3U7YH

Structure of nih45-46 fab in complex with gp120 of 93th057 hiv
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
222
Chain Sequence
b'EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRGGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIH45-46 heavy chain, Ig gamma-1 chain C region
publication title Increasing the Potency and Breadth of an HIV Antibody by Using Structure-Based Rational Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 38
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2011-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u7yH01
3BGAA 4NO5B 4QRPB 2IBZY 5C0FA 2XQYG 5EBLB 3D0VB 2DWDB 3C5JB 3N9GL 3NCYP 4EBQH 1F58H 3BUTA 3ZTJH 1ETZB 4Y16A 1JFQL 3MRFB 5F1SA 3Q6GL 4ETQB 4XNXL 1DN0A 5CGYC 4E41B 5I1AB 1H3WM 3UDWC 1MJJB 4S1SH 5JOPD 1T0MA 4XBEL 1MELA 2Q7YB 1S7XA 4WTZG 3KS0H 3P4LA 1HH6B 1T1WB 1DZBA 8CGTA 5C07B 1ADQH 4GG8B 4I18B 4D8PB 5E2TH 3PGCB 3ILPA 4P9HC 3KHOA 3P11L 1YJDH 4QXUH 3ZL4L 5ILTL 5DJZB 4YZFF 5H8DA 3WFHA 4RWYL 5B3JE 3L5JA 3IS1X 1U8QA 4BFBD 2BZDA 2QR0A 5B39G 5ICYB 2E9WA 3QCVL 5GGRB 2EIZB 3QG6A 1N8ZB 1WQVT 2DQHL 4RBPH 3ARPA 1H3PH 1QG3A 2FR4A 1CLZH 2V17L 4R0LB 1QD0A 2PYEA 2XTJE 3GSQA 4PUBL 4JO2H 3SBWA 3N9GH 4LIQH 4LKXA 2CSPA 4O2FB 3U7WH 4M6MH 1JFQH 1V5JA 2IFFH 1SVCP 1PD6A 1IARB 1JRHL 2YKLH 4OUOA 5IW1B 4F37F 2EDFA 3Q6GH 4Z5RB 3GSOB 2WIIB 4YHYC 4NC0B 3GMQB 4R3SA 3HE6B 4PIRF 1NBQA 1A1MA 2PR4H 3OR7A 5L0QB 1VKXB 4PGJA 3QULA 1AHWA 5ID0A 15C8L 2BHZA 3ZYOA 2OP4L 3ZL4H 4ODSH 1J5OH 3MRQA 5AD0A 1NCNA 4KZEH 5C09D 4GKSB 1MLCA 4FZ8L 2X10A 3AREC 1U8MB 4NO3A 2D4FA 1H5BC 2FBOJ 1KCUL 1NC4D 5IB1A 3LEVL 4ZQKB 2G5BA 1IM3A 4CUCA 1MRCH 2X2YA 2DJSA 1BHGA 5IMLA 2VLRB 4X5WB 2I5YH 4QCIB 2V5RA 2ICWJ 5DQJA 5J6HB 4HKBA 5I66B 3TC9A 1WFNA 2AXGB 3FO0L 3FT2B 4K55A 1FGNL 3Q3GA 1U93B 3VH8G 1VHPA 2W91A 1FV1A 5TF1L 1FJ1A 4I3GA 4PJAF 4OIIL 3RAJH 1IGIH 2IG2L 2C4XA 3VMOA 3UC0L 1LE9B 3TFKD 3D39E 3CFIC 1K5NB 5CGTA 2JJTA 4LEXH 4OFVA 2EDYA 5D7KE 2AJYH 4ZOAA 3W0WE 3RGVB 2Q20A 4PJXB 5MI0C 3VFGL 3TBTB 2CK2A 3HMXL 1HHGB 2FECL 1SMOA 2MKWA 2Y72A 3KPSD 1DBKL 3BP4A 3IFNL 5K9QI 2OL3H 4LMQI 4QTIH 3UMTA 4MJ2A 4ZUVB 3TT1L 1YEGH 2X4TA 3L3KB 4P4RA 5HVFB 1QBBA 1Z6JT 5DJ2B 5DMGD 4U1GB 3BKCH 3LEVH 3DXAA 3MJGX 1SMAA 1F6AA 1D6EB 5ANME 3VJ6B 1D5BB 4K07A 5D2LE 4Y5YB 3IU3A 5DEZA 5DUPL 1UXWB 3VDBA 1HEZB 3ZE2F 3GHEL 4LLWA 5AEAA 4WVRA 4JGMA 4PJGF 3FJTA 2LVCA 1J1OL 3HG1D 4ERSH 4LDLB 4RMVA 4ZXBC 3S4SG 5IGXL 3FRUB 3HI6L 2X89D 2E7LA 1NDGB 1BFOA 1LO5B 3GSRA 3ESUF 1MFCL 1KC5L 3QFDA 3MGAA 2HFEA 4XP6H 1GPOH 2C9AA 5EUOF 4XP9L 3UJIH 3OXSA 3VE0B 2VISB 1A5FL 3QFJE 3QIUA 4WU5B 5DJXB 2WBJD 3CFBB 3KYKH 3KS0J 4RAVA 3TNMB 2HG5A 3MBXL 5K9KA 1CBVL 5KS9F 3X3GH 2O26U 3CXDH 1FNSH 3KPSA 4JCMA 3KPLB 4PJ8C 4XPBH 3C09B 1WZKA 2B4CC 4YXKH 1OARH 3BEVA 4FHBD 4MSWA 5JA9A 5IW6B 3ZE0F 3JSSA 2DQGL 3CLFL 3MA7A 3B9KD 4NNXB 3ZDXF 3RWCA 1G9EA 4BK4A 1FCGA 1UM5H 1L7IH 3CPLA 4Y1AD 1OD7A 4AEIH 3ARBC 4YWGL 3GHEH 2FEEL 3EAKA 5ACZB 4X0KA 1CL7L 1KLGB 1FVDB 1BBJB 1F3JB 5F3HB 1BBDL 4KGJA 4CVZA 3KPMA 1BM3H 1EO8H 1HILA 2D2OA 2X89A 3EUUA 1ORSA 2NXZB 1OWRM 2VB5A 4G9DB 2IQAB 2LABA 1EFXB 3WHXB 2FYYB 4UQ2B 3EZ8A 4XVJL 1VGEH 2VDNL 1AXTL 4OCXH 1NDMA 1XF1A 4XMKH 4R96B 4XWOD 5KG9B 2YEZA 5FO9A 1KIRA 1IM9A 1OCWH 1UH3A 3MBXH 4B0MM 3F6IA 1CBVH 5TE7L 4GXVL 3U4BH 5AAMA 4P46B 5CEXB 1TQCB 3E3QE 1QA9B 4OQTL 4S11A 4XPFL 2AGJL 3K74B 5EU6E 4ZD3H 3WJJC 5CZVH 4ODHL 4F80A 1WBXA 1LO3L 5FYKE 1RZGA 4XBPB 3MCG1 4KHXL 5C2BL 3B9KA 4UOW0 4R26H 4KKCC 3CX5J 2P5WA 5C0JB 4PJIE 4GAGH 2Q3AA 2EEDA 3W81A 1D5XA 5I1HH 2OMNA 2J5LC 3SDAC 2FNBA 2ZUQC 5D7SH 5KJRH 4X7FC 2GKIA 5HHXH 1ULVA 1MWAL 1TVBA 1UVQB 3GM0A 5DSCA 1TXKA 4PJAB 3QIBD 3T2PA 3P0GB 3HB3C 5EO9A 3CX5K 1HK6A 4K23L 3WLWC 4LPCA 2IAND 2DKMA 5I1KL 2VDNH 4PG9A 4TUOA 4NM4L 4XGZB 1EMTH 3TZVB 5D1XC 1M7DB 1HHJB 3C8KA 5TJWK 1YYML 2XA8L 5DEFA 5BV7H 5DLML 3UZEA 3V5DB 4F7EA 3F58H 2AEQH 4OQTH 3BP5A 2HVJB 3T0VA 5IQ9A 1G9NH 5BCAA 2W65B 1QR4A 3G08B 5AAWA 3NZ8A 3QPXH 4HWZB 2WWKT 1BF8A 3DSFL 5DJ0A 3RY5A 3MXWL 4DK6A 4RX4A 1BZ9B 2EH8L 4NNYB 5A43C 5DT1L 2V5SA 4XPAL 2C1OA 1H9VA 5DURB 1BEYL 3OX8B 4LFHD 3DYPA 5DGRA 4LLDB 3IAPA 4PJGB 3K8LA 3B43A 4ODWB 4HDIA 4Q9RH 3GI8L 4QTHB 4I3RH 4P4KD 4I48A 4TPRL 3GSNA 3DHMA 1JZ5A 4LL9A 4UT9H 3VU2A 3CAFA 3QUXD 4JFFB 1ZLWH 3T3MF 5CS7A 3AVEA 4YBHA 2IANA 3JV4A 2DQTH 5B21A 5EUOB 3D9AH 5DQ9A 3ZMRA 5CILL 1XCQA 4NM4H 3VWJA 4BJLA 3T77A 2ZSVA 5GS0L 5C9KA 4G7VL 3W82A 3UTPE 2IGFH 1CVSC 4FQQA 5D4QA 3ABZA 2GITA 3BSZH 3DRTB 3RY6C 3UBXG 1W2KT 1K6QH 4PP2B 2I9TA 3PQYA 3BRDA 3RVUC 