3U7YH

Structure of nih45-46 fab in complex with gp120 of 93th057 hiv
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRGGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords NIH45-46 heavy chain, Ig gamma-1 chain C region
publication title Increasing the Potency and Breadth of an HIV Antibody by Using Structure-Based Rational Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2011-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH01
4XP6L 1QR1B 5EC2A 2BMKB 4XHJC 4ZDHA 4G9FB 5C0FB 1G7JB 2I60H 3DVNA 3TZVA 4D9QD 5JXAH 4HS3B 1KV3A 2H8PA 1CLYH 4MSWA 3HC3L 5DJAB 1JHTB 1YEHH 3ARBB 1SJVA 1YYLL 1GJIA 2EKJA 2D7QA 2DWDA 4G6MH 4YNYB 4ODXA 5CCKL 4OZFH 5EO0A 3L6FA 4DUXA 2GITA 2BX5A 2W91A 4XWGH 3QDGA 5GJTL 3D39D 5EN2B 1LEKA 3P9MA 1WT5C 1E27A 3QZWA 3VXUA 1A14L 3HNVL 3PL6C 4UMGA 1N0LA 3TPUB 4WI3A 3WHE1 4XMPL 1AO7A 5KS9F 3CMGA 5I1IL 5F93C 4LBEA 1FLTX 1ZS8A 3TYFA 3C5JB 2OR9L 1BVKA 1J8HE 5HJ3B 1VFUA 3TV3L 1GC1C 2EDOA 5I8KL 1A7RH 2XWTA 4GG6A 3OR7B 1VFAA 4XNZC 1SYSB 4UILH 1FL3B 4NJ9H 3IRZA 4HG4K 4YJZL 3GFUA 3QEQD 4DVBB 4HS8L 5HHME 3L9RA 3QR2A 2XTLA 3QWRD 5DFVD 3VFOB 2P5ED 2VQ1A 5DZOA 3IB4A 5FOJA 5FV2A 5TGBB 2YEZA 1U8OB 2XTJE 3BP5B 5KTEH 4ZSOE 5A43C 4X5WA 1DZBA 1F3JA 1MJ7L 2I26N 3G5VB 1G7IB 3L5WA 3JVGC 1PW3A 2VC2L 1P84J 2CXKA 2R23A 2JTDA 4L4VE 1HK6A 3TM6A 4WEUD 2AJ3B 2DLEA 2HJFA 4NCC2 1YEKL 1G7QB 1RUMH 3E2HC 4MHHG 3OX8B 2A9MH 2CLRA 4NKMA 5FYLL 4OFYA 1A3LH 5AWNL 4MX7A 4BH8A 5M94B 1D9KC 4NQCE 4MCZA 4MJ2A 32C2A 5I9QC 2DLIA 5EG6C 3O4LA 5LWYH 2BNQB 5C0BA 3LN5A 1QRNE 4GBXC 4U1HA 5GGSB 4LAQH 3P4NB 5I15L 1UCBL 5DRNB 3MV7E 1RUPH 5IBUB 1GC1L 1G6VK 5CINL 1RZ7H 1OQXA 1SJHB 4UOW1 3FOMA 2XA8L 2NTSP 3MRGA 3TWCL 1I4FA 4LLYA 1NBYA 1R5WB 4I0KA 4YE4H 1Q0XH 2AQ3A 4WNQA 1JHLL 4ZFGL 4DFIA 2V5TA 3BP6A 1A7BA 1BZ7A 5FA3A 1A4JB 2ESVE 2J5LB 1QSVA 1GRWA 3LDBB 1YY8B 2EXYC 4ZO6A 1EHLL 3B9KC 4NQDD 4M48L 1FFPA 4L8SB 1RU9L 1WUNT 5D7SL 3RVTD 5T33H 2WNGA 1P4LB 3GGWA 2HLFD 3SDDC 3LEVL 3BRDA 1H5BA 4XPBL 5EBMA 1TNNA 3LAFA 3KLDA 2J7LA 2FR4B 4HWZA 4R7DA 4NQTA 2AJVL 2CIIB 3NIFE 2OR8A 4P57A 1FGNH 4WO4A 3BXNB 4Y0GA 5BV7C 4HWBA 2X44D 3BT2L 4XP4H 3FZUC 3CC5B 4L4TD 5T3ZH 1WFNA 1ED3A 2AGJH 2HJLA 1OWRM 4X6FA 4EDWH 2R1YA 1ND0B 3IDGB 4YEFA 4OZ4B 4ZG1A 4DWHA 2UWEE 1QQDB 2OR7A 4WCYH 5FOBB 3UBXG 5ADPL 4L3CB 2C4FT 5DO2C 3VFNA 1MI5A 1EBPA 3MLWH 4YDJB 4GXVL 3D3VE 1M05B 3ET9F 3X13A 3NCCB 1E6JL 1S7XA 5D7LE 4ONOA 2FJFA 1NLBL 3PABA 1Z3GH 3TBSA 4LDOB 4PRPB 3EYOB 3WXWL 2H9GB 4F3FB 2PNDA 3MCG1 1FORH 3RWIA 1C08B 4KMLB 4JGMA 1JZ5A 2AI0L 2CRZA 3CH1A 1LEGB 5EIVA 4U1MB 5F96L 2NY4B 4ZFOA 3HE7D 1JZ7A 1JHKL 1IKFL 2BSRB 3BE1H 4LVHC 3EYQC 3RNQB 1PVHA 2HJKA 4MNHA 4ZAKC 1MRDH 5E9DA 4OZIF 3WS6A 1NCWL 5HPOA 3VXME 2OSLA 4JRXD 1HCFX 2HKHH 3S3JA 4MNQA 1I7RA 1E28B 1IKNA 4KK9C 3H9SA 4BZ2H 5CKAA 2YKLH 1RFDL 4PY7A 4HJ0D 3HG1D 4Y5VC 4YFLF 4PJIE 1FVEA 1R24B 3RWJB 1YDPA 2ZSWB 4K9EL 3FO0L 5BV7L 2QV2A 1HKLL 2EEDA 2FECL 3DGGB 1VGKA 4PJXB 1J1PL 1LK2A 4XBEL 3H8NA 4I2XE 3O9WC 3TVMC 8CGTA 4X7SH 1V3LA 1K4DB 2PETA 3QULA 2AK1H 4U0RC 5HGAB 2IF7A 2W1NA 4WY7H 5T5NG 3OKOB 5I75B 3ULUL 1WC7A 1IC4H 3FFDA 2DQEL 1H8NA 5HDOA 4XVJH 4NQED 1PDKA 1U8MA 2R1WA 2X4TB 4G9FE 4M6ML 2EE9A 1FYHB 2Y36H 4W4OA 4S2SA 1UYWH 4ISVB 3SDCC 3V4PH 1FIEA 5HY9A 4DKAA 4XCYB 4L3EB 3GMOB 4XP5H 3P0VH 1QHPA 1DQMH 3GIVA 4M7ZC 4QNPE 4YXKH 4WIQA 4P5KA 2ICWJ 2GT9A 3ULSA 1ZSDA 4XHJD 3T4AB 3ROOB 2OL3A 3LPGA 4DAGH 4YHML 3GO1L 2ZUQB 2G9HA 4QRPA 4DGVH 2LTQC 5E6IB 1T2JA 4X6DF 3DTXA 1S8DA 3N85L 15C8L 4P0DA 1S78C 2DF3A 1I8IA 2P49B 3DUUB 3SN6N 1WAAE 1EO5A 5D7IF 2B5IB 2W0LA 4Z7VF 5CAYB 3T0EC 1IZJA 1NKRA 1IARB 1RJCA 2HFGH 5T1KD 5HHVH 1KLUA 1KXVC 4R0LB 3HI5L 1KLGA 3E8UH 3OF6D 2NXYB 3TT1L 4K7PL 1AGEB 4YUEL 4LKCB 5FKPA 4KQ3H 3VA6A 5FUOH 3NGBB 5ITBH 4WFHE 4P99A 5FYLD 5DJDB 1ZV5A 2R2BB 5JUEH 1MFEH 3UTSD 4XZUB 4LSSL 1LE5A 4FXGA 3I3BA 3LCYA 4PJHB 5EO9A 3RUGA 3PL6D 4JO2H 4P5MA 3GRWA 3JTSA 3TO4A 1GGYA 2HYMA 3L5JA 2X4SA 4UBDD 5D2NA 3FQXA 2G75B 4I18A 1IGTA 1SEQL 1P7KA 3BISA 1D6EA 2QQNL 2P5WD 2F19H 5ICXA 4QHMA 1I85C 1PYWA 3QCUH 2NXZC 3O3BA 2NY6C 5F89A 1K8IB 1HXMA 5HHNB 4IMLA 3WLWC 1OSPH 5IM7B 2EO1A 5CJXC 3HAEB 4ALAL 4UIMB 3R1GH 2B1AL 1EAPB 1HILB 3SJVB 5CIPB 1BIHA 3M8OH 4AH2A 4OTXH 5D1ZA 4X6CF 3LS4H 3D85A 3GNML 4S11A 4GG8A 4LIQH 4OLZH 1MAKA 3QXDA 3QNYA 3WNOA 5IQ9B 2WIIA 4OFVA 3EOTH 2IJ0C 5KW9L 1JN6A 3DXAA 5DHVH 1FO0B 4PJ8D 1J7VR 3IVKA 5HHOB 2IMMA 2M26A 4PJ7F 2GHWB 3T0XA 5LVEA 3SY0B 5FECB 5E5MA 1N6QH 2FO1A 1QZ1A 3MLYL 2BNQE 4IS6A 4PV8A 3KWWB 4LKXA 3K8MA 4JLRA 1J9CT 1VKXA 1X5AA 1RZ8B 3MR9A 1DSFH 5GRZA 4Y19A 5DK0A 3S36H 5IB3B 3MBEA 4WI8A 1U8IB 1B6UA 3HA0A 4QRRA 3FRUA 3D39A 2ZOLB 4K07A 3ZTJH 4JG1L 1BFTA 4ZUVB 1KIPA 4U1NA 1TETL 2KKQA 2VL5A 2G5RA 1XR9B 2VDKL 4GBXD 2X9WA 4GKSA 4HUXA 4Y2DC 3SE8H 4Y5XA 4M7LT 4YPGB 1RSFA 5HDLA 4EOWL 4NNXB 5FDWB 1IMHC 4YWGH 4OCLC 5C0AA 3MRRB 4PJAA 4MD4A 4DGYH 3MNZA 5DMIL 4PJBF 2X4PB 4HS6A 3KPSD 1JWMA 1JRHL 1WBYB 3T1WA 2X1OA 4QYOB 3V9FA 1A22B 2OTWA 1EIBA 3NIDE 5FK9A 4O4YH 2ZJSL 1LDPH 4P2CG 3W0WB 1T1ZB 1W0VB 2AXJA 4WUUB 3WNPA 2YMXL 1AGBB 5D6CA 3DHMA 1QSEB 1KT2A 