3U7YH

Structure of nih45-46 fab in complex with gp120 of 93th057 hiv
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRGGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIH45-46 heavy chain, Ig gamma-1 chain C region
publication title Increasing the Potency and Breadth of an HIV Antibody by Using Structure-Based Rational Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 38
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2011-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH01
4PP1D 4YHLL 4ONHB 1DVFA 2QHRH 1U8KB 1EXUB 3TNMA 2FWOB 5GS1C 4P2OC 5IIEA 2G5BB 3WIHH 5D7SL 3IB4A 1JNHB 4OLYH 4NQCA 1YNTA 3K8LA 5E9DA 5E6IB 1CK0L 1ACYH 1JPFB 3C5ZC 1B2WH 4BKLA 2XKSA 4EOWH 3HI1A 4F7MA 3RWEB 3W2DH 4YDLC 1Q1JH 5KSBA 1JNNH 5EORL 5BW7C 1FNFA 1A6ZA 1KC5H 3G5YA 3QDGA 4PJEB 4KKNA 4CL7A 5BZWA 2HLFC 3E6FA 3L5WA 4HUXA 4KHTL 4U0QB 3RUGB 5F3BB 4P5TD 2IBZY 3D25B 5C0JA 3VGFA 4NP4L 1C12A 4LVHB 3RA7L 4YFEA 1M1SA 3ULVH 5HI4D 3CVHL 3UJTL 1JYNA 1K3ZA 4RFNB 3MV7E 2VZVA 5D93C 1D5XB 4WNQA 1SY6A 3UTSB 1MQKH 3RY5A 4JHAH 3U7WH 3OR6B 3UPRB 2AAVA 4JKMA 5I1GL 1F4YL 1N59B 2QBWA 1DBMH 1NAMH 1MPAH 2B5IC 3QIBB 1JN6A 3EO0A 5D7KE 1BP3B 4LOUD 4HXAL 2EXWD 2AEPH 2X1WL 4Q7DA 2WINB 2UVEA 4XPGL 1U8IB 5JUEL 4Z7NE 5J9PB 1FVCB 1NLDH 2QQLL 3E8UH 2C3VA 3IFOB 3QDMA 2BRRL 2VLRE 3BGMB 3FRUA 5J8OA 3U4BH 3BZ4A 1UM6H 1INQB 3HA0A 1UJTA 1EIBA 2HLAB 1W72H 5INCA 1AGBB 4I4WA 1AP2B 1GZQB 4NQTA 1VSCA 3QQNA 3MOAL 1T1WB 2MOVA 3Q1SL 3O2VH 3DMMD 4JQIL 1D5ZA 4CDHA 1RIVL 1RZIB 3RHWF 2CRIA 4FQQA 4OZGF 3TWCL 2FIKB 4YDVB 2GJ6D 7FABH 1OLLA 4WV1B 1A4JA 1J05B 4MQ7B 4R4FL 4FQXD 4LKCB 4X5XA 3VI4F 4RSVA 5JXEC 5JLZA 3MA7B 3VD3A 1KIUA 2IPKB 4NQDE 3GJEB 1U8PB 1ETZA 5FYLH 2KZ1B 2JCCB 3GSXA 5BS0A 1ADQA 2X4OB 1VCAA 3WLBB 2X1XR 4NKQB 2WW8A 3IJSA 1X6LA 2DJ4A 1QBAA 4R3SB 4NWTL 5ITBH 4PB0H 4OV5B 4L3CB 4OD2B 4E41B 1E28A 2FGZA 1TNNA 4EUPB 3K2UL 2EC9T 4Y4FC 3LV3A 1YA5A 2IF7A 2I5YL 4K23L 3QDAA 4UT7L 5E94A 2J8OA 1QFWL 1KCVH 5DC9B 4NN6C 3PGCA 3G6AB 5CZXD 3BGFC 4KAQL 1ZHBB 1U6AH 5EWIH 4GBXC 3LVEA 4I3RH 2F53D 2AK4A 4AIOA 5D2LA 5HGGS 3SDXF 4M7ZB 4WU5A 4S0SD 1F90L 2WAHA 5EO1B 1CXHA 1WC7A 2X4PA 3LAFA 6FABH 3GSQA 3PQYA 1KTRL 4L8SA 2Z35B 1IEAB 3WN5C 1NH6A 4KJPC 4IJ3C 2XNAA 4OCSL 2GITA 2JELL 2VLKA 5DUBA 1HH9A 3V6OE 1I9JH 1QSFB 5MEOB 2DJSA 3X3FL 5I74B 3OZ9H 3R0MA 2B20A 5C0AB 2VXVL 4XP5L 3LCYA 3IDUA 1QFOA 2BX5A 4HF5H 2Q7YA 2XPGA 3PXHA 4XVSL 1S9WA 4YIQA 4LP5A 1G0YR 3GBLA 5SWSE 1OOAA 3ARPA 4JEGB 4YUEH 5EBMA 1J0JA 4ZNEA 3GMQA 4HS6A 2DKUA 5DYOA 3H3PL 2P7TB 4EVNB 5L2KA 2R0WH 3V6BR 1C16B 2OL3B 3WFHA 1QLEH 5I1HH 3RBSA 5DJ0B 3VXNA 4JFFE 3S3PA 2D9CA 1N2RB 1NBQA 4Y5VC 5I75B 1BX2B 2VL5A 3L6FB 4YWGL 5F7FA 3KLAA 5H37G 4IHOA 4DFIA 1F58H 4JFZH 3P30L 5IB4B 3BP5A 2LTQB 2YOCA 1G7IB 1H5BC 4K7PY 1NMAL 4LNRA 1BLNA 5BOZG 5HPMA 4YGVA 1JTOA 3VGGA 5JO5A 4MA1B 4HLZG 1S7UB 3GI9L 4UV4L 4F57L 4X7SH 1KULA 3DUSA 4DGVL 2YBRA 2OI9B 4NO5A 1GC1L 1YEJH 4F7EB 5DRXB 1A2YA 2DJUA 3TZVA 1BOYA 1CD1A 4Q6IC 2ZOLA 4MYWB 4IOFD 3HI5L 2P47B 5B21A 2B0SH 3H9HA 1FFPA 5ESVA 1FO0A 4HWZA 3SE8L 4R96A 3TLRA 1VFAA 1U3HB 1DP0A 3HMXL 5IEHA 4I77L 3HE7B 1JHKH 4NUGL 3MLUH 3QDGE 1E6OL 3BP7B 1V3MA 3I50H 3CH8A 3L5XL 4K3DH 5IG7B 3RL1A 2NXYB 3HCVA 4LU5H 1MF2L 5FUZH 5E95B 3MBED 1XGPA 3PP4H 1Y0LB 1TJHH 2IFFL 3CU1A 4LKXA 5DRWA 3QI9B 3HPLB 4C56A 1AI1L 3CMOL 3LKOB 3S88H 2FD6H 2X2YA 3BIAX 3BWAA 1XIWC 3NIFF 2R4RH 3K1DA 5C09B 3MUZ1 3A0OA 3I75B 5HYJA 4I18B 3CSPA 1JYWA 3GUTA 1HXMA 1I85C 3ZKND 4L29B 3PGFH 4RRPG 4M5ZH 2HRPL 1F42A 5C0IB 3BKCH 4U1JB 3ZE2F 3TEUA 4KI5E 1ADQH 1OGAA 2QR0A 2V2TA 2RAMA 3EOBB 2EKSA 5DI8A 5E00A 3EFFA 1T04A 1Q9LA 3BO8B 1I8LA 4GAFB 3D85A 3MV9B 3OKOA 4Z7VA 2QSTA 4PJIA 1AO7B 5E2VH 1BQLH 1RZKH 2KUTA 2XV6B 4G9FA 2FX9H 4PRHE 4NHUA 2DDQL 2FBJL 4YHIB 2DWDB 4YQXL 3HRZB 1KG0B 5TH2B 3CFBA 1F11A 3GBML 4PV8B 5IVNA 2FX8H 4PJBB 2HMID 3RTQD 4WWKC 5HJ3B 5DMYA 1AKJD 1DN0A 2FJFA 2H3NB 3O9WD 4OAWA 3F7YB 3QZWG 3OWEA 2N7BA 3T0XA 5E1HB 1FLRL 3WLWD 4DCQA 3NN8A 4IRJB 3F5WB 3TJHC 4FQXA 3MUY1 3H9ZA 4JPKL 2VXUL 1ZHNA 3TT1L 3G5XA 4O2FA 4MHHI 4KI1A 3TIEB 2VZUA 4WFHE 1AE6L 5DC0A 3MJ6A 4HUVB 2VR4A 3GSUB 2DQFA 1IM9B 5JHDE 4PGBB 4LQFH 1T1YB 3K2MC 3HNTL 2IBGA 2IBZX 3B2VL 4YR6A 3QIUD 2DQIH 5D70H 4YXKL 4PYGA 3LEYL 2V9TA 1EMTH 4UIMB 3H8NA 2ZSVB 1ZLSH 4M6MH 3SGEI 2AK4E 3QR2A 4M8QB 3VXQA 5A43C 4PJCA 5IBLC 1FG9C 4KK8C 4X4YA 2BCKB 1KB5B 2F53A 1PEZA 1F8TL 3GHEL 4LPUA 1WAAF 1ZT7A 3HAEA 4K3JL 3HC0A 1RZFH 4JRXD 4PR5A 5CCKL 3WE6B 1ES0A 2VUYA 5C08D 3OKLA 1CFVH 1NFKA 1DLFL 4OZIF 4NC1C 4NKDB 4PJFE 3GMRB 1TPXC 3V6FB 4JM2C 1J1XH 3C5JA 4YAQB 1CI5A 4YHZH 2GJJA 4L8BB 3VH8B 5D7JC 3T8XA 2R9HC 1IAIH 3IU3A 4O5LH 1A02N 3FN0L 3S9DB 2FX7L 3WIIL 1MY7A 4NWUH 4Z0XA 3GSOB 3REWB 1FO0H 1KT2B 2GUOB 3B6SB 3KS0J 2ADJB 4PRDA 3KNBB 4LLMA 4S2SA 4LFHD 5HGBB 1SEBA 2R1WB 5C0GB 1DEEA 1OD9A 4P23B 5D1ZB 1RU9L 2DI7A 2BVUA 5D9SB 4BZ1L 2ZG2A 3TN0C 4JFYB 2VITA 4CVXA 3LKNA 3LS5L 1FNSH 4J1UB 1EEYB 2YMXL 5EZJB 3T3PF 2VOTA 5F93C 2DBLL 5HVWA 1Q0YH 1I8MB 4H0GA 4DZBB 4LCWA 3FN9A 3D69A 4G6JH 1KLUB 1UB6A 4EIGB 4TQEH 1A14L 1F3JA 3NA9H 2QHLA 3QXDA 3UTZB 3CFKA 