4MQ7B 3ROLA 3WIHA 3BPOB 1YUHA 1N3NB 1S7SA 4NSKA 4F7PA 1Q72H 4R4FL 5AWNL 3TH2T 3IU4L 3K1DA 3WSQL 1ITBB 1SY6H 4DN4H 1NEZG 3SKNB 5A3ID 1VEMA 5DT1H 2C4FT 4NN7C 5KOMC 5FYJD 1MRDL 4FQXB 4IJ3C 3MO1A 4LVHC 1REIA 2JK5A 5EU7E 3SOBH 2R1YA 1T7ZA 3H8NA 3F8UB 1FDLL 1HOCA 5ADPH 1L7TH 3GI8H 5KTEH 4OLXH 1A1NA 1E6JH 5IOPB 5FECB 3TVMB 4U1HB 3BH8A 3QUXA 1J11A 5DUBB 1ES0A 3LQAL 4NZRL 2AEPH 3QUYB 4LSTL 1AGDB 4IIQC 2VDLH 4MQTB 2APBA 3RWFB 1AGEA 1KTRL 2YPVH 1MWAB 3VWKB 1AD0B 4W4OA 4BFIB 4M5ZL 4XCCL 5CILH 4Z0XB 5HDOA 4Z7WE 4S2SA 3MRPB 1M6OB 4MS8C 5GS0H 1V3KA 2KL6A 5B8CA 3BO8B 1L6XA 5FB8B 4XVSL 43C9B 3QCTL 4QWWD 1PAMA 4MNHB 5E9DB 3G6JB 4GG6E 3ZTNH 3PDOA 4Z7NF 5IB2B 1F13A 2R4SH 4N8CH 1U92B 6FABL 3UTZB 3ZLQC 4M9OA 5IBLC 4DUVA 5AWNH 3IU4H 5BQ7A 3PWJA 1B9ZA 3GDBA 4P9HH 1MRDH 5BVJA 1I7ZA 2R9HD 3HE7D 4X5XA 5E99H 3V6OA 4APQC 5BZWB 2QV2A 2XZCL 2GJZB 4FTVD 1FDLH 3TCLB 4F57L 3NFPB 5J13C 3VXQA 2VAAA 1U8JA 4HUMB 3WV0A 1A6VL 4KKBC 2YPKA 3O3BA 1U9KA 4F33B 1IEBB 3O41A 2WP3T 4YFLF 4FXGB 4LSTH 1FYTB 2HLAB 3IFPB 3OG4B 5FGCE 3RI5K 1P69B 3QISA 2YPLE 4LVOC 4QHNA 1BOYA 3K2UL 1A7OL 1PKQB 1BIIB 2VUOA 3QJFA 4YO0B 3QRFM 3ARYA 4Y2DB 5ACLA 4C55A 5KVDH 4KJWD 4MD5B 1IAOA 3T0EC 4XCFL 1UZ6E 4NQSB 4NO0B 5I1LA 5F89B 1XH3B 1SVZA 3BDYH 4K8RD 2AXFA 3BQUC 4DAGL 1PSKL 4BSVB 1TLKA 3ES6A 1UG9A 2V7HA 3ARUA 4YBQD 3M8OL 2NY4B 1FPTL 4H1LH 4RMSA 4GAYA 4XX1E 1VGKB 4OZ4A 2Y36L 1RIHL 1JZ4A 4JVUA 5EU4B 4EXPX 2FGWL 4X6CF 4DGIL 1MRFL 2BXZA 4FQIH 3ZDYE 2XZCH 2YWZA 4FTVA 1DQJA 3MCLH 4NBZB 4Z6AT 5I73C 4IDLA 1P7KB 2P44B 4X6DF 3S3SA 4J7RA 1I7TA 2YD8A 1NMCB 1XGTB 4GRMB 4XHJC 1XZ0B 3IKCA 2JLLA 1LDSA 1Q9WA 4N0RA 1RUPL 1F4YL 1FFOB 5HYFA 1N6QH 3K2UH 3JZ7A 5TE6H 1EGJL 3EOBB 4PG2C 4CU7A 4IRZH 4XPTH 1I3VA 2X4RB 4DFIA 3B3IB 1IGTB 1DLHA 3ALXA 1VEPA 2X44D 3DO3A 4HGMA 3SDXE 5F7DA 4DEPC 1RVFL 4WFGD 3UTTB 1VDGA 2ADIB 3HE6C 1S9WB 4KQ3L 1Z0MA 5INCB 4JRYE 1PKOA 4UILL 3TPUB 1J1PL 1ZLWK 4LLQB 1KLFA 5L0QC 2YD7A 5E2VH 4I2XE 4KFZC 1RUQH 1RIHH 4U1LB 4N0FA 4YUEL 3GSXA 1XGRB 3PHQA 1G0DA 5LXGH 4L4VE 4MB4A 5F1KC 2BP3A 2ZUSA 2XXMB 3QUZB 3TO4D 1WEJL 2XPGB 2Q76A 1OTUD 3I75B 1PZ5A 4UDTA 2F19H 3FTGB 1Z9MA 4KI1A 2Q87A 4BKLB 5T1KD 1QSEE 1JHKH 1JPGA 2GTWA 2G9HA 5DD1H 4MCZB 5IFJA 1F4YH 1CFNB 2X4NB 5C7XH 5GJSH 5IROC 1QLEH 4ORZC 5DHVH 5MENE 1MI5B 2VDKL 4PR5B 4RAUB 4H0IA 3OKDB 5F6HI 1JNJA 3GMPA 4HMCA 4TYUA 4Y4FC 2YC1B 4E0RB 5L2KB 2PO6C 3QEQB 1VFAB 1G6RH 5FYLD 4AL8H 5GS1A 1EZVX 5E5MB 3OR6A 3SQOL 4M4RA 2R2BA 3ARFC 5K93A 5JOFB 4UILH 4OM0L 1IL1A 2J8UE 4QRRB 3S35H 1CFBA 5ISZD 4JZOB 3KPQB 5IB3B 2F74B 1A47A 5GJTH 4NJ9H 4J3XA 3T4YB 4JY4B 5M7QA 1T6VN 5EU3A 5ESVA 5CIPB 4JFPA 1M7XA 2CR6A 5MHSE 4DCQB 2GHWB 4YHNB 4OZFG 1UB5A 3TN0B 2UV3A 3VFWA 3TO4A 2LE9A 1WTGT 1WEJH 5IB4B 2X09A 4HPOL 4CDGC 1FZJA 2B4CH 3GSVB 2QQKL 2XQYK 1CXFA 3BZ4A 1MHCA 1ZSDB 3QUMA 3LKSA 2X41A 3TGXA 1YY9D 4PJEA 2KQMA 1GOHA 1T2JA 1CR9L 1UH4A 4Y4KD 3MLTA 4B7IA 2P4AB 3SGDI 3IDGA 3HC4H 3S36L 2ZPKH 5EOTA 3O3AA 4KY1H 1T22A 4Y8AA 4ZOEA 3MRRA 2Y9RT 4KJQC 1PX4A 1D9KD 1FL6B 4P5TB 2KZ1B 4CN1A 2Z35A 3IFLL 3DV6B 5EG6C 3BP7B 4RMWA 3GSUB 5ICXB 1Q0YL 2R0WH 3VXMD 1JZ8A 1P7HL 2F53A 1G0XA 5ISZA 4MNQD 1QSFE 5HDQH 2M26A 4L8SA 1XF2B 4Q9CA 4YGVB 4CDHA 3C60B 5D7IB 1SYSA 1R5VB 2EE9A 4X6CB 5DJAA 4U6YA 1JTOA 3TIEA 1MVUA 3CUPA 5DJ8A 4FQLH 3MOAL 4DN3H 1JWUA 5CJOL 1B0WA 3GSWA 1YEJL 3OV6A 3HC3H 4P2OD 4GKNB 4X6DB 1A6AA 4HPOH 4PRNB 3REVA 3HPLB 3EDKA 1LK2B 5HYSB 3OAYK 4Q9BA 3RUGB 4GAJL 5I8EA 5K9JL 3ZYIA 4LOUC 5KVEL 3D5OF 5IW3A 2I27N 5EOQL 4JANA 3OAUH 1AGBA 2WV3A 5DRZB 1NUGA 2CPCA 2R2CA 3H7LA 1HH9A 1I1AA 4X99A 4MJID 4PV8A 4R2GC 4U6HA 1T1XB 4G6KH 3HAEA 1T20B 2OBGA 4D3CL 3BPNC 3BUYA 4GQ9H 2ZSWA 4F7TB 1GZQA 5SWQB 1EX0A 4PJ5B 1A14H 1Z5LA 4WEBL 5HDLA 4M61A 4CVWA 2R4RH 2D7OA 1OB1A 1W0YT 3MPCA 2J6EA 5MERB 3RDTA 2HFFA 1CLCA 3P0YH 2C7UA 2HKHL 3GJEB 4YDLB 3QPQC 4RGNC 3PWVA 3AB0C 3S7GA 1J05A 4L3ED 1NFDA 1JF1B 3RPKA 3SGKA 2BDNL 1TJGH 4DGVL 3FAXA 1HHIB 1U6AH 3D3VD 4PGDA 3E6FA 1X5KA 1ZEAL 5K9JH 1CFTB 3ARGA 5D9SB 1YNTB 3HUJE 4XRCB 5E2UL 2FLBT 5F3BB 5E8DH 5IV2A 5IQ7H 1GOGA 3ARZA 3EW3B 4H8WC 4KMQA 3P4NA 3O6FC 3W5NA 4KHTL 4RRPG 8FABA 4HEPG 2XWJA 3DVGA 2ADGB 5MEOB 5DUML 2PUQT 3DO7B 5T5NG 4DW2L 5DVOA 1U36A 1Y18A 2EH7L 2EYRA 5DMKA 4FQ1H 1A3LL 2B1HH 4P57A 3C8DA 4WEBH 1XT5A 3RTQB 2EYTB 1UJ3A 3VD5A 2H6PA 5MEQA 1KCVH 3SDCC 1T5WB 2BNQE 3MRHB 4KROC 4EN3D 5IVOA 4G6MH 3KDMA 5F7UA 4L8CB 2IQ9H 3ZKMD 1CG9B 2NY2C 3WFEH 4WI7A 3KYMA 3MNZA 3D3VA 2X70A 3QWQB 2GW5A 3R1GH 3MUJA 1L9MA 1VFBB 1KEMH 3SDDD 5E4IA 2VN4A 5INDB 3QXVA 3AS2A 5FHAL 4NFBA 4QHKI 2Z9TA 