3U7YH

Structure of nih45-46 fab in complex with gp120 of 93th057 hiv
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRGGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIH45-46 heavy chain, Ig gamma-1 chain C region
publication title Increasing the Potency and Breadth of an HIV Antibody by Using Structure-Based Rational Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 38
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2011-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH01
4QRTB 4F7PB 5FIEA 2XPGB 3C08L 2VLKE 2D7TH 5L88H 4OCXH 5KSAC 2Y07L 1XGPB 5CJQL 4S2SB 2P8LA 4ZSOB 1KG0A 4N9OB 1S8DB 3WBDA 2VH5L 1Y6NR 2DM4A 1IC7H 4EUPA 2A1WL 4FQIL 1RZIB 4KZDL 1HZHH 4FXKA 4QTIL 5BV7H 1C8PA 4HIXH 5ITBL 4PGJA 3ORJA 5C0RH 5GQBA 3SDXF 1RJLB 2YKLL 2J8UE 4R2GC 1AY1H 3VRLE 1CICA 4XNUL 4PRIB 1H15B 4JRXD 2CLRB 1VHPA 3DX6B 3EOBB 1VGEH 4JFED 1YNLH 4X4ZA 3MJ9L 4KKNA 3DROB 5D7LB 2JJTA 2ICEA 3QWQB 5DVLA 1BZQK 3TO2A 2Z91A 2B5IC 2R0ZH 1NGZB 1EJOH 1Y18B 3OKEA 3QI9C 3UTSD 4P9ML 3BH9A 2DQJL 4FFZH 4M4PA 3VJ6A 5JIIA 5F6IB 3IU4L 2KH2B 1DBKL 2A73A 3T0ED 3CFJA 1U6AH 2OZ4A 3MLYH 5HPMA 1IMHC 1NAMH 4N1EA 3GM8A 2EDFA 4HS6B 4YGVB 1A3QA 4Y19B 1ADQA 4S1SH 4R7NB 3X13A 1LNUB 2F54A 4WUKL 3S97C 4NUJB 3NZ8B 2UVEA 1WIOA 1GZPB 4XHJD 3MRNB 3M17A 5HI3D 4F57H 1I9IH 4QLRA 3BKCL 2P47B 2VZSA 1FGVL 2LU3A 3PHQA 4ODBD 5E8OB 8FABB 3NPZB 4IOIA 5FF6B 3QXWA 1NFIA 4DN4L 3ULUH 2WWMC 2D7NA 3NTCH 1HHGA 3LSOA 4X4XB 3HB3C 3MFFB 2BSRB 3BRGC 5D2NA 3U7WH 1CFTB 1CGTA 3QO0A 5JTWA 3D39E 3O3AB 1LDSA 5KS9A 3VH8G 3EHBC 1YEDA 3IJYA 3VGGA 4KI5D 4D9LH 2EDNA 4F15C 2EXYD 4HAGA 3RX7A 2RAMA 4OGXL 3PWVA 3W0WD 2NZIA 4GBXB 3RGVA 1I4FA 4XHQA 3JWOL 2YS4A 5TQ0H 3T04D 2EZ0D 2RB8A 3W9EA 1X6NA 4HEPG 4M5ZH 3FQWB 3QWOB 3A67L 4F7TB 3IGAB 5IESH 2ED9A 3DSNA 1GAFH 2AI0H 4P46A 2X1XR 1MFDH 4EJ1C 4XPAL 3RX8A 3O8XC 2F53E 5FYJE 2EDBA 3DX9B 1F11A 2NLJA 5DHYB 3O3DA 4U1KA 4HWEL 2O5XH 2H9GA 3GRWL 4M43H 5BO1H 4YDKL 2ZUWA 3U46B 2A6KA 4LLQA 4YX2L 1CE6A 4TVPD 3CFKA 2I9TA 1PD6A 2Z35A 2I5YL 4F9LA 5LGJB 1CYGA 1KLGA 5F9WB 1MIML 1KLFA 3MOBH 3BP4A 1OB1A 1MFCL 4JRWA 4K3GA 1V8HA 3NPSC 3PV6B 2NY7L 2X42A 1S78D 5LGHH 4KDWA 4U6XB 4TUKL 2AK4D 3ZE1F 2QQQA 1YPZA 5CJ8A 2VO5A 2BVPB 4XVSH 2PTVA 4YHKH 4PJBB 1T1ZB 2DMCA 4IRJD 4LSSL 3EO0B 4ODUA 3IF1B 3QEUB 5E8DL 4LCWB 4PJ5D 1OPGH 5DQJA 1TVDA 3HAEH 3ARGC 3SDCA 3UBXI 4KRPD 3PQYD 2I60H 5KS9F 4RMQA 3BIBX 5C0AB 4C56E 5EG6C 5EC2B 1ZLVH 4Y16C 5MHSD 1KULA 3TGXA 1WWBX 4HKJB 2GAZB 1R24A 4QXWA 3VMPA 1T1YA 4P23C 4D3CH 2P5EB 2PR4H 3ULVD 3BHBB 1HSAA 3V4UH 1ETZA 1UXWB 3MRFA 3RWJA 1BFOB 2DTSA 1HEZB 1SHMA 1WIUA 4JDZB 1IGJA 3KYKL 3SE3A 5I8KL 3AS0A 3H0TB 1QRND 1MCIA 3QEHA 1ZT4B 5D5MF 2BJMH 3U82B 5C0FB 1MLCA 3QEGH 4LHQB 4NQCB 1ZXQA 5B3JE 2V17L 1YMHB 2DICA 2PXYB 4BZ1L 1S9KC 1SEQL 2I27N 1NDMB 5C0BE 1N64H 4IS6B 3ULVL 1U8QB 2O26U 1RV6X 4L5FL 1P9MA 4NO2A 1X5GA 5EOQH 5I15L 1AKJD 4JFQA 3NCBB 4OV5A 3L5HA 1IZJA 1ED3B 3P0VL 1C5CH 2ZUSA 4KV5F 2C1OA 1HH6B 3FB6A 5EU6A 1FQ9C 4I48A 2WUCH 5J9PA 1R3IH 4N0CC 1MRFL 5DJAB 1I7TA 4GRLD 1J8HB 5KSBB 5AUMA 5D96C 3RTQC 4F3FA 2YA2A 3OXSA 2DJ4A 1MHCA 1YPZF 1CLYL 1AIFB 1A3LL 4Y4KA 3RVUD 4M6OL 3X11A 4GMSL 1U8OA 2AK1H 1NCTA 4OJFL 5C2UB 3QIWB 1A5FH 4HGKC 4JPKL 3MXWL 5EORL 3S96A 4JM2D 1RU9H 1AXTH 1JTOA 1CL7L 1P2CB 2XY2A 4HULB 1XF3B 1YMME 1S5IH 4IMLA 4K94H 4IIQB 4CVZA 2HN7B 4KZEL 5IB2B 1EZVY 1F2QA 2YHGA 4GAYA 1P4LB 4HGWA 5MI0B 4Z7QE 1QHOA 1SVCP 1BVZA 2X2YA 3CVHA 1TPXB 1YQ2A 43CAA 3OWEA 1CF8L 5E08H 1F4AA 3LRSB 1INQA 4JFFE 1MFAL 4FA8A 3F12B 1FCGA 3QXAB 4EQ2A 4GMTL 2GY7B 5DJ8B 4D0BB 2WZPD 4NYLB 1G1CA 1C1EH 2BXZA 4PREA 1KCRH 1XF4B 4AM0A 4CVUA 1TZGL 3LN4A 5L8KB 4PRPD 4HZAA 4UBDD 4LSQH 3KYMB 1YEHL 5HYJB 2VLJE 3CFDA 1UM5L 2YC1B 3TZVC 3IDXH 1OQXA 1ZA3B 5HYSA 4N0UE 5AG8A 1BJ1J 1H3UA 3BW9B 1OAZH 1D5ZA 4MYWB 3WHXB 3B8YA 3U4AA 4QXGH 4CNIA 3UEZA 1OTSD 4YDIH 2IPKA 5EPMB 5HGHB 2PYFA 4YO0A 4OZIB 3IJHA 3EYQD 4KUCD 2YN3A 3LKSA 5I74C 3E8UL 4MS8C 4BSWB 1N59A 3GSXA 1JF5A 3DNKA 3O3EA 5CEZL 1JZ3A 4KVNL 4XCCL 5FB8A 1TQBC 5I76B 2ICES 5HHOD 3T4YA 1NJ9A 2B4CL 2COQA 3NVQA 4HHAA 3C5SB 3HZYA 4X8XA 4NZUL 2V5RA 4LBEA 2XQYG 3U79A 1BAFH 3O9WA 5D2LE 1T1WA 2VDOL 3U48A 3KGRA 2NY1B 4XZUB 5F88A 2PYED 2CKBH 4JGMA 2Q3AA 3EBAA 3TM6A 1EEQA 2JE8A 2EDRA 5D5MB 4PJ9D 1FNSL 4QHLA 5IROC 3IDUA 1BFVL 5K9JL 4ZUSB 3T2OA 2ZG1A 3T77B 1RUMH 2GFBA 1KIUA 4XXCA 4ZUUB 5DR5H 1AGBB 2CGRL 1MJ8H 2BHYA 5C07B 1NCAL 3KPSA 3TBYB 1A1NB 1NBYB 3EGSB 5DJYB 2VLLA 3GJFK 1LEGA 5DRNA 1EO8H 1II4E 1DQLH 5BRZB 1NDGA 4OF0A 3H3PL 4O00A 3LD8B 2HKHL 3UDWA 5HTSA 5MEQB 1Q38A 1RZ8B 1K5NA 1GC1C 5A2IH 4YPJA 3TVMA 4Z95H 4H8WH 3FQTA 3H7BA 1SBBA 3O41A 4L9DA 3MCKB 3TNMB 1H3PL 2YOCA 4KC3B 4WO4A 1AHWC 4F7EB 2VSDA 4OLEA 4EN3D 2XN9B 3B6SA 3Q0HA 4NN6B 1L9NA 3S34H 2VDML 1JGLL 4RAUB 1KTKE 4O02L 4ONOA 5JO5B 2QSVA 5F9JA 1AD0B 3ALPA 5C71A 3MJ9A 3VXMD 3HZVA 3QEQD 3WL9A 4J3XA 4G7VL 4NFBA 1MAMH 4PJCB 3BGAA 5LXGL 1NGPH 2MCG1 2CSPA 4AT6A 4RISL 3IB4A 4UB0H 3VDCA 4ENEC 1BD2E 4M62L 1C7SA 2ERJC 1WK0A 4FNLL 2ZCKH 4G8EA 3RFZC 1MRDL 2J4WH 4Z0XA 4XH2B 5I9QB 1T20B 5SWQA 1UM6L 1A0QL 1SYSB 1XGUB 2VKXA 