1XGUA 1I75A 3MLPA 1CFVH 1RZGB 4JHZA 5TQ2H 1FYTD 3MV8A 1DJSA 2ITCA 3D2UB 1A5FL 3SKUD 1MPAL 4KC3B 4N0CC 3SDDD 2HVKB 4JPIB 5ESAA 1YY9C 4O58L 4HV8B 4V2CB 4OT1H 1KTLB 1P5UA 5IEHA 2CIKB 5EU6B 1BBJB 3VW3H 1K85A 4F9PC 4H1LA 3ARQA 1A9EA 4XI5C 4TOYL 1NLDL 3QEUA 1IGYA 3DROA 3FZUD 4HCRL 4WU5B 4Y1AB 3S88H 4OQTL 1LE9B 4QLRA 3AROA 4CVXB 1ZTXH 2X1PA 2EKSA 4NZTH 4Z7OE 2VXVH 4PRPE 1RZKC 4JN1H 2VDQL 3ULUD 3QH3A 2WZPD 1K3IA 4JY5L 1BOGB 5DO2D 3TIDA 1NDMA 3V0VA 4HK0A 5DEGB 3I02B 5I1EH 1CFTA 4H8WC 1IEAB 2H32B 3NA4A 4PY8J 4E0RB 3MODH 1I9IH 3EO0A 3DX8A 4XC3L 3WIFA 4B5EA 5JPNB 3L95A 1A7PL 4NKQB 5EZOH 2H26A 2ICWA 1T22B 4LMQI 5D5MA 5E8OB 3H3BC 3U0PA 5SWQA 1JI2A 4U2YA 1CLZH 2Y5TB 4JQIL 4PJXE 5IVOA 5FB8B 3AGVA 4ZS7L 5C0NC 3VFPB 3HNTL 3ZT7A 3BDYL 5JR1H 4FZEH 3VGGA 4UQ2A 1N4XH 2DRUA 3AREA 5J3HC 5CGMA 1BWMA 1IM9B 1RUQL 2ZCKL 4JPKL 4DW2L 5IB2A 3NFNB 5AEAA 2HLAA 3SKOA 1KIQB 4NC2B 5F7LB 2BFVH 3HFML 3O9WD 4NP4H 4C83B 4GAGL 1VFBA 4LPVA 1U93B 1FZJB 4QWWC 1BMGA 5LGKA 1RZKL 4L3EE 4BFIA 5L2KA 2O5ZH 2DM4A 3EYUL 4K8RL 2Z93A 3TJEL 4J3OC 1N6UA 5TF1L 4Q9BA 3LH2L 4RMQA 3B2VL 4KI5F 4H8WL 4J7RA 4ZNEE 3K7UA 1FLRH 3MOBH 4JCLA 5HGBA 3SDCD 3VDCA 3CDCA 4FTVB 3V6OA 4M6NL 2OTPA 4GLRI 4L1HA 5BS0D 4WHTA 3SDAB 4WU7B 1J05B 4XAWL 4JVPA 3TN0D 4FQHA 2GK2A 2D7TH 3F7QA 3V7AE 1KPVA 2ZWLT 1SBSL 4ERSH 2NX5E 3UZQA 3F5WA 5I8EB 5DWUH 4APQB 1JNNH 3Q2CA 3UC0H 4E9LA 3TBTA 1ONQB 5I30H 4PJHE 4PRHA 1ZHBA 5A16A 3T0ED 4JPVH 3AY4C 2V6HA 1J0ZA 4IDJL 4C4KT 4J8RA 2VZ3A 5DC4B 4BSWA 2R69H 1CD9B 3P0YH 1QKZH 4FS0A 5ETUA 3UBXA 3DUSA 5AG8A 2DI7A 3WHXB 1QBAA 4HF5H 2BERA 4YIQB 4HUVB 5J12B 4X5XB 2LU4A 3OXRA 5D2LA 2FJGA 3HZVB 4HKXB 4Y88A 3SQOL 2VZUA 3CIQA 4KRPB 4RA0C 4DN4L 1BJMA 4HDIB 3SOBH 4WHCA 4MQXC 4HIHB 1YEGH 4LMQE 3SJVE 1DVFC 2JIXA 4LLMA 5CP7B 2V17L 5HVHC 3PWVA 1FDLH 2V9TA 2NY6D 1MWAH 3C08H 5F1IB 1F8TH 5MHSD 3MLRL 5HHOE 5LBSL 4NRZB 1ZVSB 5JOFA 3BWUC 5IVNA 5C6TH 3F58H 1YJDC 4X8JB 3L3GB 1EUTA 1TJIH 3ZDXE 1CT8A 1UADC 4UU9A 4PJCB 1FPTL 2NQCA 1CZ8L 1RUAL 2DI8A 2DLGA 1RIHL 3IGAB 3TYGH 1GGIL 5BXFB 5FUCC 4HAFA 2YUVA 4GW4A 3QIBB 4J2XA 4HX1B 4OLYL 4PJGA 4RMSA 1A2YB 1T1XA 1DEDA 1OARH 4FFWC 2IAMD 1QNZL 4ZPTA 5DZLA 1NDGA 3NACL 1C7TA 4PRBA 5F7WC 2NW3B 3IFOA 1RVFH 2JE8A 3O2DH 3TNNA 1NMBL 3VXOB 5DD5H 4JREC 1MVUB 4H88L 5IQ7H 4LEXH 5K9OB 5E00B 2IC2A 1CD1A 4L3AA 1FVDA 2KDGA 1A3QA 2NY2D 5E7FA 3LHPH 1MCEA 3IFNL 1PY4A 5F21B 2YXMA 5L9DL 2Z31A 3S37X 4BUGA 3U2SB 1CTNA 4NKDB 4TSBH 4XWOC 4PGEB 1OM3H 1UZ6F 1G6RB 4U1SB 4QRSB 3WD5L 4FQ2L 1IZKA 3W0WE 5DMKB 2FGWL 2VLRD 4WUUE 1UB6A 2C1OB 2W60B 2YPKA 3EGSA 1QSEE 3ZLQC 2QSCH 1T4KA 2XACC 3ZT5A 5JA8B 1J1OH 3I50L 4NSKB 3QNZA 5I1LA 4V2BA 3U4BL 2FZ3A 3GHEL 4JDTH 1YJDL 4HH9B 3H9HA 5EU6E 1HDMB 1YPZA 4ZTOL 3OKEB 3GSUB 2CDGA 4G43B 3BZFA 2Y25A 2APXA 1D5BB 2NY1B 4WFGE 4LAJH 1ZE3C 3M1BA 4Y1AE 4U6HA 2DM3A 5BMFH 4X83A 3IDXL 5LJYH 3MV9D 5EOCL 3QFJB 3TBWB 5L8KB 4G8IB 3ARFB 4XGZA 3QUMH 4PJ8A 4P2OA 4TVPH 1XCQB 1MHEA 1AKJD 1R3KB 1T6WA 3F65A 4OGAC 4OV6F 1M7DA 4TRPL 3WE6B 3REWB 1I9JH 3OZ9H 3RA7H 4UT7L 5A2JH 4L8BB 5KVGL 4XI5D 4MJ5A 4WHYH 3QUZD 1MNUL 5C0EB 2EDJA 3MUHL 4RIRA 3QJFB 1HXYB 1J87A 4PP1C 3HMWH 3QEHA 3ARDB 4WWKB 3F7YB 3JV5A 4XBGB 2CGRL 1HEZB 5EU5A 4OI7A 2R0LH 2F54B 3BUYA 4K8RD 1Y6NR 5I1AA 3GM8A 1BFVL 4WJ5B 4JQXC 3ZE0E 4MNGB 2A6IA 4Z6AT 1K2DB 1U92A 3NAAL 5D7KE 2EDQA 1HQ4A 1UJ3B 4NC1E 4V1DA 5J13B 2X89A 3LQAC 4DJMA 3DIFA 1TZHB 4CN1A 1CFQB 1Q1JH 2NY0B 3QDME 3QPQC 4M93B 1BFSA 4UQ3B 5C0CA 1L6ZA 1DE4A 1TNMA 3KXFB 4OFPA 2DQCH 1ADQA 1CBVH 5FGSA 5I1CH 3KPNA 5EDXA 2VQUA 3U30B 1LGVA 4URTB 3GBLA 4JB9L 4ODTL 3UP1A 4KMTL 7FABH 3ALPA 5CFHA 2YBRA 5KSBB 4QOKD 5KVFL 3ZDZE 2HT4C 4RAHA 5E6ZA 4ODHL 1BQLL 5JLZB 3EZ8A 1EMTH 4Z5RA 4NZDA 1JYXA 3WFCL 1YN6A 1NGZA 5EUOB 5IT2L 4DK3A 1L9MA 5AUMA 4U31A 3VGBA 3CVHL 4NQXB 3VXSD 4L8CB 5ALCL 1UA6L 4JM2C 5J3HD 2DQDL 2XZCH 3DMMC 2Q8BH 3TBYA 2IANB 4YZFE 1DQJB 2PTTB 1X9QA 3JWDL 2G2RB 1UJTA 3GMLA 2CPCA 1W72B 4KKBC 1KTDA 1NAMB 1LHZA 4CN4A 1SBBA 3QG7H 2OZ4L 4LLUA 2C7UB 5CLWA 5K9KB 1C5BL 2EE6A 4QWWD 2O5YL 3VJ6B 3LV3B 2AJXH 4FTVE 5C2BH 1MOEA 3WJJC 2F53B 4HUMB 1P7QA 1RJZB 4XMLH 5FYKH 1Q9LA 4OF5A 3S4SB 3WLBB 2BOBB 4YGVB 3RWGB 4PJEB 2AXGB 5GS0C 2IQAA 2W65A 3B83A 4O9HH 5EC2B 2BVYA 1J1XH 1OP3H 3C2AH 3GKWL 4BSVA 4ZDHB 1OP3K 2NNAA 1JPTH 3DVNB 3TZVB 7CGTA 1C5CH 2DIJA 5E56A 1QOKA 2H8PB 1QFWI 3MFGB 1PLGH 1CGUA 4MSWB 4NZRH 3I2CH 3PDGA 6CGTA 25C8L 3LZFH 3RZWA 3UX9B 3MA7A 2DWDB 3AMLA 4ODXB 1KB5L 5EO0B 3L6FB 3VWKD 3ZE2F 2H1PH 4G7YH 2GITB 4JFFA 3QDGB 4NUJA 4Z7UA 5C8JA 1BF8A 2VXUL 1LEKB 4LRNL 3P9MB 3BHBA 4YHZL 1E27B 1OL0A 2BRRL 3K4ZA 4XPFH 3VXUB 4OIIH 4JJ5A 4OZGF 2YRZA 2YZ8A 5AZ2H 3HLAA 1JF6A 2Y5EA 2DQTH 5ENWA 5I76A 3TF7C 5TF0A 1AO7B 4LVNB 2B39A 4ZXBA 1MRCL 1V7NH 4LBEB 1PZUB 1ZS8B 3TYFB 4MJIA 1EHAA 1FNEA 1KCUL 4F33A 1BVKB 4NIKB 1A6AA 4QTIH 1A6UL 2XV6B 5C08A 1XF5A 2XWTB 4GG6B 1OQOA 1ZLWH 1VFAB 3U0WH 1CG9A 5GS1A 4TNWK 5JNYA 1KIRA 1ZLWK 1X5XA 3VD5A 3FQWB 3S98A 5GS0L 4MQXD 1LO4L 2CXGA 3WJLC 3L9RB 4PJCE 2VTFA 1AC0A 2IH1A 2XN9D 4UTAH 4ZFFA 4XMKL 3OPZL 3CPLA 4FQPA 4NN7B 4G7VH 1FQ9C 1PG7W 2VQ1B 5D6DA 2WANA 2YEZB 4QGYA 