2OZ4A 3Q6FA 4OLUH 2EXWC 4BZ2L 3L3OA 5E94A 4QOKD 1RD6A 2GCYB 1S3KL 1DEDA 3QXDA 4MD4A 4QHUB 5E1AA 3CX2A 2NY3B 1KJVB 1FORH 1ZANL 3HHRB 4UI2A 4WWKD 5GS2D 2RAMA 3KJ4C 3MRJA 4TNVK 1KIUA 3BAEL 1A3LH 3WKML 1NC2D 5JW5A 4FNLL 1CXIA 1SJHB 5B38A 5C08D 4WEMB 4PRHD 2AW2A 1UWEL 2DLHA 5I71C 3C6LD 3FQTB 3L5WB 5F71A 4DTGL 4HUXA 5CP3H 1VFUA 1XF5A 3PG2A 5I1GL 1E4XL 2APVA 4YHIB 3QAZC 4HWEL 5E6IC 3L5XL 5GRVK 4TNWF 6CGTA 4Z95H 3IKKA 4PRPD 4J1UA 4KTDH 4NP4L 3ILQC 1W72L 3DBXA 1M1SA 4DUWA 4KUZH 1WK0A 1YMME 3SDDA 4BSWA 1BLNA 2DTMH 4JFZL 2V7NA 3BMVA 2NY6D 5EC2A 1OOAA 4PRIE 1KN4H 4NQED 3SO3C 4GRLB 4M8QA 2A6KA 4RGMC 4BZ2H 3N50A 2AQ2A 3NGBC 3PWNA 3GUTA 2EO1A 1CFQB 1S3KH 4ZTOH 5LQBL 5I8CB 4EUPG 4P2RB 1IC7L 3N1GC 3QUYC 3N85L 4WWKA 1EDQA 3BAEH 4LASH 1UJTA 1NC2A 3WN5C 5BS0E 1KFAL 1GVIA 2L0DA 2AJZB 1F11A 2EIEA 4NKOB 3UTSB 1HHHB 3FQWA 4OLEA 3WLBA 4HHAB 3CVHL 4LCWB 3TA3B 4KI5C 1H8OA 2FSEB 4UBDD 1KENL 5D7LD 1JF5A 4NQCB 5AG8A 5I2IA 4JFEE 3C5ZC 4JPKL 2XA3A 3NH7L 1M7IA 1QRNB 4NHUA 3PE9A 5D7JD 3BYTA 2B7DT 3KLAA 3IFOB 5EZJA 2WUCH 3ZHLA 4HKZA 1OGAA 5CINL 4WJ5B 4JFZH 4IMKA 5GSRA 1T04B 5DVNA 1GGCL 1ZT1B 2R39A 3RL1A 3DTXA 4UAOC 5ELIA 5BOPA 5JO5A 4F7MA 3EFDL 2NX5E 4U0QB 2E7HA 4YDIH 4NKMB 4U1KA 4E5XB 1I85A 2XN9D 1HXYA 1L0QA 4HSQA 5LQBH 4LAQL 5TF0A 2P43B 5ID1B 2HLFD 1IC7H 3DMMB 1R3LB 3ARWA 2JKXA 4M48L 3B2VL 4YHZL 2GUOB 4GBXD 3BPLB 1T3FB 4FFZL 1KFAH 4G80B 2MQ3A 3W9EB 4Z7OF 3PHOB 4G8GE 3G6AA 4NQXB 2HKFH 4YHLH 5GRZA 2MPAL 4KK5D 1EPFA 2JIXD 1DR9A 2OLDA 2YOCA 4JHBA 4AENB 5KVGH 5D7LA 5KSVA 5HI5D 3NH7H 5E03A 3H9SB 3HRPA 3IDXL 4N5EC 1B0GB 1LEKA 2L7UA 3BI9X 3EIFA 4FS0A 1YPZA 2H32B 2A1WL 4HK0B 1W72B 1H3UA 1WAAF 3INUL 2IEPA 2ARJB 4JN1L 3QHZH 5DQDL 3RWJA 1N6VA 5E0QA 3KNBB 4U6TA 2W92A 3MR9B 2DYPB 1JK8A 2DL9A 4MJ6B 1LK3H 2CLRA 3MV8D 5JXAL 4IOSD 5D2NB 1CK0H 1U3HD 5JXED 5JMRA 2ILLA 3T1FA 4YHPB 1XAUA 2JJTC 2LTQB 4HJ0C 1H3GA 4GBXA 2BVOA 2HT3C 4WFHE 4UQ3A 3WD5H 4E41E 4V1DB 3DX7B 1CDBA 1FZKB 1RUML 4W6XB 5E8EA 1MFAL 3KPTA 4EVNA 5JHLH 2JIXA 5F1NB 2DQUH 2X4OB 4C56A 3D1MC 1ZLVH 1KUMA 4HS3A 5C07E 1NCAH 3RHWF 4DKFH 3NIFF 5FA4A 3VFTB 2I26N 4RZCA 3CVHB 2DBJA 4NKIL 2VABA 4MXWL 4EI6B 4P2QD 1TMCB 5I8KL 5DMJB 5CHNA 3ULVC 3JTTA 1MJ7H 4JPVL 5TH2B 1NCBL 1ZVHA 4P23D 3DWTA 4JFQA 4EI5D 3WXWL 2QADC 4JPIB 5C0DA 1GGIH 3UPAA 3WNMA 3INUH 3BPCA 3IXTA 5IHZA 1H15B 3C87A 1KULA 2YBRA 1CDIA 4BFEA 3WUZA 1F97A 2XKUA 3MV8A 3MGOA 3LY6A 5JXAH 3S97C 2QSCH 5FV1L 2XTJD 1AP2B 3NA4A 5E95B 4OZFH 5JXEA 3TFKC 3DGCR 3OB0H 2E9IA 1D5ZB 3VW3H 4IRJD 4X9FA 2KKQA 2X7LA 4KH2A 4KRPD 4AM0A 4XMPL 1FAIH 1T89C 4UTBL 4LEOA 3EJYD 4R6UA 1EUUA 4XPHH 2BC4B 5LBSH 2OQJA 4R97B 1G7HB 2YUZA 3MRIB 3ZKSD 4BQCA 2R1XB 4XXCC 4G6FB 4KC3B 5BRZB 1OAKH 5J9PA 3UPRA 2ZUVA 2CDEB 2N1KA 4YAQA 3B9AA 3D69B 2ICWA 3CZJA 2AV1A 1NCBH 3WE6B 4G8IA 1UWXK 3RVVD 4R4ND 3VFVB 1KJMA 4XVTL 2AK1L 3V7AG 5F8RC 5IMOB 3Q0HA 1T7VA 4XNMB 1A02N 3IXAB 1TZHA 4ACPA 4AIOA 2HT2D 2VLRE 4ZODA 1CT8A 5CFHA 4D0CB 3CVIL 3BHBB 4J3UA 4ONHB 2WM0A 1AQKL 1P7QD 5IBTH 3HZMB 1Z2KA 3AGVA 4WO4A 4M7LT 4KJYB 4XAWL 4NZDA 3ULSA 2BVUA 2ATKA 4ODBD 2WAHA 1HDMB 3IDMB 3LN4B 2BNUA 4YPGB 2WBJC 3OQ3B 1AJ7H 5CKGA 3HPJA 4ZUSB 4L4TA 3ZHKA 3F12A 1QVOA 2VH5L 2D7PA 5ETUB 4QF1A 3D87B 3VXNB 4K7PY 3RNKB 1ZT4B 1X4YA 3Q1SL 1RHHB 3FB6B 4JREB 4PJXE 5D7KD 3W0WD 3QNYB 4WI3A 4MAYA 4TSCL 5D1ZC 5GGVY 3NBNA 1E4WH 2DQJL 2GSGA 4PTTB 3UJTH 2XZQH 5T1LB 5HHOB 1S7UA 1MFNA 3WUWB 3C60C 4LRNL 5FOBB 2A74B 3O2DL 4PGEA 4PY8I 4UTAL 1D6VH 1P2CB 1NL0H 5JPMB 1IKNA 4ZAKD 3HC0B 3H7BA 5KSBA 5I17B 1YEFH 2NY0B 2W9LA 4UT6L 1H8SA 5TDNA 3TV3H 5JNYA 4K7PL 3QG7H 2ADFL 1AR1D 5DR5H 1P7QA 4YH6A 1NCWL 2HP4A 3LEXA 3T8XA 3LDBC 5GGVL 2IPTL 3MJ9L 3IJSA 1T83A 4YEEA 2NR6C 4XWOC 3UAJD 2ZCLL 4NHCL 3E2HC 3IS0X 3UPCA 4H8WH 2GQHA 5A2LH 3RL2A 4WRLA 2P8PB 3G5VB 2KPNA 4LHUB 4YLQT 1INDL 1K8IB 5F9OL 4YDKL 3D39A 4H26A 2VXVH 3VRJA 3QFJD 5BO1L 3U4EB 3CH1B 3OF6A 3QA3A 1NGWB 4IMLB 5IM7A 4Y89A 4ODXB 5CSZA 3LKRB 4MYWB 2LV4A 3I9GH 4Q0XH 1BAFH 2QQQA 3BIBX 5FA3A 5L9DH 3CFKB 4UTAH 2EYSA 2P8MB 3MROB 3G5ZA 4KJPD 2V2WB 4X6BA 3BISA 3UO1H 4I0PB 4RNRB 5EBGA 5ERWB 1CFVH 1A6WH 5C2UB 1KACB 5MEPA 2VLKE 4P5MB 5CD3A 1OAUL 5EUKB 2GSIA 3NOIA 4LCCA 4PTUB 1ZLVK 3QCUH 3QIBC 3EYFB 5FK9A 1T21A 4U1SA 5D2LA 1NCWH 3NVQA 4DKEL 4JQXC 4OBRA 1U8LB 1RIVH 1OW0A 4ONFH 3QZWB 5BJTA 4U1IA 3TYFA 3O4OB 5LGJB 4G43A 3X3FL 4K9EC 4NHCH 1OAXL 3QXTA 1BQHA 3PGDB 2CLZB 3WFCL 4HS8H 2ZUYA 3RU8L 4NQDB 1FNEA 1NGPL 1XIWB 2W9EH 4WI2A 2CUIA 4QO1A 1INDH 4NUGH 3QDAA 2APFA 1FH5H 4X7DC 4LFHG 1A9EB 1JF6A 1YEIH 5EU5A 5ESAB 3S37H 4HK3J 4JR9H 1P1ZA 