3KYOB 4PTTA 2YD5A 1OAUL 1IQWL 1RPQA 4I18A 1VFAB 5C08D 5D1XD 4POUB 5K9OB 5IBLC 1VFBA 1R3LA 3CVIL 1KBGH 3ARZA 2QL1A 3RKDD 4ETQB 2AXFB 15C8L 1A7BA 2G75A 3MFGB 3PABB 1J86A 1YYML 1RULL 5I1GH 2OTUA 4HV8B 5JPNA 1DE4B 1DBBH 2WINB 3IFNH 4O2CA 1MI5B 3ARYA 4XB8A 2FDBP 5T1LA 4MLIA 3B8SA 2B1HH 4OGYL 4OQTH 1JMZA 4OTXL 4UDTA 4LASH 2A6DA 3OZ9L 2DQHH 2RIKA 5IK3B 3HE6C 2P5WB 4ONHB 5B8CA 3MV9E 4FOMA 4W6YB 2VXSL 5TQ2H 3SE4A 1G9NC 2DQUH 3PIQA 3SOBL 3BUYB 4KKCC 4MSWA 1KJMA 5IVNA 2ZCHL 4NQEB 3VXSD 5DC9B 1G6RA 5DQ9A 4PJGA 2LTQC 5I19H 4LLAA 2G60H 5CSZA 3GRWA 3MO1A 1KYOJ 1L7IH 1I85A 4PJ7E 1D3CA 4FXGB 4WEBH 4XAKD 5GHWL 5D7JC 3FHAA 4AYFA 2VAJA 4K71C 2ITDB 1UWEH 4G6ML 3LDBB 4X83A 1KGCE 4OFYA 2D0FA 4M1DH 1HSBA 3H9SB 4MGXA 4X6DE 1UWGH 4Z0BL 1EV2E 3SDYH 4P4KC 1QYGH 2L4OA 2ZKHH 4I3RH 1B3JA 4PJXA 1URLA 2QBWA 5BS0A 4XPHH 4MNHB 4G8GD 4WFHE 3LPWA 5IEKA 5DLMH 3HNVL 1NKRA 1Z9SA 4UV4H 4ISVB 3PDOB 5B39A 1S7UA 3O0RH 4OZHE 4M7KH 4V2CB 5IEHA 5IMOA 1C16A 2EYRB 1FIGL 5DJZA 3P0GB 1YZZA 5FHBH 4G6JL 3KYNA 5CEYA 3GMOA 1G1YA 2HTKC 1KTDA 3T0VA 4OKDA 2YPLE 3T4AA 1A6UH 1GIGH 1IEAB 1UJ3C 2GJ6E 4IRJA 3ZTNH 5ADPH 1E6OL 3MJGX 3QA3A 1IAKB 4O2EB 4PJ5A 1TVBB 3NCYS 5TE7H 4M5YL 3BT2H 1IGTA 4PJGF 4YXHL 3ARRA 2DLEA 1CR9H 4KI5F 3O6MH 1L9MA 1BQHB 1KJ3L 3HNTH 3QCVL 1IAIH 3RZCB 3HZMB 2O93L 3EFFB 3UJIH 1J11A 1U95A 5KVDL 4OKVB 4JR9L 3CX2A 1XGYL 4Z77B 4E5XB 3DLQR 4GH7B 4QRPE 4K3EH 1P7QD 4DWHA 5KTEH 5DJCB 1TJIH 4MLSA 3WJJC 4DQOL 4PJEA 2RFXA 1HHKB 4HJ0D 3IFLL 2NY5H 3MRMB 2P1YA 4MA3B 3K81A 4U0RB 5DVKA 5EBLA 3NA4A 4GKSB 4K23H 2VC2H 2CDFA 3MRRB 2BHZA 3QDGD 4PJXF 4D0DA 4L4VA 1U8IB 3MNZB 3TA3B 4WV1B 3O3UN 4ZD3H 3IDJB 1MWAB 5FUOH 3VA2C 1G7QA 1T89A 5AYQA 1AKJA 1TETH 2NY0B 2ICWB 2ESVE 5DVNA 3WXVH 1A7OL 3IXAA 2ADGB 3QB7C 4JDTL 4C83B 1DN2A 4IHOA 4XP6L 2NW3B 1IJ9A 4EI5B 4OCNC 1NBVL 3UTTD 4KDVA 3FO9B 4PYGA 4ZS7H 3GSUA 3QQNA 1NCBL 1MCPH 4RWHA 4NQVB 1DZBA 4LLYB 3BZ4B 3SCMC 4O5LL 2DRUA 3BYYA 4YXLL 3WFCH 1YQVH 4MQXD 3L9RA 3PGDA 4XCEA 5TDPA 2I25N 3GZKA 5J6GB 3JV6A 4WTZG 2DD8H 5EBWB 4LKCA 2AKRB 4LU5L 1CFVH 3CH1B 2F8OA 3B9KC 1S7XB 1FZOA 2XWBA 2XTLA 1BX2A 3SDDD 5FYKD 1LEIA 5GGQL 1FRGL 4Y2DD 3C6SA 1DANU 2GI7A 3LHPH 5JDSA 3ULVF 3OAUH 5IVXE 4NNXA 2BVQA 3L3JA 1L4IA 4MNGA 2NXYC 4CADB 1A47A 1MCBA 4JRXB 5IFHL 3GMMB 4JFEB 2KKQA 4EZMA 4OZFH 1EHNA 1KJVA 4PJEF 4Z7NE 3RUGB 2J12B 3TYFB 4HWZA 5C0CD 1QSEA 1RK0A 3G6DH 1OSZA 3MRIA 1IAII 5TJWK 5H2BB 1P84J 4ELME 3QNXB 2F19L 3FB5B 4LSPH 3UTSB 1CD9B 4H1LH 3X3GL 1DLFH 3D85D 5DD0H 1QR1A 1R3JB 3ZKQD 5ECJE 3SN6N 4BKLB 4LPCA 2HTLC 4BFEA 1B90A 3RJDA 1H0DB 4OFDA 3T0EB 1IBGL 5KOMC 1OY3B 1WZMA 4WUUD 4R96B 1FPTH 1F5WA 5D8JH 3TWCH 4C58B 1REIA 4U1MB 1KCKA 1HINL 4PB0H 4XC3H 5FHAL 1FYTD 4GW1B 3UPRB 2W07A 4HX1B 1K3ZA 2AJSH 3TF7C 5LAXA 4NZTH 5F7LB 1J0HA 4Y4HD 5DJ6A 1H3GA 1IGIL 3CFCH 2FJFA 1BEYH 3MBEC 5FYJU 2R8SL 4XNMA 2ZUTA 1JVKA 1RZ7H 1H8OA 1MCWM 4X8JB 2IFFL 4NN7C 3QUKB 5F1SA 5CINL 3L3HB 3DGGA 1DUYB 5ENWA 2VQ1A 3LIZL 4KFZC 5HHOA 4NZRL 1RIUL 4LOUC 5T1DL 3IRPX 5JOFB 1CDHA 2AJZA 3VFRA 1IM9D 1B4JL 2ADIA 3QP3A 4PFEA 4QXUL 4Y5XC 1T03H 3F7VA 1FIEA 4OZGA 3MROB 1KJ2L 3W0WB 5B38G 1Q94B 3FT2B 4H26B 4OZFG 3TV3L 3UTQA 4YDVB 2P7TB 4JG1L 4RMUA 5L2JB 2ADJA 2IQ9L 2PYEA 3DO7B 4A6YB 3EDJA 3PGFH 2YBRA 3DMMC 3EDKA 4H1LG 1OTTC 3MUGB 4MD5B 4YBQC 1UKSA 2WUBL 4XT1C 1Q9WA 5JQ6H 5AZ2H 1F4WL 5HHMD 3SY0B 5HYIA 3O6KL 3IDMB 4JQIL 3RVTD 4GQ9L 2EYTA 1I3RA 1P4BH 5D1ZC 1I7ZB 1SY6H 2FJGA 3FHQA 3QUXC 3UPCA 1EGJL 1IKNC 4QY8B 1R0AL 3GMPA 3GBNL 1C12A 1TJHH 4HCRL 1W0VB 2GQHA 4Y1AD 4YPGA 3D18B 3MV8D 5C8JB 1DVFB 3WFZA 3HPJA 1HIMH 3P30H 2FH6A 1TNNA 4YBLB 5A16B 2VN7A 4OUUB 2AW2A 2Q3ZA 4FHBD 3V7AG 1JGEB 2JIXA 4QO1A 1J1PL 1KIPB 5A2JH 1YY8A 5BVPL 4PJIE 2AK4B 3BI9X 4KHTH 2IANB 4MNQE 3L3IB 2AXHA 4KK9C 4UUJB 4HWNA 1NANI 3I6KA 4JFXA 4JFDE 4PJHE 2F5BH 3MUZ1 5K9KB 2UZIH 4KHXL 4L8DA 5CIPA 2EXWD 5DDHB 3JV4B 2R1XA 4RGNC 4XTRD 1A21A 2LABA 1A14H 1GPOH 4S0TD 4U1LB 3QJHB 2D7QA 3D6GA 3U36A 5FGSA 3RRQA 4KRPB 5FDYA 3PQYB 4WHTB 4HJJH 1U3HC 4CRPA 3L6FA 1OSPH 2FEDD 4ELKA 5E2JA 4NRYB 2BC4B 4OZGF 2DBJA 1P1ZB 5SWSE 4RMVA 2QSTA 1EVTC 3I84A 1FL3A 4NUGL 3MQIA 2AJVL 4RGMC 5EBMB 4KROC 1T83C 3QDJE 1HYSD 4Y5YB 3CXDH 1UB5B 1YYLH 2HRPH 1T7WA 1KENL 4N5EC 4Y4FC 2OL3B 1QRNB 1VEMA 1PYWB 1I3GH 2XZQL 4K8RH 5GRVL 4JPVH 4HC1L 1EHLH 1T4KA 3VD4A 2HA1A 4NDMA 2HLAA 1BWWA 4HFUL 3QFJD 8CGTA 5FUZH 1JPFB 4G7YH 1OWWA 4DTGH 3VWKC 1AGDB 2DQIH 1U0QA 4U49A 5IB4A 1F45A 1U9KA 3GJEA 7FABL 2HT4C 2Z92A 4TTGA 1H5BB 1CZ8H 2DLHA 2PTTB 3A6BL 2C3XA 3SPVB 4ODTH 4BA8A 4F33A 2ZWLT 1LE9B 1DUZB 1EDQA 2D0HA 4GRLB 4OI7A 3S35X 4HUKB 2HVJA 4JZNA 2ARJQ 3SGDH 1CQKA 1FSKC 2ENYA 1NLDL 4L3AA 4N8VG 1A3RH 3C9NA 5LVEA 2CXKA 1S7SA 1ZA6A 3MACH 4JJ5A 4LRIA 1PX3A 4OCYL 3MSPA 2E9IA 4FP8H 4P5MA 5EUKA 4QRUB 1M6OB 1NUNB 2OX5A 3K2MC 1CGYA 2VLRA 4Y0GA 4JM2B 2XQBL 2C3WA 4P2RD 4R90H 3HMWH 1WCBB 3JWDC 1QFOA 1OD7A 3BPOC 5ANMB 3UMTA 2JJTC 1PG7X 3DX7A 2FB4L 5CWSA 3ARPA 3H9HA 4XAWH 3HG1B 4I0PC 3UTOA 3VXSA 4FG6C 4MZ3A 2GITB 3IDIA 2X4QB 4JQXA 3ALWA 2E7CA 3STBA 5IIEB 2DWDA 1AQKH 2Y7QB 5JORB 3HC0B 2OXGA 5GSRB 5ISZD 1ZWIA 3VXPB 5HDOA 4Z78B 5C0ND 