4P4KC 4X6DE 5AEAA 5T5NG 3VFUA 3U48A 3OGCB 4BQ8A 1JIBA 2X70A 2RJMA 3R1GL 3O6KL 1J1PL 4E0RA 4JB9H 2AK1H 3V5KA 1BPVA 4UOW1 3U6RA 5CLTA 3MQIA 4RGOH 1HKLL 2ADGB 4HS3A 4B50A 3N1GC 5HTSA 3BH8A 1LP9A 3EOAA 1N7ML 5T1DL 3MBEA 5C0NC 4B41A 2GK0A 4GG8B 1P6AB 3SDCD 3DRQA 3GKWH 2JE8A 2GAZA 2JF1A 5EO9B 4XCYB 1FBIH 3LKRA 1JRHL 4R26H 3I02B 1MRFH 1N4XH 2FBOJ 4GXUM 3X3GH 5DLML 4YZFF 2NY5L 5FXCH 1C8PA 4R90H 4RMRA 5TGBB 1UADC 3KPPA 3MRRA 3EDDA 1HHGA 5IV2B 2Z8VC 1IC4L 2P5EE 3L3GA 3VXRA 3VG9C 4MHHG 4M8VA 2O61A 2FNBA 3FKUS 2CLZB 4D0DA 1KTDB 3LZFL 1FL3A 5EFIB 5IBTL 5TQ2L 4UB0H 5DURB 3SCMD 3G6JF 4RMTA 3QNXA 1ZANL 2V7NB 1AHWC 1OY3B 1BOGB 5DHXB 3U9UA 1HEZB 4ZUVB 2B39A 3RKDD 5MEND 2GJ6E 3LH2L 4JFHD 1MCNA 3UP1A 4OSUL 1DE4B 2XXMB 3VFTB 3RTQA 1SM3L 1MNUH 1AKJA 3O9WA 1A7OH 3ROOA 3ULUC 5DJ6A 2FJGA 3HAEH 1YQ2A 2A38A 1IT9H 2HTKC 3VFOB 2QQQA 1I7TA 4G8IA 5D1XC 3CFEB 4NFDA 3DGGA 3L3JA 1AY1H 3TCLB 1RZGB 3PIQA 3E6HB 2EEDA 2UYLA 3NCCB 4RWYL 1XR8A 2VR5A 5T1LD 2YUXA 1VADB 1T1ZA 3QIUA 5J11C 2CDEB 3U0WL 3GK8H 1I1AD 1P7KA 2AJXH 3W9DA 4PJCE 3EDFA 4IOIA 1OTSC 2YD6A 3VRJA 4PREB 1L4IA 2F53E 3H9YA 4Y19B 1U8JA 5E7BA 3SDXB 5EU3B 4XNYH 2DYPA 1CIUA 3DSFL 3O4LB 4Y16B 2D0GA 5TF1H 3I2CL 4XNXH 2NY4C 1Z9OA 4L4VD 25C8H 2I60L 2ATPA 4LNVA 1C5DB 1GIGH 5DR5L 3NCFB 4XNUL 1HN1A 1AXTH 2SEBB 5DRNB 4DJMA 5C08A 3IDGA 2BJMH 3S3JA 3PWVB 4KJYB 4GAGH 1D6VH 1MCLA 5TPWL 4Z7NF 2VXSH 1UJ3A 2PTUA 1FSKC 5IB5B 4EUPG 1BFOB 3A6BL 5EU7C 5BVJA 2Q8AH 4RNRA 1UH4A 4H26B 2IALA 4ELKB 5E4EB 4GKSB 1J11A 5B8CA 4MXWH 1CDUA 2NTFA 5CEZH 4TPRL 4KZEL 3HC3L 3FN3A 4GG6F 2X7LA 4L5FH 5KVDH 4FXKA 4HKXA 1NC2D 4WO4D 2CH8A 1TENA 2H9GB 2YD9A 4I3SL 3G9VA 3UZVB 1P4BH 2YD8A 5LCVH 1U8NB 4JFDE 3TNNA 3F58L 1RZ8A 2PF6A 3EUUA 4KKCD 1G6RA 4NCC2 4Y88A 5F1SA 1WIUA 3HE6A 2BP3A 2FR4A 3IDXH 4MCYB 3JWDH 4ERSH 1PKOA 3MLVH 4YDIL 1QFUH 3NZHH 3T2QA 1R0AH 2VLJB 1JHTB 5I9QB 3DV4B 4O58H 4KVCH 3H9SE 4HD9A 1PGRB 2CGRH 3H3BC 2Z93A 3O8XA 2BVOA 1NLBL 3RWFB 2PR4H 4JJ5A 3OKEB 1BVLA 4FFVC 2VZ1A 3C5SA 1NGYB 1NANI 3MRFA 4ODVL 4LASL 1T7WA 2YK1L 5EOCH 4XVUC 1FGVH 3DX9A 2HP4A 2AJSL 1MVUA 4QRUA 4JFXA 1X5GA 1U95B 2NZIA 4PRPD 3PHQA 1MHPL 1U2HA 1U58A 1BAFH 1I75A 4LPXA 4R2GC 1E4XL 4XGZB 1P7HL 1SJEB 3Q6GL 1UM5H 3NZ8A 4QXWA 3N1FC 3BXNB 4YBQD 2AVGA 2PNDA 1Q8MA 3JWOC 4MB4A 4UNUA 5CHNA 3ZTJG 1T03H 2YWZA 5HVGB 4P2RB 4XPHH 5LQBL 4JFEB 2AJUL 5EUOA 1A9EB 4L3EB 1AIFA 4M1CD 4N0YL 1CFSB 1KN2H 3V5HB 1QHPA 3ARDD 3D18A 3PDOA 4ZXBB 3Q3GA 5F7KC 3B43A 2VAAB 4G80B 4QOKD 4P9HC 4RX4D 4U05A 4QCIA 5HD8C 3QDJB 4TUJA 5T33H 1MLCA 4Z5RA 2EDNA 3H42H 5T3XH 2GJZB 3AREB 1OSZB 3RVWD 1PQZA 4APQC 3CCHB 3UTQB 5IW6B 5CJ8A 5HBBA 1NFDE 4PYHA 1PY4A 5I18L 3MOBL 1Q0XH 2X9YA 4M7JL 5KVFL 3MJ8B 3CLFL 4QLRA 3ZKSD 4H5SA 5I71B 4JRYB 1A1MB 3MROB 1TZHA 4NRYB 4WHTB 3H7LA 1I9RH 3FTGA 1A3RL 1QTYT 4LRIC 5E8OA 3BN9C 2IAMC 4S1RL 5LVEA 2EDJA 3SCMA 3UO1L 1EHNA 2EH8L 5GRVL 2H2SD 3MRIB 5DQJA 2CJUL 3KJ4C 5C0BE 5CZVL 1BFVH 3QA3A 2LVCA 4HHAA 2IQAA 2W60B 4FMKA 1MFBL 3U7YH 3IVKA 5E8PB 1EO8H 1QG3A 5FGBC 2QSQA 2O5XL 1UENA 1KEML 3EGSA 1LQSR 3GJFA 2YC1A 5I66B 4UTBH 5E2TH 3WNPA 1EEZA 2N1KA 5E6IC 2V5RA 5LAXA 2AI0L 2VZSA 4R0LB 4HG4K 3KPQA 4XPAH 5M95B 3ELAT 4HAGA 4F8TA 1KENL 4OCRH 3O3EB 4PRNB 3UC0L 3V7AE 1EH9A 1E27A 1IGJB 5IW1B 1CICA 1JE6A 1FVEB 3OKKB 3QUMB 4MA8H 4HJJL 4TULL 3HUJA 5JW4M 4Y4KB 4NQUA 3O0RH 4EI5C 1W0WB 2AQ1A 4JDZB 3MRBB 4LVHC 4ODUA 5IMMA 5T1LA 1QP1A 2VNCA 3TO2A 5IB3B 3KDMA 1YYML 5CWSB 2XKNB 4RFNC 5GJSL 1I1AA 2H2PC 3K4AA 3U46B 3D3VA 3WUWG 1MIML 2Z92B 4PJDA 4HKZA 1N8ZA 5D7IA 1NC4A 2CMRH 2V9RA 3Q6FA 4JKLA 4WGWB 4O51A 3M07A 3V4PH 2NX5A 3CZFB 3P73B 4JRXE 4OD3L 3QIBC 1VACB 1BD2D 1M71B 1QQDA 1U8OB 1BM3H 4MCZB 3RIAK 3GIVB 1L0YA 1G6RH 1TZIA 4JFQB 4RMQA 4OZIB 2PYEA 3E3QE 3RDTB 1TCRB 4L4VA 5IB2A 4D9LL 2VUOA 3K1KC 3ARBD 3KG5A 4OF3A 2CDGA 3W39B 1IM3A 1N26A 3NCYP 4HJGB 3RJDA 2HTLC 1SYSB 4G8FA 2VDRH 1MH5B 2X4SB 3MNZB 3PNWA 1W0VA 1CBVH 5I15H 2JJWA 2XTJE 1QLFB 4D3CL 5JOFB 3MV8A 3QEQE 3W0WA 1NUFA 4HIIA 1ND0A 3NAAH 4P5KA 1ZLWH 1PYWB 1REIA 4P3DA 3C6SA 3OG4B 3NH7L 2F58L 2MWCA 4MB3A 5DJAB 5I16A 1MFCH 4QT5A 5E70A 2NY6B 1MCEA 2IQ9L 4UT6H 3ZHKA 1NC2A 4WO4A 3MO1B 1FQ9C 3KPRD 3TH2T 4N1HB 3RNQA 43C9A 1DQTA 2G75A 3VD7A 4R4NC 2UZIL 5D4QA 5D7LE 2E7MA 5FO9A 4Y8DC 3PWJA 2PO6A 1G9MC 5GSVA 1CZ8H 2P43B 1NAKH 2LQRA 3CZJA 3DWTA 4LCYA 4I2XE 4OQTH 4Q2ZA 5EA0H 3C60B 4PV9B 3OXRA 2NYYC 5L8KB 5HHPA 1NGPL 4XBEH 1LEGB 1XF1A 5H35A 1AR2A 1TJGL 3U36B 5ISZB 3VH8G 5F9JB 3N0PB 5F7YC 4ZUWB 3BEWB 4NJ9L 1L6XA 3KLDA 1R3IL 1MHEA 3NABL 1XCTA 2QEJA 2BOBB 3MLXH 4OD1L 4M7ZC 1D5IL 2X4TB 3ZT7A 2PW2B 4K7FA 2AJVH 4ZFFB 1ZA3B 4Y7MA 2IC2A 4LIQH 4J4PA 4P48A 3N50A 3TH4T 2MCPH 4ZO9A 1FAIH 2I9LB 3BKMH 1B0WA 3JXAA 4HZLA 4HQQL 3ZHLA 3B8YA 4PRIA 5I74C 5EU5B 4GMSL 1NCBH 3LSOB 1JZ2A 1QBBA 2YD1A 3B9VA 2ZOKA 1ORQB 1J5OL 3AXLB 1PG7L 3KPSD 5K9KA 3WHE0 2AV1A 4WUKL 1MCWM 4PJFF 1RMFL 5F71A 2CK0H 3QULA 2A9NH 3CVHA 3JTTB 1KIQA 1UB5B 3GJFH 4WFFD 2R4SH 4LLVA 4QY8B 3ARDA 1RIUH 3L3KA 5I8EB 1YEGL 5FYJH 1RJZB 4M00A 1RZJL 4HWBH 1JFQL 2YSSB 5H2BB 1RUKH 5I75C 2PCPA 5EZOH 4R4BB 3MRCA 3QCTL 4DZ8B 4XMPH 3DURA 2EEAA 3FO0L 