2Y1VA 3NTCH 1NGQH 1IBGL 1I1YB 3L3IB 1LQSR 2R0KH 1EXUA 4N5UA 4U1MA 1FGVH 2V5TA 3O4LB 3PWLA 4IOIB 2BOCA 5F1IB 3RTQC 5HPMB 3FN0L 1FIGL 1CF8L 3RIAK 5LAXB 5EU6D 3MBED 2CK0H 4HUVA 1YDPB 4QRTA 5T3ZL 5E08L 4M1GH 4P4KC 2FJFB 4O4YH 5IESH 5FYKD 1DP0A 3CZFB 1EEYB 2Q8AH 3O8XD 4B53A 2VE6B 1Y0LA 2R2EB 5L2JA 5E8NA 2IAMA 1FFNA 4JO1H 1CYGA 2EDDA 3X3FH 3PWPB 4PJAE 3WFCH 1BX2A 4UV4L 3WMSA 1G7LA 4HKJB 3FONA 4GS7B 2YR3A 2V5YA 3V0WH 1J0KA 3Q5OA 1S7VB 5E2WH 3ZKXC 1RZJL 3WXVL 2QHRL 2VR5A 1A6ZB 1G0YR 1IGCL 3AUVA 2HTKC 4JJHA 3VGDA 1I3GH 2OL3A 4Z7VB 3FOMA 1IBGH 1X5FA 5D1QD 4HIJB 5FF6B 5A3IC 3D25A 3GEWB 1OD9A 3MC0A 3M17B 5C0AB 4KKLD 4EUPH 5I1IL 5EU6A 3MBEA 4J12A 3NZHL 3DUUA 5I30H 4MDJB 4HKXA 4PBXA 4WUKL 4M6OL 5EPMA 1K4DB 2OJZL 1G7QB 3OL2A 1UQSA 3PP4H 2BVPA 2BSSA 3O8XA 1MJ8H 1RURL 3E8UH 5CJQH 4PJIA 2XWBB 2BRRL 3NCJL 1BVLB 4A6YH 2BHYA 1GH7A 3AXLA 4CVXB 3TBVB 4I13B 3T65A 4GRLC 5SWSE 1Z0NA 3LKPB 5CP7B 3QDMB 3U7AA 1QPXA 4N0UB 4NO2A 2Z93B 1DUZB 4AIZA 4IRSA 1A7RH 1W0WB 2PTUA 4QWWC 5EUOE 5JW4M 5C0FB 3CDYA 4GSDH 4OF6A 1AY1L 3MGTB 4JKPH 3WXVH 2NXYB 5JQ6H 3T1WA 4Y16B 3O2WH 3ALWA 3BP6B 3CLEL 1CGUA 1X5JA 4HUWA 1DN0B 4PJ7F 3OTTA 2OTWA 5D1QA 5JIHA 3A6CL 2OR9L 3CU1A 1T0MB 2NTFA 2ZUWA 1ZHLA 4PYHA 1S7XB 3HE7C 4XAKE 1UB6A 4KMTH 5I1IH 5KVMC 5GGUA 1VPOH 4KV5F 3ZE0E 1WWBX 4IEFB 4M6OH 3RWEA 1LILA 1TJHL 3ILPB 4UB0H 1BGXL 3HCVA 4MB3A 2HRPH 5TE4H 1ERNA 4BH7A 1XR8A 3L7FA 4LF3B 2BRRH 3NCJH 2OJEA 1YEHL 4X6EA 4UT7L 1N0LA 5IMMA 3EOTL 1L6ZA 2QR0B 3GIZL 2V9RA 5FCUL 2XOTA 1DVFD 4LNVA 1YC7A 3KPOA 3QG6B 3H3KA 1U0QA 3RWHA 2VLJA 3F7VA 2P24A 4KJWC 3HNTL 1KPVA 3I6GB 2FR4B 2QL1A 2HRLA 4X98A 2PYEB 3NABL 3GSQB 4QXGL 2ZG3A 3VXUE 1AY1H 4MA3A 2LU4A 4XPGH 2VN7A 1A8JH 2CKNA 1LDPH 2LU7A 2WSKA 4ZOBA 4PGCA 1WFUA 3CLEH 3CC5B 4MQSB 1INQA 4XTRD 3WCYA 2HH0L 2HFTA 4KI5E 3A6CH 1UA6H 4DZ8A 4R3SB 1JWSA 4LSVH 3KPPB 4I5BA 5E9DE 3G6JE 1A1MB 2WQ8A 3EHBC 3DX9A 3GMMA 3OR7B 4CL7A 5CWSA 3IJHA 1JV5A 4QNPF 3QULB 1IKFL 1AHWB 5ID0B 2ATPA 2O61B 2ZUXA 3V4PH 3MRNA 4M1DL 4MWFA 1NBZA 4WHYG 3VCLA 5HYJA 4HIEA 2FO1A 1A6TA 5LCVL 3MRQB 5AD0B 3GMRA 1RZKL 3VGEA 3RP1A 3OXRA 2ICWI 2CO7B 3BGFB 4NO3B 5GGSA 4LPTA 2A6DA 3LS5L 1FZOA 2JJSA 5FUCE 1INEL 1DVFA 2G5BB 1IM3B 4K3EL 1JL8A 3IF1A 4NM8H 4YDVA 3S5LG 1CQKA 4LCYA 4NN5C 1T7WA 5IMLB 5FDWA 1FYTE 3B9DA 4YK4B 3ARQA 2A9ML 4EDWL 5DQJB 5C86A 1QLRA 4H20H 2ZJSL 1TITA 2X1WL 2YPLD 1PKQE 3W11D 5HY9A 4OQTA 1OF2B 3Q3GB 4OFYD 3TJHD 3NCEB 1IEAA 5F7HA 4CADA 1FV1B 1FJ1B 2R0LL 5DFVD 2FX8L 3IVKA 5I8OH 2BMKA 1J8HE 4LQFL 3QXWA 2W60A 4ZFFA 5J11B 3HZVA 3I6KB 4MA7L 3WHE1 4GG6A 2LVEA 1AIFA 1IKFH 2EDLA 5HGAA 12E8H 1CLYH 3P4OA 3GFUA 4LLVA 1AC6A 5FUZL 2DI7A 4HGKC 1JPTH 5C0NC 3W9DA 5JZ7D 3Q2CA 4O9HH 1B0RB 4ODTL 3BP4B 2FX7H 4S0TD 4O58H 2EDQA 5L7XL 1S7WA 2FL5A 5JDSA 2X4TB 2YZ8A 1ZXQA 3MRGA 4M1CD 3DXAB 4HWBH 1ZE3C 1TDQA 3UJJL 4K3EH 4Y0GA 3T3ME 1F6AB 1FFQA 1KPRA 1ONQA 4NZTL 4Z18A 3IU3B 2VZSA 3UX9B 1GGBH 4Z8FH 4PFEA 2ZJSH 1VESA 5C9JA 1P9MA 4NWTH 3PL6C 3U0TB 4N68A 5KSAA 2F54A 2CKBH 3ORJA 3SE3A 3ARDB 2VWEC 1I3RA 1WWCA 5KW9H 1FAKT 4WU7A 1BFOB 2EDTA 3GSRB 3FO1A 4LRIC 3L3JA 2IC2A 3P30H 3S6CA 3UTTE 3EJZD 3QFDB 1QQDA 4H88H 3WJLC 1OQXA 1HXMA 5FO7A 4RGOL 2HFEB 2F5BH 1SY6A 4JG1H 4UU9A 2BY3A 5E8OB 3OXSB 5T5FH 1K3IA 3LD8B 4YHOL 4JRYD 5HHQA 1RUKL 3QIUB 3ULVE 1QFUL 1UM4H 4CMHC 4MX7B 4WUUE 4RAVB 1BWWA 4BUGA 2HG5B 1CICD 4FFYH 1HYSC 1CS6A 4UZGA 5K9KB 5L6YH 2KBGA 2X40A 2H1PL 1MHHA 3GJFB 3SJVA 2FJGB 2D7TH 3HAEG 1YY9C 4LP5A 4L4VD 2YA1A 4QGTA 3BEVB 3MSPA 2FX9L 4Y4KC 5F96H 4MSWB 4K71B 5AZ2H 1HINL 1OP5K 3CGTA 3MA7B 2VZ3A 4MAUL 3RWCB 3CPLB 1A6UL 1QSED 2GK2A 3IDYC 5CLTA 2DQCL 3GSNL 2B2XH 4Z7UB 1D9KC 3VRLF 1F45A 4R90L 1XR9A 4IOFD 2BNRB 4X0KB 4HXBH 4XNUL 2DQIL 3P0VH 5DFTA 4MD0B 3ZHDA 4CVZB 4RFEA 4WCYL 4K3DH 3KPMB 2PW1A 5MEND 5CEZL 1HILB 1VADA 3UDWA 1ORSB 5L2KE 1NGXA 1CTOA 4OT1L 5IB5A 2YRLA 3EBAA 4ZUTA 3VGBA 1N64H 3HTLX 4LGRB 4KU1A 1LO4L 2HT4C 2CDGA 2RCSL 4QRRE 1NDMB 4P2OC 5C8JA 4Z7QF 4J3WA 3S34L 1RZIA 1KIRB 4PJBA 5FO9B 3PIQA 1IM9B 3WS6C 5DRXB 1PQZA 4WTZA 4ZFZB 4JDZA 4JREC 3U2SA 3MACL 2X1QA 1W0VB 4LSSL 4TN9A 1E4KC 1N4XL 2YD4A 3BT2L 4BH8A 1UEMA 1HINH 2VQ1A 1RZGB 1C16A 3TIDA 1KIQA 3B9KB 4PJ9C 4PPTA 3SCMC 4NJAL 3WO4C 2P5WB 4PJDE 1A6UH 1CDGA 1QSEA 3B8YA 1D5XB 5B39A 2PKDA 1MLBA 4YC2C 4QXTA 4XNUH 3KJ6H 5HVHB 4Q9QH 4OD3L 4XHQA 4LHUG 1E28A 2UZYB 4GMTL 1TVBB 5DSCB 5B4MC 4NUJA 2QBWA 4YNYA 5EO9B 5EBMB 2QTEA 4K9EH 2EE3A 2C3WA 3FQUB 1FBIL 3U46A 4MXVF 3HNSL 1R6VA 5IVXB 4K7FA 1X3DA 3R0MA 4PG9B 2Q7NA 4TUOB 2CLVA 3BH9A 5F97E 4XXDA 5FKAA 1OSZA 4Y1AE 3C8KB 4OB5H 