4O58L 4JO1H 1UACL 1F58H 5DA0B 4UIMA 4IEFB 2NCMA 3OR7B 5FFLA 4NCDA 1G7MB 5EFIB 2N56A 2YPKB 3ARBD 4YLQT 4K2UL 1FFPA 5DJDB 4CN1A 5TPWH 5MERB 1LILA 4ALAL 3SDAD 4PRBB 5JW4N 1JP5A 1UA6L 1V7NH 3LPFA 4PRPB 4OZ4B 1U8LA 4XPTL 4DVRL 1A7NH 2X40A 3KPRB 1WV7T 1FVCB 1OGTB 3ARFD 1I8MB 1ITBB 5D2NC 4WW2C 3TFKC 5ITFA 4MA8L 4Z7WB 3EYUL 5DC4B 4ZQKA 5CSBA 1K85A 2O5ZL 1EAPB 2PNDA 3L3GA 1MHPL 5CMAA 3OPZH 4UTBH 1OP3H 6CGTA 5KSBA 12E8L 3KPMA 5ELIA 4KKLD 3HFML 3MLVL 4FQQB 3BH8A 1LO5B 4WHYH 2BRRH 1Z3GH 1E4WL 4NQDA 3D3VE 1OP5K 4M1CC 1MWAL 1G7HB 3LMJH 5IT2H 2DIJA 4WCYL 1YEIL 2BVEA 3RVWC 5CD3B 2GTZB 1JN6A 4RGNE 1JGDB 4MQSB 2XRAL 3MC0A 5I1LA 3SDXE 4R0LB 2LAGB 4I2XA 4M6AA 1BM3H 1SYVA 1QBLL 3DXAD 4N0FA 2Q76A 3BEVA 1OARL 3TCLA 4KTEL 3DV6B 1F3RB 1K2DA 3FCTA 1ZVYA 3OF6D 5E2TL 3EYSH 4XP4H 1ORSB 4YHIB 1FCCA 3W11D 3ZE0F 1HDMA 3C60D 2WQRA 3U4BL 1HOCB 3NOIA 1A6WL 4WI6A 4TPRH 3SQBA 4ONGH 5C0EB 5LJYH 2PTUA 4V1DD 2Z31B 4PJ9B 1LO0L 4BZYA 1HCFX 2UWEA 4POZC 3SE8H 3KJ6H 2VDNH 3CLEL 1TQCC 2FYYA 3DJ9A 1P7QA 2CLVB 1WTLA 4O4YL 5IFAH 3BN3B 4WTXA 3WIIL 4K7FB 2LQRA 4U1GB 2R0WL 5LKNA 5CZXD 3T2PA 3KLAB 4K3DL 1FFOB 3WUWG 1MJUH 2ED7A 4K9EC 3QDGA 4L9LB 1N5YH 4DW2H 5IJVA 5KAQG 1WEJL 2CXGA 4AEIL 25C8H 1JPST 3QDME 2VLKD 1U91B 4GFTB 4HWBL 4RA3A 5E94B 4HIJB 3SDCC 4HZLA 4WHYG 5HDBF 1YECH 1B4RA 1NAMB 4J4PD 3V9FA 5JW5B 1AC0A 2JJUA 1U92A 4M02A 5GRUH 4LVOB 3WO4C 1HE7A 2GSGA 2QHRL 1R3HA 1E4XH 1CDCA 1JNNL 3UBXB 4Z7UA 4M7ZC 4PRHB 3QUZB 4X4MA 3I9GL 2C3GA 2X70A 4EN3B 3EO9L 3SE3C 3HI1A 3TBVA 2BNRE 5F9OH 1MCWW 4GAJL 4NO3B 2VTFA 4F37K 4AENA 3GIVA 4HS3A 4P57A 3FOMA 1ERNA 4WDIB 3QQ3B 3VXMB 1KT2B 2AJYH 4WHCA 2F9BT 3QEQB 5EO0B 2ZUVA 1QA9B 4ZTOL 1TVHB 1MCJA 4HEME 3TIDB 4PJFB 1RVFH 1P9MC 4Q6IA 4PY7A 4TNWF 4DKDC 1IC5H 3BZDA 3L95B 1BBDL 2O5YL 3U30B 2DTMH 4GS7C 4MDJB 3QIBD 3S3SA 4HG4J 3GSOA 5IP4A 2UWEF 5T1MA 4LLUB 5E5MB 2W0KA 4ZUVA 2UZXB 3EZ8A 3K4AA 3VXNB 4ZPVA 3RWIA 3QUYC 1X5FA 1I1YB 1KTLB 1WAAA 3O2DH 4KVCH 32C2A 5FGBC 4MAUH 3HTLX 2R9HC 4OD3H 1CGSH 1AI1H 2F54E 3X12A 4OF8A 5C0IB 4KAQL 4RFEA 5D1XB 5C08B 3D9AH 3EYFA 5BOZG 2EDOA 3D85A 4UNTA 4Z5RB 3MJ7B 4YHNA 2IBZX 1RHHB 1NUGA 3VXUA 3CZFA 3ZE1E 5C6WH 4WUUA 4I8DA 4ZPTA 5K9QI 1KCSH 1WFTA 1P7KA 5F7YC 4XP5H 4IRZH 3D39D 5D2NE 5D72L 3FTGA 4KKBC 3CAFA 5E6IA 2R2EB 4Z7UF 1HH9B 3GI9L 4PJAB 5J13B 4Y4HA 5DI8B 3TBSB 5KS9E 4F2MA 3PWJA 2BFVL 4ZMAT 1NC4D 3HKFA 4UINL 1KJ2A 4PJDE 5GZOD 1OF2A 1S7QA 1WWCA 3AREA 1NFDA 2OSLB 4YHYB 3Q6FB 1CGVA 4Q2ZA 2CMRL 4BQBA 1F4YL 5IOPB 2HWZH 4LVHB 4WI9A 3HAEB 3HZKB 2F53D 5FYJD 1DN0B 1WBYB 2YK1H 5D70H 1B2WL 4HQQH 3MRDB 4UNVA 3U6RA 5C6TL 4M4RA 4UAOC 1IM9A 5T5NG 3VCLA 4X6BA 3BWAB 3GBML 4KK5D 5DO2D 3U9UB 2D2OA 4HW6A 3HE7B 3DX8A 1EGJA 1D5MA 1DQQA 3VFPB 4KXZI 4OIIH 2Z9TA 3FN3A 1B9ZA 2WNGA 2HFEB 4YZFF 1JE6A 1J05B 2W0FB 4HCRA 3NH7L 2AEPL 4UT7H 2I26N 4Z7VB 4B53A 2XA3A 2Q6WA 1JRHL 1WAAF 1NMBH 1R3KA 4NC0B 5ERWA 3EYOA 1JPTH 3U1SH 4LDLB 4LFHG 4M7LL 4O51B 4PGBA 5ILTL 4M61B 1T0NA 2DMKA 1O7SA 2N7AA 5DUML 4G8GB 3CUPA 4KJYA 3QULA 3QXUA 4Y88A 4ZAKD 4J3OC 2W60A 4K7PX 4NQUA 3HMXH 2SEBB 3T2QA 4JN1L 3BPNC 5IHZB 1X4XA 3O4LB 4G6KH 4PLOB 1JPSH 1EFXA 3MV8A 4HKXA 2B2XH 4NGHL 4EEEA 4XWGL 2DDQH 5KOVC 4C56D 2V7HA 2DLFH 3O9WC 4JPWH 2XZZA 4NO5B 4YNYA 3JTSB 1JUFB 3HRPA 5KSAD 3N1MC 4EDWL 2R23B 3GFUA 1XCQB 2C4FT 2Y36L 4J23A 4LPXA 1OGAE 2X4OA 1NAKH 4QRSB 1QLFB 2GK0A 1A6VH 2AEQL 4ZTPL 1NFDF 5EIVA 3PJSB 4HUUB 4YQXH 1BIIB 4DOHB 5GGVY 4P9HC 4R4BB 4DVBA 3BISA 1Q9OB 2H32H 1CD1A 2CRYA 5K93A 3V4PH 4HBCL 1IGMH 4WTWA 1EK3A 2HJKB 4R2GD 1ZEAL 4R4FH 1P4IH 1NEZG 4YDJA 4P59H 4JM4L 4Q9RH 2HYMA 4YJZL 5C0BD 1LVEA 4HC1A 2PCPA 2X4PA 4AIZA 5D7IB 4EBQH 1A4KB 3S37X 4PS4L 4YUEH 5GRXG 1CFNB 2VR9A 1CDUA 5CBAB 3W39B 3VGEA 3LEVL 1JTPA 3QI9D 1H3XA 3OKKA 1RURH 2DAVA 4PLKC 4MJIB 3HR5B 3VXQA 5DHVA 5GRZA 4TQEH 5AD0A 3UDWC 3L1OH 4RWYH 3RWEB 5EU6E 1QBML 2FATL 3TVMC 2HT3C 4H20L 3R0MA 1KCVL 1JBJA 3QAZC 3L5WA 3FT3B 4WO4C 4DAGH 1CLZH 3GB7B 3TEUA 4L8SB 4LPVA 4LF3A 2DIAA 1ZTXH 3UTTB 1YMMD 2WWMD 4M7JH 2QLVB 2CJUH 5C0JB 3HB3D 3D0VB 1OM3H 3LV3A 3FQNA 4AIOA 3I02B 3WXWL 4MQTB 2P8MB 4U3CA 3VFTB 4ODVH 3R06A 2JK5A 4NT6A 4HS8H 3BN9C 2P24B 4UT9H 5EBGA 2FR4B 4Z8FH 3SGKA 3EHBD 5C0DA 5FYLE 5BMFL 5KW9H 4YR6A 5GGSY 2X4NA 4WY7L 5IVZA 3KXFA 1U2CA 1T5XA 3FB7B 2BNQA 4GKNB 1ND0B 2ZUQB 4BELD 1JWSB 4JFFD 4N90D 2X9WA 2VSCA 2OJEA 1VGKA 2X7LB 1PLGH 4BFBD 1MLBB 3P77B 3SDDB 3O3BB 3WN5A 3WFEL 4Y2DB 4LIQE 1ZGLM 1OW0A 2XKNA 3O8XD 4I18C 1RIVH 1QSFE 4OCWH 1SQ2N 4Z7OE 4G42A 4U1IA 5CS7A 5GJSH 2NZ9C 4MD0B 1J5OH 4NHUA 1WBXA 3UYPA 3KS0J 4G9FB 2IMMA 3WKNA 4XMPH 2VLJD 2H2SC 5ISZA 4BK5A 3DSFH 3OKLA 2FSEB 3J8F7 4D9QE 5KJRH 2P8PA 4P5TA 5C0CB 4UDUA 4OCXL 4GKZA 4H5SA 3CFIC 3E1F1 1M1SA 1N8ZA 3ECBA 2BSSA 5CP3H 3QG6A 3S8WA 3QXDA 1YUHB 3OHXB 1HHJA 5E1AB 3SDAA 1YC8A 2W65B 4MMXC 3TJEH 1HZHL 5BV7L 5IGXL 4EOWL 3SE4C 3JWOC 1E27A 1UWXK 5EU3A 3E6FB 5C0RL 3ARFA 4HIIA 1AY1L 1VFOA 4LMQI 4TTDC 1FYTB 1I7UB 3X3FH 2ADGA 5JLZB 1VGEL 5F3BB 1YNLL 5FOBA 2B20A 3ARGD 3QCUH 3ULSA 5DD5H 2FBJH 1JTTA 3ROOA 3ZDZF 3BAEH 4Y16D 5ICZB 2R0ZL 3QUMH 1WFOA 5EU7C 1EJOL 1GL4B 1I85C 5KVMC 1MFBH 3GMLB 