4P4RA 4R90L 4X5WB 4RX4D 1F3JB 4Q74A 3L5WB 1T89A 3C5ZC 4G6FB 4MAYA 4PLOB 3D48R 2R23B 5BS0A 5I1DA 1U8JA 1JJUA 4YPJA 1G9NC 2HJFB 4P48A 2XWJA 1CI5A 1NFDA 2CDFA 1YMMD 1MQKL 4J3SA 4IMKA 4FFWD 4D9RD 2CLRB 1U3ZA 2XKSA 2VR9A 4NKMB 1FNSH 3L5XH 1A47A 4MX7B 5KVEH 3A67L 4BH8B 2L0DA 1K9TA 2VE6A 4MCZB 5IHBA 32C2B 2H2PD 3O4LB 5C0BB 3LN5B 5HYQA 4H0HB 4MB5A 1G0DA 5C1MB 3CZFA 4U1HB 3QJHA 3D1MC 5DQJA 1HHGB 3HZKA 4KUZH 4YBQD 4DQOH 4J3XA 4LF3A 2IQ9H 2PXYC 5JQ6H 1D5IL 3FOMB 3MRGB 1MFAL 1I4FB 4LLYB 1NBYB 2UVFA 1ETZB 3UCRA 3K74B 3BYYA 3GSNA 2N1KA 2WUCL 4WNQB 3T65A 1N59A 3NH7L 4N8CL 4P4KA 3RKDC 3ZL4L 1IFHH 3BP6B 3K2UL 4O00A 5FA3B 5LXGL 4K3JH 4U3HA 3J7HA 4CNIA 1FFNA 1LMKA 4UB0L 1FFPB 3QFJE 5FO7A 3TO2A 4QTHA 5TE6H 3GGWB 3H0TA 1FRGL 2ZCHL 1H5BB 5I66A 5EBMB 4HWZB 4R7DB 4NWUH 2PYED 3QUXA 1F5WA 1BJ8A 1G9NL 4P57B 5E7BA 1CLOH 2IPKA 2B4CH 1NEZG 4M7LL 4WO4B 1IRAY 2MQ3A 1QYGL 4NYLA 2CDEB 4XCNB 5I8OL 1AP2A 3WFEL 1JGVL 3U9PH 2IAMA 4JN2A 1ED3B 2HJLB 4X6FB 4OGAD 5HBBA 2F54E 5T1DL 3NZHH 4BZ1H 1HHKA 2AABH 4KPHH 4PYGA 5GRUL 4PUBH 4MNGE 1YNKH 1KCVL 1QPXA 3VFNB 1BEYH 5IF0A 35C8L 2JKXA 4PP1D 3X13B 3B5GA 3OAUL 3STLA 5GHWL 1S7XB 2FJFB 2BJML 4GAFB 4Y5YA 3PABB 1MFDL 3TBSB 4EUPH 5GISH 3DX9A 1DUYA 4IRJC 4JKKA 5E2WH 2WMPA 1VADA 3KXFE 5KAQF 2JJUA 3CH1B 3EYSL 1JWSA 4GO6B 1DQLH 4HQQL 4ZFOB 5KSBE 4IRSA 4JM4L 3MCLL 1N8ZA 4MNHB 2IBBA 5E9DB 1VCAA 2X41A 3QDAA 4QF1A 3DO3A 3QPQD 5EUOE 4NQSA 3IKCA 2OSLB 3O8XC 4PD4K 3WFBH 3EIFA 1MJUH 3VFGH 4MNQB 1I7RB 2DLHA 3PWLA 4X7TA 1FGVL 4PY7B 2IANE 2R2HA 5DT1L 4K2UH 1FVEB 1WZMA 1YDPB 2AEPH 2ICES 2QADB 3S96A 1VGKB 1IM3A 2WQRA 4M1DL 3RY4A 5BVPL 3O3EA 3T09A 2MCG1 3ARBC 3DVFA 4RDQF 5I6XC 2F53E 3RWFA 3QULB 4JM2D 3CK0H 1AHWB 5GGTA 1BWWA 5IHUH 3BGFB 4Z8FH 3WN5C 4PJEE 1OCWH 1WC7B 5F1NA 3FFDB 2DKUA 3V5HA 4Z7WF 4P2RA 5E8DL 4HZLB 2R1WB 4BKLA 4HW6A 1OTUD 4KDTC 4LK4A 3DURA 4HPOL 2FB4L 5FYJE 1HYSD 2X70A 4S2SB 1FC2D 3SE9H 4LHUG 2DQHH 4X7EC 2PYFA 5C09A 5HY9B 4MD5A 5EU3A 1KN2L 2VZOA 5GS0D 3GIVB 5HHXL 5HDQL 4G8EA 4P5KB 3BD4A 3ULSB 1ZSDB 4KTYA 2E9BA 3VH8A 2OL3B 1FCCA 2G9HB 2Y7QA 4QRPB 4IRZL 3PWPA 3QDGE 3GHBL 3DTXB 1GGCH 5ISZA 3ME0A 1WEJL 3SKNA 1I8IB 1JPST 3VXUE 5ALBH 4MDIA 5AAMA 1QBMH 3EO9L 4OI9A 1J8HD 1HIML 4WUKH 3UEZA 4D2NA 3MROA 1KLUB 1AO7E 1KLGB 2XT1B 4UINH 4Z7OF 5FKPB 2P45B 3N1PC 2OLDA 1S7TA 4LHUD 5IVXA 4JO4H 1TLKA 4CMHB 5SWZA 5HHMD 1LE5B 3I6GA 3VXRD 3IU3A 4FXGB 4GG6E 5EO9B 1L9NA 5DEZA 5FUZH 2ORBL 1NMAL 3RUGB 3WNNA 4P5MB 2R56H 4C4KO 1U8NA 3JTSB 3TO4B 2X4SB 4QXUH 5D2NB 3FQXB 3VXSA 4I18B 3VG0H 2XTJD 1BD2A 1IGTB 2CK0H 3LSOA 4YQXL 4KZDH 3QEGH 4ZO8A 1P7KB 1D6EB 4KJQC 2QKIA 5JW3L 1GGBH 1KPRA 5ICXB 4QHMB 3MREA 1PYWB 3D18A 3TJHC 4L4VD 3BN9D 3MA9H 1HSBA 2AJSH 3RWDA 3O3BB 4FQCH 4GXUM 2GYSA 5F89B 4OIBA 2YPVL 4C56D 4POZC 5C0JA 1HXMB 5ICYB 2E27L 2HRPL 1ACYH 4IMLB 3HUJA 3BPOB 3GIZH 1KXQE 4HJJL 1Q8MA 4W68A 5JIIA 4HXBH 2JB5H 5E2UL 4AH2B 1QR4A 2MNUA 4NQCD 5D1ZB 4OD1L 2IPTL 3D85B 4MGXA 4Y16A 4GG8B 1JNLL 1RHFA 3QXDB 3QNYB 2WK2A 4HD9A 2WIIB 1QRND 5CJBA 1JN6B 3DXAB 3PJSA 3IVKB 3OAZH 1U3JA 3C5ZD 1KCSH 2BNUA 3CFIC 5E5MB 4OF8A 1RIUL 3MV7D 1J18A 3CSYA 2J5LC 4GUPA 3HNSH 1IAII 3O4LE 2IALA 4IS6B 4PV8B 4HFUH 4LKXB 5C0BE 1BP3B 4POUB 4JLRB 3DX7A 1VKXB 4YHYB 1K3ZA 2GY5A 4L8SC 3MR9B 3Q5OA 5TJWK 4Y19B 5DK0B 3UO1L 3DPBA 1CWVA 4F8TA 3MBEB 4N8PA 4XHQA 5FCUH 4OM0L 4QRRB 3FRUB 3D39B 4EIGB 4X6BA 3MSPA 5T3ZE 4B50A 1NGXB 1CICC 1T2QL 2ESVD 3FQTA 5EIIA 1KIPB 4RBPH 1KUMA 4U1NB 1LP9A 2VL5B 4GKSB 4HUXB 4RBPK 2F5AL 4Y5XB 4KJYB 5D7JA 3V79C 3Q48A 2UVEA 3LPWA 4LQFL 1Y18A 4GKNA 2X2YA 3PDOA 5IESH 3AUVA 3NABH 2GAZA 4RRPG 5C0AB 2YA0A 4PJAB 3RVXD 4MD4B 2WSKA 2H6PB 4XCCH 5T1LA 3RX8A 3C6SA 5T1MA 4YO0A 3MNZB 1I7UA 4HS6B 3BIKA 1JWMB 1EAJA 3DSFH 2CKBH 1QFHA 3OJVC 1X5YA 1FC1A 1NCBH 2OTWB 2QJDA 3O41A 5J1SC 3RKDD 2J88L 1JGUL 4WW2F 2X4RA 1E4KC 4R8WL 1BREA 4AEFA 2EC9U 1KT2B 1XGUB 1U0QA 4ZD3L 2VUYA 3MNWB 3GI9L 2VOTA 5DQDH 3MV8B 4LPXA 5AAWA 2J1KA 1R5IA 2ITCB 5DD3L 1HI6A 1CXEA 3EDEA 4OGYH 5GGVY 4XX1E 3QAZC 5ESAB 1TVDA 3NFSH 3ARVA 3ZDYF 3CFCL 3PHOA 1Z6JT 2NY4C 3D3VD 1YNLL 4XVTH 1UT9A 5D7LD 2EICA 1U2CA 5CD3A 4KFZC 3S35X 4GS7C 4H1LB 1A9EB 3HS0A 3THML 1MI5E 3QEUB 2VSCA 3W2DH 1IGYB 1PG7X 1SY6H 1S9WB 3DROB 3AM8A 4Y7MA 4PYHA 1LO2H 4YHKH 3IDYC 1AH1A 2ADGA 2EKSB 3RVWC 2OP4L 4LL9A 4O5LH 3MUGA 3MLTA 3OAYH 4PS4L 3UJJL 5BJTA 3QH3B 2R2EA 4TUKH 4YK4B 5EBGA 2Q8AH 5BQ7A 1K8DA 1AQDA 2R0WH 1TQCB 3OAYK 5CZXC 1NDMB 2JJSC 3TIDB 3V0VB 4HK0B 3BGMA 3P3YA 1CFTB 4LSRL 5ECJE 4G6KH 3JUZA 4TULL 5E9DE 2F9BT 4OCWH 5HYEA 3ES6A 1A6WL 2XQYK 3IFPA 2OK0L 3BFOA 5F8RC 3EO0B 3BPCA 5FCSH 3DX8B 4YEEA 2CH8A 3JV6A 4MNQE 5F1KC 3WIFB 1WWAX 2VQTA 3TH2T 1OW0C 3H9SE 3L95B 2FX9H 2J8UA 2Z0BA 5F7HA 2H26B 2ICWB 5TDOA 2A1WH 3TH4T 5EOQL 5DR5L 5D5MB 3U0PB 5SWQB 2X9XA 1QUNA 4ONFL 4G5ZL 3VFSA 2CSPA 2NY5C 1Q38A 1M71A 4HUKB 4RGOL 5J6HA 1FNFA 1G7LA 1R3HA 1KCRL 2CMRH 2Z91A 2APFA 4G9FD 4MA3A 4UQ2B 2ZUQC 3AREB 4CVZA 5E6IC 1KACB 4MLIA 3NN8A 2VXTL 1ORSA 5IB2B 3RWHA 2HLAB 3SKOB 4PGDA 5I71B 1CS6A 3ARBD 1VFBB 1CIUA 2LVCA 4NPYA 1MFCL 4BFIB 1HHJA 2HTLC 4R0LC 5L2KB 1U3HA 2RJMA 2NXYC 2BNRA 3P77A 