6EBXA 2GOOC 1UG4A 2N99A 4BDTB 2H5FA 1ABTA 1CDRA 1TXAA 1CB9A 1W6BA 1DRSA 1CTXA 1NTXA 1LXGA 1IJCA 1BTEA 1XT3A 1CDSA 2CRSA 1KFHA 1HC9B 2H64B 2HLQA 2MJ4A 1JGKA 1ERAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEA A;  2MJY A;  1HAJ A;  1KC4 A;  1CDQ A;  5EBX A;  2CCX A;  1IKC A;  1KXI A;  1IQ9 A;  3BT2 U;  3QB4 B;  4QTI U;  1G6M A;  1M9Z A;  1HOY A;  1NYS A;  2PJY B;  3EBX A;  2BHI A;  3ERA A;  1LXH A;  1S4Y A;  1ES7 B;  1IK8 A;  1COD A;  1RGJ A;  1NTN A;  2J8B A;  2H8U A;  1COE A;  2CRT A;  5IMY C;  1IDG A;  4RUD A;  2K3G A;  1V6P A;  1NEA A;  1LX5 B;  1NXB A;  2LCR A;  3LAQ U;  1JE9 A;  4ZQY A;  1YWH A;  2CDX A;  1H0J A;  2H62 C;  2MJ0 A;  3U73 U;  1VB0 A;  1HAA A;  3NEQ A;  1JBD A;  2CTX A;  2I9B E;  2QC1 A;  5DO6 A;  3PLC A;  3VTS A;  1IDH A;  2MUO A;  1CVO A;  1QKD A;  5IMT D;  4P7U A;  1I02 A;  4DO8 A;  1CXN A;  1MAH F;  3KFD E;  1ERG A;  3FEV A;  1MR6 A;  4OM4 A;  2NBT A;  3EVS C;  3BT1 U;  1QKE A;  2HLR A;  1LSI A;  1FRA A;  1FF4 A;  4UY2 C;  4BIK B;  2QJB C;  1NOR A;  2H7Z A;  3KFD I;  3HH7 A;  4HQP F;  2FD6 U;  2MHY A;  2LA1 A;  2JVE A;  4EY8 B;  1ONJ A;  1NYU A;  1F8U B;  4IYE A;  2MFA A;  3NH7 A;  1CHV S;  2ERA A;  1CDT A;  1KBA A;  1REW C;  5DZ5 A;  1FAS A;  4FAO C;  1B41 B;  1KBS A;  2L5S A;  1F94 A;  1L4W A;  1KU6 B;  2X8B B;  4OM5 A;  1KS6 A;  2VLW A;  2JQP A;  1FSC A;  1HC9 A;  2BTX A;  1CRF A;  1IDL A;  2ABX A;  2H62 D;  1CRE A;  1ZAD A;  4FAO E;  1FFJ A;  4LFT A;  1PLO A;  2UWR A;  1BXP A;  1KL8 A;  2L03 A;  1CCQ A;  2QJA C;  2H64 C;  1TXB A;  2H7Z B;  5DU1 A;  1IDI A;  1TFS A;  1KTZ B;  1FSS B;  4XJJ A;  2GOO B;  2OFS A;  1LJZ A;  2PJY C;  2QJ9 C;  2UX2 A;  2MUP A;  1KBT A;  1RL5 A;  1TGX A;  3U74 U;  1CXO A;  3NDS A;  1QM7 A;  6EBX A;  2GOO C;  1UG4 A;  2N99 A;  4BDT B;  2H5F A;  1ABT A;  1CDR A;  1TXA A;  1CB9 A;  1W6B A;  1DRS A;  1CTX A;  1NTX A;  1LXG A;  1IJC A;  1BTE A;  1XT3 A;  1CDS A;  2CRS A;  1KFH A;  1HC9 B;  2H64 B;  2HLQ A;  2MJ4 A;  1JGK A;  1ERA A; 
#chains in the Genus database with same CATH topology
 4AEA A;  2MJY A;  1HAJ A;  1KC4 A;  1CDQ A;  5EBX A;  2CCX A;  1IKC A;  1KXI A;  1IQ9 A;  4KSN A;  3BT2 U;  3QB4 B;  4QTI U;  1G6M A;  1M9Z A;  1HOY A;  1NYS A;  2PJY B;  3EBX A;  2BHI A;  3ERA A;  1LXH A;  1S4Y A;  1ES7 B;  1IK8 A;  1COD A;  1RGJ A;  1NTN A;  2J8B A;  2H8U A;  1COE A;  2CRT A;  5IMY C;  1IDG A;  4RUD A;  2K3G A;  1V6P A;  1NEA A;  1LX5 B;  1NXB A;  2LCR A;  3LAQ U;  1JE9 A;  4ZQY A;  1YWH A;  2CDX A;  1H0J A;  2H62 C;  2MJ0 A;  3U73 U;  1VB0 A;  1HAA A;  3NEQ A;  1JBD A;  2CTX A;  2I9B E;  2QC1 A;  5DO6 A;  3PLC A;  3VTS A;  1IDH A;  2MUO A;  1CVO A;  1QKD A;  5IMT D;  4P7U A;  1I02 A;  4DO8 A;  1CXN A;  1MAH F;  3KFD E;  1ERG A;  3FEV A;  1MR6 A;  4OM4 A;  2NBT A;  3EVS C;  3BT1 U;  1QKE A;  2HLR A;  1LSI A;  1FRA A;  1FF4 A;  4UY2 C;  4BIK B;  2QJB C;  