1CFBA 1YN7B 4P23D 3LEYH 4F80A 1NUFA 5I8EA 3BP5B 5F1KC 1U6AL 5HD8C 3MLYL 3DVGB 4NWTL 2Q7YA 4EKXA 1U8HA 1IM3A 4DGIH 4S1SL 1G7PB 1PEWA 5T3XH 4OFVA 5KG9B 1S7RB 4UIKH 2BY1A 5IQ7H 3INUH 4XX1E 3BO8A 3TN0B 3BMVA 4N8CH 3L3KA 3CX5J 5FV1L 3D25A 1U93A 3ULUL 1JL8A 2G2RB 1BVLB 2OMNA 5ESVB 2XFXA 3DVIA 1E0OB 4HWBA 5D7KE 4OAWA 1J0JA 3IDGB 4NRXB 1RJCA 4N0CD 3VI4E 1WT5A 5E1HB 1JWMB 1EHXA 3WD5H 3LS5H 2XZAH 3RTQD 4D9LL 1MCOH 4G5ZH 5EUOE 4HFWB 2QSCL 1GRWA 4Y1AB 3B43A 4QTHB 4HMDA 5TQ0L 4HG4K 1OLLA 5IESL 1GOGA 2VLKA 4AH2B 3SKNA 3KWWB 1GAFL 5I1CH 2AI0L 3O45A 4RGOL 1WICA 4JRYA 1Q9LB 1MFDL 3MNVB 2PF6A 2MWCA 3G08B 2XWJA 4DGVL 4LGRB 4FTVA 4M6NH 4IOFC 5EIQA 3F6IA 4MCYB 4RQQB 4NJ9H 2O5XL 3PV7A 1PBYA 3X14A 4L8BB 3DTXA 5I16A 4LHUD 5SV3A 2R69H 5IW3A 3X17A 5C2BL 1D5BB 4ODWB 4CKVX 1YNKH 2EIBA 3OKDA 5ETUA 2EH8H 2JJSA 1BD2D 3BP7B 1FAIH 3MCG1 3OMZA 4X5WB 4JHBA 4MX7A 2A6IA 3UZEA 4I77L 5FCUH 1AGFA 2RCSL 5ID0B 2RGSA 5LGHL 1JV5B 5IQ9B 1E28A 4NWUL 5A3IC 1T89C 1S5HB 5JDJA 3RI5K 4XVSL 2VZ1A 3L3DB 3O4OB 1RMFL 2FHFA 4DZBB 3MLRH 4U6VH 5I18H 3EIFA 4LPTA 4RNRB 1OPGL 3V8CA 4NKOA 3IU3B 4LSUH 3ZL4H 3QPXH 3U0PA 2I60L 3TZVD 3QFJB 3RNQB 1EEYA 1O5DT 4S10A 1G9EA 5CKAA 2A6JA 1ORQB 4MJ6B 4Q97A 3Q1SH 3ZMRA 4D3CL 5JIPA 2PR4L 4NNYA 4QHKI 2X4RA 2MCPH 3V4UL 3MV9D 2IADB 3GMNA 4YXKH 1QP1A 4D0CA 3PWPB 4MS8D 5I17A 2VDKL 3OL2A 4X99B 5JA9A 1KELL 3OXRA 3NACH 1VADB 3QEGL 5E2WL 4L29A 3D39A 1G0DA 3F7PC 5IFJB 3LKPA 1EEZA 5GS0H 1CU4L 5IHBA 1U41A 1A2YA 1QFWH 4PJGE 3JUYA 4QOKB 2HFTA 1GJIA 5EOQL 5E9DE 1H3VA 2V5SA 3VRLF 3P4LA 2D3VA 4RZCB 4P2RB 3UTZA 3RL2B 3DVNA 5EU7E 1I9RL 4XWOC 4NKIH 4HH9B 3VW3L 1XGQA 4S1QH 5EWIH 2NXZC 2WUCL 1U2HA 5E0QA 4WI8A 3VXRA 5ESQB 1TXKA 3NCCB 5HGDA 2XWTA 1QLEH 3GO1L 4XNZB 2VIRA 3IJSA 1KGCD 3G04B 1YEGH 1QHPA 4DCQA 3F58L 4UTAH 5DEGA 4HPYL 1EA9C 4XXDB 3IAGC 3HCVA 2V2TA 4XP9H 1W0YT 4F8TA 3DUSA 1UH2A 4U31A 3KPNA 2ITCA 2H3NA 2RBLA 1Q0YH 1YJDH 2AK1L 4WFHD 4DUWA 1TZIA 4F7MA 3PUCA 3S35H 1A5FL 4GXVH 4PJXE 5BS0E 3STLA 4EVNA 2OI9B 2B4CC 5DMJB 1EO5A 1RU9L 1AXTL 1T21B 2O61A 4YEEA 4A2MA 2E8ZA 2YUZA 1F6AA 1XCTB 1S5IL 3ARBB 3OKYA 4K94L 5F7EH 4FFYH 1BJ1H 3U2SB 3P4OA 1WBZB 5T1KD 4QF1B 4RDQG 5GGUA 1OAQH 2NY6C 1FL5B 5JPMA 4M3KB 5CJBA 4BH8B 2YPLD 1AGDA 3BGMA 1Z0MA 2QR0A 2GJ6D 1PG7H 5E08L 2AXGB 4LRNH 4ZXBB 3REVA 3VWJB 2DQDL 2XY1A 1Q0XH 1AP2A 1I1FA 2MFNA 1X6LA 1FFNB 4NJAL 1VEOA 3KYAA 4QT5B 4ZYKB 2JB5L 1VKXA 5KSAA 1C1EL 3RPIA 2IG2L 5HGGS 2CUIA 5HI4C 4KQ4L 4ESKA 5FKPA 3EDDA 3V6FB 4Z76A 2VWEC 3TESA 1SJHA 2FWOB 5DRWA 4LSQL 4QRPD 1UH3A 4HKBB 3IDXL 5AEAA 2GCYB 4JPIA 1E6JL 1OAZL 4ENED 1QFWI 3I3DA 3DXAB 4WU7B 5F7FA 4QXGL 1WUNT 3L7EB 3QQ4B 2IAMA 4YDIL 3OKOA 1CG9A 2PO6A 3MRBB 3O6FD 1SVZA 1AH1A 4NQSB 3C60B 1OT2A 2AJXH 4OCMC 4L4VE 4V1DB 5F6IC 1KOAA 1UM4H 3UC0L 2ESVD 4POYA 1QEWA 2V2WA 5IBLD 4YH6A 5KZCD 3NFNB 1D5XB 5B38B 3RWHA 4OZFB 1T2JA 4IRSA 5KSVB 2BCKA 1QR4A 4RX4A 2XT1B 3NA9H 5ESAA 2BK8A 1FNGB 5ICYB 4X6FB 3RBGA 5DD6A 4KTDH 3ZDYE 2CKBL 3FN9A 1H3WM 2NTSP 3HE6D 4HXBL 3GUTB 3LKQA 3W9DA 3MLPA 4HKZB 5HGAA 2VERN 2W92A 3KPPB 1QD0A 3DV4B 1Q72L 1RUML 3R1GH 4KKCD 4TSAH 5DMKB 3HI5H 4R8WH 4Y5VB 1ZGLA 2OTWB 4X7TA 5FECA 4RMRA 4MHHI 1MJ8L 2DYPA 4GBXC 2J8UB 1NSNL 4IJ3C 4MNGE 1Q9KA 3DWTA 2DJUA 3J7HA 1TZHA 4C59B 4P2OA 2YR3A 3QISA 3JUZA 5B3JF 1G9NL 4JQVA 5GS2D 3D69A 3DUUA 2CLZB 5C09B 2CPCA 2H26A 5D7JD 1QSEE 2YA1A 3REWA 4WNQA 4H8WL 1N2RA 2C4XA 4UOJA 3QIBB 1X7QB 5I30H 5F89B 2M2DA 1GGCH 4DKFH 2A38A 3GSRA 2ATKB 3VFGH 4XNYL 2IEPA 3RKDC 4P4KD 4DJMA 3TBTA 3VH8A 3S34L 5DUBB 1T22B 4N0UA 2W91A 2J5LC 3GSWA 3KLSA 3PWUA 5CEZE 3AAZA 4U2YA 4JHZA 2ATPB 4MXWH 4BJLA 4LLVA 3ARTA 4LPYA 1J18A 3FQUA 2YZ8A 4JO3H 2VISA 5H37H 2GIYA 1B0WA 3P9MB 1T3FB 2YN5A 1DQTA 2X1WL 5F96H 3DIFA 4FQJH 4RSVA 1SEBA 2HTKD 4AQ1B 1K6QL 5DJ0A 1H8NA 3CX5K 1EH9A 2MQ0A 4PRNB 4I4WB 1BBJA 3MRKB 3C8DA 3QFDB 4QHNB 1JNHB 5JW5A 2J4WL 3EW3B 5FA3A 2V7NA 2CK0L 4PP2A 2DI9A 3PWLB 1M7XA 2V9TA 5BQ7A 4JY6B 4P2YA 4JQXC 1NC4B 1RZKH 4Z7QF 1UB6A 3CDGA 3MGAA 5EZLA 5L0QB 5BVJA 5TDNB 4KWUA 5GGSA 1BOGB 4QXTA 3P11H 1KBGL 3PHOB 1WZ1H 1BJ8A 4XNQA 3QZWB 3QJFB 1G9MH 2F53B 5L7XH 3S4SA 1ADQH 2VWEE 2XTJC 3MUJA 1HI6B 5DS8A 3MLZH 4L1HA 5D7LE 1LK3H 5I1AA 4CW1A 4M8QA 2B1AH 5E8NA 4LASL 5EO1B 4JHAH 5F7UA 5H94B 2WIIB 3TNNB 5J1AA 5F7HA 5EO9B 4HXAH 1LO2H 5JHLH 4KJQD 1BLNB 3B9DA 1HILA 2GSIB 4U4BA 4NKDA 1IAOB 3K2UH 5CGMA 2DQUL 5H37G 5I1DA 1HCVA 4MA7H 4Y8AA 5INCB 5F1NB 3VDBA 5CEXA 4XPFH 1BJMA 5FM5M 4NO0D 4MNQD 4Q9BA 4YAQB 4DGYH 1FGNH 3CMOH 4JFDD 2X1OA 3WFBL 5DD3L 4Q74A 4ZAKB 4X9GA 5I19L 2G60L 3V79C 1L7IL 1UVQB 1OP9A 4FQXA 2RHEA 3MRHA 3SCMD 2LE9A 5EU5A 4N0RA 5ALBH 4LLDA 4C56B 1SMOA 5AYUH 5IW6B 2CR6A 3ARUA 3U9PL 4X6CA 4D8PB 1FZKB 1PEZA 5D2LF 5SWSD 2XYCA 4YIQB 3B9KD 1QPPA 4ZOAA 3VXOB 3PGCA 1ZVSA 4M1DL 4DKEH 3QWRD 3QDJD 3VRJB 1CDBA 3FT4B 2AAVA 3EOAB 3IAQA 5MI0C 3SDYL 1QYGL 3PF2A 5CBEB 2WWKT 5FA4A 5HSFA 4XNXH 3NN8B 2XG5A 4O9HH 4XPHL 1OCWH 4LCYA 3ULUF 1R5WB 5DLML 1FZJA 4TSBH 1I8KA 3WE6B 2NXYD 4R2GB 2IALA 1MUJB 4M7KL 2EEDA 1JK8B 2C7UB 4U1SB 1AGCB 1D9KB 4MMZC 5IW1B 5C0BB 2G5BB 4MD4A 1JF1B 3BRFA 4ZUTB 4WU5A 2FGZA 5FHBL 2YZ1A 2N4IA 