3U74U

Crystal structure of stabilized human upar mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
283
structure length
263
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTCSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMCHIDVSCCTKSGCNHPDLDVQYRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator surface receptor
publication title Crystal structure of the urokinase receptor in a ligand-free form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase receptor
total genus 69
structure length 263
sequence length 283
ec nomenclature
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u74U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u74U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3u74U02
2K3GA 1FASA 2ERAA 3VTSA 3KFDI 1RL5A 1VB0A 1CRFA 5DU1A 3EBXA 2H64C 1ERAA 1IDLA 1LXHA 2J8BA 1HC9B 1S4YA 4OM5A 1FFJA 2QJBC 1NORA 3QB4B 2HLRA 1PLOA 1FSCA 2H7ZB 2OFSA 2MUPA 1H0JA 5DO6A 1JE9A 1I02A 1B41B 3NDSA 1CCQA 1CHVS 4AEAA 1ES7B 1RGJA 1MR6A 1G6MA 1IDHA 1TFSA 1FRAA 1JGKA 1CDSA 1COEA 2BHIA 2H5FA 1LSIA 1UG4A 1KFHA 1IJCA 4RUDA 4EY8B 2H62C 1BXPA 2H64B 1IQ9A 2VLWA 2QC1A 1CDRA 6EBXA 1KBTA 2H7ZA 1ZADA 1CREA 2MUOA 5EBXA 1CDQA 2GOOB 2JVEA 1JBDA 1CODA 1LXGA 1IKCA 1CB9A 2CDXA 1CXOA 1FSSB 5DZ5A 4BIKB 1LX5B 1XT3A 2MHYA 1ABTA 1ERGA 2QJAC 1KC4A 1MAHF 1DRSA 2MFAA 1YWHA 1L4WA 4DO8A 1FF4A 1ONJA 3BT1U 3NH7A 1NYSA 2ABXA 1KL8A 1IDIA 1IDGA 4P7UA 5IMTD 3EVSC 1HC9A 1KU6B 4XJJA 2L03A 4IYEA 1KBAA 1HAAA 1NXBA 1QKDA 2I9BE 3LAQU 2CRTA 3U73U 1KS6A 2LA1A 1CDTA 4FAOC 4ZQYA 1TXBA 1QM7A 1KXIA 2CTXA 2PJYC 3PLCA 2X8BB 2NBTA 1CVOA 1REWC 2HLQA 2CCXA 2H8UA 1NEAA 4QTIU 1M9ZA 2H62D 1TGXA 1V6PA 4HQPF 4UY2C 2MJYA 1QKEA 1HAJA 3KFDE 2JQPA 1CTXA 1F8UB 1F94A 1TXAA 2MJ0A 3HH7A 2GOOC 4FAOE 2L5SA 1NTNA 1BTEA 1NTXA 3U74U 2LCRA 1HOYA 4LFTA 4BDTB 2QJ9C 4OM4A 1IK8A 2FD6U 2N99A 2BTXA 1KTZB 2UX2A 2UWRA 2PJYB 3FEVA 5IMYC 1W6BA 3NEQA 1NYUA 3BT2U 3ERAA 2CRSA 1CXNA 1KBSA 2MJ4A 1LJZA
chains in the Genus database with same CATH superfamily