3O6FB 4OIIL 5GGVL 2E9IA 5C9JA 1HHHB 2BOCA 1Y6KR 2FEDC 3PABB 2LTQC 1IKFH 5GS2D 1EGJL 3FT4A 1NCNA 2GY7B 2FGWH 4X0KB 4M02A 1FL5B 1ORSA 4NZTL 4MA1C 2JK5B 2A9MH 5MENE 1X5KA 2R2EA 3OHXA 2A1WH 3MNVB 1CE6A 2WIIA 3V95A 2X6MA 2OI9C 1SYVB 4PJXA 4M7LL 5FECB 4NQEB 4XXDA 1Z5LA 4NBZB 4R6UA 5ID1A 4U6YA 4KK9C 1ERNA 2OK0L 4LCUA 4HPOH 2NW2B 3B8SA 1U3HC 1FZJA 5DHVA 3EZ8A 3MCLH 4C55A 3FOLB 3INUL 4NBYB 4RCAA 3HE7C 5CILH 2HAZA 2LU7A 2EDXA 3U2SB 3P11L 1ZSDB 1RUAL 3MR9B 5BJTB 4I48A 2NXYC 4A6YB 4UV7H 1MRCL 3ISWA 4UBDC 3UDWC 1WQVT 1X3DA 2J8HA 1CGSH 1GGTA 4MLIA 4JPIB 3QI9C 3QXUA 4PJ8A 5GJTL 4PJ7E 3N85H 1T89C 3BQUD 3WKML 3ZL4H 2JKXA 4OI9A 1QR1B 1JGUL 1M05A 3MLWL 4S11A 1DUZB 4YBHA 1IILE 1LO3H 3MCKA 4XXCA 1QBLL 2AXJA 2ZUYA 2ID5A 4JO3H 3MODL 3S5LG 2NY1D 3FQTB 2EDOA 4HH9A 1LK3H 1ZT4A 5IMKB 4P0DA 1K2DA 5EC2A 4P3CL 2HWZL 1R5VA 1DSFL 5KSAB 5DD5H 4XNMB 2J5LB 3R06B 2VABB 4JQVA 3SDDD 1T83A 2F54E 3DTXB 4RISH 2R0KL 4UZGA 1S5IL 2YXMA 5IBUB 2HJLA 4KHXL 5C0EA 4NNPH 4XBGB 4Z7UB 5B38B 5IR1A 3IDMA 4I0PD 4PJIF 3HFMH 1M7IA 1U8LB 4J3VA 5F72S 1QRNB 5FDWB 4B7LA 1A1OA 1A5FL 1JWSB 5KJRL 5IVOA 2XZQH 3KYOA 1Y6NR 4KRPB 4HPYL 1FVDA 1FNAA 4J6RH 4Z95L 4YHLH 4F7TA 4GG6B 5HI3C 4FFWD 1FLTX 1M6OA 2NY0B 3OB8A 5L6YL 4IRJC 1AGCB 1TFHA 4HWUA 5D7SH 5EBWB 1LEKA 5FEBA 3QO1B 1G7QA 5LGKA 1VGEL 4CBPA 4OBSA 1NAMB 1CK0H 3GHBL 3CFJB 1IC5L 1K5NB 3KPRA 4OGAD 4OLVL 1H8SA 3BZFA 4JFOB 3TVMB 5EIQA 5LG1A 5IKCA 1HQRA 1CFNA 5EORH 2LABA 3QIWA 5IJVB 3TBVA 2VLMD 4MNQD 3OKDA 3T4AB 4YLQT 5E1AA 1PY9A 4LHQB 4YPJA 2WMPA 2CLVB 2R0LL 4DEPB 4KHTH 5K9OB 3BT2L 2HFFB 4Q9RL 1F4XL 2XY2A 4UOW0 2P5WB 1W72B 4F33B 3RWHA 1EFXB 4J3WA 4NP4H 5CGYD 4G42A 3VXUD 2ICEB 3DX7B 3RA7H 2AGJL 1N6QL 3BP6B 3CVHH 3UJTH 4CMHB 3KLHD 4LHUD 4TVPE 1MI5D 4XTRC 3RWDB 5I1GH 1F4YH 5IMOA 2A77L 1BZ7A 2MKLC 2YPLB 4PJCF 1P53A 3H7BA 3QWOB 3FOMB 4PRPE 1FE8L 1F13A 3FB6A 2VDML 4HXAH 3HMXA 2ED8A 1FV1A 4DKEL 1I7ZB 3QG6B 4O02L 4POZD 3UPCA 3FL7A 4XPGH 5JUEH 4ZAKD 2QQLH 3H2WA 5I8CA 2BRRH 1WK0A 3QUYB 2FSEB 1YUHB 3D9AL 1DL7L 2WWKT 3D0VA 4YNYA 1WV7T 1QSED 2BVQB 3P4OA 3MOAH 4QYOA 1CL7L 3Q1SH 4JQIH 1IAKA 1RIVH 5SWZD 2X5PA 3KPOB 5ESQA 3TWCH 3PDGA 3MGOA 1QUNA 3CC5A 3BYTA 4R7DB 4QOKE 1NKRA 5T1KA 5JXAL 1OCWL 4R4FH 4PJAA 4YO0A 3ULSA 5DHVH 2E6JA 5J3HC 3SE3A 1UM4L 2WQRA 3F7VB 4P23C 5D1ZC 2C5DC 4J8RB 1IGIL 4XWOC 1UZ6E 2YRLA 4NWTH 4YPGA 1HK6A 5IWLA 3K2UH 1H3TA 3ARGB 3ES6A 4N5ED 4ZDHA 5KAQG 1RVFL 4Z76B 2I5YH 1X5IA 4K23H 4HK0B 1FC2D 2RFXA 1B9ZA 2NCMA 4QNPF 1HSBB 1QFWH 2WM0A 4XZUA 3P0VL 3K8KA 1S7XB 1R5IA 1DVFB 4LMQE 3TNMB 2UV3A 2D31A 4KAQH 1YMME 5IIEB 3BPLB 1NEUA 3S36X 4WW2F 2EDQA 5MP6L 4TOYL 1MCQA 4NQCB 1YNTB 5HHMD 5E9DB 4BKLB 1F90H 1YN6A 3DRTA 1VA9A 5D8JL 5EUKA 5EOCJ 1KELL 3HKFA 2VRAA 3HI1B 2PKDA 1NKOA 3IFNL 4F7MB 1XF2A 5KSBB 5F3HA 5FGCB 4U1KA 5HGHA 3G5YB 3LHPL 5BZWB 1LP9F 4JO2L 4OCSH 3L5WB 4HUXB 2JELH 5ILTL 4MZ3A 3KXFD 1AFVL 4YBLB 3X3FH 1GPOH 3MUGA 2VXVH 4KDVA 1VFUA 1C12B 5DJCA 4XP5H 2CDFB 4KU1A 1LVEA 2XIDA 4LLWB 4XVSH 1RUQL 4WNQB 2CR6A 5MERA 1A6UH 4MQTB 1LE9A 1RUML 5FYKE 2X4NB 1DTUA 3Q0HA 5DK0A 1G1YA 3SDAD 3H3PH 1S78C 2GT9B 1BD2E 4MA3A 3MXVL 3NA4A 2ICES 1JN6B 3EO0B 1BJ8A 1YEFL 4PJHE 4RAUA 5INDA 1BIIA 3TA3D 4HMEA 2NZ9D 3SDDA 2NXZD 3FFDA 4YC2B 4LCCA 2YD2A 5I17A 3CDGA 2C3VB 4YWGH 4IEFB 3QDMB 1KIPA 4U3HA 3FRUB 3P30H 3BZ4B 4GRMA 5J06A 1OP5H 1G0XA 4P46D 1NMAH 3V8CA 4X7TA 5INCB 5JTWA 4I4WB 1NFDF 3V7AG 2BNQD 4Z78A 3GI9H 5AG8A 1D7FA 1A8JH 1D5ZB 4UV4H 3WCYA 4F57H 8FABA 4DGVH 4FQQB 2VMFA 4P2OD 5DJYA 1NGXA 1GC1H 5E08L 1A4JB 1HH6A 2Q3ZA 1A3LL 3C5ZD 1RK1A 4X5XB 4CJ0A 1ONQA 3HI5H 2G2RA 5JLZB 1SMOA 4GW1A 3SE8H 4U7SA 1J0ZA 1ETZB 1K8IA 3HMXH 3IETA 3GSXB 5BS0B 3NGBB 4I77H 3PV6A 4NUGH 3LQAC 1E6OH 2H41A 2HLFD 4TN9A 2BSTB 3L5XH 5JIPA 3D39D 2P46B 4L9LA 1E28B 1MF2H 1OWWA 2UUDH 3WFDL 2ESVA 3QXVA 3FT3A 1DFBL 2HJKA 3LV3B 2IFFH 2X44D 1QFWM 4MNQA 2DRUA 1H0DA 4FS0A 3HNVL 5IGXL 1ZHKA 1AI1H 3CMOH 1C5BL 5E94B 5CSGA 1BGXL 4DUXA 2NTSP 3PGCB 3MBXL 1NBVL 4LRNL 5DFWH 1KPRA 4LHUA 2HRPH 5BRZB 4ZS6C 5C0CE 5LJYH 5L8JB 4M1GL 4NO3A 1MI5A 2XWTA 5D2LB 4M43L 5KZCD 2NLJA 4WU5B 1KTLA 1ROWA 4Y16C 1P7QD 1WC7B 1XT5A 2HG5A 1GRWA 3GSQB 3PQYB 4L8SB 1SJVA 1TDQA 2IAND 1VFBA 2F5BL 3D6GA 3NCJL 4MJIA 5IJKA 1VENA 3EDKA 5MEQA 2XNAB 2GITB 4X4XA 3WFBL 1HDMA 2VLKB 5DUBB 2HVKA 1HH9B 3T2PA 5GS2H 4X8XA 1EO7A 1RJYA 2DDQH 2FBJH 4GAJL 4YQXH 4LCIL 5GGUA 3KPSE 4JM4L 3T1WA 4OLUL 2Q7YB 2XPGB 3GBMH 1DQJA 1S9WB 4HFWA 1QSEA 5F7HA 1EK3A 5E4EC 1AD0A 4WFFE 1B4JL 5EBMB 5JXED 3GMQB 1WZ1L 4HS6B 5DYOB 1KN4L 4ODBD 2F74A 5L2KB 2XOTA 3WFHB 1FLRH 1IGFL 4K55A 4AM0A 4HGWA 1UH3A 4KRNA 5GPRA 3VXNB 4JPKH 1NFIA 2VXUH 1NBYB 3TT1H 4CN4A 4YE4L 3STZA 4HH8A 4NKOA 1QNZL 2VL5B 1AE6H 1H3PL 4Y4FD 4N0CC 3V79C 1IGYA 1I9IL 3KLAB 4IHOB 3O6LL 4D0BA 1KJ2A 4F37K 2WBJD 1XFPA 3BP5B 4BYHA 3MLTA 5GS0L 3BUYA 3FQUA 4ZSOE 3GSNL 4LNRB 3MRDA 1BLNB 5HPMB 1OGTA 4YGVB 4OF5A 5IEKA 3HNTH 3B2VH 5MHSE 5JO5B 1CGXA 4GRWH 5I9QC 4YXKH 4AEHL 3TBWA 3LEYH 3RAJL 1LGVA 3DUSB 4KJWD 1XGUA 2FECI 4GBXD 4NO5B 1A2YB 2EDDA 5C3TA 3TZVB 1XMWA 5IESL 1PAMA 1CD1B 2ZOLB 3ZSSA 4D9RD 4XC3L 4HX1A 3H9HB 5ESVB 1FFPB 4OZ4A 