2WP3O 5MEOB 3I6GB 4K7PH 2B5IB 3RWFA 1NGYA 3QI9B 2J8OA 3EO1A 1MF2L 2QKIB 1A6UL 3WEXA 1GIGL 2AV7B 4J1UB 1JFQH 1U8JB 2ZSVA 3RHWF 1BQLH 5GRWA 1VENA 2R1WA 5TE7L 1KPRB 1HQ4B 4X7EC 1IKFH 3T0BA 5E8EA 1UYWL 4RAHA 1CR9L 3O6ML 1LWRA 2A9MH 2WBJA 3MZGB 5DK2A 1TITA 3HNTL 1IAIM 5DTFA 1IAIL 2M1KA 3V2AR 3NAAH 3MV9A 1U8KA 4S0SD 4NFDA 3CFEB 4HPOH 1YMMB 2VLRE 4PJBE 4X6CF 4ZS6C 1N6QL 2BX5A 5KTEL 3RJQB 4X5LA 4LCWE 1ZT1A 2RR3A 1FO0L 5LCVH 4LOUD 2NY5L 3C5ZA 4R3SB 1G84A 3S37H 4QHMB 3FQRA 2FEEL 2XNAB 4K23L 1YEFH 3D5OF 2XV6B 2DBLH 2AQ3A 1V7ML 1MQKH 4ZD3L 1KLUB 1JZ4A 5FUOL 1A1OA 3VMNA 1K4DA 3B9AA 1EX0A 4WJ5B 5EN2A 4JFFB 3D48R 1L6ZA 3I3BA 3WFHA 3JVGA 2EYSB 2L7JA 2F8VA 3DYOA 2IQAB 3P4MB 4GO6B 3AU1A 1F4XH 3DMMD 1OTTD 4YBQD 4ZS7L 2HT2C 3O8XB 1MJJA 2JELL 2HVKB 1JWUA 1MCPL 5IROA 2XTJE 5ACZA 5D1ZD 5KN5B 2YSSA 3QUXD 2VLJB 3VI3E 3MRPB 3EDFA 1LHZA 2IH3A 4HUMB 5TE6H 3L3OB 2FIRT 5IB5B 1F4HA 2YRZA 4JB9H 4KI1A 2DD8L 2FX9H 2CO7B 1ZOXA 3THMH 3ILPB 4JVPA 5HVWA 1CFVL 2JJVA 3LD8C 4MJIA 4OZHA 5KVFL 3HI6H 2Z93A 1KCUH 4ZUWA 3B2UC 5E6IC 2UYLB 4NPYB 3T08A 4OIBA 4HK3N 5HDBE 5AZEH 2DL2A 1FL6B 1FV1A 5FYLH 3EUUA 3RVXC 3LQZA 3NPSB 1S7TA 1VCAA 3D3VD 3KJ4C 5KSBE 3GHBL 4WENB 4ORGA 2X9XA 3CVHH 3VFVA 1MHEA 4NQDE 4CDHA 2F5AL 3AREC 4KK9D 5I1KH 2CRZA 4NN6C 2GJ6A 1IGCH 1B88A 1R5VB 2KL6A 4LNRA 2APVA 2V6HA 4RGND 5D6CB 4EI6B 5HHQA 3BIKA 5E24E 1AHWA 3V52L 4BH7B 3ARGB 2A2QT 4CN6A 4TOYH 5DK3A 1J88A 3G6DL 1U3HD 4Y16B 1HQRB 1ONQB 1U3ZA 2HJFA 4I2XE 1IL1A 4LSPL 3DARA 2CQVA 5DD0L 4PJ7F 2AS5M 3M1BB 4P23B 4MAYA 4W68A 2OM5A 1YEEL 3CSGA 4ZFFA 2K3TA 4KROD 3U0TB 1OVZA 3CFBB 5KVGH 1KNOA 1MEXL 3DURB 1FPTL 5D8JL 3TWCL 5ID1B 4HF5L 4JY5H 4N5ED 4Y4FD 1YNTA 4PB0L 5IR1B 2E9WA 3WUZA 2BDNH 4Q9QL 4OQ1A 4EDXB 3P3YA 3AM8A 1S9VB 1DP0A 2AJSL 3F5WB 4OLYH 4NZTL 4APQB 5IF0A 3JXAA 2R4RL 4ZFGH 2VL5B 4LARH 1BEYL 2KBGA 3O6FA 4U1JB 1I7RA 3QG7H 2VDPH 5ICXB 3QDMD 5C0GA 3ROLB 3MJ8B 2Q86A 3VWKD 5J8OA 5LG1A 3D2UA 4HK0A 5HYQB 4I9WE 4OZHF 3WV0A 3TC9A 2CKBA 35C8L 1DL7H 2HT4D 3E6HA 2WW8A 3GBLA 5F7DA 3RGHA 5C3TA 5FDWB 1AGEB 1JHLL 4P4RB 4W6WB 2Y6SC 4LCCA 5DT1L 2VZUA 4KGLA 2C9AA 3RTQB 3DECA 2R4SH 3BZFB 3LOWA 1C08B 3VG0L 1T03L 5A1AA 3SKMB 1A7PH 3M45A 5CLTA 3V0VA 3R8QA 3FFCB 1AD9B 4JG0L 2EXWC 2H2PC 2VZVA 4Z7UE 5E1AA 4QHUA 5BZWA 4N9GB 2BNRD 4X4ME 2C1PB 3MRJB 3QCTH 4ZFOB 3P9WB 2ZCLL 1K4CB 3PGFL 3MYJA 4P9HH 3HE6A 3AGVA 2CIKB 5JQ6L 2GJZB 1GYAA 1QVOB 2OR7A 2A83B 5DGQA 1A9BB 1MPAH 3V5DB 1BECA 4JCLA 5DK0A 1P4BL 3E0GA 1JF6A 3FFDB 3NFPA 1F02I 5HYSG 3WSQL 2NY4C 1HYSC 4LHUB 4I0PD 1FVEA 4Q9CA 4FG6D 1CK0H 3EJYC 2XICA 3HHRB 4OBRA 2JF1A 1TJHL 1BD2B 2I9LA 2FX8L 4UILH 1NGXB 1N6VA 1HIML 1RUKH 3MLTA 1ZT7B 2DLGA 3Q6GH 5CJQH 5I1EH 1DDHA 4NC2B 1T5WA 5D4QA 2VZOA 1UC6A 2ZSWB 5D7JA 1U8NA 1A1MA 2MKLC 2F54D 3MMEA 4JANA 3V5KB 2VLME 2F5BL 3MOAH 5TGBB 4Q6YA 2UZIL 4QTIH 3RZWA 3VFUB 1A14L 4OGZA 2J8HA 5IHUH 1A6ZA 5CJOH 1QTYT 4ZDHA 3VXUE 1MVUB 1FLTX 1CTOA 4BFIA 3TZVB 1BQHG 4HJJL 2W0LA 2DWEA 3TFKD 1OSPL 4XGZB 4JZJB 5F8QC 4U7MA 3CPLB 2VB5A 1MHHB 1VACA 3SGKC 4XBPA 2D9CA 1NBZB 2ADFH 4YFLF 3HUJB 3CXDL 1YYLL 1MH5B 1KACB 4TUJB 2HRPL 5DXWA 4JAMB 1A4JA 4M1CD 4X7SH 3IU4H 3PWNA 3MREA 4MJ5A 5DA4A 1XH3A 2ZZUT 2A9NH 1ZLWK 3MXVL 1NFDE 4K8RL 1FZMB 3RVWD 3VFNB 1OW0C 3FL7A 3MGTB 1EHLL 1Y0LA 5I2IA 2P49B 1IGYB 2DLIA 5FUZL 4GOSA 1DBMH 4AEEA 4PJ7B 3N50A 2DQIL 4DN4H 2J1KA 4I1NB 1GGIL 5E4EB 4P5TC 4ODTL 4Z7NF 5JW3H 3UTPD 4OLZH 5H35B 2H32B 1VFMA 5IM7A 5DFVC 3GI8H 4POZD 1GZQB 1ES0B 4JDVB 2AXJA 3BD4A 3FRUA 4X6DB 4U0RC 2OLDA 3S5LA 3AUVA 1G7LB 1A3RL 4PRAA 1F00I 3MACL 4ERSL 5DUPH 3MRQA 2BY2A 3HRZA 2KQMA 4FP8L 4OGXH 4P3DA 5IBUG 1S5HA 4NSKA 5I8CA 5L2KB 5FO7B 4RMSA 3OKNB 3QXVA 1NBQA 4X6EA 5E8PA 1T04A 2C3VA 2PUQT 3NABL 3RIAF 2W9EL 4OCSH 3SDCD 4XPAH 3RL1B 1Q8MA 1G6RH 5T1KB 3RWDA 2FJHB 2XG4A 5SX5K 4U6YB 1QQDA 4MNQA 1KEMH 1OGAD 1UQSB 3K74B 3GRWH 1KB9K 3DRTA 2YPLB 3HPLA 4HT1H 1ZLSL 5IG7A 3PDGA 4YDKH 5GGRY 4MJ6A 1TJGH 4PGDB 3VXTB 1Y6KR 1CXHA 5JOPE 1IEBA 4PV8A 3SCMA 4QGYA 4JFOA 3OJDB 3GK8H 3T0WA 1JYXA 4CVXA 5MENB 4JO1L 1F58L 4X4YB 3L5XH 5KBNC 1SJXA 3MR9A 1MFCH 3BZEB 4LEOB 2ARWA 1KPUA 1X5JA 1HYRC 3SO3B 2ZNWA 5TPWL 4XRCB 2Q7NA 1M7IA 4XCNA 5SWZA 3VGFA 3MTRA 5HHVH 4TULH 4W4OA 5GS1A 4TVPH 1A7NL 4QRPB 4RRPG 1JPGB 3T65B 1DBAL 4LSSH 1U8MB 1UWXH 5EU6D 4J3TA 1WT5C 4X5XB 5KSUA 1F6LL 3AFLA 3QUYD 4CMMB 2NR6C 1F90H 1ZHBB 2BRRL 3DETC 1Z3GL 5IMKB 2R2HA 3F7YA 2CDGB 2R9HD 3VFSB 5D9SA 4PV9A 1M71A 1MAKA 2ESVB 5J11B 3OX8B 4PG2A 3K0WA 5KZCB 2VITB 5DJXA 4L8CA 5I8KH 2A74A 4HUXA 5FV2A 5GIRA 1FG2B 4PJ8B 4XI5C 5DSCB 4PJIF 3QXTA 5IKCA 1SJVA 2V17H 2ARJB 1U8PA 2VR5A 5DYOB 4O2FB 1FO0A 4I13B 4KKBD 3ULVH 2DI8A 4JFPA 5FYLD 4L5FH 4XP4L 3H7LA 4OD2B 4IMKA 2HMIC 3ZDZE 2JJSC 4ONGL 4QYOA 2AV1B 3VRIB 3DBXB 3KXFE 2IH1B 3U83A 2BNQE 1NL0H 2VDNL 3KJ6L 4UQ3B 2MTPA 1MRFH 3GHEH 2DQCH 5DRXA 4ZFZB 3LB6C 5IFAL 3QRGH 1AQDA 3BPCA 3TT1L 5IVXB 4YE4L 1RQ5A 2Z4QB 5J3HC 1QSFD 5F7NC 1RY7B 3DHMA 1XZ0A 3BGFC 1OLZA 2LTQB 4MDIB 4UQ2B 1N5YL 1A3LH 1IT9L 4DW2L 4M6OH 1A22B 3WS6C 25C8L 4OJFH 5HI5C 2UZYB 3TO4A 4D9QD 3GMQB 1FNEA 3BP6A 4X98A 5EORH 4PIRF 1YECL 1RZFH 4NCC2 3NFSL 4ELMB 