2K3GA 1FASA 2ERAA 3VTSA 3KFDI 1RL5A 1VB0A 1CRFA 5DU1A 3EBXA 2H64C 1ERAA 1IDLA 1LXHA 2J8BA 1HC9B 1S4YA 4OM5A 1FFJA 2QJBC 1NORA 3QB4B 2HLRA 1PLOA 1FSCA 2H7ZB 2OFSA 2MUPA 1H0JA 5DO6A 1JE9A 1I02A 1B41B 3NDSA 1CCQA 1CHVS 4AEAA 1ES7B 1RGJA 1MR6A 1G6MA 1IDHA 1TFSA 4KSNA 1FRAA 1JGKA 1CDSA 1COEA 2BHIA 2H5FA 1LSIA 1UG4A 1KFHA 1IJCA 4RUDA 4EY8B 2H62C 1BXPA 2H64B 1IQ9A 2VLWA 2QC1A 1CDRA 6EBXA 1KBTA 2H7ZA 1ZADA 1CREA 2MUOA 5EBXA 1CDQA 2GOOB 2JVEA 1JBDA 1CODA 1LXGA 1IKCA 1CB9A 2CDXA 1CXOA 1FSSB 5DZ5A 4BIKB 1LX5B 1XT3A 2MHYA 1ABTA 1ERGA 2QJAC 1KC4A 1MAHF 1DRSA 2MFAA 1YWHA 1L4WA 4DO8A 1FF4A 1ONJA 3BT1U 3NH7A 1NYSA 2ABXA 1KL8A 1IDIA 1IDGA 4P7UA 5IMTD 3EVSC 1HC9A 1KU6B 4XJJA 2L03A 4IYEA 1KBAA 1HAAA 1NXBA 1QKDA 2I9BE 3LAQU 2CRTA 3U73U 1KS6A 2LA1A 1CDTA 4FAOC 4ZQYA 1TXBA 1QM7A 1KXIA 2CTXA 2PJYC 3PLCA 2X8BB 2NBTA 1CVOA 1REWC 2HLQA 2CCXA 2H8UA 1NEAA 4QTIU 1M9ZA 2H62D 1TGXA 1V6PA 4HQPF 4UY2C 2MJYA 1QKEA 1HAJA 3KFDE 2JQPA 1CTXA 1F8UB 1F94A 1TXAA 2MJ0A 3HH7A 2GOOC 4FAOE 2L5SA 1NTNA 1BTEA 1NTXA 3U74U 2LCRA 1HOYA 4LFTA 4BDTB 2QJ9C 4OM4A 1IK8A 2FD6U 2N99A 2BTXA 1KTZB 2UX2A 2UWRA 2PJYB 3FEVA 5IMYC 1W6BA 3NEQA 1NYUA 3BT2U 3ERAA 2CRSA 1CXNA 1KBSA 2MJ4A 1LJZA
chains in the Genus database with same CATH topology
2K3GA 1FASA 2ERAA 3VTSA 3KFDI 1RL5A 1VB0A 1CRFA 5DU1A 3EBXA 2H64C 1ERAA 1IDLA 1LXHA 2J8BA 1HC9B 1S4YA 4OM5A 1FFJA 2QJBC 1NORA 3QB4B 2HLRA 1PLOA 1FSCA 2H7ZB 2OFSA 2MUPA 1H0JA 5DO6A 1JE9A 1I02A 1B41B 3NDSA 1CCQA 1CHVS 4AEAA 1ES7B 1RGJA 1MR6A 1G6MA 1IDHA 1TFSA 4KSNA 1FRAA 1JGKA 1CDSA 1COEA 2BHIA 2H5FA 1LSIA 1UG4A 1KFHA 1IJCA 4RUDA 4EY8B 2H62C 1BXPA 2H64B 1IQ9A 2VLWA 2QC1A 1CDRA 6EBXA 1KBTA 2H7ZA 1ZADA 1CREA 2MUOA 5EBXA 1CDQA 2GOOB 2JVEA 1JBDA 1CODA 1LXGA 1IKCA 1CB9A 2CDXA 1CXOA 1FSSB 5DZ5A 4BIKB 1LX5B 1XT3A 2MHYA 1ABTA 1ERGA 2QJAC 1KC4A 1MAHF 1DRSA 2MFAA 1YWHA 1L4WA 4DO8A 1FF4A 1ONJA 3BT1U 3NH7A 1NYSA 2ABXA 1KL8A 1IDIA 1IDGA 4P7UA 5IMTD 3EVSC 1HC9A 1KU6B 4XJJA 2L03A 4IYEA 1KBAA 1HAAA 1NXBA 1QKDA 2I9BE 3LAQU 2CRTA 3U73U 