4C57C 1DQQA 1FO0B 4HWZB 5E5RB 4R96B 3NPZB 1VFAB 5IHUL 2FLBT 5F7MC 5IEHB 2VLLA 1F8TH 3GHEH 4UQ2A 1D5BA 1MHCA 4K3JH 4KJPD 3CFDA 4QHKJ 3IRZA 4G8EA 2JIXD 1UQSB 3OKMA 5CCKH 3RL1B 3HCVB 2XN9D 4RBPK 1OQOA 1XGPB 1K3IA 1DLFH 4YEFA 1UG9A 4OGYL 5C9KA 2ZNWA 4LKXB 5D5ME 5DRWB 2A6KA 3DARA 4C56B 4BFIA 1OHQA 3NACL 5J6GA 3BRDA 1F2QA 2J8UE 5CSZA 4GRLA 2V6HA 4PGEA 3DX6A 4RQQB 5HYJB 3FN0H 3GUTB 1HXMB 2FX7H 2C7UA 1MCRA 4ZXBC 4B5EA 1S3KL 4QRRA 4BSJA 4MWFA 3HTLX 4JN1L 4UUJA 4FQ1L 3V0VA 5DXWA 3WO3B 1G0DA 1OGAB 2MKWA 2QR0B 2V2TB 1HHKB 3KHQA 4U1MA 2EKSB 5DI8B 5E00B 4IRZL 3EFFB 1RU9H 1Q9LB 1OTUC 3TA3A 4BZ1H 4OKDA 3D85B 2JJSC 3OKOB 3N9GL 4Z7VB 2MMXA 4PJIB 2PXYA 3LS5H 3PV7A 3LN4A 4ZPTA 4G9FB 3EZJB 5I76A 2YMXH 4NHUB 1SHMA 3MNWA 2DBLH 1UCTA 2OM5A 3DLQR 2R15A 3CFBB 3T0AA 4ZOBA 1F11B 2P24A 3GSRA 5HYQA 2P49B 4Y2DA 1A14H 4LLQA 2BNQA 2H32A 5DS8A 3TYGL 5DK2A 4UMGA 4C83A 1DN0B 2FJFB 3QHZL 4OAWB 3FB5A 4JCMA 2CXKA 4JZJA 4DCQB 3NN8B 4Q6YA 1ZHNB 3R1GH 3O6KH 3G5XB 5JPNB 1J1PH 2Z31D 4X6CA 4O2FB 3SJVD 4HULB 1QPPA 1MLBA 1HKLH 4U1IA 2RBLA 1MJ8L 4AENA 2Q3AA 2R2BA 2VLME 1INDL 2F8VA 3EIFA 1I3VA 1LWRA 1N7MH 2DQFB 5T1DH 2AKRA 1S7WB 4Y4KC 4OFYD 1A9BA 4FP8L 4HMCA 1XIWD 4YR6B 5IBUG 5C0DA 3VXUE 3HUJF 3QFJE 5B38G 4L1DA 2ICWA 5JIHA 3HI6L 3DETC 3T0EB 1ZWIA 1JRHH 1MI5E 2PTVA 4PJ7F 4TYUA 4X4MA 3CDFA 4N9OB 3QQ4B 3VXQB 1ZHLA 5DLMH 4WHYG 2Y4SA 4X4YB 1J88A 2NY5H 3LIZL 5AD0A 1VKXA 1XR9A 1C7SA 5E6YA 2NNAA 3HN3A 4GXUN 2XRAL 3WNMA 3HAEB 1NL0H 2MJWA 4ESKA 3HC0B 3V9FA 4PR5B 1ES0B 1MELA 4S1DC 5J57B 1IC4H 3OAYH 1MRDL 1OAZL 1IE5A 1WCBA 3OKLB 1BQHA 2IANA 3U1SL 5GRJL 4GS7B 4ODXB 5MEPA 3LZFH 3MACL 3C5JB 3HG1A 5CAYB 3BYYA 5IBTH 5TQ2H 3T8XB 5SWZE 1ZANH 3FFCD 4WWKD 3FT2A 1CU4H 2XYCA 1A21A 3LH2H 4UDUA 3S96A 4DVRL 4OGXL 4OSUH 4XMLL 4Z0XB 4LARL 5E4IA 4LF3A 3VXME 1WBXA 3B3IA 2V2XA 5GGRY 3BJLA 4PRDB 4LLMB 4S2SB 5IQ7L 2KL6A 2NY6C 2GTWA 4WUUB 1SEBB 1DEEB 4P5MA 3E2HB 4V1DE 3VDAA 1V7NL 2PTTA 1ZS8A 4UILL 2BVPA 1VFMA 2BY0A 2VITB 4CVXB 4MD5A 4F80A 4IIQA 3LKNB 1RHFA 5HGAA 5IM7B 5AUMA 1G7LA 1GAFL 2WBJA 3L1OL 4RWYH 5FKAA 2DQCL 4LCWB 1SY6L 1BVZA 1FYTD 3D69B 1UB6B 1C1EL 1F3JB 2ARJQ 3DXAA 3U0WH 2Y1VA 4PIRF 1VFOA 1BJMA 3VXSE 3VFUB 1LHZA 3NCBB 2X70B 5HHME 5B39G 1JTTA 4QF1A 4Z0BL 3V5KB 1ZE3C 1CDHA 2ZJSL 3U6RB 3I2CH 3X14A 3RZWA 1WJ3A 3IXAA 4HS3B 3MRQB 4QHMA 2JIXA 2I60H 1LP9B 3BH8B 4LSTL 4JM2D 3PG2A 2EXYC 5DR5H 4Z7WA 3QG7L 4XNUH 3EOAB 3KXFE 5I1JL 4K2UL 5D7JD 3MBEB 4ELMA 3OR7A 2GK0B 3DRQB 3WJLC 2ZWLT 5TPWH 2GAZB 2H32H 1CDJA 1F45A 3A6BH 3LKRB 4KK6C 3SY0A 3EHBC 4BZYA 3WHXA 4NFCA 1L7IL 1ED3A 3ILQD 3MMEA 3MREA 1JF6A 4TPRH 5D2NE 4KZEH 3HC3H 1N5YL 3NFSL 4L8DA 1FGNL 3KPPB 3MRRB 1UACL 5DVMA 2Y6SC 3RWCA 2PW1A 4I3SH 5ABDE 1CT8A 2WUCL 1HHGB 1I8IA 3L3GB 3MRHA 1WICA 3VXRB 3K4ZA 2QQKL 5K9JL 3F58H 3WNOA 4PJGE 3O6FC 4B0MM 2O61B 2BNRB 1G9NC 1TVHA 1NGWA 3QQ9D 2DIBA 4D0DB 4UI2A 5KS9E 1FL3B 3NIGF 4YDIH 2AQ3A 3THML 2R1XA 4QRPD 1UZ6F 1YPZA 3QNXB 4ODHL 3U9UB 4P4KD 2Q76A 2YA1A 2P42B 5LWYL 3HS0A 4Q6IA 1HNGA 1IAII 1NLBH 4W6WB 4QTHA 1EAPA 4PJXF 1AKJB 3O9WB 3ROOB 5DJ6B 2FJGB 3ME0A 1MCOL 4O4YL 2CXGA 4ODVH 4K7PL 4LASH 5EU6D 2YK1H 2Z31A 2AJSH 4OZHE 1E0OB 3D39E 1I7TB 3D2UD 4G8IB 3FCTA 1JPGA 1V3KA 1MHPH 4TTDC 4XC1L 1E4XH 5CLWA 5KVMC 3AMLA 3L3JB 1LO5A 3Q6GH 3PIQB 4YHNA 1QFHA 1TVBB 2UYLB 1XR8B 1K4DB 4NFBA 5AAWA 3TM6A 4OFYA 1RFDL 1XIWA 4R97B 1T1ZB 3QIUB 1EEQA 1H3WM 2ZPKL 1P7KB 1AD9A 2R56L 4MSWB 5LQBH 4YXHL 2YEZB 3W9DB 2AJUH 5AAMA 4IOIB 5KN5A 1WBYA 4N0YH 3VRJB 1JBJA 2BHYA 2E7LC 1U8JB 4HUMB 2HT3C 3QXAB 2DYPB 1Y6MR 3DO7A 3SE4C 5FHAL 2O26U 5KSAC 4J3TA 1HOCA 2VL4A 4ETQA 5TE7L 2QLVB 5F70A 4PJ5E 3RI5F 3EJYC 1JPSL 1U8QA 2ATPB 2GIYA 5AWNL 5I0DA 5I18H 3MOBH 4M7JH 5C08B 4DKFL 5KVFH 4CU8A 2XA8L 3D0LA 3CLFH 3IDGB 4WTXA 2OYPA 4Y5XA 3ECBA 4U1LA 2HFEA 1GGIL 4OZGA 4AIZA 4FZEL 5EPMA 1UJ3B 4CW1A 3GJFK 1A3RH 1FFOA 5BVJB 4S1RH 5L0QB 4RNRB 1LE5B 3UO1H 2EH8H 2IALB 3NVQA 5FGSA 2CJUH 1MY5A 3FFCA 4RZCA 3ULVC 1ZA6A 5CZVH 5B8CB 5DEFA 1MFBH 3LN9A 3WEXA 3N1MC 3ULUD 2NTFB 4JVPA 4JREB 3BOVA 5GZOC 3S35L 2NY0C 3UTTA 2O5XH 2X7LB 5KOMC 1KEMH 1WEJL 4HKXB 5EB9A 4DAGL 5DVKA 2HH0L 2EC9U 5D1XD 2AI0H 2X1QA 2AW2A 1FC1A 3AY4A 1A7RL 3P9LA 4PLKC 1RPQA 1KENH 2W91A 3MRKA 3UC0H 3TVMC 1G6RB 1UWGL 1EHXA 2XQYK 3HE6B 2FR4B 4HJJH 3MA9L 3VJ6A 4TULH 2YXFA 3LN5A 2E8YA 4DEPC 1B6DA 4D9QD 1OPGL 1MIEL 4G8GD 1EGJA 4LSDA 5E56A 1I9EA 5JW4N 4ALAL 5IROA 4K3GA 2FZ3A 4ZO6A 5LGJA 3NCYS 4WW1A 1YYMH 3DO3A 3G6DL 5GJSH 1A7BA 2JLLA 3MOQA 2Z93B 3O8XB 4CMHC 4D9RE 2BVOB 3U30B 1MIMH 3LD8C 1ZTXL 4JJ5B 4B53A 1R3LA 1BVLB 2DQTL 2VZ3A 4ONFL 4OZFA 3RY6C 1TTFA 2NY4D 3C5SB 5AZ2L 3MRFB 3QDHA 2V5SA 5CZKA 2WWKO 4OD3H 4TNVF 3DX9B 1QR4A 2K1MA 4QO1A 1MVUB 4QRUB 4JFXB 3RPIA 1KEGL 2XN9E 3PHQB 1IBGL 3A67L 3WL9A 3NZ8B 1BREA 4D9LH 1WUNT 5KVEL 3QUYC 1HQ4A 4IRSA 3CXHJ 5GXBB 5CHNB 4TNWK 1X5FA 4K9EL 2AV7A 3SN6N 1SJHA 3IFLL 5FGRA 3L3IA 3MLYL 5EUOB 4KRMB 3BN3B 4IS6A 4MJ6B 4MNGE 4D3CH 1AIFB 3VGBA 4PG2C 4L4TD 4FTVD 5E8EA 3D18B 3PDOB 3Q3GB 3PWPE 3NH7H 4CN6A 2C1PA 2F58H 2EDKA 4QCIB 4TUJB 1B0GA 2OR7A 4PJAF 2IQ9H 1JF1A 5BXFA 1J8KA 2MHAA 2CKNA 3IRPX 1S5HA 1PQZB 4X99A 