4WI8A 5D7IE 2ZKHH 4X6CE 5E2JA 4WW1A 3FB7A 5DEFB 1NGZA 3MA9H 2H2PD 4F7EB 3FO2A 3AREA 2AABL 1OTSD 3BP5B 1H5BA 3FRPG 5IQ9B 2VKWA 3I50L 3ARSA 1N4XH 4X6DE 5DJYA 2FDBP 1JNHA 3I3BA 3NZ8B 1MCWW 1U91B 1UCBL 5FYJL 5DJ0B 3VFNA 3RUGE 3SE9H 3QZWG 4NJAH 1CXHA 4JZNB 2Y23A 2XV6B 3RIFF 5K59F 4AG4L 4X6FA 4X80H 4FXLA 4HDIB 5D5MA 5HVGB 5FO8A 1RIUH 4I48B 3GSNB 3GZKA 3O4OC 1NAKL 1IT9L 1QFOA 1WFTA 2E5EA 4FQCH 1A7PL 2D0GA 3VH8A 3MUGA 3NPSB 3JV4B 5DQ9B 4M62L 3VXSA 1XCQB 4EN3C 5D71H 1LO0H 4HH9B 1JGUL 3VWJB 3T77B 1YNKL 2ZSVB 3U30C 3ZKMC 1QSFA 1MY5A 5A1AA 4FQQB 2NY1B 3SKMA 1TCMA 3VI3E 2GITB 3SKJL 3ET9F 3H9HA 1P4IL 3K8KA 3HLAA 4FA8A 3MJ8A 4Q6IB 5C71A 4TSAL 5CBEB 3BEWB 4W6WB 2I9TB 3OKKA 3PQYB 3ROLB 4OZIE 1YUHB 1MCNA 1S7SB 4NSKB 4PV9A 5C1MB 4F7PB 2DTSA 4LVNB 5DHVA 5LGHL 5SX4H 3ARBD 3EO9L 2Y4SA 3MO1B 2R1YB 3I2CL 3UROR 1HOCB 4ZXBA 1G6RA 2ZP0T 4RMTA 2YSSA 4WHCA 1Y6NR 1A1NB 3TO2B 5F72S 1JGDA 1S5HA 5EWIL 1KPUA 2WK2A 3OPZL 5T1DL 3BH8B 1AFVL 1ES0B 3FQNA 4NQVA 3WIIH 3C6LC 1MEXL 2BFVL 3S4SA 1KT2A 3NIDF 1QPPA 4S2SB 2BXYA 3ALPA 2IBZX 4JZJC 4K8RL 3K1KC 3CDGA 5B8CB 1B6UA 4QLRA 5KBNC 3EOYG 1DBMH 4ZTPL 4PJ8A 4X4XA 2PNDA 3SN6N 4DVRL 2ZCKL 5E70A 3LOWA 4Q7DA 1CE6A 5BXFA 2BSTA 2NY6C 1T4KB 2NY7L 3D2UA 2BNQD 2HJFA 2EE6A 1CZ8L 3UXFA 2J7LA 5AZEL 1ACZA 2VR9A 4ZSOE 4LHQB 4OFIA 4P59H 4EIZC 4KKCD 1U41A 1AKJD 3UTQB 2X4PB 5BQ7B 5TGBA 3MLVH 3PWJB 4PBWD 3N1PC 2ORBH 2DBLH 3ARBA 1I85C 4HPYL 5ITBL 2CRMA 5EIQA 1I7ZB 5BVJB 3HUJA 1F00I 1IAKA 1ND0B 3I2CH 4S1RH 2PETA 2W9DL 3LRHA 3VXQB 3KR3L 5I74C 4F58L 1U8JB 4HXAL 5DJDA 4OUUA 2YPKB 3O3BB 5T1DH 1IC5L 1AFVH 1J0IA 4L8DB 3O41B 1DQLL 2BHUA 2BFVH 4HBQA 4NDMA 2A6JA 4PJEF 4UBDC 4TVPE 4X4ZA 4BZ1H 4K8RH 4HT1L 4YHKH 1IAIH 3QJFB 5D7JC 3V52L 2YUVA 2LFGA 5HHVH 2Y5TA 1YNLL 1IAOB 5EBWA 3K4DA 2ZCKH 1XFPA 4QRQA 5I1LB 1RK0A 3WJJA 3ES6B 5AZEH 2V7HB 3X12A 1N6UA 3FMGL 4CAGA 1AKJA 4GAYB 5GS3A 4AYFA 1ACYL 1PYWB 4NOBA 1EHLL 1OGTA 1YA5A 2D0FA 3SDAA 1PDKA 4XWGH 2A73A 3OAZH 3C9NA 4FTVB 1DQJB 2Z8RA 4WY7L 5EIVA 4G8EA 4DQOL 4TRPH 4PRID 5KANG 5DK0A 3QUML 4GBXC 1I7TB 2H32H 4MQXC 1I1RA 2Y6SC 4J2XA 1MREL 1R3IH 3P73A 4WHYH 3IKCB 2XNAA 4M3JA 1VEOA 3QDJA 4P2RE 3JWOL 4KK5C 4FG6C 5D1XA 3QI9D 4JQVC 4I0CC 1Q1JH 1OTTC 4OI7A 1LP9A 3ECBA 3N1MC 5BW7A 4XH2B 4Z77A 4NZUL 3IYLW 1DSFL 3F7YA 5BS0D 4UV7L 1DLHB 3QDGD 3GBNH 4KVNL 2UWEA 1RJLA 4GH7B 1NLBL 2GJ6A 4LCWE 2BVQB 5F7DB 5I18L 2EDHA 3OKMA 1FNFA 4M8VA 4PB0L 3IGAA 1Q9OA 4NQCE 4Z76A 4NCDA 2DF3A 4N90E 1QRNE 2VXQH 2LU3A 3MLUL 1NGYA 5F6IC 1OPGL 4JFED 4NFCA 1XCTA 4NN6C 2VUYA 2YD1A 4L1HA 4R8WL 5ENWA 3LSOA 1EHLH 4N0FB 3GSXB 1EBAA 1G1CA 3NN8A 3OGOE 4HIXH 1UWGH 1YMMA 2OI9C 3PHQB 5DRWA 1ZVSA 4WI6A 4CJ0A 1G9MC 4WY7H 1CGWA 2D03L 4PRIA 1U3HC 3IDNA 1NFDF 2BX5A 3ISWA 3NACL 1LNUA 3DVNA 2E8YA 3H0TA 4ODUB 3QUMH 1PZ5B 3PXHA 2NX5D 3F7PC 4UDTB 3QQ4B 1EHXA 5HD8C 4LP4A 4M6AA 4MDIA 1JPGB 1XGUA 2GTWB 5HHNA 2G9HB 1J0YA 1KJ2H 3JWOH 1MCPL 4MS8D 5FYLH 4F9LC 5BZDA 4G8FA 3KYOA 2AJSL 4PP1C 3RY6A 4M7KH 3ZDZE 3GMPB 2E27L 4G8GD 5JPNA 1IFHL 1P4BL 1NKOA 5GS1B 3OR6B 4P23C 4PB0H 5F1OB 1XMWA 2R2BB 3LQMA 4EI5C 2SEBA 3IDJA 3QT2A 1F02I 2J6EL 1N0XH 1KB5A 4CRPA 4W81A 5EU3B 5ESVB 4LSUL 4JFPB 1Z3GL 1KELL 1UB5B 1Q9KA 2XTJC 3VFWB 1E27A 3TO4B 2W0FB 1NEZA 1FSKB 4KKBD 4NNPL 4IRJC 1JBJA 3BN9D 3QWRD 4GRWF 5F7KC 4IIQA 5IBUB 5C0RL 4HFUH 4MA1B 2YD2A 3BZ4B 3EJYC 5D2NE 1MHCB 1TZGL 3LKSB 5CBAB 3L6FA 4L5FL 4PJEB 5HVWA 3HAEH 2WBWB 3RRQA 1SM3H 1PFCA 3MLTB 4V1DE 5CP3A 4C83A 4L1DA 3ME0A 4E41D 2ZG2A 3IDGB 1RJYA 1FVEA 1F8TL 3ARDC 5EOTB 5GIRA 3O3AB 4HLZG 1T22B 4G8GA 4Y8DC 4ZDHA 2IMNA 1SEBB 5H94B 5GRYA 3RVVC 1U3YA 4R4NC 4EZMA 1IGFH 2Z35B 5DD6A 3ZKNC 5C07D 2D3VA 3GBML 3NMEA 2F53B 2ED8A 3NCCB 4WV1B 1OAYL 4L8SB 1IQWL 2HT2C 1UM6L 4LSUH 4APQA 1SYSB 2F5AH 4FABH 4U6YB 1HHKA 5CEYB 5DJ8B 1RFDH 2IBGA 1R0AH 1NANH 1JWUB 3GSWB 1KEGL 2B1AH 5GGQL 5IWLC 5CLWA 2GFBB 1A6AB 2A77L 3QWRA 2BCKA 5FYLE 1YMHA 4LDOB 5I8EB 4JDTL 2P47B 2OZ4L 4NO5A 4MMZC 4RFNC 3C2AL 3C5JA 4L5FH 1MPAL 1AGBB 4L8BA 2NY5L 2MOVA 2KDGA 5HYIA 1HH9B 1I1AB 4X99B 3VFPA 4P9ML 4ETQA 3RWGB 4JHWH 4M00A 4E41A 1VB9A 3T0EA 1SBSH 1MCBA 4U6HB 3QH3B 4OD1L 4HZLB 3T2OA 3BQUA 3HE6D 4ONOA 2Q7YA 3UP1A 1WVZA 1EAPA 1H0DA 1GJIA 3BUYB 1JGLL 2ZSWB 3GO1H 1OAZL 2JB5L 1NLDL 5BRZE 5BVPH 1Z5LB 4ZAKC 3MFGB 1OAYH 1I8IA 5DZNA 1I1CA 1OB1B 1AR1C 3RDTB 2HFFB 4JG0L 2C7UB 3QP3A 3HFML 1PLGL 2DQEH 1KEGH 3PWVB 3E6HA 1J05B 1NFDB 4F7CA 2UVEA 1KF9B 3FFCA 2DLTA 3RZWA 3UAJC 1FG2A 1ZVYA 1DQDH 2EIZA 4PGDB 1N8ZA 3E6FB 2VLRD 4JDTH 4HIIA 3LVEA 2OZ4H 3ARGB 3BKYL 2Q1EA 3EYSL 4PG2A 5HHME 3VXME 2XRAL 5IV2B 