5GRUL 4K71B 5C9JB 1D6EB 5IMLA 1E4XL 3FQXA 5ALCH 1J8KA 1Z9OA 4LEXH 5CGYC 1CGWA 2EC8A 3G5VB 3FRPA 1D6VH 1RJYA 4JZOA 4P4KB 4JVUA 5EOCH 3MLSH 3FO2B 2BOCA 3OR6B 5DZOA 4BSVA 2IMNA 3PL6A 3BEWA 4WFFE 1DVFC 2BMKB 2FO4B 4LGPB 4IM8A 1FC1A 1AO7A 2AJYL 4WI4A 2NMSA 2Y1VA 1F2XK 3GSNL 4MA1B 3O9WD 3ZKXB 3FO1A 3LPGA 1RVFL 3TIEA 3AXLB 1N5AA 3ARWA 3D3VA 4PTUA 5GZOC 4H1LA 1H9VA 2DTML 5JW4M 2HH0L 3G6AB 4G43B 1YEHH 1QLRB 3G5YA 1UJ3B 4HUVB 3P73A 5C1MB 1W72B 4MCZA 1YDPB 5C7XH 2JCCA 4CUCA 4KVCL 2J88H 4P49A 3TBWA 1DSFL 1CGSL 1AI1L 4KMTH 1OTUC 5F1IB 1DQMH 2WBWB 1CXFA 5I66B 3QH3A 2ZOLA 5FKAB 1CDGA 5DRZB 4PRDB 3L5JA 5E2VH 2E5EA 3KNBA 1KIRB 3KPOA 3GMRB 5HVFB 3E2HC 3BDYL 4F7CA 1A9EA 3VE0A 4KK6C 5D7KD 1PQZA 4PLKD 3EYVB 4XP5L 4NZUH 4JFEE 3V6ZA 4DFHA 1CT8A 1LP9B 4E9LA 3BD3A 4HIHB 3JZ7A 4RMWA 4M00A 2R29L 3G5XB 3TVMD 5A40E 2LU4A 2HT3D 1CFSB 1QNZL 1T0MA 1S7WA 2ATKA 4WO4D 5E56A 3KLDA 2HWZL 4GAFB 4PJIB 1XGTB 5EIIA 3HS0A 4NO0B 5D70L 4HQQL 1FHGA 2ID5A 4JRYE 4PJHB 4JFDB 3A0OA 4GSDL 5DEFB 3WNMA 4UT6L 3RIFF 1NC2B 4FTVE 3O2VH 3WDHA 1KB5L 3CLFL 5GSVB 3PP4H 2ZOKB 3BN9D 1NCAH 3T1FB 4NQXB 2VE6B 2GTWA 3H42H 4OIIL 2BNRA 3BXNA 4K3JL 4OCRH 2EKSB 4UT7L 3IFPA 3QYCA 2JCCF 5SWSB 1KPVB 1NMBL 3UO1H 3B9KB 3BPLC 2HKHH 3S7GA 1RJZB 1M05A 4XCYB 2IAMC 1JPTL 4LNVA 3P0YH 4U0QB 3U1SL 2HRLA 1OP3K 2PO6C 3QDJB 1CIDA 4PG9B 4HJGB 1CFQA 5FAAA 1M7DB 4NRZA 3QIUB 1MJ7H 5DVOA 4U3XA 4MWFB 4I0PA 1H3PH 3U4EB 3HMXL 1C5DA 2OQJB 2AJ3A 2NXYB 2NZ9D 5D1QA 3P4NA 5AAMA 1S9WA 5HGBA 4LCUA 1JPSL 4N8VA 4JHWH 1J7VR 5FM8A 2H2SD 2DDQL 1HXYB 4IRSC 4ZNEE 4JLRA 2ORBL 2E7LA 4JPWL 1UXSB 1ZHKA 3LKOA 1BGXH 4PLJC 3WFDH 3ES6B 5J6HA 1Z6JT 2CDEA 3RDTA 1J1OL 5T1LD 5CIPH 1NAKL 2BVYA 3FOLB 2GUOB 4N1CA 2YUXA 5LXGH 3C5JB 3L7FB 4YQXL 4GW5A 3CCHA 4ACPA 1U36A 1X5XA 3V4PL 2HJLB 1IGML 4E41A 4FNLH 4LLWB 4R4FL 4G8FA 3LKNB 1P4IL 3LH2L 4TTDD 4WW2A 3V0AC 1MRDH 3MGOA 4Q9RL 1X5HA 1UM6H 1A0QH 4YHMH 1E4JA 1F3JA 5EC1A 3MRGB 3I75A 4EBQL 2DQTL 1IQWH 1T2QH 5JNYA 5E9DD 3MBEB 5AG9A 4PJDA 4YUEL 2FLRT 2IANE 1IQDB 1UVQA 3FONB 3CVIH 4P2OC 3ZHDA 4PR5B 4NN7B 1A6AB 2GEEA 15C8H 4JQVC 2OCFD 5CUSL 3MRCB 3G6JA 2DQFB 1YYMH 2PETA 4TQEL 3L1OL 3VFOA 4RWYL 5HD8D 3VXRE 4R0LC 5JXEA 4ZG1A 2MOVA 3AB0C 4OFYD 4TNVF 5MHSE 5J4MA 4Y5XB 1D7FA 3BQUB 4OGYH 5DMYA 4I0KA 4DAGL 2CIIB 1DLHB 5E99H 1J1XL 3SKOB 4F58H 5BV7C 4TUOB 5BS0D 1X5ZA 1FE8H 2Z31C 4NOFA 4QHKJ 4UU9B 5FO8A 3KS0H 3O6LH 4P5KB 3IXTB 1X5AA 3DMMB 1ZTXL 3UBXG 1QO3B 3SOBH 2CJUL 4I5BB 1JZ8A 1OM3L 2OYPA 1RZJH 2ZCHH 4FQ2L 3BJ91 4U1GC 3RNKA 1UCBL 5DWUH 2LVCA 1S7VA 4XBGB 5D1ZB 4ODVL 4U1NB 2NY3C 3EKCA 4OM1H 5BXFA 3QUXB 3I2CH 4HS8L 4UT9L 3IETB 4L9LC 2ZP0T 4IBLT 2QADB 3HLAA 3P9LA 1TENA 5GHWH 2VAAB 43C9A 4WW2F 3KHOA 1UZ8B 5BZDB 3WIHL 1NGWA 1XFPA 4G6MH 3G5ZA 1ZHNA 1TTGA 2YUWA 2I07A 3WLBA 4CMHC 4QRRA 4HDIB 5IJKA 1RIVL 4PJDF 4OCWL 4LPUA 3QUZC 4IOFD 4PPTA 1OGAA 5GJSL 1J9CT 1AXSB 4ONFL 4Z0BH 4PGEA 4NKMB 5CP7B 5CHNA 1J5OL 1XR8A 2R1YA 2WWKO 2AEWA 1BVKB 4XMPL 4R7DB 1MRCH 3G6JF 1S9YA 3ULUC 3DSFL 3FB8B 3HNVH 1PSKL 5KJRL 5FO9A 1U3JA 3SDXB 2ED8A 1FN4B 2D31A 5INDB 1IVLA 4M6MH 1N26A 2W1NA 5I6XC 3WUWA 3GKWL 1U3HB 3AY4A 2WK2A 5DJ2B 4U6HB 2GT9B 1HHHA 4PBXA 5FGRA 3WJLA 2VNCA 3VFMA 1K8IA 2HFFB 4RGMB 3HG1E 4DZ8B 4GG8A 3TJEL 4L4VD 4FZEH 1SJEA 5CSGA 4Q0XH 5A3ID 4WI5A 1T2XA 4Y4FB 1JZ6A 3VFWB 1LK2A 1E6OH 7CGTA 5HHXH 5T3ZE 3X3FL 3JTTA 2H8PA 4MQ7A 1EBPA 2Q8AL 4LSTH 4YHZH 5EZJA 1WSST 2YEZB 3QCUL 4YXHH 1O0VA 3QUYA 5JUEH 4HMEA 3BAEL 3QUML 4FQXC 3MA7B 1CCZA 1KXVC 3QDMB 5FGBA 3QCVH 3VWKB 3HAEG 1LD9A 5IB3A 1C7TA 2GK2A 5I75B 1G7IA 1JGVH 2IFGA 2BSTA 3KPRE 4WI2A 4WWKA 5HY9A 5I73B 2EDLA 2P8LB 1RUQL 5HHPA 1XEDA 1KG0B 3BVNA 3QO1A 4GQPH 4DQOH 3DGCR 5T3XL 1TLKA 1RIHH 5LBSL 5J13C 3N85L 3N0PB 2X4UA 4RIRA 4EUPB 3INUL 1XIWA 4N1HB 5GGRA 3ETBF 4N8CL 4FXKB 2V5YA 1DEEA 1A7QL 1CICB 3D1MC 1A7OH 2I24N 1KV3A 4P2QA 4LVHC 4JDTH 5F6HJ 5HJ3A 4XP6H 3BPOB 4XWOD 2X4TA 2MHAA 1NBVH 3LKRA 4X9IA 2H1PH 2ICEB 2NXZD 1QSED 3UYOD 1NCBH 1P53A 3TO2B 3WD5L 3I3EA 3LS5L 2Z91B 1X4ZA 2XZAL 1QSFA 2XXCB 3OKEB 1DQJA 1MCOL 3HE7C 3BH9B 2Y4SA 3D0LA 4XVTH 2V2XA 3VJ6B 1YN6A 5JR1H 5HVHC 2A73B 3CFJB 5HPMB 1S9XA 5CFHA 2EE9A 4QRQA 5I1CL 5CEZD 3VA6A 5MEPA 3X13B 2F54B 2MQCA 2DKMA 2WBJC 3M17B 1FRGH 5DHXB 4GAGL 3QSKB 1LDPH 4L4TA 3N1GC 3PHQB 3GSNA 1WC7A 4IOIB 1NFIB 5I71C 5HBBA 4GRMA 1T7XA 5JHDA 2NY6D 2QHLA 2DL9A 1HHGB 3IDYB 3LSOB 4CJ1A 5IFHH 1Z5LA 5D2NB 1FAIL 1HWHB 1WJ3A 3QO0B 4D2NA 3C5ZC 3KDMA 3RWCA 4JFYA 3B3IA 4LVNC 3KG5A 5FYKH 5KS9B 1YEDB 3IJYB 4ZOEA 1J87A 3X3GH 5E6YA 3PWVB 3RGVB 1I4FB 2EO9A 3MNWA 4KTYA 1OAYL 3W9EB 1L0QA 5HI4D 1LEKA 3MLRL 5I18L 4PRHE 2X1QA 1IBGH 4RAVA 5DZNA 3JVGC 3DRQA 4P46B 1TTFA 1HINH 5IB1A 5FK9A 3ULUE 1F11B 2NLJB 2D7OA 3UX9B 4K94C 3O3DB 4U1KB 1I1AA 4Z7OF 4LLMA 5D7LD 5TDOA 2H9GB 2Y5EA 4JY4A 3VXME 1VERA 4HUWA 2W9LA 1KEGH 2A6KB 4LLQB 3LZFH 4YHLL 2JLLA 1PZUB 4PJFE 1BREA 1CE6B 4OF7A 3CFKB 2D4FA 4FQHA 2IFFH 2I9TB 2Z35B 4YXKL 2G9HA 4RFOL 4OV6F 2YWYA 1KLGB 3LIZH 2E3VA 1U42A 2VL4A 1RIUH 3T0DA 3NACL 1JHKL 5EZIH 3BP4B 3FO0H 1OB1B 4Y7MA 5T1DH 2EDJA 2JIXD 5DF0A 5GS0L 4QXUH 4H0HB 1ZE3C 2D03H 4WW1A 5A43C 1KJ2H 