1NOR A;  2H7Z A;  3KFD I;  3HH7 A;  4HQP F;  2FD6 U;  2MHY A;  2LA1 A;  2JVE A;  4EY8 B;  1ONJ A;  1NYU A;  1F8U B;  4IYE A;  2MFA A;  3NH7 A;  1CHV S;  2ERA A;  1CDT A;  1KBA A;  1REW C;  5DZ5 A;  1FAS A;  4FAO C;  1B41 B;  1KBS A;  2L5S A;  1F94 A;  1L4W A;  1KU6 B;  2X8B B;  4OM5 A;  1KS6 A;  2VLW A;  2JQP A;  1FSC A;  1HC9 A;  2BTX A;  1CRF A;  1IDL A;  2ABX A;  2H62 D;  1CRE A;  1ZAD A;  4FAO E;  1FFJ A;  4LFT A;  1PLO A;  2UWR A;  1BXP A;  1KL8 A;  2L03 A;  1CCQ A;  2QJA C;  2H64 C;  1TXB A;  2H7Z B;  5DU1 A;  1IDI A;  1TFS A;  1KTZ B;  1FSS B;  4XJJ A;  2GOO B;  2OFS A;  1LJZ A;  2PJY C;  2QJ9 C;  2UX2 A;  2MUP A;  1KBT A;  1RL5 A;  1TGX A;  3U74 U;  1CXO A;  3NDS A;  1QM7 A;  6EBX A;  2GOO C;  1UG4 A;  2N99 A;  4BDT B;  2H5F A;  1ABT A;  1CDR A;  1TXA A;  1CB9 A;  1W6B A;  1DRS A;  1CTX A;  1NTX A;  1LXG A;  1IJC A;  1BTE A;  1XT3 A;  1CDS A;  2CRS A;  1KFH A;  1HC9 B;  2H64 B;  2HLQ A;  2MJ4 A;  1JGK A;  1ERA A; 
#chains in the Genus database with same CATH homology
 4AEA A;  2MJY A;  1HAJ A;  1KC4 A;  1CDQ A;  5EBX A;  2CCX A;  1IKC A;  1KXI A;  1IQ9 A;  4KSN A;  3BT2 U;  3QB4 B;  4QTI U;  1G6M A;  1M9Z A;  1HOY A;  1NYS A;  2PJY B;  3EBX A;  2BHI A;  3ERA A;  1LXH A;  1S4Y A;  1ES7 B;  1IK8 A;  1COD A;  1RGJ A;  1NTN A;  2J8B A;  2H8U A;  1COE A;  2CRT A;  5IMY C;  1IDG A;  4RUD A;  2K3G A;  1V6P A;  1NEA A;  1LX5 B;  1NXB A;  2LCR A;  3LAQ U;  1JE9 A;  4ZQY A;  1YWH A;  2CDX A;  1H0J A;  2H62 C;  2MJ0 A;  3U73 U;  1VB0 A;  1HAA A;  3NEQ A;  1JBD A;  2CTX A;  2I9B E;  2QC1 A;  5DO6 A;  3PLC A;  3VTS A;  1IDH A;  2MUO A;  1CVO A;  1QKD A;  5IMT D;  4P7U A;  1I02 A;  4DO8 A;  1CXN A;  1MAH F;  3KFD E;  1ERG A;  3FEV A;  1MR6 A;  4OM4 A;  2NBT A;  3EVS C;  3BT1 U;  1QKE A;  2HLR A;  1LSI A;  1FRA A;  1FF4 A;  4UY2 C;  4BIK B;  2QJB C;  1NOR A;  2H7Z A;  3KFD I;  3HH7 A;  4HQP F;  2FD6 U;  2MHY A;  2LA1 A;  2JVE A;  4EY8 B;  1ONJ A;  1NYU A;  1F8U B;  4IYE A;  2MFA A;  3NH7 A;  1CHV S;  2ERA A;  1CDT A;  1KBA A;  1REW C;  5DZ5 A;  1FAS A;  4FAO C;  1B41 B;  1KBS A;  2L5S A;  1F94 A;  1L4W A;  1KU6 B;  2X8B B;  4OM5 A;  1KS6 A;  2VLW A;  2JQP A;  1FSC A;  1HC9 A;  2BTX A;  1CRF A;  1IDL A;  2ABX A;  2H62 D;  1CRE A;  1ZAD A;  4FAO E;  1FFJ A;  4LFT A;  1PLO A;  2UWR A;  1BXP A;  1KL8 A;  2L03 A;  1CCQ A;  2QJA C;  2H64 C;  1TXB A;  2H7Z B;  5DU1 A;  1IDI A;  1TFS A;  1KTZ B;  1FSS B;  4XJJ A;  2GOO B;  2OFS A;  1LJZ A;  2PJY C;  2QJ9 C;  2UX2 A;  2MUP A;  1KBT A;  1RL5 A;  1TGX A;  3U74 U;  1CXO A;  3NDS A;  1QM7 A;  6EBX A;  2GOO C;  1UG4 A;  2N99 A;  4BDT B;  2H5F A;  1ABT A;  1CDR A;  1TXA A;  1CB9 A;  1W6B A;  1DRS A;  1CTX A;  1NTX A;  1LXG A;  1IJC A;  1BTE A;  1XT3 A;  1CDS A;  2CRS A;  1KFH A;  1HC9 B;  2H64 B;  2HLQ A;  2MJ4 A;  1JGK A;  1ERA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...