1KNOA 2FX8L 1MIEL 2Z93B 3R0NA 5ACLA 5D8JH 4WW2C 5F9DC 1IGIL 1N7MH 1OTTC 2VR4A 4RZCA 3DECA 1T5XA 3INUH 3I3DA 2ZUXA 4QRPE 5TQ0L 5MENA 2IBZX 3G6JA 4OLWL 4X99A 5FGCB 5HGBB 4MA7L 4PJ9A 5CUSH 5L6YH 1AXTL 2J6EA 2G60H 2R29L 2VH5L 3BIAX 1ZT1A 4WHTB 4I3RL 4WFHD 4FQHB 4JFQA 2JB6A 1HHHA 3ABZA 1P2CA 1NEZA 1P5VA 1CL7H 1KPVB 1EGJA 1P6AB 3B4NA 2NY5L 3F5WB 3GMMA 3LKSA 2EDKA 4LIQE 3TBTB 4PLKC 4B7IA 3RUGE 4PRHB 1ZHBB 5A16B 2VDML 4RWHA 5I16A 4J8RB 1CD0A 4R2GB 5D2NE 3CX2A 1I8KA 5IFHH 4UT9L 2A9NL 4U7MA 4MZ2A 5IBUG 3UBXB 4Z7QF 2BY3A 3DUSB 3KYAA 4U3XA 1YQ2A 1JP5A 1FNAA 3KYKL 3MC0A 1UWEH 2J6EH 3OXRB 3C09B 5D2LB 4XPAH 2FJGB 2P4AB 3IAPA 4N0UA 5I8CB 3ARPA 2OXGA 2V9QA 1U8LA 3WDHA 4OGXL 1UM4L 1F97A 2MKLC 4C58B 4XNUH 5I74B 2JIXB 4LLMB 3GEWB 4ETQB 3PWVB 3BEWA 3TJHD 4OJFH 2BNQD 1NJ9A 3VD7A 4DZBA 3QFDA 4IHOA 2Y6SC 2Z92A 4JHAH 3H9ZA 3DXAE 5E70A 1DN2A 4OCMC 5JOFB 4ZNCD 1FL6B 2KZ1B 1DN0B 2XZQH 5GS3A 4J6RL 5F7UA 1DLFL 1CT8B 4UU9B 1AY1L 2ICWI 3BOVA 2YD4A 1HH9B 2Z8RA 4Y19E 4GW4B 4PJGB 3QIWC 1JFQL 4QRRE 1JGDA 3D39E 3WS3A 2ENSA 4F7PA 4O2FA 1NDGB 3EBAA 2WWKT 4PRBB 3IFOB 4P3CH 4JVUA 4RQQA 3TNNB 2RIKA 1OGTA 4MXWH 4JKPH 3ULVH 2V2TA 4ENEC 2LVEA 1VPOL 1FO0L 2F5BL 4FABH 1F90H 1CD1B 1FVDB 5C0AE 2FO4A 4PJAE 3MGTA 1N6VA 1B4JL 4Z95H 1HKFA 2Z31B 4L5FH 2ZG3A 3VXRA 5E5RB 3QUMB 4XB7A 4MVBD 4J1UA 4OCYL 1RMFL 3IU4L 2FSEA 2Z8SA 2KZWA 3JSSA 1IC5H 5DVKA 2YPKB 2CRMA 3EGSB 1T4KB 5JW4N 3WFDL 4P3WA 1ZLUH 3MV8E 2FX7L 1ZLUK 3S3SA 5I1LB 2F58L 1ZLSH 4Q7DA 3KVQA 3KJ4B 1NCUA 2A73A 1I3UA 3AB0B 2FZ3B 1AQKH 4C56A 1QACA 2XQBL 2ZUVA 3H9HB 1F4WH 3FQRA 1YPZB 2X9YA 1MCQA 2CDGB 1KFAH 3MJ9A 2P24A 2NR6C 4GRWF 3M1BB 2DQJL 4WEBH 1DQDH 4QRTA 4U6HB 1ZLVH 1WZLA 3MJ7A 3RIFK 4JZOA 1F11A 1FN4A 1J0KA 2NY4D 2UZXB 4I0PA 1MHEB 4P2OB 1XZ0A 4NC1C 4Q0XH 5GGUA 4KWUA 4R6UA 3FHQA 1G1CA 4FFYL 4JE4B 4MJ5B 3UYRL 5F44A 5JW5A 4Q9RH 4M8VA 4M1GL 4UT6H 3L3IA 1KG0A 2QHRL 4HC1A 1JNHA 4X9HA 4RIRB 3MLSL 3MRJA 2ZG2A 3QEHB 3RVWD 4RFEA 5EU5B 1DL7L 4HJGA 5DHXB 4HWNA 1F4XH 3F12B 4XH2A 3BUYB 5I1AB 4I9WD 3WIHL 2BOCA 2ZG1A 4MXVF 2KL6A 4HXAH 2ZPKH 3BD5A 1I8LC 3MJ9H 1U92B 4PLNC 5HGHA 5D5ME 4V1DB 4G9DA 4MA1B 3RY6A 4CU8A 3SQBA 5C0IA 2P46B 1XGYH 5BRZA 5IJKA 3DIFB 1AGFA 4OSUL 2P1YA 2W9DH 1KPUA 4JEGB 4EQ2A 4F7CA 5C0CB 1DE4B 3V7AG 2HVJA 3AFLA 3KPNB 3G6AB 2V2XA 4NM4L 5I2IA 3VGFA 2YBRB 4L3ED 4Z5RB 4LHJB 3PDDA 3SDAC 1V5JA 1YN6B 1NGZB 4XBPA 1CGTA 1F13A 3GBMH 4M6OL 1DBKH 3HC3H 4LLAA 4JO3L 4QY8A 5FV1L 5AUMB 3UMTA 5L2KE 5BO1L 5IBTL 2FH6A 3FMGL 1YYLH 5E6ID 3TBYB 5CCKH 2WLYA 4NOFA 1Q94A 1MQ8A 4XNMB 2YD9A 4QKXB 4APQC 3I3EA 3GMLB 3EO1A 1GSMA 1FNHA 1KTDB 5GJTH 4EDXA 4RRPA 5JO5A 4LLUB 5FGCE 3LEXA 5FO8A 1IVLA 1A14H 3HAEG 3V6OE 2Q20A 3HNVH 2FBJL 2NXYD 1P7QB 1U8PA 1OSZA 5JZ7C 2QHLA 3NZ8A 4XMPH 4YDIL 2A0LC 1KJMA 2IQAB 2VB5A 5I1IH 3A6OA 4CVWA 2W65B 5K9QI 1OTTD 2OR9H 5J12C 4BSVB 3MTRA 3TV3H 1MHHA 2HT3C 4MD0A 2X4NA 2NNAB 3F6LA 3ELAT 5I8KH 4R7NA 4KRPC 5CBEA 1OB1A 2E5EA 2ZUWA 3U7WL 1JPFA 2IBGA 4PRHE 5GGQH 3CMOL 2VYRE 5JTWA 5ICZA 1ZHNA 1BX2A 1U8QA 4FFZL 4JKWA 3BUTA 3MA7B 4P9MH 4LCIL 2JCCA 3BZEA 5GRYA 4KMQA 1EJ6A 4IOSD 4JFFB 4NUJB 4Z7UB 1CGSL 1TPXB 4PLKD 1MJ7H 3BHBB 1HWGB 5D2LE 4JJ5B 3SJVD 2VC2H 3HLAB 5ENWB 5I76B 3EUUA 4JG0L 1WZKA 1BBDL 1A1NA 1G7JA 3QIBC 5J6GA 1YEKH 1T0NA 4ZXBB 5IBLC 4FZ8L 3KLSA 5HHOD 1AR1C 4MJIB 5KZCB 1KEGH 1I3RA 4LOUC 1FNEB 3LKPA 3ECBA 5IKCA 2PTVA 4F33B 4WTZA 5FYLH 1OAQL 1C1EL 2DI9A 5IB1A 5AWNH 1A6AB 1V7ML 5C08B 1XF5B 2EDFA 1T83C 1CG9B 5JNYB 5F7EL 1KIRB 3JVGA 1JPSL 2V7HA 4DTGL 5F9JA 3VMNA 3TGXA 5KVDH 3VG9B 3FRPA 5I15H 1UCBH 2IH1B 3MLZH 4ZFFB 1GGUA 1ZGLA 3CPLB 4DEPB 1GC1H 5CINH 3VGHA 2VISA 4PJGE 1EK3A 2Y6SD 2XA8H 2VLLA 3TWCH 2ED7A 3TNMA 4P4RB 5L8JB 3MXWL 1T1WA 1D9KA 4PJFA 4XT1C 4MAYB 1JHLH 1IGFL 3NTCH 3WV0A 4GMTH 5I1DB 1CGVA 3MACL 3BZ4A 1U8JB 3N06B 5JMOC 4P23C 2AS5M 2XWJB 1UEYA 1NFDB 3HI6L 2CDFB 2MPAL 3QPXH 1B90A 1G0XA 1EHLH 4M48H 2R4SL 2GKIA 1RU9H 4KAQH 5HVFB 4X4ZA 4DK6A 3W0WD 4WUUD 4XPBH 1T7ZA 2VE6B 1QSED 2NY1C 3PP4H 2AJVH 3HMXL 3QO0A 4I48A 4TVSa 5HYQB 3D2UD 4ENED 3CZFB 4L29A 1CFNA 5DQJB 2BVQA 1QP1A 3HZKB 2R8SL 3ARFC 1MCWM 1DDHA 4B53A 2M1KA 3VFWA 4ELKA 4LF3B 2EDDA 4I3SH 5HHQA 4Y4HC 3PF2A 4RFNB 5EU6D 3CD4A 2QTEA 2HG5A 4DUWA 2W0PA 5D72L 3BQUC 5TDPB 2OM5A 1OAZL 3AS2A 4WFGD 3DNKA 3GSNB 4LLQA 4YHIA 4Y1AD 2QQKL 3T65B 1N59B 1YPZE 4P4KB 5KS9A 3ARDC 5GZOC 2ED9A 1E6JH 2B1HH 1U9KA 3U1SL 4AZ8A 1T66C 4CADA 1G6RL 4CNIB 3PGDA 4JRYA 1BFOA 2WINA 5FM5O 3TO2B 4QTHB 1J8KA 1EEYA 3H0TB 1UJ3C 4EUPB 2NPLX 5I66B 1JF1A 3MXVL 2HT2C 2L4OA 1L0QA 3GBNL 5DRNA 5J13C 1S9KC 1KBGL 5F96H 3VXQA 4WTXA 2APVA 1G1YA 3QUXB 1JHKH 1IKFH 3ZKQD 2IPKB 1QFWL 4M93C 1ZANL 2C9AA 5K33A 4NO5A 3U6RA 5L88L 4NYLB 1Z9LA 1EX0A 1AP2B 1NCWH 3QRGL 4MMXC 4JN2B 1YEFL 3U30C 1NH6A 1CCZA 2B0SH 4JVWA 5EUKA 1RFDH 3VU2A 3P4LA 4HMEA 4ZQKA 3IETA 4N0FA 5DD1H 3KPOA 1AD0A 4R26L 4ZFZA 1HKLH 4V1DE 3MRDA 3UPCA 5IF0B 1J1PH 4XBEH 2C4XA 3STLB 1F3DJ 5HI4D 2NY2B 4Y5YB 1INEL 3A6BL 3MJ8A 1HINL 5HI3C 3DX9B 1DUYB 5C0CE 2P44B 3B9DA 2YA2A 2DQEH 2P7TA 3RVUC 1WIUA 4YR6A 1MFNA 4PB0L 1WZ1H 3UTZA 4F9LA 4M6MH 5IFAL 4IRSB 3Q6FA 1N8ZB 