1JZ6A 4O2FA 3HZKA 2NY5H 4TNWK 2H9GA 3HRZA 3EDEA 3P4NB 4JRXE 1A3RH 3GSOA 4PJHB 4Y4FD 8FABB 1WLHA 2PO6D 2XWJB 1TCRB 3BZEA 3DVGB 3HE6A 2V2XB 1RI8A 3JBG7 3KPNA 2G60H 1U8OA 1MHPH 5J1AB 1Y18B 2DQFA 4KJPC 2EYRB 4JO3H 5DMKB 1MIEL 4P57B 3VXTA 3B4NA 1OAQL 3MRKA 4WTXA 3RGVD 3IJYA 1QKZH 1Z9SA 1WWAX 1DANT 1UJ3B 4PJCE 25C8L 5E56A 4YR6A 2H6PB 4JB9H 5MEQB 1KGCE 1TNNA 1BIHA 2E8ZA 1MCHA 1U8MA 1WAAE 4Y4HC 4MJIE 4N0CD 4OLWH 4OZHB 2HVKA 4GRWB 4EOWL 3KYMB 3U79A 2Z91A 3LZFL 2A38A 1PEZA 2VLRA 2Y06L 4OCSL 2CO6B 2FWOA 1AE6H 1MCSA 3EYSH 5I66A 1YPZF 1MFEL 2JJVA 3FT2A 4XVUD 5IROA 1AC0A 4K3JH 1ZHBA 3MLRL 5BMFL 1S8DA 4G9FE 1U93A 3V8CA 4U6VL 3MCKA 5SWZB 3Q6FB 1ZTXL 4Y4FA 4GMSH 5A2JH 2PO6A 3VDAA 4TQEH 4KJQD 3L3OB 1EO7A 5E94B 5GS2H 4FXKB 3ARFA 1QFHA 3QXDB 4L3EE 1LE9A 3AMKA 5E1AB 2R69L 3E3QC 1UXSB 1NFIA 4R7DA 3GI9L 2ESVA 2E9BA 2L7JA 4IM8A 1KCRH 5DJ6A 1JTPA 4UNVA 4CJ1A 3MMEA 5I75B 1OAQH 5JW5B 4HC1H 4ELMA 3RGVA 5B38B 1IC4L 1J7VR 4PJXA 4RQQA 3JV0A 4WIQA 4YFEA 1UYWH 3VXRA 25C8H 3L3DA 4YXLH 2NY1C 4ALAL 3BFOA 5A2IH 2EICA 5AUMA 4HUXB 5EORL 1XF5B 3B6SA 3L3KA 4Q6IC 5L88H 3FOLA 1VCAA 3KLHD 4ZS7L 3V5HB 2EDJA 1QTYT 4OZFA 3LZFH 4LOUD 3GHBH 1WT5C 3SDYH 2VLKD 2OXHA 3DBXB 1K4CA 1NMAL 3U9UA 3SDDB 3DI3B 1BLNB 1FRGH 5EC2B 2Q8BH 4M7JH 3MLRH 1WFOA 2Z31B 5BMFH 3DVIA 4ZUWA 3IDIA 4M8QB 4R2GD 5IJKC 5IVZA 1ZTXH 4U6XA 2A6KB 5FYJU 2NXZD 4DFHA 2MQCA 3PWNB 3GUTB 1BFTA 4OLVH 1NSNL 1EFXD 4DKAA 2CGRL 4XP5L 2CH8A 1DLFH 2VISA 1CGTA 3V0AC 3MNWB 1CU4L 2UZIH 3OGCA 5DJXA 2MHAB 1F11B 1YN7A 5ALCL 4P46D 1AI1L 3FQWB 4JM2B 5J06A 3KPLA 2WIMA 1AXIB 3B5TA 3K3QA 2W59A 3L95A 3VFOA 3GK8H 4ZO6A 3OZ9L 3V7MA 5I2IB 2YS4A 3P4MA 3SE8L 2QJDA 4DZBA 1M7IB 2W0KA 4NHUB 1DQQB 1HKFA 4I9WE 1GSMA 4U7SA 1KXVC 3KLAB 5EZJB 1NJ9A 2VLKA 1L4IA 2VITB 4HKZB 1OGAB 5HHPA 4LSQH 1NMAH 2NW3A 4KKNA 1QSZA 2ID5A 5GSRB 1ZV5A 1WZ1L 3HNVH 3MLPA 1XGYL 5ACZA 3T08A 5TPWL 3O81A 3RL1B 3DTXB 2EE2A 5F3HA 3G04B 2F8OA 5TQ0L 5B3JF 2YD9A 5JO5B 3PWPE 3FHQA 1KNOA 5JIPA 1S9YA 3DUHA 4UIMB 2CRZA 5T3XE 3O6ML 5A40E 5ITFA 4U1KB 3BRFA 4KDWA 2R29H 4G9DA 1EEZA 1NSNH 4I8DA 1HXYB 4LU5H 3A0OA 2CGRH 1TETH 4PS4H 3KXFA 1A7BA 3TZVD 4Z9KB 1CTNA 5AYUL 3QQ3A 5CJXC 4Z7VE 4P2CG 1TNMA 4M02A 35C8L 4JHZA 3V8OA 2DWEA 3G6AB 4TSBH 5ALCH 3O6KH 3MV7E 4JCLA 2MCPL 3SDCD 4KROD 1VFOA 2AJVH 3JWDL 4NBYB 4P5KA 5C0AE 2ICEA 2CJUL 3RJDA 4JGJA 5D7LB 2AK4B 2NY2D 5EU7C 4HAGA 1YEKL 5EIIA 1MJUL 3GNMH 5IIEA 5E5UB 1LEKB 1BZQK 3UBXI 1N5YH 3I02A 1RZ8A 2DN7A 3I84A 4JM4L 4NIKB 5DURD 4ZFGL 2R2HA 1DTUA 1MFBH 1AXSA 3EYUH 1I9JL 3O6FA 2EXWD 1IEHA 1DBBL 5GGRY 1G9MH 1UVQA 4OCRH 4ZUUA 3QDME 2A83A 4N0UE 5JW3H 3MQIA 4XTRC 3RWJB 4XNQA 1PBYA 4OLZL 1JK8B 5I15H 1CIDA 1ZLUH 3NFSL 4RRPA 1X44A 3TZVA 2J8HA 1AO7B 1SJEA 3T1FB 1QBMH 2BVOB 3GMNA 3FFDA 5KN5A 35C8H 5DFWH 5EZOH 1I8MA 3SDCA 4AH2A 2C4FU 2XG4A 5HDBF 1ZWIA 4N8PA 4EVNB 3MV9A 2HVJA 2D9QB 1CDJA 4C56B 4A2LA 3VFMA 5FHBH 1FLRL 3G08A 4HIHA 4U0RC 4HS3B 4XAKD 5FA4B 3TBWA 1IQDA 4RZCB 3FT4B 1HI6A 2XN9E 3EDDA 2VABB 4GAFB 5I1EH 1MFDH 4AEEA 1RAMA 1VACA 5CHNB 3JTTB 2X4UA 4ZFGH 2I9LA 4JPWH 4U33A 3QRGL 4EBQL 1F58L 4JFQB 1I9JH 3HA0A 4MNGB 5C0DB 2Z8WC 3HMWH 3W11C 3BPCB 4C58B 3IXTB 4BQBA 5IHZB 3S36X 3TVMD 3J7HA 3RX7A 3U0PA 5DFVC 2YBRB 5SWSA 1U95A 4J6RH 4S1SL 1IILE 3QUYD 1A7QH 2PYEE 4XX1G 3MGOB 5D2LF 3VWKD 4BYHA 1P84K 3VXUD 1T7YA 5E2TL 1UKSA 1Q0XL 7FABH 1YJDL 2X7LB 4GXUM 4QXUL 5E7BA 5JIIA 4AM0B 1G7IA 1P5VA 4RIRB 1TVHA 2YMXH 5C3TA 1KOAA 4KI5D 2JCCB 1YC8A 4AMKH 5E6IA 5JZ7C 5E9DD 2OQJB 1FN4A 2QLVB 4ETYA 3STLA 5DD3H 1L0YA 1TENA 4NCC1 1N3NA 5J9PB 3MRBA 3UPRB 4YAQB 4P3DA 1H3PL 5GGTH 3IB4A 1CLZL 2ICWB 2AV1B 3CDCA 4HLZH 4JO2L 3MRCA 4BQ9A 4G8IB 4LIQL 4JFYA 3QRGH 1KJMB 5IT2H 1ZA3A 3U7WL 4M6ML 2IFFL 5CZKA 4P99A 2YKLL 4P2YA 5HJ3B 5IOPA 3ZSTA 1U58A 1OM3L 1A1OA 3KGRA 3HN3A 1TZHB 3JWNC 2YZ1A 3F5WB 1CT8B 2DI8A 3QUYA 5GSVB 1AQDA 2PR4L 1FYTD 3EJZC 4MA1C 2LQRA 3FN9A 3NCBB 4Z0XA 4WO4B 3VXUA 2ICES 3WN5A 1FO0B 1S9VA 3ULSB 2R0ZH 1Q0XH 2ATKB 4FFWC 4P2QE 4TULH 1BVKA 4ZG1A 4EUPA 4ODSL 4Y2DD 1J5OL 5J57B 4TOYH 3HPJB 4L4TB 1CICC 3F12B 1QVOB 4KZEL 1JZ2A 4NO0D 4C4KO 1J8HD 4QF1B 4MNHA 3G6JA 1LE5A 1MUJA 1NAMH 3C5ZA 3LH2H 1AR2A 2GIYA 2NY4D 3BRGC 2W0LA 4N5ED 1MRCL 2EIBA 5EN2A 4A6YA 4OM1L 2I5YL 4MAYB 4WV1C 1YEEH 2GSGB 4D2NA 5FEBA 3BZFA 1S7UB 3EO1B 1BPVA 5E5RB 1T2QH 3WDHA 5I76A 4PGEB 4U3CA 4IOFC 1C8PA 1BD2B 2MCG1 5J12B 4YIQA 3DXAE 4JFOA 1OM3H 3H7BB 5KSBB 2XKSA 4D0BA 1A4JB 1FC1A 3LB6C 5TDNB 5IFAH 3RAJL 5JNYB 2MFNA 1PY4A 1IGIL 4PD4J 1P7QB 3G9AB 5I9QB 5JHDE 4PJIF 4OGYH 2DIBA 3LEXB 4HJ0D 4LEXL 1OQOA 3T8XB 1JGVH 2HT3D 