1YPZB 3ME0A 1K8DA 5EUOA 3OGCA 4PD4J 1KB5A 4JG1H 4ODUB 3IRZA 4JFZH 2E6JA 1F42A 1NEZA 3WO3B 1J0IA 2IBBA 5DQJB 4NKIL 2OK0L 3SDCB 3Q3GA 2FX7H 2N7BA 2NTFA 4X9HA 3MA9H 1F4WH 1QLEL 2E7MA 3O6KH 2J3SA 1YEGL 2E9BA 4X6CE 2BVOA 3WO4B 3IFOA 1R24B 5D6DA 2UY6A 5FUCC 1PAMA 5ACMA 1T1YB 1HK6A 4XP9L 4FQCH 1B0RA 4MAYC 5KANI 5IMMA 1HSAB 2VXQH 4M7ZB 4PJAE 1ETZB 3H3BC 1EJ6A 1YJDL 4DK6A 3MRFB 5EA0H 3RWJB 2R56L 3QPQC 5EU4B 1IGJB 1RZGA 4FQ1H 4GXVL 4GBXD 5D71H 1A6TB 3HMXA 3NCMA 3QEHB 1BZ9A 4GG6A 1MLCB 3AM8C 3NMEA 4GXUM 2FL5A 3EAKA 5F7EL 4FFYL 1DFBH 2MSPA 3GSVA 4NQTA 3O6FC 4QCIA 3KPLA 1OAQL 1LE5A 1ZHLA 4NO2B 4PP1C 4JFQB 4OV5B 4KHXH 3OJMB 4GS7B 3CJJA 2UVFA 4OB5L 2C1OB 1ZSDA 3FB6B 5EU6B 2GHWB 4I48B 5J9PB 4LRNL 1RK1A 1B0GA 2JB6A 3QNZA 3QDHA 4GRWF 1I7TB 1MFNA 3VI4F 1P6AB 1Q0XL 4G8IA 4LCCC 1I8IA 3OBAA 1I9EA 5AUMB 4LCIH 1ZKAA 4F3FB 1I1CA 3GSQA 4AEHH 4Z7VE 3OXSB 2NQCA 1MHCB 2EDQA 1JHTA 5MP6H 4Q7DA 2BNUA 2XXMB 3PNWA 3LS4H 3WCYA 5EUOF 2AJVH 2R2BA 4Y4KB 2J6EL 3X11B 1U8OB 1XR9A 3LEXA 4H0GA 2VLRD 3S96B 3CC5A 4B50A 3LN5A 3STZA 2HG5A 2PW2A 3RIAK 3GGWA 4LCWD 3O4LE 4IMLB 3GDBA 4CVZB 4JN2A 3IVKA 2LV4A 4P2CG 3UYRL 3O11A 4U6YA 4GAYB 4H8WC 4HGWB 1KN4H 2MPAL 4XCFH 2AJXL 4S1DC 5E9DA 3CVHB 7FABH 43CAB 2BOBA 1KIQA 4Y89A 1UM4L 3ELAT 1XF5A 3A6BH 4GG6F 5JMRA 4UOW0 5DHVH 2PW1A 1INQB 1NMCB 1FJ1A 4M93B 4DOHE 4HIEA 1CLOH 1AFVH 1T7YA 3V5HA 3ZDXF 3VG9B 2XTJD 3B83A 1NLDH 4GT7A 4LEOA 3D87B 2L7UA 4PREB 3LQAH 3NA9L 1ZS8A 2PXYD 3TN0C 1IC4H 4AM0B 3CSYA 5E00A 4GUPA 4PGCA 1WCQA 3MV7A 4YHPA 3LN4B 4KTDL 5BJTA 3CFDB 5I1HH 3ZHLA 5HYSB 3GJFA 3IDNA 4HAFA 3C6LA 4R9HA 1D5ZB 4MJIE 2X44D 1FVDA 2FB4H 4CNIB 3WIHA 4LQFH 2IPKB 1IGFH 3TH3T 3R1GL 2F74A 2PYFB 4ODXA 2VABA 4YO0B 2NNAA 1R5IA 3IJHB 2NX5A 3LKSB 4NQDD 1MCRA 1N59B 2Y5TA 3GSXB 2A0LC 2P43B 2XA8H 2DQEL 5CD5C 3O3EB 5IV2A 5FB8B 1XF2A 5CJXA 1HWGB 3T4YB 1NJ9B 3ZKMC 4H25A 4O58H 4HHAB 1PKQA 3HZYB 3H6JA 3KPQA 2NW2A 4AIXA 2GW5A 4LKXA 4LBEB 1FBIL 5I0DA 1FDLL 3O9WB 3SKJH 2APBA 1T1WB 2IWGA 4PB9L 1EMTH 2IBGA 3S3PA 3NZHH 5CP3A 5L6YH 1W0WA 1X5KA 4J12A 4AL8H 5TH2A 5F88B 4XPTH 4YHOH 1HKLH 5FUCE 3RPKA 5LWYH 3KLHC 3LN9A 2K7PA 4KPHH 1G7JA 4MA8H 4QHLB 1RUAL 3EYUH 3M07A 1HHIA 3S88H 4G80A 1MHPH 1DTUA 3CSPA 2GFBB 4J8RA 4UZGA 3K4ZA 4IOSD 4K3HA 4JO3L 1WFUA 4X0KA 2LAAA 5DZLA 2VXUH 3KPSB 2VXVL 3QUMA 2VLLB 4EIGB 5DRNB 1LEGB 3ARDA 4I9WD 4KJQC 3WIFA 1NDGB 3ZT6A 1G0YR 4G9FE 1T6WA 1IZKA 4TYUA 1ZLWH 2X4SA 4LAQH 4UI2A 2FZ3A 2XRAH 1K5NB 4L3EA 1MIEH 3TVMB 1QBLH 3B5GA 3BSZH 3FQTB 3MUHL 3H7BB 4BUHA 1RZKL 1OARH 1DCLA 4FXLA 3O41B 4RA0C 2EKJA 1MNUH 4K7PY 4WO4B 1CN4A 4G6AC 3CMGA 3P11L 1A6WH 5HDQL 3B6SB 4DKAA 3RAJH 5DFWH 1G9ML 1HXMA 4OF5A 1ADQL 5F9JB 4FFVC 1DJSA 1EXUA 5IBUB 1CDYA 4ZS6D 3V8OA 2FIKA 1QBBA 3KVQA 3MLZL 2VQTA 2EIZA 1LGVA 3HZVB 3WL9B 3C8KA 3FJTA 2R0WH 3WS3A 3HC3L 5EOTA 1LK3L 4W4OC 3IKCA 4K3DH 4H88H 4QKXB 5GS1C 2B1AL 3V6OA 3OAZK 4LAJH 4G9DA 4AT6B 4N5UA 2EDKA 1LO2L 3RA7H 5JHLL 4L3CA 1MQ8A 1EHAA 4KKAC 4CBPA 3W82A 2FD6H 1PZ5A 4G8EB 5HPOA 1BZ7A 4Z0XB 2AP2A 2DS4A 3SJVA 3S98A 2EDXA 5SWQB 4XPFL 1TCRA 3QNYA 4PTTB 5SX5H 4DGYL 1FGNL 3K8KA 2HT2D 4I18B 2VLMD 4PG2C 1R3LB 2VDRL 3E3QC 4E42A 1CXKA 2EDWA 4B7LA 3LAFA 3T8XA 2OR9H 1XGRA 2KZWA 5JQHC 5F3HA 2G75B 1ZANL 3VXUD 5ALBL 1NANH 2HFGL 2OTUB 5AYUL 5D93C 5JPNB 1P5UA 1U58A 2EH7H 4O2CB 4GW4A 3LRHA 3FAXA 3VGAB 1S3KL 2NYYC 2NY5C 3K1DA 5T1LB 1T1XA 3B2UD 5E6ID 1WZLA 5C9KA 4DKEL 4UDTB 2A6DB 5JOEA 3ZDYF 4IMKC 3RVXD 1BBDH 5B8CB 1FH5L 4XNXL 5GGTH 2FBOJ 4TSBL 4M8VA 3ARED 1L7TL 4ZXBC 1JGUH 3O2WL 3VWJC 1N3NA 1GOFA 3PIQB 3S36X 4MSWB 3MRLA 1KJMB 4QRTA 4F7PA 2XPGA 3EZJB 4JJHA 5CZVL 1G6RB 1XGPA 4S2SA 1G0XA 4PJGB 5DQ9B 4ZSOA 1VFUA 4K7PL 1NEUA 4KAQH 1S8DA 5CSZB 4OFKA 2HP4A 3MO1B 3TLRA 3TO4C 3TPUB 1RZIA 4OUOA 4OIAA 3T0XA 1JFQL 1PKOA 1BQLL 1RJLA 3N9GH 5KVEH 3NGBB 2OP4H 1AJ7H 5D72H 4PRIA 1H15A 5TFSH 2CLRA 3DX6A 3EOBA 1HSBB 3GI9H 3DROA 4OGAC 5D7LA 4JFHE 4XBEL 4PJXB 4OT1H 5BS0B 3PL6C 5IEKB 1NGZA 1Y18A 4KRLB 4HPOL 3QHZH 5B39B 5IEHB 2VZTA 2QV2A 5IMOB 2APFA 1EFXD 1C16B 5AWNH 3WYRA 3ZYOA 5DJZB 4HS6A 5LCVL 4YGVA 5F7KC 4NZDA 3S37L 2X09A 3KYNB 3OSKA 4Y19A 2Y6SD 1Y6MR 1LNUA 4R7NA 5CEYB 1YEFL 3GMOB 2BXYA 4NUJA 1KTDB 3NZ8A 2DBLL 1GZPA 1MQKL 3MRNA 1EEUA 5TF0A 3WKMH 5JOPD 4R97C 1H8SA 3T4AB 2VDQH 3MCLH 4IRJB 2H2PD 5E8OA 8FABA 3QA3B 5FF6A 2Q20A 1FG9C 3MODL 2RJMA 3NH7H 1WZKA 4LL9A 4PJ5B 3SEPA 5FYJH 3PWPE 1QFHA 1IGTB 4X4XA 5DGRA 3MFFA 1CVRA 2BSRA 4NHCH 2XOTA 1CFTA 1VEPA 2JTDA 1WGOA 3O3AA 5DUMH 2NY4D 5SWZE 4JKMA 1U95B 4N68A 4JO4H 5TE6L 2UUDH 4QOKE 4JB9L 3EJYD 4GBXA 5I0ZA 3THML 2YD1A 3NBNA 2VQUA 3HI6L 4XWGH 3FQWA 1KCUL 3QWOA 4F7TA 3IGAA 1NQBA 4PJEB 4ZOCA 2RFXB 2CR3A 5AZEL 5M94B 5EBLB 4LPWA 4JKKA 2BERA 1AC6A 2CDFB 3DX9A 2Y36H 4L4VB 5DHYA 4D0DB 3O81A 2W0PA 3CVHL 1G7QB 1VSCA 1AKJB 1OQOA 2AEQH 5I1KL 2J6EA 3KR3L 3U46A 5SX4I 1IGCL 3IXAB 2QQLH 4K07A 1KYOK 3E3QE 4IHOB 3V0WH 4HBCH 1NLBH 5DMIL 1ZEAH 4X9FA 3GSUB 5LGJA 4JM4H 5T5FL 3QQ9C 2VRAA 4OBSA 5TE4H 3QZWG 4OLXH 2AQ2A 3PV6A 1W8OA 3L9RB 3PGDB 4U6XA 4XCEB 4MJ2A 5TDPB 3JV6B 4AY0A 1NMAL 5DC0A 5KVGL 3KXFD 2BVPA 1F8TL 4LKCB 2BNQD 3BKJL 4PJBA 1T1ZA 2N1KA 