2UZIH 1ZGLM 4NZRL 5DQDL 1X4YA 3X17A 1KCLA 4KZDL 3ARGC 4QRSA 3ZKQD 3ARFC 4H5SB 3RKPA 1TZHB 1Q9WA 1CD8A 3FTGB 4L3AA 1JK8A 2A83A 2NY2B 1PSKL 5E8OB 3EYVA 4QRPA 3SCMB 3WXVL 5DQJB 3QA3B 3OJDA 2IQAB 4HHAB 4AMKL 3LQZA 1TJGH 3IVKB 1DVFC 3ZE1F 2LFGA 4NJ9H 4O2EA 3BPLC 2ZUTA 4X5LA 1KXVC 1T0MA 4XVUD 3EGSB 1V8HA 3GJFB 1Z9MA 5CBEA 2YC1B 3NABH 1DANT 4LSPL 5SV4A 5EBLA 1EEZB 5LAXB 3SJVE 4AEIL 1D5IH 1KUMA 1GZPA 5JW3L 1U3ZA 5HHOD 3L95B 4C59B 4EN3A 1E27B 1MOEA 3AU1B 1CICB 1FNHA 3D2UA 1KLFA 1AGFA 4HCRL 2X4UA 3HUJB 4XPBL 4HQQH 1FFRA 4YBLC 4KQ3L 1VHPA 3HZVA 4GMSH 1OD7A 3AS1A 3L9RA 4Q58C 4ODUB 5IMMB 2LAGB 5SWQA 5T1LB 1RJLA 2D7OA 1J5OH 4OFVA 3TO2B 1PG7H 3KDMB 3DX8A 4WUKH 1FN4A 5D5MF 3ZE0E 1RMFH 3D3VB 4JANA 4PJDB 4HKZB 5HD8D 5F6HJ 5D7IB 3WD5L 1JL8A 1NC4B 3Q6FB 2YD7A 1IAOA 2NX5B 4BUGA 1YEGH 4APQD 1MAKA 1CQYA 1QQDB 1RZJH 3O11A 1JFQH 1CGTA 5DO2D 1TZIB 3C09C 5C92A 2EDBA 3VI3F 1FFQA 2PYEB 3QCTH 4L4VB 5IB2B 3FO0H 4OIIH 5GGVH 1QYGL 1YN7A 2W59A 4N8VA 4MJ5A 1MCKA 2P45B 2DS4A 2CDGB 1EGJH 1IM3B 4UINL 2IAMD 5EH1A 3PP3H 4DW2L 5FOJA 4G8FB 3FFCE 4Y1AD 4NZTH 3HLAA 1CXIA 3PNWB 1W0VB 4LSQL 1DR9A 1AGEA 1M7DA 3QUKA 4F7CA 3MV8B 5B4MC 3U4AA 1XGRA 3V6ZA 3W0WB 4M7LH 3IF1A 1ZK9A 4HDIA 4HIIB 1LD9A 1ND0B 4DVBA 4OZFH 4P3DB 3C6SB 4N90E 4WI5A 3BZEA 5I16B 5CJXA 4QT5B 2OK0H 2IADA 4X5WA 4KWUA 1NC2B 4ISVA 4WO4B 4AL8H 1U8MB 3INUH 3NGBC 3RNQB 43C9B 2G75B 3SOBL 5K59E 1A6TA 3EFDL 4NC0B 3T3ME 3PGDA 1RUAH 3PWJB 2PO6B 1QA9A 5GSVB 4RA3A 2WIMA 3T4YA 1R24A 1IC1A 5JZ7C 3HAEG 4EI5D 3MFGB 3KYAA 4LCYB 1NMCB 1Z0NA 1MRCH 1O0VA 4Q2ZB 5GS0D 1RZKC 3GB7B 4QRQA 4WCYL 5I1AA 5IVXE 1FYTE 3EDEA 1OF2A 4Y4HA 3OXRB 5GJTH 3WKMH 4PLNC 4FOMA 2H2PD 1JGUH 3MLWH 4MA7L 4U1SA 4WI9A 3UTSD 5HHPB 1R5WA 1QBLH 5H35B 1S8DA 2CIKA 3MV7D 1EZVY 3MODH 5I1DA 2DF3A 1MHEB 3QIBD 1XCTB 2WUBL 5A3IC 4DKDC 4P3CH 2HWZH 4JPVL 1DSFH 1LEIA 4MVBD 4K7FB 3FAWA 3OAUL 4NC1E 2J1KA 4KKBC 1I1CA 2VDOL 4L8SC 3DYMA 2D9QB 5DD1L 2R0KH 1E4JA 1S5IH 1RI8A 5FM8A 2EO1A 2VLRD 1MEXL 4KHXH 3UJJL 5FF6A 4HZLB 3KYKL 3CMGA 2QADB 1KV3A 4PRIB 2MSPA 5GZNC 4KKAC 4K8RL 1Z0MA 5DA0B 5FA4A 2YN5A 2ZOKB 3IDIA 5KJRH 1A5FH 1CCZA 2M1KA 5K9KB 2IMMA 4OUOA 2AV1B 1TLKA 4N1CA 3QULB 2YRZA 3CVHB 4Z95H 3NPSB 1KIQB 5HDBE 5C1MB 4L4TA 4OF8A 3IDNA 1BFSA 2V7HA 2ITDA 2AERT 4LLVB 5DMGC 3ARDB 3L3KB 5L6YH 2EO9A 3BUTA 3F6IA 2IH3A 1VGEH 3L3DA 2A73A 5L7XL 3E0GA 3VXPA 5KSVA 3EOTL 2EH7L 3GHBH 1OP5K 3BKJL 4N68A 1JGLL 4W4OA 2PCPB 3MRNA 3MRCB 3LS4L 1JMXA 4OLVH 3DURB 5C9JB 3CXDL 3TBYA 4NQSA 5DMIH 2EIZA 2C3HA 3FT4B 4IM8A 5I1LA 5GGSA 2R0LH 1ORSB 5GISL 3BT2H 4Q9RH 2Q8BL 1F4XH 1CLYL 3P9WB 2R2EB 3OHXB 1B0RA 4W68A 5F7EL 1CE6B 5GRUL 2WIIB 2AGJH 1N6QH 3RGVD 1TQBB 4POYA 4NM4L 4PJXB 3TZVC 3D1MC 4XXDB 1Z5LB 1PG7X 1L0QA 1QBMH 5ID1B 4U6YB 2A77H 2IBBA 4LCUB 4ZYKA 4NHCL 2WNGA 4HUUB 5EU6E 1FZJB 5DHVB 3X11A 1JZ4A 2GCYA 2ATKA 3BGAA 3TIDA 5E8NA 3NTCL 1FE8H 2ADIA 2VDMH 1S7QA 4DKEH 4O02H 4I48B 5DFVC 1QSFD 3I3BA 2VDLL 2OXGA 3X12B 1DQLL 4MJ2A 3BH9A 3IDYB 1RULL 4PY7A 4PJ8B 1YEKL 3D9AH 1QO3B 1DL7H 5F6IB 5FAAA 2A6IA 1M05B 1RZ7L 4N0UA 2VXQL 4EI6A 3MCKB 1CL7H 4JG0L 3B5TA 3SKOA 2E7HA 3V7MA 4HH9B 1DN2A 4Q9CA 1ZT4B 2EICA 4DN3L 4I13B 3VW3L 3TO4A 1K2DB 1OCWH 4HJ0C 4KV5F 5EC2B 5JXAH 1HI6A 1OWRM 1R5VB 2BSRA 4WJ5B 3L3HA 3ILPA 4K94L 3VD9A 2VQ1A 3FZUC 1MAJA 1A0QL 1FAKT 1KXQE 1UM4H 2K3TA 1WIOA 3PWLA 1JVKA 5JW4Q 1I8LC 1IGIH 4FRWA 4JKPL 4WIQA 2NY3D 5C0EB 1KCSL 4MS8C 1KFAL 3G6JA 5IR1B 3QBTB 3DVNA 3IDMB 4BSVA 2OJEA 1M7IB 5DC4B 3S3SA 1F2XK 1RVFH 4JG1L 4LRIA 1J8HA 4LQ1A 4HKJA 4PJGF 1A1OB 5C07A 1A22B 2FO1A 2X1OA 3KYOB 5ANME 4L4JA 1FVDB 5EBGA 3ULUE 5BV7L 3P0VH 1EXUA 3I9GL 4OB5L 1IGCL 3CLEL 4F7TB 4KK9D 1YC8A 1N5AA 1TTUA 4ZUTA 3TGXA 3QWRA 3P0GB 3W9EA 3ZDYE 4U6TA 1LEKB 1G7QB 5MP6H 4TOYH 2NXYD 5D8JH 3KR3L 1KELH 3RWEA 3KPRB 3QPQD 4X6CF 1H8OA 3BZFB 3IFNH 1FRGL 5IKCB 4P2QB 1HQRB 4M6NL 1CFNB 2JTDA 3QIWB 4K07A 3LHPH 3TBVB 3OKDB 4D9QE 5E1AB 4G8GE 4JO2H 4EI5A 5ILTH 4OZHF 1ULVA 3FHAA 1AFVH 3GSNA 4ZFZA 3BPNB 4XB7A 4TRPL 5C09D 2C9AA 2DM2A 1MCWW 1EPFA 3RWHB 4X6FA 1P2CA 3FO9A 4HUNB 3UTSA 3T0EC 1MJUL 2MQ3A 1RUQH 2Y9RT 3ARTA 3OR6A 4ORGA 1XF4A 5DUPL 3RIFF 1TMCB 3MV7A 1RUMH 1T2QL 4TSBL 3UAJD 3OF6D 5IMOB 4OGZA 1WWBX 1BZ7B 4H8WL 4LSRL 3O4OB 1E4KA 2FL5A 3L5JA 1CS6A 3H7BB 3MJ7A 4X7EC 4KI5D 3MXVH 3DECA 1LNUA 3FB6B 1YEFH 4Y0GA 3MV9D 1EJOL 2NQCA 1AO7D 1FV1B 1F97A 1DLHB 2XWBB 1YQVL 1OAUL 2D3VA 3DROA 5I8CB 1NMBL 3O2WL 4GS7C 1YY8A 3EJZC 5EU7E 2VLRA 2C4FT 5A2LH 3H3KA 3MGAA 4XH2A 1AP2A 5HDLA 3OMZA 3EYOA 1YNLL 5JA9A 3D0VB 2H6PA 2IJ0C 3P4OB 4L9DA 4QYOB 1IAKB 1CLOL 4FTVE 1EX0A 5HI3D 1HZHL 1G9EA 5ESQB 2EDFA 1JNLL 3ZSTA 3GMLA 4F9PA 4IRJD 3MGOB 3CC5B 2H8PA 4HKBA 5E08H 4LKCA 5T1KB 4PJAB 1A3LH 4YO0B 3ULSB 1V7ML 3CSGA 4L8CA 4TSCL 5D6DC 5FM5M 2X4OA 2CLRA 3E2HC 4NQDA 2GSGA 3FAXA 32C2A 4OD2A 1IM9D 3EKCA 4YPGB 1KLGA 4ODSL 1UCBL 3RPKA 3HZKA 3J8F7 1I1YA 5F7NC 3WFDH 1DFBH 4NNXA 1WF5A 4ZDHB 4BFBD 4OF6A 2C3XA 2VKWA 3HNVH 3K8MA 4XMKL 5IGXH 4N0RA 2RFXB 1C5BH 3RZCA 4XZUB 1BGXH 4QTIL 1D9KA 1R5IB 3RGVA 4MAYB 1TJIL 3NFNA 2D31B 1NBVH 4LRNH 3KPTA 4U31A 3KGRA 4RDQF 3EYUL 3LKSA 2JB5L 3U82B 4X80L 4LLDA 4N9GA 