1KS6A 2LA1A 1CDTA 4FAOC 4ZQYA 1TXBA 1QM7A 1KXIA 2CTXA 2PJYC 3PLCA 2X8BB 2NBTA 1CVOA 1REWC 2HLQA 2CCXA 2H8UA 1NEAA 4QTIU 1M9ZA 2H62D 1TGXA 1V6PA 4HQPF 4UY2C 2MJYA 1QKEA 1HAJA 3KFDE 2JQPA 1CTXA 1F8UB 1F94A 1TXAA 2MJ0A 3HH7A 2GOOC 4FAOE 2L5SA 1NTNA 1BTEA 1NTXA 3U74U 2LCRA 1HOYA 4LFTA 4BDTB 2QJ9C 4OM4A 1IK8A 2FD6U 2N99A 2BTXA 1KTZB 2UX2A 2UWRA 2PJYB 3FEVA 5IMYC 1W6BA 3NEQA 1NYUA 3BT2U 3ERAA 2CRSA 1CXNA 1KBSA 2MJ4A 1LJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3G A;  1FAS A;  2ERA A;  3VTS A;  3KFD I;  1RL5 A;  1VB0 A;  1CRF A;  5DU1 A;  3EBX A;  2H64 C;  1ERA A;  1IDL A;  1LXH A;  2J8B A;  1HC9 B;  1S4Y A;  4OM5 A;  1FFJ A;  2QJB C;  1NOR A;  3QB4 B;  2HLR A;  1PLO A;  1FSC A;  2H7Z B;  2OFS A;  2MUP A;  1H0J A;  5DO6 A;  1JE9 A;  1I02 A;  1B41 B;  3NDS A;  1CCQ A;  1CHV S;  4AEA A;  1ES7 B;  1RGJ A;  1MR6 A;  1G6M A;  1IDH A;  1TFS A;  1FRA A;  1JGK A;  1CDS A;  1COE A;  2BHI A;  2H5F A;  1LSI A;  1UG4 A;  1KFH A;  1IJC A;  4RUD A;  4EY8 B;  2H62 C;  1BXP A;  2H64 B;  1IQ9 A;  2VLW A;  2QC1 A;  1CDR A;  6EBX A;  1KBT A;  2H7Z A;  1ZAD A;  1CRE A;  2MUO A;  5EBX A;  1CDQ A;  2GOO B;  2JVE A;  1JBD A;  1COD A;  1LXG A;  1IKC A;  1CB9 A;  2CDX A;  1CXO A;  1FSS B;  5DZ5 A;  4BIK B;  1LX5 B;  1XT3 A;  2MHY A;  1ABT A;  1ERG A;  2QJA C;  1KC4 A;  1MAH F;  1DRS A;  2MFA A;  1YWH A;  1L4W A;  4DO8 A;  1FF4 A;  1ONJ A;  3BT1 U;  3NH7 A;  1NYS A;  2ABX A;  1KL8 A;  1IDI A;  1IDG A;  4P7U A;  5IMT D;  3EVS C;  1HC9 A;  1KU6 B;  4XJJ A;  2L03 A;  4IYE A;  1KBA A;  1HAA A;  1NXB A;  1QKD A;  2I9B E;  3LAQ U;  2CRT A;  3U73 U;  1KS6 A;  2LA1 A;  1CDT A;  4FAO C;  4ZQY A;  1TXB A;  1QM7 A;  1KXI A;  2CTX A;  2PJY C;  3PLC A;  2X8B B;  2NBT A;  1CVO A;  1REW C;  2HLQ A;  2CCX A;  2H8U A;  1NEA A;  4QTI U;  1M9Z A;  2H62 D;  1TGX A;  1V6P A;  4HQP F;  4UY2 C;  2MJY A;  1QKE A;  1HAJ A;  3KFD E;  2JQP A;  1CTX A;  1F8U B;  1F94 A;  1TXA A;  2MJ0 A;  3HH7 A;  2GOO C;  4FAO E;  2L5S A;  1NTN A;  1BTE A;  1NTX A;  3U74 U;  2LCR A;  1HOY A;  4LFT A;  4BDT B;  2QJ9 C;  4OM4 A;  1IK8 A;  2FD6 U;  2N99 A;  2BTX A;  1KTZ B;  2UX2 A;  2UWR A;  2PJY B;  3FEV A;  5IMY C;  1W6B A;  3NEQ A;  1NYU A;  3BT2 U;  3ERA A;  2CRS A;  1CXN A;  1KBS A;  2MJ4 A;  1LJZ A; 