3BX7C 3VD7A 2DJUA 2AJYL 3IJSB 3L7EA 4RISH 4YO0A 3X11A 4XNZC 3KLDA 4MD5A 2XI9A 5JUEL 3RL2B 4X9BA 4NO0A 1J8HA 3UTTD 2OL3L 4PD4K 4QTIL 5KAQF 3VDCA 1YEGL 2YD5A 3SGEH 5EZIH 4PGBB 2VLLB 4AQ1B 1ZGLM 3D39B 4H26B 3BKCL 2RFXB 1V7NH 1ZLUK 3RVXC 4OM1H 3DV4A 3ULVD 3QA3B 3O2VL 2IPKA 1JCKA 3LAFA 4WUUD 5CSZB 4LLYA 3BWUC 3SGJC 1X6LA 2QADD 1D3CA 3P77A 2WMPA 1GZPA 5FA3B 1QFWH 3QUZD 4ERSL 2EYSB 2ERJB 3G5ZB 4WFFE 1DEEA 4D9QE 4X6BB 4K94C 4ZPVA 1TQBB 3DURA 1LVEA 1XGTA 5MEPB 3MODH 4JO4H 5CD3B 1GGTA 4LCCB 2DQDL 5FK9B 1T21B 5I6XB 4Z7UE 3OHXA 4U1SB 4XP6L 1GPOL 3UJIL 1U2HA 3V79C 5HGDA 2BNRE 3KWWA 3O0RH 2H45A 5BJTB 5HGHA 3N0PB 3TYFB 1MI5D 5TQ2H 2X4RA 3KYKL 4M7ZC 2X9YA 4ESKA 4G43B 4UMGA 1CXEA 1BQHB 5I19L 3HKFA 4CN4A 1CLOH 4L4JA 1WBYA 3X3GL 5C09A 5JUEH 5L2KD 3CXDL 1FNSL 1FP5A 2P49B 1HKLH 2H2PC 4XPBL 1FNEB 3MV11 4N9OB 4M7LH 1X5HA 2VXSL 4NT6A 1S9WA 1DBAH 4YXKL 3K0WA 4J3VA 1OTSC 5INCA 4QNPE 1OARL 3EDFA 4AIXA 3TPUA 4Q58C 4G3YH 1NC4A 1UH2A 4XBGB 1DDHB 4QRRD 5EU5B 1P1ZB 2XFXA 3O2VH 3PWUA 3MLWH 4WUUA 4YE4H 1UM5L 1L7IL 1EXUB 3RI5F 4AEIL 4U1MB 1V7MH 1JE6A 3EOAA 3PWLB 2BOCB 3TN0D 4LKCA 5LGKA 5FYKH 1ZT7B 4DUXA 3BVNA 1BM3L 1CXLA 2XPGA 4HUVB 1EO8L 1YYLH 3I75A 4PJ7A 1BOGA 1F4XH 5GPRA 5CMAB 3TWCH 4P48A 2P5WE 3BGMB 2DQDH 4PBVC 4RDQF 2NLJB 5EULV 5DMIH 1S5IH 1VGEL 1Y0LB 2IAMB 4OCXL 1FFNB 4XMKL 1JWMA 3HI5H 5HYEA 1OCWL 1T89A 1YECH 5I19H 1BX2B 1I9RL 1V8HA 3U4BL 2FIKA 4CN6A 2YC1A 3V5KA 1G7LB 2VXSH 4XXCA 4P5TD 5IVXE 5TFSH 3GJFK 1DBJH 4ZD3L 4B50A 4KUCD 3LKOA 5CZVL 3VRIA 3BIAX 4HEME 5D1ZD 2OL3B 4R26L 3FOMB 3C60D 4GAGL 1MAMH 4HWBA 4DCQA 5I1HL 3D25B 4YHNA 4HGWA 3BWAA 4OD2A 3HG1A 5D7SL 5KJRL 4GG6F 2DRUA 3MBEB 5IB4A 5T1MA 5HHXL 3DUUB 4HKXB 1ZS8A 5GRUL 4FP8H 3VXOA 1UACH 2HAZA 1KTDA 1CDUA 4NCC2 5EOCJ 5EO1A 4NZJA 2CKBA 3FQRA 1DFBH 2BVPB 1OP3K 2BSSB 3OB8A 1PX3A 4O2CA 4PJDA 4GXUN 4PJIB 3QB7C 1GOFA 5EO0B 2NR6D 1EMTL 3AXLB 1IAMA 2WBJA 2GEEA 2Z31C 1KSRA 2OTPA 5CKAA 3T65B 1I9RH 4JY5H 4HBCH 5BV7L 3F58L 4NO2B 2AEQL 1EUTA 4AIZB 4IRSB 5CEZE 1G9NL 1YZZA 3O3DA 3M1BA 3QPXL 3BP7A 4MXQD 4PJ5D 3WFDH 5JLZA 5D1ZA 1UENA 4HUWB 4OCYL 1HIMH 2CDFA 4YGVA 4Y1AA 3C60A 5D7IA 2OTWB 5D1QB 3GMLB 1B6DA 3LKNB 1X6NA 3B2UC 3H3PH 1I8LC 1UZ6F 1ZHLB 4Q9RL 4ISVA 4JM2C 1UB6B 3PQYE 5DVLA 4I3RL 5DI8A 5GGUB 2DKUA 4XZUA 2Z4QA 1BFVH 4UDUA 5CSBA 5GRUH 3RWEB 5DYOA 1KCKA 4UT9L 5DDHA 5J3HC 3RUGA 3S9DB 3HCVB 3H42L 2CXGA 2VDPH 4D9LH 4BH7B 4KTEL 1XR8B 2DQTL 4Y7MA 3D9AL 3L7FB 3H3BC 2OJEB 4X6EB 4PJFE 2XTLA 3VFSA 2BK8A 5BW7C 4N8VG 2IGFL 1T1XA 3BSZL 3QEGH 4M93B 3RWHB 2O5YL 1K6QL 4Q2ZA 2VLJB 3F7VB 2P24B 4MJ4A 1KPVB 2I07A 2IADA 43CAA 1B2WH 4MZ3A 5SWQA 4MA3B 2B5IB 3DGGA 4WHDA 4UINL 4PGCB 1IJ9A 1Q72L 4Y2OA 4OCYH 1INQB 1SY6L 4DN4L 4HUUA 5IR1A 3DECA 3FHAA 3FO9A 3RTQD 4DZ8B 4UNUA 3ULUC 1JWSB 3SOBL 4OCMC 5ADPL 4YX2H 1L7TL 2DM4A 3DX9B 4MHHG 5KTEL 3GMMB 4OLXL 4LLMA 2EDNA 5CWSB 3IJHB 1JV5B 1E6JL 2ADJA 2J2ZA 2ATPB 3OJMB 3QIBA 3MRNB 4PJBF 1YN6B 4OZIA 4MWFB 1NBZB 3VCLB 5HYJB 3H42H 1CFTA 4HIEB 2AEPL 2EKJA 1A6TB 4JQXA 5D9SA 1OLZA 2VDLL 2G75A 3LQZA 4KTEH 2OSLA 4Y19B 2YPVL 2NNAB 4DOHB 3GMRB 5ESQA 3V4UH 2EEBA 5F3BA 3OXRB 1RUAL 3QI9C 3C6SA 4L29A 5DGQA 5GGSB 2A6DB 1GAFH 4EDXA 5D6CB 1DVFB 2QSQA 5KS9B 3ZT6A 3IF1B 4YDVB 2O5YH 5FDWB 3MREA 3CFCH 3NA9L 32C2B 4BQ8A 5MEOA 3ZTNL 4N8CL 2R4SL 2NY3D 1QLRB 1HQRA 3LIZH 5DK2B 1J10A 4YHML 5BV7B 1JZ7A 2HTKD 4UINH 1MNUH 5HY9B 4TVPD 1IEAB 4CADB 3PJSA 4X7SH 5ACMA 3R06A 3RTQA 3NPZB 4P9HL 4QY8A 5DK3A 2BMKB 5E99L 2MNUA 4ZFFB 3MRHA 2EC8A 3HZVB 4GG6B 1B3JA 3CH8A 4P4KA 1AIFB 1OP9A 4G7YH 4ZSOA 5HGAB 4PREA 4XCNA 5DC0A 2A2QT 1R24A 4LLVB 1ROWA 1VFBA 3PABA 2X4SA 3W9DB 4IHOB 2NZIA 1RV6X 1RUAH 1S7WB 2FL5B 2X6MA 4PLJD 1G1YA 1U8NB 4GRLD 4H25A 2D0HA 2DDQH 3MRGB 2C26A 5KVDL 3HI1A 1FLTX 1HWHB 1KPRB 4XMLH 1ONQB 3NA9H 3BDYL 5C0BB 4P2RD 3MXVH 4YHMH 2WQRA 2P5EE 4UUJB 1X5LA 3NCMA 2ITCB 5D5MF 3X17A 1HN1A 5KSAB 2F54B 3WIFA 4WW2C 2AI0H 1JI2A 1I3RB 1JPFA 4WU7B 3L3JB 4Q74A 4FQIL 1QQDB 1MIMH 4LCWD 2FJHA 1HXMB 3MCLL 5FO7B 3TA3D 1FG9C 3E0GA 2FRGP 3DETC 4NQCD 4N90D 5HHQB 1QRND 4YQXH 3LCYA 4JVPA 3V4VH 2ZOLA 3BN9C 4K7PX 4HQQH 2BOBA 3PDDA 3FQXA 4GJTB 3VFRB 2R8SH 5FM5O 2RBLA 1LO2L 1MHHB 3SJVB 1N6QL 2GT9A 5TE6L 1G7PA 4IRZL 3MZGB 2EC9T 4LGPB 2QEJA 4TUKH 4XPTL 4GRLA 2QQNL 3M07A 4KXZH 1MCEA 4QHMA 1DCLA 5IKCA 3IRPX 3S96B 1HZHH 2NCMA 1CFQA 1UZ8A 5I8CA 2CXKA 3OAYH 4RA0C 1U8IB 3DMMD 5GZND 1TTUA 4Q6YA 3NIDE 5FUOH 1XR9B 2GAZA 2XKNA 4KK6C 1BF2A 4M6NH 5CZXD 2AKRA 5E2VL 4RFEB 3VXPB 3X14A 4I18C 2PW1B 1RUQL 1FIEA 1VADB 3A6BH 1WCQA 2FB4H 4V2CB 3RPIA 1NGXB 5IB5B 3EHBD 1CGSH 