3T77A 1P84K 4M1GH 4M43H 1R3HA 4PRAA 5HHOE 5E5UB 4JGUA 3DRTB 1YN6B 2GFBA 5EUKB 2Z35A 4GKZA 5HXMA 4I5BA 1I1FA 1XF2B 3MSPA 5F3HB 5D71L 2X9WA 5ENWA 2F5BH 5HGHB 2P8LA 3NCJH 4DTGL 3WFBH 3MBEC 4Z7WF 4EQ3A 1I4FA 1J10A 3JWDC 4GAJH 5ERWA 4ELMF 4LCIH 3S36L 4KMQA 5DJCB 2OJZL 4GRWB 4JM4H 5TDOA 3F12A 4U7MA 4OLUH 2AABL 5FIEA 5MERB 1LE9B 3GM8A 1B4JH 1PKQE 1AC0A 2NY1B 4PD4K 5SWSA 5J3HD 1KIRA 1C16A 5DK0B 1S9XA 3T1FA 1KN4H 2UWEE 4P23D 3GBNL 5D1ZD 5DUML 1IGFH 5JDJA 4MA3B 1G7MA 3JV5A 2GEEA 4ETYA 1T22A 4RAUB 4XWOD 4M62L 5INDB 1BIIB 4JFFA 4QXGL 4YE4H 3SDDB 1CF8L 3CU7A 1QNZH 4FA8A 3FFDB 3QEHA 4LCCB 3VXTA 1H3PH 3CDGB 5I17B 5DVNA 1KIPB 3O6LH 4DGYL 5GS0H 3GSNH 4CU6A 4Y1AE 4F2MA 4X7TB 5T3ZD 5CS7A 2DI8A 5CIPA 3VDCA 3AM8A 4HV8A 4Z78B 4AEHH 8FABB 4YJZL 3RAJH 1YPZF 4WTWA 5DJYB 5C0FA 1NGXB 2B2XL 1AJ7L 1Q9OA 1J12A 3O3UN 4TVPL 3STLA 1A7NL 5IESH 1HH6B 3O9WC 1RK1B 4XC3H 2XQYG 2G2RB 4GW1B 2QSCL 3KYMA 1K8IB 5IHUH 2EDRA 4Z9KB 4PJEE 3VWKA 3IETB 2YKLL 2VISA 2A6DA 4JE4B 5F8QC 3CGTA 3RUGE 3IAQA 3UDWA 3QEGL 4L9LB 1S9VA 1U41A 5C6TL 3GMMA 4QHUB 1NGZA 2ESVB 1FL6A 1SQ2N 3FT3B 1BECA 2HJKB 5C7XL 4OGYH 7CGTA 3QH3A 2DLFL 4MNQB 1H0DB 3UTSE 3DVFA 1ZHKB 4R97C 2VQTA 3QIUC 3NACH 4HUWA 3I75A 1B88A 3WIFA 4HBCL 1QFWI 1XZ0A 3O6ML 1KPRB 4LHUB 4P4RA 2WLYA 4X7DC 1S3KH 4NO3B 2XWTB 1JZ5A 2NLJB 3LY6A 4JN1H 1KTLB 4FQ1H 2HG5B 2OQJA 2B4CL 1DDHA 5GRYA 5JORA 2D7QA 5IQ9A 2P5ED 4IRZH 4NZJA 1VFBB 2XY1A 5I73B 4MJIB 1MVFA 1X4ZA 1KNOA 1IJ9A 4LLYB 3N9GH 5MEQB 4X4XB 2XXCB 1HDMB 2DIAA 3BVNA 2HVKB 5DURD 1RJYB 3PHOA 3WUWA 4OCXL 4PRHA 4WFGE 5GGUB 4G3YL 2KBGA 3HMWL 1UJ3C 1CIDA 2G60L 4U2ZA 5L0QC 1DQJB 3C2SA 4HFWB 4JPWL 1QSEB 1H3GA 1AD0B 3TYGH 2EIDA 5B8CC 2JCCE 3K74B 3QHZH 5HYSA 2VSCA 3F5WA 5JQHC 2F74B 4NDMA 4AM0B 4HGWB 1IQDA 1NFIB 4KDWA 3WV0A 4E41E 2MTPA 3STZB 5GIRA 4MXVF 4NKOB 3KYNA 4KK5C 1MFEL 2AEQL 1IGYB 1MJ8H 3DIFA 4D0BB 3I6GA 1KJ2B 5IVZA 1INDH 2XZCH 4NGHL 3IS0X 3MLTB 2DKSA 5D6CA 3HE6C 4WRLA 3FQUB 5GRXG 2WLZA 3IYLW 3MRDB 1WT5C 1GGBL 4FP8H 5K59F 5IEKB 3T3MF 3EO9L 5JHDA 1W2KT 5ALBL 3ARYA 2FATL 4OCYL 3HI6H 3F62A 3JV0A 1VEPA 4ZS6D 3O8XC 5FYKL 4Y5YA 3U30C 1JZ7A 4QEGA 5TE6L 1WFUA 4Y16D 4HX1B 3T0DA 1KB5A 4OZ4B 1DQQB 5FK9A 4NCDA 3LIZH 1BFTA 3ZKMC 4YHML 4I8DA 5FUCC 1J87A 2VLLB 4UQ2B 1D5BB 2XRAH 3L7FA 1MHCB 3FQNA 4RAVA 4G8EB 3WE6A 3FO1A 1QSFE 3OKMB 2E9JA 1MRDH 1OAZH 5C0AE 3WS3A 2EEBA 3P4LA 3U1SH 5I8OL 1LO0L 1P4IL 4JQXA 3CH1A 3V6FA 5GRJH 3WKNA 2OR8A 4HC1L 4RGNB 2A6KB 3SKNA 2FD6L 3MACH 4JM2F 1YJDL 4PJFA 2BVYA 5CIPH 4YDJA 4NIKB 3VH8A 43CAA 4BFIB 2D7PA 3EYQD 3T2NL 3GRWL 1U8HA 5J6GB 4KDTA 5CSZB 4GRLB 1JV5A 3DX6B 2A6JA 4JVWA 4AH2A 4U33A 4GT7A 4ZNCD 4DVRH 4OGXH 4XMLH 4LARH 4QRRB 4MWFB 4P59L 4ZG1A 4UUJB 3V0VB 5C0GA 5IQ7H 4XRCA 4EXPX 2DQDL 3JTSA 4U1MB 5HDBF 1LDPL 1T4KA 1II4E 1V7NH 4PBVC 3HR6A 2Y36L 3UBXI 1GVIA 4XNZB 3TA3B 4JFDD 4UILH 1SBBA 5IB1A 3CUPA 4ZOEA 4J1UA 2NXZB 2PXYB 4ZPTB 3JV6A 4MQXC 5DVLA 1DQDL 1QOKA 2VLJD 5I76B 1F3DJ 1GAFH 2QQNL 3L1OH 3MNWB 3ZMRA 3L7EA 1PEWA 2EYTA 2DQCH 5F1KC 4JY5L 1SY6H 2NY2C 2P24B 3GSRB 5HYQB 3SCMC 2KPNA 4Y2DB 3H9SD 1C1EH 2VC2L 4LLQB 2BNQB 2H32B 5DS8B 5DK2B 3RKDC 1JTPA 4C83B 4WWID 1UA6L 3FB5B 15C8L 4X6DA 4OCLC 4JZJB 1I3RA 3RX7A 3O2DL 4Z0BH 1CN4A 2EDLA 4GKNA 4X6CB 4Z77A 2ZJSH 2R8SL 5DA4A 2X40A 2W65A 3VG0L 1MLBB 2L0DA 1L6ZA 4H20L 4U1IB 1N6UA 4GSDL 1CICC 4AENB 2R2BB 4LSTH 2ZUSA 5E99L 1CE1L 3QG7H 4MD4B 2CKBL 4CJ1A 5I1JH 5CUSL 5JMRA 2AKRB 4K2UH 1MCFA 1A9BB 2EDYA 2H1PL 5C09E 4P2RD 4P5TA 5C0DB 2HT2C 4JFPA 5CKAA 2CQVA 1QHOA 2ICWB 3AVEA 1ZWIB 3MCG1 4ZXBD 2E9WA 1KGCD 1FNLA 1L7IH 2AP2A 4NZDA 3AS2A 2ZG3A 1K8DA 3BDBA 3SBWA 1K9TA 4EQ2A 1INEL 1N5YH 3NFSH 5AD0B 3W5NA 1VKXB 1FGNH 1XR9B 2NNAB 3GMNA 2W9LA 2ZCLL 3MV9E 1B4RA 1OTUD 3WHE1 1AO7E 4DWHA 4EBQL 5DTFA 5IFAL 2WUCH 5C2BL 3RL2A 3WSQL 3CK0L 2W92A 4FQ2L 5K9JH 2QQKH 1WCBB 2P5EA 1BQHB 2HYMA 2IANB 4NO0D 4NPYA 4JRYD 2EE3A 5MEPB 1KB9K 3K4DA 1U36A 3S34L 3S5LA 3ZDXF 3HG1B 2HKFL 1H3XA 4PJBE 3THMH 4K8RD 1T66C 4OTXL 2DN7A 3DMMA 4ODHH 3GMPA 5C0BD 5DSCA 3FT2B 1DE4A 3FHQA 5DJ2A 5LWYH 5D1QD 4UDUB 1NANH 3S96B 2GJ6A 1WBXB 3B3IB 1ZVYA 2V2XB 3RWJA 3HZMA 3ULUF 1GYAA 2GTWB 1MCOH 4O4YH 1HCFX 4K7PH 4P5MB 12E8L 1ZLUK 2PTTB 3I3DA 4BQBA 1ZS8B 4QXUL 3CFEA 3C8HA 4I3GA 5FA3A 2BVPB 2PO6C 4XC1H 4IIQB 5HGAB 3SGJA 4NCC1 1NMCC 4GLRH 4FFZL 1G7LB 4KKCC 2WBJB 5C0RL 5E8DL 5FKAB 5HHQA 3DETD 1ZGLB 1RFDH 1X44A 2C3GA 4LSUL 1ZEAL 1AXSA 1GH7A 4HIXL 3QQ3A 3G5VA 1TIUA 3DXAB 1WZMA 2ZPKH 1CXLA 2R56H 3ARZA 3QFDA 4B7IA 4YXHH 2R69L 4JKWA 1BBJA 4YFDB 2M2DA 1P5UA 4X4ZA 2W0PA 5DZOA 4AQOA 3IAPA 3JUZA 4QF1B 4Y16A 4M48L 5FHAH 1QKZL 2GYSA 4RAHA 3X14B 3RHWK 2VYRE 5KANI 4J4PC 4L1HA 5TE7H 3IXAB 4QHMB 2SEBA 1JPSH 5AWNH 5L8LB 4Z7WB 5CMAA 3UBXG 1L9MA 3RU8L 4DKFH 2XZZA 2XA8H 2V2WA 4HCRA 4ELMB 2QADC 3OR7B 2Z4QA 2AXFA 1GGIH 1KYOJ 1JHLL 1P9MA 3DOSA 4JR9L 4FZEH 1WITA 3QUZB 4ORZC 4ELKA 3I84A 5J4MA 2WV3A 5FV1L 2XTJD 4UT9L 2HT4C 4KC3B 3SY0B 1A6AA 1XGTA 4AEEA 3WHXB 1PD6A 1ED3B 3LRSA 3QEQD 3NPSC 1NEZG 5K9QI 3MMEB 2NY6D 1JRHI 3S35H 4L8DB 1BJ1J 1C08A 3ARDC 4YX2L 1G7HA 4PY8I 3RWCB 2RGSA 2PW1B 1HIML 4DAGH 1PZ5A 3MRLA 2M8XA 4M3JA 