#chains in the Genus database with same CATH topology
 2K3G A;  1FAS A;  2ERA A;  3VTS A;  3KFD I;  1RL5 A;  1VB0 A;  1CRF A;  5DU1 A;  3EBX A;  2H64 C;  1ERA A;  1IDL A;  1LXH A;  2J8B A;  1HC9 B;  1S4Y A;  4OM5 A;  1FFJ A;  2QJB C;  1NOR A;  3QB4 B;  2HLR A;  1PLO A;  1FSC A;  2H7Z B;  2OFS A;  2MUP A;  1H0J A;  5DO6 A;  1JE9 A;  1I02 A;  1B41 B;  3NDS A;  1CCQ A;  1CHV S;  4AEA A;  1ES7 B;  1RGJ A;  1MR6 A;  1G6M A;  1IDH A;  1TFS A;  4KSN A;  1FRA A;  1JGK A;  1CDS A;  1COE A;  2BHI A;  2H5F A;  1LSI A;  1UG4 A;  1KFH A;  1IJC A;  4RUD A;  4EY8 B;  2H62 C;  1BXP A;  2H64 B;  1IQ9 A;  2VLW A;  2QC1 A;  1CDR A;  6EBX A;  1KBT A;  2H7Z A;  1ZAD A;  1CRE A;  2MUO A;  5EBX A;  1CDQ A;  2GOO B;  2JVE A;  1JBD A;  1COD A;  1LXG A;  1IKC A;  1CB9 A;  2CDX A;  1CXO A;  1FSS B;  5DZ5 A;  4BIK B;  1LX5 B;  1XT3 A;  2MHY A;  1ABT A;  1ERG A;  2QJA C;  1KC4 A;  1MAH F;  1DRS A;  2MFA A;  1YWH A;  1L4W A;  4DO8 A;  1FF4 A;  1ONJ A;  3BT1 U;  3NH7 A;  1NYS A;  2ABX A;  1KL8 A;  1IDI A;  1IDG A;  4P7U A;  5IMT D;  3EVS C;  1HC9 A;  1KU6 B;  4XJJ A;  2L03 A;  4IYE A;  1KBA A;  1HAA A;  1NXB A;  1QKD A;  2I9B E;  3LAQ U;  2CRT A;  3U73 U;  1KS6 A;  2LA1 A;  1CDT A;  4FAO C;  4ZQY A;  1TXB A;  1QM7 A;  1KXI A;  2CTX A;  2PJY C;  3PLC A;  2X8B B;  2NBT A;  1CVO A;  1REW C;  2HLQ A;  2CCX A;  2H8U A;  1NEA A;  4QTI U;  1M9Z A;  2H62 D;  1TGX A;  1V6P A;  4HQP F;  4UY2 C;  2MJY A;  1QKE A;  1HAJ A;  3KFD E;  2JQP A;  1CTX A;  1F8U B;  1F94 A;  1TXA A;  2MJ0 A;  3HH7 A;  2GOO C;  4FAO E;  2L5S A;  1NTN A;  1BTE A;  1NTX A;  3U74 U;  2LCR A;  1HOY A;  4LFT A;  4BDT B;  2QJ9 C;  4OM4 A;  1IK8 A;  2FD6 U;  2N99 A;  2BTX A;  1KTZ B;  2UX2 A;  2UWR A;  2PJY B;  3FEV A;  5IMY C;  1W6B A;  3NEQ A;  1NYU A;  3BT2 U;  3ERA A;  2CRS A;  1CXN A;  1KBS A;  2MJ4 A;  1LJZ A; 