1BIIA 1MCSA 4QF1B 6FABL 1NCDL 4O2EA 3RL2B 4D9LH 1M6OA 1VACA 4NBYB 5FM8A 1T1YA 3IKCB 3I75A 2GJJA 1MAJA 1FVCA 1CDCA 3AC0A 2DYPD 4DN3L 3PWLB 2I5YH 4X7TB 3MRCA 2YWZA 3TZVC 3KPLA 4N1HB 1NSNL 2R2HB 4FTVD 5J89A 3GO1H 5DMJB 2MWCA 3MLVH 1HH6A 3IXAA 4QXTA 1KJVA 3N85H 15C8H 3QWOA 4OB5H 2DWEA 3S96B 1IM3B 4P46A 3H3KA 2RQ8A 3O3EB 2X05A 4ONGL 5FO9A 4RAVA 4AL8L 4JCMA 3RWFB 2E7MA 5HI5C 1MCRA 4BQ6A 2E6PA 3HI5H 5F1NB 2VDOL 3TT1H 3V5HB 4K7PH 4APQD 2I60L 2FCBA 4YUEH 4P2RB 4BKLB 4PRDA 4LPWA 1GH7A 1HHIA 5L7XL 1CLYL 2CRIA 2O5XH 2X70B 4LSSH 2VLKA 5B3NA 3CXHJ 1IEBA 2FHFA 4D3CL 1Z9OA 3W82A 5JZ7D 2PYFB 5C09B 3ZO0A 3QXVA 4MD5B 3MJ6A 5EU3B 3T2NL 3V4UH 2DMCA 4R4FL 5IOPA 4XNYL 1W72L 1NAML 1NANI 4G8EB 2QQNH 5CJ5A 3VH8B 2HT3D 2BVEA 3CXDL 3MRKA 2Y7QB 5LGJB 2V5YA 2FIRT 3PWPB 1XAUA 4JFFE 4KRPD 4Z7UE 1OT2A 3X3FL 4OF6A 5ISZB 3EDDA 3SKNB 5ABDE 5EZLA 4MDIB 5I0DA 3GDBA 1CDIA 3DRQB 4ALAH 1NGWA 4JR9H 5IUSA 1YQVL 3HB3D 4H26A 2B1AH 5FYJL 2QEJA 3MROB 1BGXH 1ODAA 4EKXA 3TEUA 1RIVH 3GNMH 3GK8L 4MJIE 1S7TB 3FAXA 4BM7A 3U0TB 1I85A 2RHEA 5KW9H 1J0YA 5IVXB 1FP5A 5B22A 4OZIA 4NN6C 5SWZB 5C08E 4NJ9L 3IU3B 3SGDH 4XXCA 5C6PB 2PO6A 1U8NB 3MLYH 3QIBD 2EYSA 1KN4L 3NOIA 3S35H 1RQ5A 1A3RL 5CD5C 1BD2B 3LSOB 1AR1D 5DHYA 4A6YH 2GCYA 4KRNA 1N5AA 3HC0A 2QKIB 1S7QA 3LRGA 1KPRB 2FYYA 3MREB 3D18B 4JG1H 4FQIH 1HSBB 5CEZH 3RWDB 2DN7A 2O26U 3BYTA 1JUFA 3RI5F 5C0JB 1TETH 2GJZA 1JYWA 4WRLA 4OLVL 2VDKH 2C3VA 5FXCH 3HUJB 5BS0E 4EOWH 2GK0A 2VKWA 1NFDE 4Y16B 3JBG7 3PHQA 2NZ9C 4PRNA 5DMIH 4AT6A 3P9LA 3T1FB 4LVOB 4KVNL 1R3JA 1XIWA 4LPYA 5K93A 1DANT 2ZJSH 5F9WB 3CSYB 3K46A 4GUPB 2IALB 2E9IA 4G80B 2YMXH 5EBWA 3DX7B 4KTDH 3KLHC 5DQ9A 3EDFA 5FA4A 3CDYA 1OPGL 2OQJB 4UOJA 4X6DA 1A5FH 5DVNA 3UPRA 4X6BB 4HKZA 5I19L 1Q0XL 2WWKO 4UIMA 4O58H 5D7IA 5EIIB 2NY1D 4Z7VA 4JFHE 3QI9C 3T8XA 1LP9B 4J4PA 4WO4C 1UACL 2DICA 3P11L 2ADJA 1OLZA 2GIYA 3ARFD 5D7JB 3PWNA 1NUDA 1EDQA 1Y18B 4GKNB 4OQTH 3PDOB 4M61A 5T33L 2GAZB 1FFRA 1H3WM 1OAXL 1SEBA 2NZIA 2VWEC 1F6AA 5EC1A 5T1LB 5E4EB 5T1MB 4YO0B 1I7UB 3K2MC 3BIKB 5GRVL 1B0RB 2VDQH 3X11A 4OD2B 2X5PA 1FGNL 3O41B 3ROLA 4WWKD 3ARDD 5GZOD 4KKNA 2X4RB 2DM2A 1FBIL 5T3ZL 2F54D 3NPSB 1J88A 2D9QB 1T66D 2BSTA 2VAJA 1G84A 4U7SA 1R5IB 1CDBA 3H9YA 1HI6B 3N50A 1A6PA 1FAIL 4XC3H 4DKDC 3WNKA 4WCYL 3PHOB 4OFKA 4OZFG 5FDWA 3HC4H 3MLWL 2FRGP 3BX7C 5E94A 2NY0D 1QEWA 1CXIA 3WS6C 3HS0B 4JQIH 3ARXA 4X6CA 1Y0LA 1PSKL 3K4AA 1Z3GL 4WI2A 3KXFD 3S4SG 1K4CA 3K4DA 1FORL 2GSIA 5E2VL 3ZHDA 5E0QA 2ADGB 1RI8A 2X09A 3BDYH 4PJ7A 4HIEA 1BQUA 5EPMA 2MQCA 4DKFL 4ODWA 3MUGB 5HD8D 3MLTB 1U58A 4JPKH 2QADC 2R2EB 3BE1L 5BQ7B 2J12B 1K8DB 1AQDB 1MRDL 3D2UA 2F15A 3BGMB 3HFMH 5I17A 2NY7L 4GAGH 1VEMA 3BGFC 3ES6B 1RZKH 2IAND 5HI3D 4GT7A 4I3GA 3IFPB 1UH3A 4NHCH 3W39B 3BPCB 5D1QA 3O6KL 2VLJA 3RVUD 3TA3A 3ZHLA 5TF1H 3JV6B 3LH2H 1J10A 1UB5A 2J8UB 4WU5A 1RZFH 4W4OC 5TDOB 4H8WH 2Y9RT 4KV5F 2F53D 3G08A 5GRJL 4ELMF 3UPAA 4LSPL 4X7SL 3VFSB 4FQQA 4HULB 5J6HB 3JXAA 4XVSL 4M6NH 3R8QA 4WY7L 4PJBA 5DMYA 4XB8A 1RZJC 1G7LB 3V4VL 2Z91B 4XAWH 4ZFOL 3TZVD 2ZUYA 3ORJA 4CVZB 4WEMB 3NN8B 2J4WL 1ORSB 4BFEA 4Y4FD 1SBSH 1YC7A 1P53A 4P2RE 3RWHB 3VWJA 4L8DA 5DA0B 2D3VA 3BP4A 3V4PL 3IS0X 4KXZH 1G9MC 1IAIL 3OMZA 5INCA 4NPYB 3CXHK 5C09E 1HHJB 5HI5D 3T77B 4IDJH 1U3HB 3WO4B 2ZSVA 2BNRB 3P77B 5BOZG 1KNOB 3QDGD 1TVBB 4DGVL 5KSVA 3VXUD 4FN0A 4M1CC 4RZCB 1UXSA 3NA9H 1T5XB 5MENB 2YN5A 2AK4A 3PWPE 4HGMA 3BP7A 4X99B 2PCPA 5IMLA 5ISZE 4PJ9B 1AO7D 3SQOH 5C86A 2VUOA 1ZT1B 1UQSA 3NFNA 2DB8A 1IC7L 4JFQB 2JB6B 1HHHB 2KPNA 1QFWM 1KGCE 1P2CB 2V17H 1NEZB 2BSED 4K94C 4HBQA 4S1RL 1UCTA 3WNLA 3LKSB 5IVXE 1T20A 3BPOC 3MLRH 5LBSH 1RZJL 5SWZE 2X6MA 2OL3L 3UAJD 5I16B 4NUGL 5FM5M 1I8KB 5D1ZC 2DYPA 3VXSE 1FPTH 3OKYA 5EA0H 1RUAH 1BD2E 1E4WL 1WIPA 1RIHH 4EI5B 1IGML 4AJ0A 4X9GA 4OLYH 3OJMB 1SHMA 4G6FD 1GPOH 3MRHA 1KTKE 1QNZH 1G9ML 4WU7A 2D7MA 1EBAA 5I0ZA 1JPGA 3NACH 4N0UB 3T3PF 2WBWB 4YHOL 1JMZA 4U3CA 4U1IA 1NMBH 1U8LB 1UVQA 3HUJE 1EUUA 4CMMA 3MBEC 3QCVH 5INDA 4OFYD 3MGOA 4LIQL 4ZO9A 1FHGA 4YFEA 4YAQA 1F02I 1EHNA 3GRWL 2OMBA 3BEWB 3O4LD 3IFNH 3MX0A 4DZBB 3QFDB 5C0BD 4IHOB 2Z92B 1NL0L 2D2OA 3MRQA 2EIDA 3T3ME 3V5DB 3WD5H 1FFOA 4FQ2H 2K7QA 4BQBA 3WDIA 2FGWH 3QBTB 3S36L 4K7FB 4JZJC 5T3ZD 2X4OA 4K94L 4P59L 3HZVA 3LIZL 3I50H 5E2JA 1SJEA 5HVGB 1JV5A 2A6KA 1JGDB 2WUBH 1KJ2A 3WS3B 3U4BH 3K1KC 3QXAA 4AK1A 4F7PB 3GHEH 1YJDH 2WIMA 4O2FB 1EV2E 4NN5C 4RQQB 1LP9E 1S7SA 4ZTOH 1OGTB 1F4HA 3SGEH 4HSQA 3W11C 5I1GH 3KLHD 1AE6L 4AQ1B 4YWGL 4HIXL 3SPVB 3KYOA 5HDBE 5EOCH 2FO4B 2IPUK 3MGTB 5CILL 1BZ9A 2UYLA 1JZ8A 5TE4L 2EECA 4I77L 5C3LD 4O4YL 3VXRB 1LDPL 4TRPH 3LN4A 4WO4D 4M7JL 1M7IA 4J1UB 4K3HA 2K1MA 1MNUH 3B9AA 4MB4A 2E8ZA 1VEOA 3ZYJA 1RJYA 5JXEA 2BVUA 3ARTA 4PBXA 1BFVH 2JJTA 1TQCC 3LPFA 2A73B 2W9EL 4C56B 1ZWIA 3SO3B 4F7EA 2RAMA 3NAAH 3FQRB 4GMSH 1OAYL 5DEFA 2ITDA 3S88L 3GMQA 3DYMA 1ZTXL 2P24B 4UV7H 4ZPVA 4NZTL 3PWUA 2VSDA 4QRTB 5F7NC 4JN1L 3MJ7B 1YUHA 1PEZA 3BPLB 4FNLL 4JZOB 1F11B 5CSZA 1FN4B 2CO7B 3SCMA 3BWAA 2UV3A 5DMKA 4I0PB 1XZ0B 2C1OA 5GGUB 5D9SA 4JB9H 2COQA 4ODTH 4GOSA 4KMTH 5KVFH 5DUBA 2VDNL 5CJ8A 