2VUYA 4CN4A 3EO0A 1FYHB 3IF1A 1FZOB 2BDNL 3QEUA 2XWBB 4LCWA 1BX2B 1IFHH 1KF9B 1QBMH 4I0CC 2FATH 1LEIB 4J3UA 5IBTL 3C6SB 4H20H 5JDSB 4NNPH 5C0AA 4NNXB 1KCVH 5EC2A 4ZFGL 4LARL 2BVQB 3L3JB 4HKJA 2GAZA 2VYRE 3QG7L 2VDPL 5D1QC 1JRHI 2P5EA 5T33H 1G6VK 2D4DA 3BHBA 4XPGL 1DL7L 1UXWA 1KJVB 2DKUA 1BFOA 2DMBA 1HEZA 4P5TD 2NXZB 4JDZA 4HWZB 2E7LC 1QSEB 1OT1A 1RK0B 3KHQA 3H0TA 1EO7A 1OSZB 3MRIB 4DEPB 1ZT4A 5C0FA 3RDTC 5DFVD 4NQCA 1T66C 1QR1B 1YMHA 3SQOL 2PXYA 5LQBH 1NDMA 3EDEA 4IS6A 4XVUC 4PY8J 3ZSSA 1U8QA 3WLWC 4WFFD 3RY6A 3NCJL 1QFUL 1ED3A 4K8RC 1HH6A 1NCCH 4N0YH 5LAXB 1N4XH 5DJAA 1BF8A 5DJ6B 1AO7E 2XI9A 1J8HA 2FJFB 5DD1H 4NCC1 4XNMB 3FZUC 5JMOC 3ESVF 4PJBF 1AIFA 4XC1H 3DGGB 4JGJA 1KSRA 2E27L 5ENWB 2VQ1B 4FMFA 5HHOB 4UILL 3QIWA 1RUKL 4QNPF 5JXEC 3Q6GL 5I1EL 4MB3A 2AJZB 3VFRB 2ADIB 1MCEA 1P2CA 3F7VB 4OZGB 1XF3A 2JCCE 4KJWC 3N1QC 5GS3A 4IIQA 2MJWA 3H8NA 1MCFA 2HN7A 3BESR 3UTQB 5IB2A 2P48B 3MOAL 4JE4B 5IGXH 2ADJB 4EOWH 3LCYA 4ODHL 2PYEB 1P4LA 4ODSL 5IHUL 2YBRB 1EUTA 5CJOL 4WFEE 3V7AE 1Q9WB 4KK8C 1D9KC 1N0XL 2EYTB 3LRSA 1I3RB 2YRPA 3ZHKA 4NIKB 4OD1L 4KUZL 1EAJA 3F12A 2FJGB 3T3PF 3QXAA 1V3JA 4YDLC 5C09E 3PE9A 1I3VA 5DJ8A 4B7IA 4D0BA 3VI3F 1AR2A 1BPVA 2ADFL 4NYLA 2NR6D 3GMPB 1NCWH 1V5JA 2B39A 3DETD 1MSPA 5B4MC 1C12B 1NH6A 2Y72A 4X7SL 1XF4A 4FMKA 4YPGB 3HPJB 3Q5YA 2A9NL 4NWTH 3BKYL 3KYMA 5HYJA 4JRYD 2JIXB 1AE6L 2YC1A 1YY8B 1CDIA 1ZA3A 5KSBF 5IJKC 4XI5D 3BW9A 2EC9T 4FTVD 4Z18A 3RVVC 3BKMH 2VXTL 2V5TA 3I6KB 4I3SL 1INDH 4JFXB 3WHXA 1DBML 4L8DB 5CIPB 4OLWH 2R1XB 1P84K 5EPMA 1VB9A 5HGHA 1EERB 5FM4A 4OZIA 3QDAA 1ZGLP 3U36B 4BSWA 2APXA 5JW3L 1B6DA 2HMID 4OLZL 3AY4C 3L6FB 4ELKB 5GJTH 5I76A 4YEFA 2BHUA 3GI8L 4KXZH 3WJLC 3C5SA 5EULV 3LB6D 2HKFH 1FL3B 2NY2C 3ZKNC 3PP3K 2AJUH 2YD6A 5DUPL 2QQNL 2R0LL 3OKMB 5J3HD 1WFNA 1JNLL 1P5VA 1IC1A 2QSCH 2W38A 4IJ3B 2AGJL 4XZUA 2HLFC 5HI5D 5K9QG 3K4DA 4RGOH 4OCSL 2OJZL 1T4KB 4NDMB 5D5MA 1J0KA 1G6RL 4DGVH 2HLAB 2V5MA 4N8PA 2ZPKL 1KEML 4HT1L 2F58L 4ZUSA 2P44B 2WP3T 3T77A 5IB4B 3GJEB 1TJGL 4TN9A 2ZJSH 4YK4C 5CGYD 2Z92B 4ZUUA 4U7KA 1AGBA 1GGBH 4WWKC 4F33B 5C2BH 1RSFA 1KFAH 5C07A 4A6YL 3HNSH 3GK8L 1A1NA 1NBYA 3TBYA 1T7VA 3EGSA 3LY6A 5DJYA 2HVJB 4NM4H 3L5XL 4JZNB 2J5LB 1DVFD 2CUMA 5BRZA 3VGDA 4I77H 4E41E 1XIWC 3C9NB 2RCSH 1S7SB 1ZA6B 4JJ5B 3S4SG 4P5MB 5MEQA 4NWUH 1RZ8A 1WLHA 1I3UA 5EUKB 2IAND 5HHVL 4OZIF 4TULL 5EZOH 1OHQA 2LVEA 5GRJH 3TP4A 4TVPL 4KQ3H 2VLRB 1RMFH 4PUBL 4KMLB 1INEH 3MCKA 4EIZC 3TNMA 4MB4A 4F7EA 5CCKH 2XN9A 3VXRD 3DX7B 2B0SH 5CWSB 3G6JE 4MJ4A 3V4VH 3H9HB 4RAUA 3VXSB 5JO5A 1AD0A 1F90L 3IDIB 4GKOA 1KC5H 2DWDB 1OTUD 5DQDH 2FGWL 5GZNC 1ZWIB 2DF3A 5EU4A 4PJCA 3GNMH 3TPKA 2VDKH 1A6TA 3BIAX 4EQ3A 3B2VH 4UIMB 1KELH 3FMGL 2FNBA 5E2WH 2XTJB 4KK6D 4APQC 1FFPB 4BM7A 5CILH 3U0WH 1CU4H 4XH2A 4TRPL 4J3WA 1T20A 1SYSA 1U8LB 1XGUA 2M8XA 3KYOA 4KU1A 5F1OB 4MXVF 1VFAA 5ITFB 5K9OA 1I9RH 2OL3L 3UJJH 2Y25A 3VW3H 1NL0L 4ZQKB 2WV3A 2R0KL 3GHEL 2DQCL 4ETQA 2AXFA 3L3GB 1GGTA 5CMAB 3GO1H 4LHUG 3PABA 4NP4L 3QRGL 1NGQH 3KPMB 4NM8H 4LSVH 2PKDA 3F58H 3BH8B 4HV8A 1DE4A 4HPYH 2WINA 3B5TA 4NQDB 1QSZA 4QRRE 5E2UH 1MI5A 1LO3H 4WGVB 6FABH 5FYKU 3BE1H 1AR1C 3EJJX 5IK3A 1JN6B 2P5WA 4ONHA 1RZFL 4U6TA 4NC1C 5I1LB 1KN2H 4EXKA 1QKZL 1I1AC 4I2XB 1MCLA 1SYVB 4RMTA 4N0FB 3BUYA 2Q76B 3BEVB 3TCLB 5ALCL 3U7YH 2IAMD 1K2DB 4LEXL 3FCTB 3HG1D 4NQEA 2PO6D 5J06A 1D6VL 1I9JH 4F9PA 1HDMB 4E0RB 4PJCF 3CK0L 5EOCL 1CTNA 3MLSL 3WDJA 3RBSA 2UWEB 2FYYB 5BOPA 5T3ZD 3CH8A 4FXGA 4N90E 1P7QB 3GKZA 2DQDH 4NJAH 2Z8VC 2OXHA 4IRSD 1QUNA 2GJJA 2ITDA 2JB5H 2IG2H 4RX4D 1T0PB 1GC1H 3QDGB 3TT3L 4KQ4H 5IJVB 4KH2A 4PLJD 3H9SA 5F72S 5TF1H 1N7MH 3QT2A 5I8OL 4HZLB 3KPRD 5T3ZL 1X44A 3M8OL 4MNHA 1YY9C 1E6JH 1U92B 4W6XB 1SBSL 5C7XL 1GH7A 2GSGB 3CDFA 4JZJC 4ISVA 1R3HB 3PDOA 5D6DC 5F8RC 4PBWD 2J88L 3F8UB 5IWLC 1QBAA 3RY5A 5C70A 4Z7UB 2JJWA 4KMTL 3MV11 1DQML 1JJUA 2EYRA 2X70B 3HI1B 3TBVB 2DYPD 5E2VL 3UC0H 4AENB 3GIVB 4HS3B 4P57B 4P2OD 4F37F 3FOMB 1IEAA 1X5YA 4XMKL 5JXAH 3BDBA 4LDEB 4P2QE 1IAKA 4O2EA 4HSQA 1TVBA 4Q6IB 2EECA 4PY7B 2X89D 2C26A 2VOTA 1A64A 1XF1A 3GSOB 4WIQA 1BQHA 5F9DC 5E4EC 1UZ6E 5T1MB 5GGVL 4ZUVB 5I1IL 3RZCA 3HZMA 4HXBH 3TJHC 1B6UA 3EFFA 1E4KC 4ZPVB 1DQDH 2Q8BH 3RWIB 1A02N 2Z31D 4OKVA 4Z77A 2D7TL 4E5XA 32C2B 3T2NH 5L88L 5DJCA 5CJ5A 1Q72H 3X12B 3UPAA 1JNJA 4RFEB 3O2VL 3EYFB 1ACYH 1HHKA 3D85B 4AK1A 3MRMA 4MA3A 4L4TE 4YHNB 1GHFH 1IC7L 2NY3D 3PP4L 4GKSA 1NSNH 5ADOH 3MRRA 4IDJH 3H42L 3CZFB 3VXUB 1U8IA 3MNZA 3TA3A 4WV1A 3IDJA 4OCRL 4HIXL 5JHDE 1MWAA 4WUUB 4ZPTB 3MBXH 3TCXA 1P7KB 1G9NH 3UO1L 2ICWA 5JW4R 3FTGB 4WWID 5E6IB 4C83A 3OTTA 3P0YL 1XMWA 4C4KO 2NW3A 4EI5A 4Y4HB 3FO9A 4F2MB 3PWJB 3KJ4B 1DEDA 2AABH 1MJ7L 1KJ2B 3I85A 4NQVA 1OF2B 1S7QB 4LLYA 5E5RB 4PRHD 3QUZD 3BZ4A 5FGCB 4XNYH 2IGFH 3AREB 1I1RA 1NFDB 2D7MA 3FFCE 4FFZL 5F93C 4Q2ZB 2A77H 3BFOA 4DN3H 5GS2H 4NN5C 5J6GA 4JHWL 1CVSC 2YPVH 3ULUD 1NAML 1ZAGA 5EBWA 1RUPH 2AKRA 3CH1A 3U6RB 1S7XA 3SO3C 1IM9B 5F44A 3VCLB 4NC1E 1L0YA 4X6BB 3WFDL 1BGXL 4WFGE 3DX8B 1D5MB 4F57L 1DQQB 1I9IL 1WWAX 1FORH 4XVJH 4X7FC 1CXIA 4BYHA 1KXQE 1K6QH 5E95B 4CADA