#chains in the Genus database with same CATH homology
 2K3G A;  1FAS A;  2ERA A;  3VTS A;  3KFD I;  1RL5 A;  1VB0 A;  1CRF A;  5DU1 A;  3EBX A;  2H64 C;  1ERA A;  1IDL A;  1LXH A;  2J8B A;  1HC9 B;  1S4Y A;  4OM5 A;  1FFJ A;  2QJB C;  1NOR A;  3QB4 B;  2HLR A;  1PLO A;  1FSC A;  2H7Z B;  2OFS A;  2MUP A;  1H0J A;  5DO6 A;  1JE9 A;  1I02 A;  1B41 B;  3NDS A;  1CCQ A;  1CHV S;  4AEA A;  1ES7 B;  1RGJ A;  1MR6 A;  1G6M A;  1IDH A;  1TFS A;  4KSN A;  1FRA A;  1JGK A;  1CDS A;  1COE A;  2BHI A;  2H5F A;  1LSI A;  1UG4 A;  1KFH A;  1IJC A;  4RUD A;  4EY8 B;  2H62 C;  1BXP A;  2H64 B;  1IQ9 A;  2VLW A;  2QC1 A;  1CDR A;  6EBX A;  1KBT A;  2H7Z A;  1ZAD A;  1CRE A;  2MUO A;  5EBX A;  1CDQ A;  2GOO B;  2JVE A;  1JBD A;  1COD A;  1LXG A;  1IKC A;  1CB9 A;  2CDX A;  1CXO A;  1FSS B;  5DZ5 A;  4BIK B;  1LX5 B;  1XT3 A;  2MHY A;  1ABT A;  1ERG A;  2QJA C;  1KC4 A;  1MAH F;  1DRS A;  2MFA A;  1YWH A;  1L4W A;  4DO8 A;  1FF4 A;  1ONJ A;  3BT1 U;  3NH7 A;  1NYS A;  2ABX A;  1KL8 A;  1IDI A;  1IDG A;  4P7U A;  5IMT D;  3EVS C;  1HC9 A;  1KU6 B;  4XJJ A;  2L03 A;  4IYE A;  1KBA A;  1HAA A;  1NXB A;  1QKD A;  2I9B E;  3LAQ U;  2CRT A;  3U73 U;  1KS6 A;  2LA1 A;  1CDT A;  4FAO C;  4ZQY A;  1TXB A;  1QM7 A;  1KXI A;  2CTX A;  2PJY C;  3PLC A;  2X8B B;  2NBT A;  1CVO A;  1REW C;  2HLQ A;  2CCX A;  2H8U A;  1NEA A;  4QTI U;  1M9Z A;  2H62 D;  1TGX A;  1V6P A;  4HQP F;  4UY2 C;  2MJY A;  1QKE A;  1HAJ A;  3KFD E;  2JQP A;  1CTX A;  1F8U B;  1F94 A;  1TXA A;  2MJ0 A;  3HH7 A;  2GOO C;  4FAO E;  2L5S A;  1NTN A;  1BTE A;  1NTX A;  3U74 U;  2LCR A;  1HOY A;  4LFT A;  4BDT B;  2QJ9 C;  4OM4 A;  1IK8 A;  2FD6 U;  2N99 A;  2BTX A;  1KTZ B;  2UX2 A;  2UWR A;  2PJY B;  3FEV A;  5IMY C;  1W6B A;  3NEQ A;  1NYU A;  3BT2 U;  3ERA A;  2CRS A;  1CXN A;  1KBS A;  2MJ4 A;  1LJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...