4ODHH 1BQLH 5JW5B 2N4IA 1S7UA 3L3IB 1KG0B 3HRZA 1JNHB 3V8OA 3WFCH 3MODL 4MNQD 3QP3A 5ILTL 5IT2H 2HLFC 3MRJB 3S7GA 3AREC 4RFEB 1TMCB 4HJGB 4JY6A 5ALCH 1UA6H 4XH2B 2DQDH 2BOCB 2QADD 4Q6IA 5FKAA 5F1SA 2J8UE 1C5DA 2XWBA 5HGHB 4I13B 4OI8A 2A6DA 4G9DB 4BH7B 1P1ZA 2YA1A 5C0IB 2O5YH 5BRZB 1NFKA 5T5NF 5E6YA 1AGFB 4NO0A 1N5YL 4UTBL 4FZEL 3BVNB 4RDQG 4F7CB 1TZIA 3GSXA 4YBLB 1BJ1H 3KPTA 2HVJB 3DMMA 4NO2A 3GKWH 2SEBB 3EZJB 3F7YA 4NP4L 3V6OC 3D9AL 3LQAH 4E5XA 1CXKA 4HUNB 1R5VA 4HKBA 1DBAL 2O5ZL 4LHQB 3FB6A 4H0GA 4QY8B 4QXWA 4P2YA 25C8H 2CD0A 2BNRE 1UM6L 4QRPD 1FJ1A 4MB3A 4M7KL 4HMCA 1KSRA 1KELH 2EIBA 1PKQA 1Q94B 1KB5H 3H42L 3QUKA 1TCMA 3EO1B 2PN5A 4EDXB 3G04A 2ICEA 2VXUH 4LRNH 5MENE 3G6JE 3LEXB 4R2GC 3MUY1 5FO8B 1YPZF 3KS0H 1U8PB 2UUDH 1OSZB 4PG9A 5KG9A 1I3VA 2AJUH 4JFEA 3NZ8B 3KPMA 1KJMB 2C3XA 4RMUA 3V52H 1MFBL 3BO8A 1DEEA 3FONA 1KCUH 4Y8DC 3C09C 5DWUL 5DLML 1MHHB 4WGWB 4MD0B 3TO4D 2X4NB 3UC0L 4OM1L 3GSQB 4AG4H 5I30L 3WBDA 4R7NB 4L8CA 2IH3A 5CBEB 1OB1B 1J86A 2HKFL 1BQSA 4F7TA 1KF9B 5BZDA 1CN4A 2PTTA 4ODSH 5LG1A 3P0YL 2ERJB 1QKZL 2Y4SA 1LO4H 5GS0H 3U79A 1ZHNB 4OZFA 4RISL 1BX2B 4WI6A 4X9IA 4L9LA 4XMKH 3OPZH 2JCCB 4NNYA 1T7VA 4HF5L 3BZEB 3VFRA 1CGWA 5JHDB 1X44A 3D0LA 4N8VA 4AEHL 1QLEL 3RTQA 2QR0A 4X7FC 5IJVA 1B4RA 4N0UE 2XI9A 4MZ3A 5E8NB 5D1ZD 3FT4A 3D85D 1NGYA 1A1NB 5A3IC 2H3NA 4HKJA 2XKNA 3B43A 5J6GB 1QTYT 3WJLA 5I1JL 1T0NB 3DXAD 1MQKH 4Y4FA 1I3RB 3ULVE 3LKPB 1P4IH 3ECBB 5IKCB 3U7YL 5IB1B 1TXKA 4NM8L 2B8OT 1MHPL 2AQ1A 1KB9J 5IW6A 1TJIL 4LDLB 5KJRL 2K7PA 4Y19D 2V7HB 3GJFH 4I0CC 3MBED 1A64A 5F9JB 1I7TA 4QRRD 3GJFK 1G0YR 1JVKA 5DS8B 5FHBH 1OARL 1ZGLB 2Z31C 2R4RH 4XPGL 2XXCB 1D5IH 2VISB 3KPRA 1S7VA 1TIUA 2VLLB 3DSNA 3TNMB 4UBDC 1RVFL 1ZT7A 5CJOL 1T1WB 1D9KB 4PJFB 1DANU 2I9LA 5B8CC 2WUCH 4H1LG 2OX5A 3NH7H 4N8CH 1OLLA 4TNVK 5C0AD 3BZ4B 3K2UH 4HMDA 1ZHLA 4LARH 5F70A 3HE6A 5LXGH 1I3GL 3RJQB 5C70A 1P9MA 1IAIM 2D0HA 4JAMA 3FQWA 5J56B 4RGMB 2B2XL 3MRMA 3ULUF 1MCBA 2M2DA 5F6HI 2EDLA 1HWHB 3VXRE 1ZOXA 3MCKA 5DI8A 2LV4A 4KQ4L 4JGUA 3W11D 3QO0B 3MV8D 4I48B 1G9NH 5SWSD 4L29B 1LVEA 2CLZA 4M7LH 4PP2A 1CFNB 4YXHL 3W5MA 2BVQB 1QYGH 1DDHB 3VFWB 3WXVH 5I8OH 4PJ8C 4P2OC 4ELKB 1WICA 3VXTA 2K9UA 2FIKA 5HHQB 3SDXF 3UTQA 4MYWB 4Q6YA 2HG5B 3BN3B 5MP6H 4OZGA 5T1DH 3W9DA 4X9BA 4JFDA 2HFFA 3BW9A 4C56E 4LLQB 4YHIB 3DHJA 2XY1A 1KCVH 4NJAH 4Z7UF 5KS9B 3FN0L 3ARSA 3QYCA 4MCYB 5DA4A 35C8H 5BMFL 4QGTA 5HSFA 3OAUH 5GHWH 4KK8D 2BJMH 4CADB 3QUML 3PGDB 4JRYB 1BFOB 2WINB 3MO1A 1MCDA 5C07A 1EEYB 4TTGA 3CU7A 4F7MA 2XZZA 1HHGA 3RA7L 4BZYA 4MA1C 1JF1B 1RK0A 3EYSH 5D96B 2GY7B 3VXQB 3FN9A 1X4ZA 3MCLH 3JV0A 3ZT6A 4LSTH 4NO5B 3U6RB 1ETZA 2IWGA 1KC5L 1J0JA 2JJVA 3F7RA 4C59B 4N9GA 2AV1A 4U0QB 2AJZB 5EUKB 2MTPA 3UDWA 4F8QA 4ZQKB 3IETB 2VDRL 4LVEA 4N0FB 3KPOB 4NCC1 3SE4A 3VI3F 1FCGA 1AD0B 5A2FA 3MRIA 2HTKC 5FYKU 2XZAL 1ZA3A 3GSWA 4ZFZB 3MRDB 1YN7A 1XH3A 4LVHB 1CE6A 3RGVA 4ZAKB 1Q1JL 4GW1A 5BRZE 5BVPH 5JA9A 4LGSB 3ARED 3FFCA 2DQCL 3MJ8B 1BLNB 3O8XA 2Y23A 2YXFA 4OFDA 1QPPA 1JTTA 3B5HA 7FABL 2P7TB 4Z0BL 2DAVA 4K9EC 3CSGA 4YR6B 2MHAA 2VITA 2XY2A 3UTZB 3QO1A 2CDEA 2FHCA 4XCNA 5EO1A 3G5XA 4HPOH 1UWGL 5L2KD 1VSCA 3Q6FB 1BIIB 4HH8A 3TVMB 4O2EB 1M6OB 1VACB 3ULUC 4M43H 1T03H 1T1YB 3I75B 4X7DC 3CLEH 3UTTA 2Q8BL 3CSBA 5CLTA 1FVCB 5HDQH 3VI4E 1MF2H 4RMVA 3WN5A 3MRCB 5IHZA 5ESQA 3KPLB 1I1AA 1X5FA 3T0AA 3T2QA 1CK0H 2VMFA 4IRZH 3UTOA 1HH6B 3IXAB 4QXTB 1KJVB 5CGTA 5DJZA 3QWOB 2FJHA 1JTOA 4U4BA 2DWEB 1WEJH 4XMLL 1ZVYA 3FO9A 4P46B 1BPVA 1ADQL 3V7MA 2ZOKA 5FO9B 3EO9H 4JFZL 4RAVB 1MCNA 3QHZL 4R3SA 1OP5H 4WI5A 1HIMH 4U33A 2JLLA 4JQVC 4RMWA 2W0FA 4NFCA 1OP5K 4EN3A 3M17A 4G8FB 3RVVC 2BXZA 2YZ1A 4LGRB 2AJYL 2P43B 4U1KA 1RPQA 4R4BB 1TPXC 1JPTL 2IG2L 4MAUL 2NY3B 1MCPL 4PRHD 5C7XH 4PRDB 2HFEA 1HHIB 4X0KA 2EDNA 1XT5A 4DCQA 4R2GD 4UV4L 2VLKB 1NMCB 2ORBH 1IEBB 1LDSA 1NMAH 3AMKA 3LZFL 5JMRA 1YEJL 4ZXBC 1IBGL 5IOPB 1INQA 4YQXH 3Q0HA 4KDWA 4G7YL 4X7CC 2YS4A 5LQBL 2JCCE 1D6VL 5JW3H 3MRKB 4A6YB 4PV9A 5GS1C 3VGDA 3VMOA 4KHXL 3WSQH 1AHWA 5AZ2L 5JDJA 3E0GA 3Q3GA 4PJDF 4D8PA 5F6IC 2D7NA 2YPVH 1A0QL 3VG9C 5EZLB 2HRPH 2JIXD 4HZLA 1NGWB 1V7NL 4PGCA 4PR5A 9CGTA 5JORA 5K59E 3D6GA 4H26B 4QHUA 1T0PB 5D6DC 1IQDA 4KJWC 4YGAB 2NYYC 4OD1H 2IPTH 1A7OH 4AEIL 1JNLH 2Q6WA 1RHHB 3LRSA 4BUHA 1T89C 4OZIB 1KB9K 1JYNA 3EDKA 2VDPL 3BKYL 3TN0C 1TZGL 2PO6B 5K9QG 1JCKA 3LQMA 5A3ID 2EYSB 8FABA 1YYML 3VRLE 4UTAL 1MHCA 2ILLA 3B8YA 4WHYG 3BZDA 3KG5A 5DHYB 3UO1H 4ACPA 2GCYB 5IIEA 1N5AB 1QO3A 2EXWC 3HC0B 3QA3A 3PXHA 1S7QB 5IR1A 5TPWL 3ZE1E 1HNGA 2FYYB 2VXQH 2QQQA 1GOHA 1B2WH 1T5WA 1T2QH 2RCSL 1I9EA 1JUFB 3NCFB 2GJZB 4PJFE 2C3VB 3S3PA 4DKEH 1OAUL 4QT5A 3G5ZA 1BQHB 2CRYA 4MQSB 4Z7WA 2GK0B 3P30L 3CFEA 2HP4A 1TVHB 3HN3A 2Z31D 1GIGH 1AR2A 1FNSL 5GJSL 5DHVA 3PHQB 4TVPD 4PRNB 1BM3H 5KVEL 1B3JA 4AT6B 3P9LB 1XF1A 4G6AD 3VRIA 1OGAA 2RR3A 2ZZUT 1U91A 1MH5A 1R3JB 1CICA 4X4MA 4F2MA 1XIWB 2DMKA 3HR5A 2J88H 2C3GA 4KHTL 3WKNA 1BECA 1JGUH 3VGEA 4Y2DB 3LD8C 1GZPA 4XNXL 5EBWB 3HPJA 4ZD3H 5DQ9B 4LGPB 5FA4B 3GI9H 5ACZA 2E9JA 5KSUA 1QG3A 5DD3H 5ICYA 4YDKH 4X6DB 4OZHF 4EZMA 