3U83A 1IRAY 2HH0H 1A7RH 4KH2A 1I8IB 3MRHB 4R7NA 5D7LD 2KQMA 3PP3K 1PZUB 3P4MA 1DQML 4JFDA 1TVHB 4MCYA 1UWGH 1XGQA 2XG4A 1NGWB 3MA9H 5T3ZE 4BUHA 2JJTC 1OTTC 4LPTA 5M7QA 2R1XB 1OPGH 4WI4A 1MIEH 1ACZA 3M8OL 1YPZB 4K71B 5ISZD 2Q76B 1NCCL 4ALAH 3M1BA 3TBTA 1TQBC 5DD6A 3H9SA 4WW2A 2H2SC 4TVSa 1RURL 4UQ3A 3G6DH 5T1MA 4Q6IB 2CUMA 4OV6F 1HSAA 3GSVA 5HHVL 4QTHB 1EAPB 1ZTXH 1QEWA 3T08A 4RMWA 2DQTH 1ZVSA 4KPHL 4KVNL 4ONFH 3VFNA 5AZ2H 3PJSA 2Z91A 4KMTL 2ED7A 2Z31B 3MRMA 4LLAA 1KEGH 3FCTB 1JPGB 1QACA 3MZTA 1IBGH 3DV6A 3A67H 1YDPA 1LO5B 4QHLA 1FYHB 1HNFA 4YHNB 5KVEH 3UROR 4BM7A 3T0BA 4C4KO 3IDYC 4PJ8C 4BSWA 4KK6D 1XIWB 5F6IC 4WGVB 4K9EH 5HGDA 3BAEL 3EHBD 4KROB 3IFLH 2BNUA 1AD9B 4XXCC 3MLSL 1CGVA 3MLYH 5TDNA 1I8KA 5KN5B 1WBYB 2Y6SD 3JVGA 5F7DA 3DO7B 1KF9B 1HOCB 4JQVC 1T83C 3BIKA 1KJ2L 3O6FD 4ETQB 3UTQA 2D03L 1WISA 5KBNC 2BSED 1U8QB 4M9OA 2UWEF 3MJ8A 2W0LA 4NZRH 5DQDH 4Q9QL 4JHWL 4H88L 4Q97A 4K7PX 4UTAL 1NFDA 1IAIM 3D0LB 4NO0A 3NIDF 4Y5XB 4KZDH 3ECBB 3MGTA 4U1LB 2HFEB 2WP3O 4S1SL 3SO5A 4OZGB 4AIZB 5EPMB 4CW1B 4MGXA 4GW5A 1PSKH 3EYSL 1MCJA 1J0IA 3VRIA 3WXVH 2DWEA 4P2CG 4RZCB 1ZA6B 5DEFB 4AMKH 3WEXB 1MWAL 5C0BA 3WNNA 1TETL 4JZNA 5D1QA 4EDWL 1EA9C 4M61A 3UTTB 4E42A 4NSKA 4ZTPL 4QKXB 3ARVA 4LSPH 4TTDD 4AEIH 4LHUG 3O3EA 4OBRA 5JW3H 4PGDA 5DZLA 3P9LB 1I3GL 4PUBL 4X7FC 2GHWB 3MRKB 5E5MA 3OKKA 3X13A 4BK4A 4PJ9D 1MCCA 1P84J 5KANG 3QIWC 4HCRH 3S37X 3N06B 5I1CL 4Z8FL 3VJ6B 1T0NA 4NNYA 4HMDA 3LN5B 1UVQA 4XPBH 4PP2A 1A64A 2X09A 4KQ3H 3RUGF 4LVEA 4RIRA 4Y19E 2FO4A 3SDXE 2EZ0C 2FZ3B 5LGJB 4WW1B 4YEEA 2ICWI 4KUZL 4KJQC 2HT3D 3O4LE 2F8XC 3QYCA 1GC1C 5KSAD 3B4NA 3VXOA 3RFZC 4NN7B 3WD5H 1R3LB 4OZFB 1FZOA 1XEDA 3O4OC 5K9QG 3JUYA 1UKSA 3G5ZA 3EJYD 4MNHB 2F54D 3RPIB 4JRXA 3S35X 3ABZA 3SPVA 4JFQA 3ARXA 2I24N 3FONA 4PTTA 4PLJD 3AB0B 3WL9B 3ROLA 1QYGH 2APTA 3W39A 1QRND 4PG9A 1HQ4B 1EDQA 4IRSB 1E4XI 1SYSA 3RVTC 3WFEL 4UINH 4DW2H 5F21B 2AV7B 3OX8A 1SJHB 3ULVD 5DEZA 3VU2A 2Y23A 1Z3GL 3L3IB 4ZPVA 4LSQH 3RP1A 4IS6B 1DBAL 4OIBA 2NY0D 4R9HA 4U1NB 5F1IA 5E8EB 5DD3L 5B3NA 3QEQA 5F1OB 1SBSL 4J23A 2C1PB 2UY6A 1B0GB 4PLKD 5H94A 3SE3C 2XICA 5BXFB 2MHAB 3OKYA 3TVMD 1UFUA 2JCCF 1S5HB 2FB4L 2WWMC 4YFLF 3WDJA 3SOBH 4X99B 3QRGL 2F15A 3EFDH 1CR9L 2Z9TA 5JW4R 2VLJE 5D7LA 5IWLC 4GJTB 2HKHL 5FO8A 2LE9A 5B22A 4D2NA 4QRSB 4V2CB 5DT1L 5CJ5A 2P5WD 3GFUA 4WCYH 4I2XA 1Q9WB 3DGCR 1JK8B 2A83B 4HT1L 2YS4A 5JDSA 3EYVB 5ACZA 4QRPB 5SX4H 4MA7H 1OAKL 4QWWC 3U7YL 4CKVX 4PB9L 1V5JA 3OJDB 4ZUWA 4EDXA 3BEWA 3LQZB 4MAYC 2YPLD 4TVPD 2ZP0T 3NFPB 1NDMA 5A40E 4O2EB 1T0MB 2BOBA 3C9NA 4LDEB 5CBEB 5C8JA 5FYLD 2WUBH 4OT1L 4JPVH 5EBLB 4MQSB 5IHLB 1GZPB 4G6ML 2VTFA 1MCIA 4EN3B 3OAUH 2VDOH 4NRZA 5DD1H 3D2UB 3NIFE 3PF2A 1AGFB 3QHFL 4TSAL 5ADOL 4X6BA 3QCVL 5F88A 5BOPA 2X4UB 1MEXH 4G6AC 3UJJH 4P2RE 1PBYA 3KYKH 5GHWL 5F7UA 4JFEE 1EVTC 2EC8A 3FQRA 4L3EE 3HZVB 4JZOA 5DQ9A 1KCKA 4RA0C 3KPMA 3SDCA 3L9RB 4K8RH 2HJFA 4DOHB 4M6AA 1RJLB 1S7SA 4J3UA 3FQXA 3ZE2E 1KGCE 2A2QT 3DX8B 1FN4B 5ESAA 2VE6B 5DD0L 4F7PA 3QDJE 4XHJC 4JANB 3T65A 3FB8A 2ZCKL 4E5XA 4X6EA 1KJVA 4EIZC 1BM3L 1AGDA 3C6LD 1S7RA 5JW5A 3O11B 5L7XH 3RQ3A 3EOTH 3G04A 3VFRA 2EH7H 4R4BA 3BKJH 1MJJB 1JGLH 4URTB 3SDDC 3O6FA 5E2JA 4JRYE 3LS4H 2CIIA 3ARFD 3TYFA 4LBEB 1X5JA 1YN7B 3CXDH 4N8VB 4V2BA 4XBPA 4MJ5B 4DFHA 5EO0A 4X0KA 5CJBA 4KUCD 3QJFA 2AS5M 2Y5EA 3BHBA 5GISH 3BZDA 3JWNC 3KWWA 3BX7C 4MMXC 2Q8BH 1S9YA 1GSMA 1CLYH 3T04D 4PTUA 1DVFD 2VQUA 1SYVA 5F7EH 5GRUH 5MENA 1AGEB 1M7DB 3QUKB 4F7CB 4NM4H 1XGRB 3V6ZB 3IF1B 4HDIB 1LD9B 4NQCD 4OIAA 1Q94A 1YMMD 4DVBB 1RQ5A 2YZ1A 3BZEB 2C1OB 1M7XA 2EDTA 3RVVC 4FFWC 2VAJA 2EDEA 1UYWL 2IADB 3V4UL 5KTEL 4NHCH 3V8OA 4ISVB 3BPCA 4AY0A 2IEPA 5ETUA 3NTCH 1N64L 3W81A 1A6TB 4JO4L 5ICYA 3PGDB 1QA9B 4JY6A 5EIIA 1IKNA 4PLOB 1R24B 3T4YB 5DMKA 4LEOA 4L9LC 2ENYA 4PJ9A 4KQ4L 5CP7A 2VDLH 2W07A 4GQ9L 4QRQB 1A6VL 4N1EA 1DQLH 4Y4HB 4W6XB 1RULH 4AYFA 1BQHG 1YEKH 5FCUL 3KVQA 2I27N 1RZ7H 4PJ7A 4U1SB 2VXQH 3EYFA 3VGEA 4UOJA 1R5WB 1X9QA 1WAAE 1S8DB 2CIKB 4JG0H 2E7CA 2D7MA 3L5IA 3RWIA 5FYKD 1YEDA 4DN3H 5C86A 4IMKA 3SE4A 3T0VA 5ICXB 3VW3H 5EZIL 4OZIE 3R06A 1LEIB 3OSKA 3DJ9A 3EDJA 4JDVA 3W11C 4K94H 2F9BT 4YHYB 1A0QH 2IMNA 1T7ZA 1FFNA 2F54A 4M5YL 4KI5F 4JKPH 5I73C 5IJKC 1YY9D 5FF6B 1KCSH 1KFAH 5CJOL 3MPCA 3DSNA 2DMCA 3R8QA 4HEME 4JG1H 5FA4B 3SGDI 3IDIB 4LGSB 2VIRA 4TUOA 5B4MD 2Q86A 2VDNL 1B3JA 2MQCA 2VDKL 3L3OA 2E6QA 2A74A 5BV7H 4WV1C 3I9GH 4OB5H 3QAZB 1IGCH 3CLEH 4PJBF 4L4TB 2OR9L 3IDNB 1AGCA 2V7HB 4FG6C 2ITDB 2CPCA 2X4RB 1GGCL 5E2WL 2IH3B 2NY5C 3VFMA 3L3DB 2A73B 3QO0A 3T3PE 3QNZA 2ARJA 3VXPB 5KSVB 5B3JE 3KR3H 3MRNB 1Z9LA 1H15A 1FRGH 4W81A 1DBJL 3TBYB 4M6NH 2FGWL 4NQSB 2R29L 4X9HA 2FEEL 2EIZB 4FABL 5I1LB 1JJUA 5GGSB 4N5EC 3K7UA 1J7VR 3B5GA 3BW9A 5ISZE 1F00I 3MLRL 2Y7QA 5GGQL 4TRPH 3REVA 1B0RB 3Q5TA 3RJQB 5BRZD 1MJUH 5T5FL 2APFA 5F96L 1XF5A 5A3ID 5DUPH 2J7LA 2BERA 1T2QH 4TSBH 3RY6A 1JNJA 1H9VA 5C6PB 5C0CD 5TDPA 4ZYKB 4H8WH 4LSRH 3PQYD 3X11B 2GCYB 3BSZL 2ATKB 3TIDB 5DF0A 1UEYA 5E8NB 8CGTA 4PRPA 2ADIB 1EJOH 5JMOC 1S7QB 1IC7L 5CKGA 5IOPA 1YQVH 1OAUH 4LSSL 4KKAD 3WJJA 