3UPRB 4CW1A 1HN1A 4HKZB 2EEBA 4G6JL 3KGRA 5D7IB 1JK8B 5A2LH 1YNLH 4Z7VB 3T8XB 2H45A 3TESA 1IFHL 2IGFL 1P4BH 4QHNA 2ADJB 1BVZA 1URLA 5KS9E 4PRIA 5AZEL 3PWNB 2IAMC 4P2OD 4WTWA 3IT8D 5DRXA 3T2PA 4M61B 1T7WA 4TN9A 1SEBB 4XP1L 1F6AB 1PY9A 5EC1B 2PW1A 1YNTA 3IJSA 3O6ML 4JRYE 3WUWB 2OP4H 3LEYL 1TJHL 3I84A 3X11B 1Q0YH 4NWUL 3T4YA 3SGDI 4PS4H 3UJJH 3B2UD 4U6VL 3ROLB 4U1LA 3IF1A 2NY2C 2YSSA 4Y5YC 3R8BB 3U9PL 1NGXA 2BSTB 3GSNL 1AIFA 4NRXA 3I6KA 1A6WH 2OK0H 3PV7A 2AABL 2VJXA 4W6XB 4V1DD 2APBA 5C6WH 4KJYA 2H2SC 4IRSC 5FGBA 1JMXA 3PNWA 2X89D 5EOQH 5DR5H 1Z5LA 2JJSA 2H6PA 5E94B 1QEWB 5F8QC 4ONFH 3TPKA 4G5ZH 4X6CB 5C0CD 1Y0LB 5F9OH 5FYKD 4TTDD 1K4CB 1KEML 3P4MA 1DUZA 1KCRH 3QSKB 2GSIB 5HHPA 1RUKL 2ENYA 4PJ7B 4HIEB 5EPMB 5EOTA 1CQKA 5IHLB 4ODWB 3BMVA 1U58B 2VXTH 5T5FH 2LQRA 3MNWA 2HTKD 5SWSA 4YFLI 3L1OL 5HYIA 3A6CL 1SMOA 3O11A 5I17B 1IT9L 3WFZA 2AQ2A 1F4YL 1GOGA 4WENB 3C6LA 1MFCH 1U36A 3WFBL 1MJUL 5A40E 1VFMA 3MRNA 3DV4A 5D1QB 4NBZB 2VLJB 3TA3B 3ZYOA 4HLZG 3LB6C 4HT1L 1UB5B 5GZNC 1S9WA 2W0KA 5BW7A 1IGIH 3QUZC 1TJGL 1YEIH 4P3DA 5TQ0H 1P7QD 3G08B 1DBJL 3QXUA 43C9A 1AD9A 4OLWH 4MA7H 3OG4B 4FQQB 4K8RC 1YA5A 1AXTH 2R29H 2VH5H 1FZMA 4PJBB 4HUWA 3HRPA 4PGJA 4I3RH 1LO3H 3CVIL 1AXSA 2R1XA 1T3FA 2YD3A 4YX2H 1LWRA 1GHFL 4OCRL 2BC4A 4XTRD 3KYNA 2ZKHL 1MY7A 1EEUA 2NY5H 4NWTL 4L8DB 3VWJB 3BP4B 2Q7YA 3JWOC 2EEAA 4XAKE 3SBWA 3FOLA 3OG6B 2VLKE 5INCB 4AMKL 3B9EA 4TSCL 4KZEH 4OCSL 2VDMH 3O3AA 2ZSVB 3NIGE 2A9NH 3RVVD 4JFFD 4O51A 4I9WE 5HYSG 4W70A 1X7QA 3G5YA 5KSVB 4OD3H 2AEQL 1GGCL 4UZGA 1UXSB 2AK4B 1ZAGA 5FHAL 4WI4A 5T3XH 5GGTL 5L8LB 3BP7B 4P9HH 2PCPB 5IMLB 1JE6A 3MGAA 5HYJA 4ZXBD 1VFOA 4O02L 4MJID 5KZCD 1UQSB 4OGXH 4LCWA 4JJHA 1FFQA 2GJ6D 1NBZA 3ARYA 1A6TA 3SDYH 5C08D 5JHLL 4JO4L 4FMKA 3TT3H 3C87A 3HZMB 3G6DL 5FUZL 1ITCA 1T20B 2F8VA 4OUOA 4OZIE 1NCCL 1WISA 4QXUL 2MFNA 5CEXB 2EDYA 3RPKA 3RWEA 3RU8H 1DLFH 3H3PL 3CNKA 3I6LE 2ATKB 1AY1H 3KJ6H 4EIZC 2D4FA 2DYPB 4KJWD 4Y16C 2NYYD 1GGBL 1DVFB 3GMPA 5ID0A 5K9JH 4LVOC 4YC2C 4MAYD 3MRHB 1JFQH 3JWOL 4M00A 1B88A 5F9WC 3HAEH 1ERNA 3P9WB 1QBBA 5F7KC 1JPGB 2J8UF 4OUUA 5CIPH 4U1IB 2D31A 1NCAL 4CDGC 1UVQB 4Z7NF 4CMMB 3ZZ1A 3VWKC 5INDB 3MGOB 2D7PA 5TFSH 2EXWD 4CBPA 4YAQB 2YPLA 2J3SA 1MWAA 3QIWA 4EUPG 3GMRA 2A6JA 1KCSL 2WWMC 3IJHB 4KXZI 3MRQB 4QRUA 5D7JC 1FFOB 4OCYH 1RMFH 3PQYA 3IU4H 1GCFA 4JREB 3O6LL 4CL7A 3RGHA 1WV7T 5E4EC 2X4OB 5CBAA 4JFHD 3DETD 1NKOA 3WKML 5I8CA 4DOHB 4X6DE 1SJEB 4RWYH 1JV5B 2A6KB 2F58H 1KJ2B 4P4KD 4IJ3C 3O2DA 4LSUH 3QXAB 3OKLA 5D7IE 4Z7VE 2XQBH 4XPHH 3QIUA 4MWFA 1S7SB 4UAOC 4GSDL 3QNXA 4ETQA 1E4XI 3G6JF 3NABL 2V5RA 1MJ8L 12E8H 2DQJH 4MA8H 3W5NA 3KYOB 4HAGA 4JKMA 4LP4A 1CDYA 3PIQA 1FL6A 1DN0A 3DSFL 1BZ9B 5E1AA 2GFBA 2UYLB 3QDHA 2DIAA 3QUXD 1NCBL 1JWUA 4FA8A 3LN4B 1HH9A 5AYUL 1N64L 2FEDC 3RFZC 4HIJB 4FFYH 1W8OA 1M7IB 3QUYA 3AM8C 3AS0A 3UYRH 5KBNC 1CFBA 4M1GH 4G8GA 2FDBP 2QHRH 3OBAA 3MLSH 3SE3A 4OGYL 4HGWA 3NFSL 1DL7H 2H2PC 2OMNA 1RJYB 2W38A 1NBQA 1G7MA 3WIHH 3V6BR 2EZ0C 5GRWA 1ZWIB 3DGCR 3S34H 4F7EB 4YBQC 3WO3B 1C8PA 4JPWL 5DEFB 1KOAA 2ITDB 3GMQB 3RIAF 1JTPA 4OF3A 3MLXH 4ZPVB 3PWUB 1MAML 3QUMA 4JM2F 5F7DA 4O5LL 1I8MA 1YUHB 1GYAA 3SCMB 5CSZB 3HPLA 4PJ7E 3BWAB 2H2SD 2H32H 4IRSD 5D9SB 1O0VA 4G6KL 5DUBB 1QD0A 1H0DA 3P73A 1FL5A 1S7UB 3HRZB 4M6OH 4HIIA 1WWCA 2Z9TA 1YECL 1NC4A 4JO3H 4JDVA 4RSVA 3RX7A 3F7VA 5BO1H 4JY6B 3FMGH 5JDSA 4RAUA 3VH8G 2VLJE 2KQNA 4Q6IB 5I1HH 5FKAB 2EC9T 3BPNC 5EWIL 1EVTC 1WFTA 4Q2ZA 3H6JA 1C5DB 2XWBB 4TQEH 4TUOA 3SGEI 3NBNA 2A6DB 3BKMH 3CCHA 3ZMRA 1P1ZB 4Y4KA 3MZTA 4OV5A 5E08L 1U3HC 3WO4C 4M5YL 5HYFA 1I1YA 4NO0B 2FBJH 1ZKAA 4UDUA 1AGCA 4PJBE 1WIOA 2A77L 2B20A 4P2RD 5A2IH 3JWDC 1TZIB 3GSXB 3LB6D 5DFTA 5IROC 5GZND 1DR9A 2XICA 3DMMB 4WHDA 4NO2B 3O2VL 5C09D 4PJ9C 1FIGL 4E5XB 1FZOA 1SYVA 3F12A 3RJDA 1R5VB 4HKBB 4S1QL 3VDAA 3U7WH 5IG7A 5L0QB 3FB6B 2APTA 3KNBA 3CMOH 1B9ZA 2WBKA 1INDL 2PR4L 2AVGA 4PREA 1FJ1B 4FFZH 3PWPD 3ZTNL 1N7ML 4LCIH 3RZCD 5GGRA 1A7QH 4OBSA 1PKQB 5ISZD 3INUL 3P0GB 2LAGB 3QUKB 3S37L 5F3BA 5EU7E 4QEGA 3G04B 2ICEB 5CUSL 2YC1A 1YEDB 2AK4E 5DZNA 3CH8A 1Q72H 4JO1L 3VXNA 4TNVF 4LRIC 1VESA 2Z35A 3G6AA 1VGEL 3OB0H 4R97C 1KGCD 4KUCD 2EH7L 4JG0H 4PG9B 1BBDH 5KG9B 4JFEB 1LK3H 3KPMB 3BO8B 4FZ8H 3RAJH 1DEEB 4KKLD 1REIA 1TFHA 5SWZD 1KENL 3FONB 5E2TL 5EORH 1ZT4A 4PD4J 1V7MH 3VFUB 2OCFD 5B21A 2IH3B 1KXTB 1BD2D 4FQXA 4QXGL 4F7TB 2VKXA 5F7EH 2DTML 5BZDB 1JPSH 4XNMA 4JANA 2XRAL 1H3UA 4XP9L 5H37H 5C0DA 4BK5A 4OZFB 4W4NA 4HHAA 1OTUC 4L9LB 3JWNC 4NNYB 1HYSC 1EJOL 4GRWH 3VFRB 2A83A 1UWEL 2J6EL 3D0LB 2E6JA 2P47B 3N9GL 4N8VB 4XPAL 2E7LA 4M5ZL 5B39A 3MXWH 3RTQB 5F7MC 2QR0B 3T08A 5IJVB 4NNPH 4LFHG 4MJ4A 5DJYB 1X5HA 2IADA 3G9AB 3MACH 2GTWA 4KGJA 4NDMA 3FT4B 4Y16D 1EGJL 1NGYB 5C71A 4G42A 2H3NB 4HKJB 2XKNB 3IFLH 2EDWA 1K6QH 3HI6H 2MPAH 5B4MC 5KSAA 4Y4FB 2QQLH 3C60A 2R4SH 2BHZA 3CJJA 3QXWA 3NIFF 2QBWA 1HQRA 2XZQL 5IW6B 2CUMA 1ULVA 4GXUN 1X6LA 3ZKMC 3HMXH 3Q1SL 3CX5K 1I7TB 4KI5E 2R8SH 1NAKH 5DD6A 2UWEF 4UDTA 2XQYG 1CDJA 4EXKA 2EDTA 1R0AL 1U6AL 3KPRB 2WWMD 4QHLA 4DOHE 2AEWA 1S7VB 1S5IH 5D72H 4LFHD 