1HHJA 1NMBH 3O2WH 4X8JA 2APBA 4RGNC 5DEGA 3BH9B 5I1IL 4PY7B 4XX1G 1YEHL 2QTEA 4YZFE 1WZKA 2A6IB 1YNLH 4N0UB 4F3FA 1JI2A 4EI6B 4GRLC 5B39A 1J1OL 4DUWA 1CLOH 1U93B 1Z6JT 3SKOB 1HZHH 4ZFOL 5BZDA 1T1XA 5L2KD 1JNLH 1KB9J 1NCWL 4OFDA 5IF0A 3TO4B 1HI6B 2FLRT 4QOKA 3TPKA 2BSRB 1V7MH 4RX4A 3L3HB 2RIKA 3ILPB 2BC4A 4TSCH 2VQ1B 2IPTL 4FQLL 3P4NB 2RCSL 1BWWA 5L9DL 3C6LA 3PWLB 3UTPD 4XNZC 3TA3C 3VA2C 1FNEA 1NDGA 2PYFA 2PXYC 3G6JB 4ODSH 1UCBH 3ARFA 2WK2A 1OLZA 4OLWL 3DVNB 5EOTA 4BSVB 2ZG1A 2OJEB 3BESR 4X98A 1J8HB 4HKJB 5MHSD 4LGRB 1C7TA 4XMKH 1MREL 1NCDL 5C07B 4NQEE 4XAWL 2B1AL 1CXEA 4Y2DC 3TZVD 1JZ3A 1S7XA 4F8QA 4JGJA 5A2JH 4EZMA 4KKLC 4QTIH 4MD0A 1TJIH 1N5AB 3CJJA 4ZUTB 4P9ML 3EYUH 3W9EB 4JZJC 1YMMA 2JB5H 3JBG7 4X80H 5TQ0L 2YUWA 4X6DF 5LXGL 1JCKA 5DFVD 4F9LA 3TBSA 2N7AA 4J3SA 5HI5D 4CDGC 3ZYZA 5D71H 4YHKL 4C56D 1JWMA 1PG7W 4ENEC 2EYSA 4DTGH 4EI5B 1H3VA 3IJYA 4WHYH 3GSNB 4ZFZB 5FB8A 2CDFA 4J3OC 2FYYA 4LK4A 5HYJD 4XVJL 3S36H 1JGVL 4LLWA 4X6FB 1P2CB 2OJZH 3FO9B 1EEUA 4I18C 3C2AL 4LEXL 1KCRL 2AABH 4NKMA 4LAJH 2X4NA 1UXSA 4ORGB 4HIEA 1NJ9A 1XF4B 4HJ0D 2J12B 3MV7B 4OUUA 3OAZH 1OGAD 1XGYL 4FQCL 1RK0A 2GT9A 3MJ9L 3FZUD 5KVGL 4NT6A 4WI3A 2A0LC 5CEYA 2FL5B 3GBNH 5DUMH 3MJ7B 4FQJL 2Z8WC 4ZMAT 1BD2A 1KOAA 1LNUB 4Z7UE 3D85D 4M62H 4MS8D 4QXGH 4PJHA 1CF8H 2VXTL 4FXGA 4G9FD 1QRNE 2G9HB 3DROB 5ELIA 1AQKL 1YY8B 2YR3A 3VMOA 4DGYH 2VLRB 3ARBA 3UYRL 3GEWB 4XH2B 3ULVE 3BP4A 3EYOB 4HC1A 4GG6E 5CBAA 4NO2A 2H6PB 2EYRB 5KG9A 3GRWA 1PLGL 1UH2A 3PWNA 3GMLB 2B2XH 1AJ7H 1CL7I 1EUUA 2H8PB 4HKBB 4TVPH 2DM3A 1A7NH 3ESUF 3R8BB 1WFOA 4YDKL 1X6NA 4L8CB 1LO2L 3LEXA 4G7YL 4WVRA 2QSCH 4U1HA 1G7JA 4ZQKA 5FM5O 2CLRB 4M9PA 2YKLH 4HW6A 4NQDB 2BSTA 1S7VA 1OVZA 4H1LA 2MCG1 4OZFG 1ZMYA 2D7TL 2GSGB 32C2B 3HR5A 4IIQC 1KLGB 4DGIL 1YYLL 3QEGH 2P5WE 2GK2A 3EJJX 3HZKB 3QUXD 5C6TH 1I1YB 2WBJC 4NNXB 4XT1C 4Y2OA 5C7XH 4HK3N 2DLFH 1EUTA 4NM8L 3T0ED 3QFJD 3SGKC 1TTGA 3RX5A 3LRGA 3HB3C 3RZCB 3RVUD 3FRPA 3RVXC 2VKXA 4RFEA 3TC9A 2YPLE 1D9KB 4KJWC 2Y5TA 3RGVB 3NFNB 5BRZA 4HBCH 1FCCA 4XB8A 3O6MH 5FYLE 3TFKC 3LKSB 4LLDB 4N9GB 3T77B 1R3HB 4PRAB 5C0CA 5J7CC 4PGCA 1IGTA 3VFVA 2GFBB 2RB8A 2AEIT 3O2DA 2DLTA 4HS8L 2B4CH 3PL6D 1JUFA 4GKZB 4I5BB 3WNLA 1I1FB 2XI9A 3EJZD 5ENWB 1MJ7L 2P8LB 2IFGA 5FFLA 1S7TA 1GPOL 2EDHA 2CKBA 1I4FB 3IDJA 5ERWB 4OCXH 1MAML 4GKOA 4G3YH 1T3FA 3HMWH 3QUZC 3ZYJA 3B9AA 3KPSA 2G60H 3F12B 3PUCA 5TDOB 1A6UL 3EO1A 3U0PA 1SMAA 2IGFL 4LPVA 4JPWH 3ULUL 1YNKL 5SWSB 2ADFL 1OM3L 4WUUD 1KIRB 1MCDA 3VXMD 1S9XB 3T1FB 1R3JA 1U92A 1NBYA 4WEBL 1G7MB 2GSIA 1I7UA 1T22B 4V1DD 3CD4A 4JFFB 3DUHA 2QJDA 1MFEH 4PPTA 3QEHB 3VXTB 1G1CA 2AEQH 5DJZA 2G5RA 2NY3B 4NGHH 4AG4L 1BZQK 4LCWD 1HYSD 1MCHA 1IFHL 3VWJD 1GGBH 4F2MB 4ZSOA 4UT7H 2EE2A 4QXTA 3EO9H 3MXWL 5CIPB 5ALBH 4K71C 4HV8B 2AJZA 2FATH 1HWHB 1WTLA 5DWUL 1GGYA 1A47A 4OCYH 1DANU 5J13B 5C0FB 1T21A 4NQCE 3PE9A 1Q9OB 3VXSD 5CEZD 4U1GB 5E9DE 5JOPD 1KPVA 3STLB 1NBZA 5FYKH 1VGKA 2GY5A 2J88L 4JAMA 5TE6H 5D96B 5KSBE 3KYMB 4YHMH 3T0WA 1MCPL 1X7QA 5FGCE 3OBAA 3VWKB 1HKFA 3F7RA 3IU4L 1UQSA 2VISB 2A6DB 2Z31C 2ITCA 4P99A 4D0CA 2MNUA 3BEVA 3DUUA 3VD4A 1A6ZB 3QDGB 5KAQF 3SEPA 1EJ6A 1S9VB 3PHSA 3E6FB 3GMMB 1NGZB 1FL6B 3TJEL 5I8OH 1LO0H 1P4IH 3B9KD 1UXWA 9CGTA 3QH3B 4HC1H 5C0JB 3WS6A 1YJDH 5D5MA 3BQUA 1QSVA 4N8VG 4HUWB 3T2NH 1F02I 3GRWH 5FM4A 4KROC 4RQQA 4U6HA 4WEMB 2DOCA 4U2YA 2J8UA 3GKZA 4BELD 2DQGL 3WIFB 1XZ0B 4P4RB 4JHBA 1JGEA 1P1ZA 3UJIL 1U2CA 1XH3A 1HILA 4P59H 3IJHA 1WWWX 1HHKA 4EJ1C 1YZZA 3VFGL 3QDME 2VN4A 2DQDH 4GQPH 3VXRD 4YHPA 2OQJB 2OBGA 4H1LH 1DDHB 5JORB 1W8NA 1OT2A 2BNRD 1LDPH 1VDGA 5IQ9B 2Y36H 1IGML 3DBXA 1JF5A 1CQKA 5FV2A 1KNOB 5CD5D 3BVNB 1EHAA 4Y5XC 1DQDH 4HWEL 4I0PA 2WBKA 3PHOB 2QQNH 3WUWB 4PRHB 3DYOA 3IXTA 1CGWA 3EOYG 1UWEL 4JY5H 1OQXA 4P2YA 2J6EL 4MXQC 3AS3A 2VC2H 2VERN 2B8OT 3V0WL 1FZKA 3AMKA 1G7PA 5BS0E 1UA6H 5HYSB 4XCCL 4Q0XL 15C8H 4NDMB 3VCLA 5JPNA 3ESVF 2OZ4L 1IQDB 5T3XD 3CIQA 3O2DH 3P77A 3IJSB 5GIRB 3JZ7A 3AY4C 2R8SH 1NSNL 3KYNB 3LKPA 1CGYA 1RZJC 3VG0H 3GI8L 4NYLA 3JWOL 2ARWA 4H20H 3B2UC 3N1QC 3DIFB 4GSDH 3I6GB 5IVZB 5D6CB 1S7WA 1CE1H 2X4QA 3DNKA 5ALCL 5E99H 2CKBH 3VMPA 4FN0A 1YMHA 1ZAGA 5CUSH 4KTDL 3QUXA 4KMLB 2H1PH 2OP4L 5JHDB 1A7PL 3OJ2C 4WI7A 3VXUA 3T0EA 5IROC 5BRZE 3QFJA 1OSPL 4XCFL 5D2LE 4P9HL 1DUYA 3QQ4A 1NCUA 4ZOCA 1BEYL 2DYPD 4I0CC 4Y5YB 4XPTL 2AK4B 2F5AL 3PQYE 4NN7C 2VWEC 1C5CL 1INEH 5FK9B 2X4PB 2FIRT 3GZKA 3L7FB 2ZCLH 3FQNB 4RAVB 4G9DA 2VLKE 3FO1B 4DKAA 4PJ5D 4EBQH 5IFAH 3PL6A 5C2BH 3WSQH 3CK0H 1J0KA 4ZAKA 4FQ2H 4IDJL 3AB0C 3WS3B 2W38A 2HVJA 3CH1B 5DVOA 4ODXA 3ORJA 5HPOA 4IRSC 4PBWD 3MV01 3SKNB 4YDJB 4PJFB 5F89A 3S34H 43CAB 2HKFH 2Q1EA 2EIBA 1U8HB 4YIQB 4GAYA 4ZNEE 4OTXH 5ITFA 3TPUA 2AJYL 5JHLL 1JV5B 5L2KE 2A6JB 5SWZA 5BVPL 3B9DA 4AH2B 2I9TA 5DK3A 5C2UB 3FO2A 3ILQC 1Z9SA 4WUUA 5D6DA 3MRGA 3VXMA 4KK5D 1JPTL 4XRCB 3JTSB 5ACMA 4D8PA 3S97C 3UTPE 1R6VA 12E8H 4YFLI 1T4KB 2EECA 3IKCA 5DZNA 4GXVL 4V1DA 4QXUH 3HE6D 2ZSWA 3C87A 2DTML 5IB1B 3CUPB 5IM7A 2Y25A 1H3UA 3BPOB 3JV6B 4HG4J 4FFZH 5B3JF 5C0RH 3QQ9C 5E8DH 4LVNB 1VEOA 3L7EB 4HK3J 2EYTB 3VWJA