4P3CL 1ZT7B 1HYRC 3VXPB 4EI6A 4NKIL 4MXQC 5D7JD 2XTJC 2I9LB 5DTFA 3TP4A 3ULVL 4HEME 1T21A 1SVZA 3MV11 4WDIA 5T1LD 5DMGC 5DUPL 3U82B 2GJ6A 5F72S 1ZHLB 3HE6B 3BN9C 3U1SH 2XNAA 1G6RH 2PXYB 4NRYA 4JAMB 5HXMA 4I4WA 5I1KH 1JZ4A 3MRMB 4N1EA 2YN3A 3BQUA 2DKSA 3MCKB 3GBNH 4IDLA 5DI8B 3E1F1 4KKCD 3UTPE 5D70H 5HYSA 1XF3A 4U7KA 3MRFA 4PP2B 1QFWH 2CLZB 3PWJA 1ZANH 3SKJH 5I18L 5L88H 3BPLC 3U36A 4PJ5D 4I0PC 5C9KA 4K3EL 3VXTB 2FIKB 1ZLSL 4PJIF 3QRGH 3GJEA 1YEFH 3UTQB 1DBBL 1AQKL 3W9DB 4A2LA 4OZGB 4CAGA 4EXPX 5DXWA 3GM0A 3IAQA 2HFFB 4JFDB 4H25A 2FEDD 2V7NA 3BW9B 1L7IL 5H2BA 1JGEA 4XC1H 4R26H 4M4RA 4MMZC 4H20L 4X98A 2X4QA 3A6BH 5F71A 1UXWA 2YRLA 1HINH 5K59F 1YMHA 1QFUH 1UGNA 3MO1B 2EZ0D 5C07B 4AIZB 1AC6A 4CRPA 4F7MB 3RY6C 3BEVA 1RK0B 4LASL 3QHFL 4PB0H 3RDTA 2E6QA 4UT6L 5IJKC 4LLWA 2EH8L 2Q3AA 3B9VA 5IFAH 3RVXC 4QNPF 1NBVL 1WBXA 5TDPA 2YD6A 4G3YH 4GW5A 3AS3A 4YBLC 4L9DA 3C2SA 2FATL 3VRLF 4N9GB 4BQ9A 3EFDH 2AV1B 5EH1A 4DN3H 4IRJB 3MJ9L 4GRLA 4N0RA 1XR8B 5CP3H 4LQ1A 1NSNH 1WAAF 3G9VA 1GOFA 4I2XB 1XGYL 3MRIB 1ZA3B 3GSWB 3RGVB 1YN7B 1XH3B 4XRCA 1CE6B 4UNUA 5EZJA 3GUTA 2J8HA 4GKOA 4GW1B 3K80A 4EUPA 4K7PY 3FFCB 1G9EA 3ARRA 4OFIA 3O8XB 4ZOEA 2H41A 1UZ6E 2VDOH 3EAKA 2UY7A 4HC1L 1MRFL 2MHAB 1PZ5A 2VITB 5E4IA 3QO1B 2P42B 5L7XH 5EO1B 3G5XB 4UIKL 1U3HD 3GBML 1DBKL 2BNRD 4N0YL 1Z0NA 3O6FA 1GL4B 4D3CH 4NHUA 2AXFA 3UTTB 5I6XB 3GI8H 3T2NH 4R4FH 4XNYH 1W72H 1U42A 1NAMH 2Q86A 5MEND 2VAAA 4NGHH 3WN5B 2HAZA 5IHZB 5ESQB 5LCVL 1PKQE 1I1AB 4PJ9D 1QSFA 4OKVA 3CXDH 3AU1A 5HVWA 4KROB 3O4OB 5DJZB 5E5UB 3X3FH 3OSKA 2FJHB 3EYVA 1EHXA 2VL4A 5DVOA 2ERJC 3FO9B 2C1PA 2ZOKB 3DLQR 5C0RL 3L3HA 3BKJL 3AAZB 1CR9H 4R3SB 1NGPL 1N3NA 1YQVH 5ID1A 2W0FB 4JFEE 5FYJH 1X5IA 4EN3B 3M17B 4U1KB 3ARUA 3GK8H 1T6VN 3RL2A 2HFEB 4X0KB 5TE7L 4DCQB 3QDJA 2JK5A 2I27N 3ARGA 5GGQL 2EIZA 2CJUL 4WVRA 4EI5D 2HWZH 2I24N 2L7UA 1KN4H 1WVZA 4LCCA 4NZUL 4P9ML 2O93L 1INQB 1A3RH 1F4AA 3M45A 5IB5A 3LS5L 1NFIA 3FCTA 4HPYL 5MEOA 4PV9B 3HZYA 1DFBL 3RY5A 3Q3GB 4D8PB 5KANI 4OLVH 3SGKA 3ULVD 2DD8L 1JGLL 4PGCB 4PR5B 5JORB 3OGOE 3RWCA 1KEGL 4QHUB 1C16A 1IQDB 3NIDF 1EXUA 1G7PA 3K3QA 4P5TA 2Q6WB 4M3JA 4EEEA 3LRSB 4LP5A 1TENA 4KVNH 3CLFL 1PJ9A 1F6FB 4KI1A 5KVDL 1A6ZA 3WEXA 4S1SL 2ADIA 4IEFB 3MLZL 8FABB 5LGJA 4OLXL 1MHCB 1G7HA 4MQTB 5B4MD 3RZCA 1R3IH 2I9TA 4K23L 1S9VA 2X7LA 4RGMC 5IIEB 1OPGH 5CJQL 1QO3B 1J11A 1AI1L 3QA3B 3EJJX 3GMNA 5IR1B 1AFVH 3KPRE 3DRQA 5I19H 1Y6MR 1T5WB 3NTCL 1N26A 4GMTL 3OHXA 3ZKMD 5D1XA 3RHWF 4EBQL 4JFPA 1UACH 3P11H 2WP3T 4QT5B 3G5ZB 3QPXL 3U0TA 3MYZA 4Z7WB 4GQ9H 1MELA 2J8OA 3CFEB 4OCXL 4KAQL 1HSAA 1OAXH 5DHVB 2GEEA 3DV6B 4MXQD 1OGAB 3PP4L 3VRIB 2IBZY 1U91B 1MH5B 5GRVK 1CICB 4F2MB 3QI9A 3HR5B 3Q6GL 2HH0H 2Y07L 5DMGD 4PGBA 1GZPB 4XPTL 1HE7A 1FBIH 2OS7A 3FB5A 3HPJB 4I3SL 5E8EA 3ZE2E 3WDJA 4X4XA 2BHYA 4FHBD 5ACZB 5KSUB 4OAWA 1KJ3L 3NIGF 5D96C 1DBML 4CW1B 1FAIH 4DVRL 2F8OA 4OZGE 4Z77A 3DUHA 1JIBA 4PJXF 4JFDE 1Q9WA 3DX6A 3IDNA 2D0FA 4QHNB 3RBGA 2B1HL 5ITFA 4F15B 4PRIB 2WV3A 3T1FA 3MOAL 1PSKH 3JV4B 4I0PD 5DRXB 4E41A 5E2VH 3D25A 5JW4Q 2PW1B 3OAZK 5CWSA 2CKBA 1YNTB 3IJSB 1D5XA 4X80H 1BOYA 3H7BA 3LDBC 2Q87A 3LKOA 4G80A 4DKFH 1QA9A 3QAZB 5C07E 5SV3A 1IQWH 4LLDA 4GH7B 3T4YB 1CDUA 3LKQA 4HWBH 1GAFH 4K7PX 4KVCL 2OQJA 1A1MA 3IF1B 3QQ4A 4U1LB 2NY7H 4GS7B 2YSSB 3DYOA 2XG4A 3NCJL 1A4KA 1NC2A 1AIFB 1RK1A 2IEPA 2V5SA 3I6KB 1MIML 3IDYB 4NRXB 4YLQT 1FZKA 2B0SL 1KYOK 5CZVL 3IS1X 3O6KH 4MVBC 4F9LC 4X4YA 5DD1L 5IWLA 2OBGA 3B6SA 4IOIA 5GQBA 5BRZD 3PNWB 2ADFL 1ORQA 1F42A 3EHBC 1Z5LB 1SY6A 5GRJH 1RURH 2C3WA 4LSPH 3I9GL 1VDGA 4OBRA 1B0RA 4GFTB 4XVSH 4OD2A 3P4MB 1DUZB 3V4VH 3FFCE 1A7NL 2P8LA 4OF7A 1S7WB 5HHPB 2V2WA 5B38G 5EOTB 1WZ1L 3KDMA 3PGFL 3OKMA 5BCAA 2J4WH 4PJHF 1K5NA 1DQQB 4P46C 5SWSB 4D0CA 2CUIA 3OKDA 4CGTA 3O11B 4D9LL 4WV1A 2MKWA 1IAIH 2Q3ZA 4NQVA 4PJ5A 3C6LB 4KTEL 1UM5H 2I5YL 3MRNB 3UTTE 3RI5K 3WIIL 3DV4B 4F37F 5F3HB 2NY3C 2DTSA 3NFPA 1QHOA 3MLVL 4RFOL 4OB5L 3BAEH 1NMCC 3MUJA 4P3DB 4XNQA 3FJTA 1H8SA 1WCQA 43C9B 43CAA 1AD9B 1FZMB 4HUWB 3SGJA 3ZHKA 2YK1L 1VA9A 4ZTPL 1IC7H 1AXSB 2R1XB 5H35A 1T3FB 4P2QD 2NX5B 4FQLH 4WTZG 2BC4B 2FD6H 4WW2B 3KYNB 1DLHB 2O5XL 4ODVL 2WBJA 2X4UA 4S1RH 3ZDXF 5I75C 4MJ6A 1JZ6A 2YD1A 3W39A 2Q7YB 1BHGA 1RZJH 3FOLB 4YHLL 2PW2A 3DO7A 3MRPA 3ILPA 5D71L 3V4UL 2OL3H 3FRPG 1XGPA 3O3AB 4JHWH 4NUGH 5JHDD 4O51B 5DGRA 1E4WH 1T0MA 1IGMH 2R0KH 1X7QB 3G5YB 4WFFE 4PB9L 1I7ZA 1PKOA 4W81A 4KY1H 3BRGC 2D9CA 4XXCC 1LO0H 1G9MH 3O81A 2PO6C 4QHKJ 1OF2A 3VFMB 1P84K 4BK4A 4YHOH 5HYJB 4JR9L 3OGCA 5CGYC 4AY0A 4AM0A 5DD0H 2IFFL 1BGXL 4LCWB 1RIVL 2DBLL 2ZCLL 2FH8A 5MEQA 2Z4QA 4JKLA 2D03L 1NBZB 2B5IC 3STBA 1IE5A 1A6TB 5CEYA 3UJTL 3X12A 3MMEA 1OWWA 3GRWH 2LU7A 3T77A 4TPRL 3OXSA 3FO2A 1NL0H 1XGRA 1RV6X 1TVBA 2DQIL 1CXLA 3NGBC 2BK8A 3S35L 2YWYA 3RWEB 3RKPA 3EOYG 4A6YL 1PG7L 3IDMB 5C3TA 1H9VA 1J5OH 4K94H 4P59H 4O2CA 3LIZH 4ELMA 1TQBB 1D9KD 3GMPB 4FQIL 5GIRA 5ID0B 5CEZL 1IL1A 1XIWC 3BSZH 5DJ6A 4AQOA 2D4DA 1PQZA 4OUUB 4U2ZA 4CJ1A 1LD9A 3X3GH 2D31B 1CQYA 1AE6H 3AXLA 4XCFH 1H3PL 4LPUA 2MCPL 4HIXH 4JZJA 4Z7WE 1AGDA 2YPLB 2GSGA