3HE7A 4ZUTB 3ARXA 4D9RD 5LXGL 4Y5XB 1B88A 5J1SC 5KSUA 2FSEA 2VDRH 2CDGB 1G7MA 4PB9H 2F58L 1R3HB 2F19L 1C08A 3VI4F 1RZIB 4PJBB 1N7ML 3PIQB 1FHGA 2E6JA 1PQZB 3IFOA 2WANA 3VMPA 1C1EH 1JHKL 4L3CA 3U2SB 5DD1L 1LO2H 4R0LC 4NRYA 5C7XL 1KB9K 5GJSL 4TNVF 1QLEL 2OM5A 2QQNH 1I75A 3MOBH 3F7RA 2AJUH 4OZGE 4BH8B 3JTSA 4NKQB 2VQ1B 1C16B 1IZKA 3TIDB 1KIQB 1G6RL 2DYPD 4K94H 4AL8L 3GRWH 1GXEA 4ELKA 4JEGB 5DHYA 5ID1A 1QSEB 1R3LA 3QHTC 5B39B 3HUJF 1H3VA 5I9QC 4QXTB 3S35L 1NCCH 3RWIB 4YHYB 1KTLA 2EZ0D 3QQNA 4KK8D 4V1DD 1L0XA 3BW9A 3ESVF 3GKWL 5GJTL 4NJ9L 3RQ3A 5KVFH 1F4WH 3J8F7 4NUJB 4OJFH 4YNYB 4H1LB 4ODVH 4NRXA 1MCRA 3U46B 5E6YA 4AENA 1WSST 4K7FB 4K2UH 3O6LL 4GKOA 2JF1A 5DMYA 2F58H 2F53E 3BH9B 4OKDA 2B4CL 4XXDB 1WCBA 2A9NH 1OSZB 2Y7QA 1N7MH 5FKAB 1EK3A 3BDXA 5JR1H 5GRWA 5C0CB 1K2DA 1UADC 5C0ND 3BN3B 4WW1B 1N2RB 1NGZB 3KYAA 3FO2B 3AREB 2H32A 1P5UA 1OSPL 3EYOA 2VKXA 2DJ4A 5DJYB 1JNHB 2KZWA 2ARJA 2OYPA 3HC4L 2ZPKL 3VFNB 4KY1L 5GRVL 1AGCA 4NKDA 5LG1A 4HV8A 5HSFA 3Q48A 4WHTA 3PL6D 2AJXL 5D2NA 3WNKA 4UNTA 4X6FB 2R0WL 1XGQA 5D5MB 3S5LA 1QYGL 5DWUH 3BE1H 5FO8B 5HDQL 3MYZA 3DX7A 3GKWH 5D6DC 1FZKA 3RGVC 1F2XK 4PRDB 4FQLL 4DN3L 3VH8B 3MUGB 4IDJH 5H37G 2VZOA 4NWUL 3HC3L 4J4PC 3O6LH 3VXSB 4G6FD 2H8PA 3VG9B 1NCDH 4N0CC 1LP9F 1CDCA 2H3NA 5BRZD 1J1XH 4HLJA 4U1GC 2QSVA 1IMHC 5MI0B 1HYSD 3QSKB 5T1KA 1QSFB 1CCZA 3SKMB 3I6LE 2UWEF 3H9HB 4F9PC 4Y5YC 3OAUL 3HLAB 3MJ8B 4NGHL 1OSPH 4J3TA 4XVUC 3S3PA 3OKKB 1QZ1A 1KJ2A 4J23A 4X8JB 3T4AA 3MLXH 4G6KL 4IS6A 4JJ5A 2L4OA 3OKEB 5DHVB 4GQ9L 3QIWB 1C5DA 3PL6A 3FCTA 2AJXH 5CCKL 5F7NC 2AQ1A 3I3EA 5HHMD 5FYKU 4L9LB 1A14L 4ZXBB 1G6RB 1QYGH 1MF2H 4PJHE 3BYYA 4LRIA 1JGDB 4JRXD 3EYVA 1S5HB 3ROOA 2R4RL 1KPUB 1KN2L 1SBBA 1EEUA 4QT5B 3WJLA 1R3KA 4DVBA 4ZFOA 4HK3N 1KCSH 2VZ1A 3FQNB 4NQVB 2HT4D 3P0YL 1LHZA 4BUHA 3MRIA 4PLNC 1JNLH 4OGXH 3S4SB 4NWUH 5I16A 3NIGF 3C09C 1K3ZA 5ICZA 3T3PE 1TJGL 1KT2B 2UYLA 3OJDA 4X7TB 1I9EA 1U6AL 3KLHC 3EJJX 2VERN 3QEUA 3EKCA 4KPHL 4PY7A 3PGFH 5HHOD 4PJ8B 4X4XB 3WE6A 4KVCH 4R4BA 1HNFA 5E8DL 4XC3H 4NGHH 1KGCD 1CE6B 5BXFB 5IQ7L 2BSTB 3CFDA 4Y4KA 3D2UB 2HJFB 1P4LA 5DO2D 1FFRA 5I1JH 4OZHE 5FOJA 4GRWE 2PTTA 1LD9A 4PJ9D 3SCMD 4RMRA 4XNYH 2NY0D 1XEDA 5TGBB 3P9MA 2NXZC 4ONHA 1D9KA 5J0BA 3AS0A 3HZMA 3UYRH 5CCKH 3LV3A 4EQ3A 1Q9LA 1JYXA 1IAKB 3VXMA 1FVCB 4FQ1L 3QO1A 2B1HL 4MNQA 5C6TH 5SWZE 4FOMA 1X5YA 4RFOH 4G9FD 5B4MD 5DJDB 3OWEA 4JRXA 4OUUB 2MJWA 1KN2H 3EDJA 1KCVL 5ETUA 3EO0A 4P46C 1TQCC 5F7EH 4LHUD 4AK1A 1QO3A 4NDMB 5J56B 2A6JB 4G6ML 4P2OA 3QEHB 4TVSa 3DX6A 2IQ9L 3K46A 3WS6A 3WFEL 1CE1L 1ZT4A 4N0YL 3R1GL 1EO5A 4KPHH 3OG6B 1KEML 2ED7A 2Y5TB 2VTFA 5IJVA 3GBLA 5D72H 2Q3ZA 1KB5L 1E4KA 4PJCA 5EBWB 4LVEA 4QRQB 1RK0B 3U83A 3ULUH 3QJHA 3X12B 4I0PD 4MJIA 4OLUL 4WW2F 4PJ9A 5A2KH 3SCMA 2NQCA 1AKJB 4OIAA 1A7NH 3KLSA 2P7TA 3OKLA 5E4EB 2RIKA 1OGTB 2J5LB 3SDAB 2VQTA 2ZUQB 1MHEA 1RMFH 3RKDC 1NMBH 5DXWA 1F3RB 3C5SA 2A73B 1FORL 3C9NB 1FZMA 4ONGH 4AEHH 3TZVC 1S7TA 4G9FA 2FO4A 1KG0B 2FH8A 4F2MA 2HYMA 3ZYZA 3P73B 4AY0A 2XNAB 3QDJB 2D7MA 1GC1C 5GZOC 5E8PA 4LHUA 4OQ1A 1A9BA 1EHNA 4L3EA 5D1XB 3CCHB 1NH6A 3K81A 3TF7C 4ZS6D 4Z95L 1LP9B 2OR8A 3ECBB 1CE1H 3CH1A 4GW5A 4KTDL 5SX5K 4N0YH 4OFDA 1W8NA 4Z77B 1QLFA 2NYYC 3F7YB 4O00A 2AV7B 4KUZL 2UWEB 4CVUA 2DTML 2GJ6B 2XYCA 3O4LD 1KB5H 4LSDA 1F42A 3OKMB 1KN4L 2VR4A 3IGAB 4Z76B 1SJXA 4X9HA 5SX4I 1XCTB 4P5MA 2QHLA 3QQ9D 4OCWL 1OGAE 3DROA 3FRPA 4I9WD 5EC1A 4PTUA 5ENWB 1WC7A 4ZTOL 3LSOB 2EDRA 4H5SA 3FL7A 4KDTC 3BOVA 5DEGA 1YMMB 5DRWB 2OK0H 1ZVSB 3QZWA 2BSRA 1ZGLB 4LASL 1G7JA 4PRIB 3IDNB 1LNUB 5E7FA 3H0TB 3PWPD 3MJ7B 5T3XD 3D0LA 4MDIB 4WFEE 1WIPA 4EN3A 3LKQA 1MAKA 2I24N 1JIBA 3KPRB 2YRZA 4C4KT 5DA0B 3TT3L 1RU9H 4ORGA 4JKWA 5BZDB 3BPOC 3W39A 3UZVB 4G8FB 2WUCL 2PTVA 3ULUE 2GK0A 3KYOB 3LN5A 3RY4A 4KWUA 2WINB 3BKMH 4ZO8A 1MCKA 3MV7D 5F1IA 5FM8A 3MLZH 1KIPA 4FQXC 5C0AD 2AK4E 4L9DA 4LDEB 4YXHH 3RZCB 2AVGA 2R1WA 2SEBB 1CVRA 5I1DA 4YDIL 1MCLA 1EIBA 2J88L 3UBXB 4QOKA 4OCWH 3TVMC 4NN7B 1EEYA 4IJ3B 4LVHB 1XGPA 1CIUA 2R2EA 3VWKC 3RA7H 3ZO0A 2X9WA 5CJ5A 1Q9KB 2B8OT 5HGGS 4DGYL 1E27B 1UWXH 4WNQB 1M4KA 1NEZB 3QDGE 5C08A 4O5LH 4FQ2H 4PRHA 3HR6A 3CSYB 3QDMD 2HKFL 3C6LA 4IIQB 4YHLL 4JDVA 4HKJA 4HC1A 1DE4A 4ENEC 5KVGL 4ZYKA 2VL5A 1AO7E 3L6FB 1IAII 1E4JA 4JZJA 4HUNB 2NXYD 4PRPA 3TT3H 4Y16D 4NPYA 1RK1A 4DWHA 2FBJL 4Z7VA 1O0VA 1T7XA 1RJYB 1FVEB 2UVFA 4GKZB 5GIRB 2NMSA 4G8GB 3MRDA 4HIJA 4UOJA 4ZDHB 3MV7A 4C56E 5C0AA 4NQEA 2PYFA 3PUCA 5DD6B 3VD4A 1JPSH 4EXKA 4KAQL 2J88H 3QHZL 4CW1A 4X4YA 4O2EA 4ELMF 1CGYA 3CIQA 3TJEL 5FUCC 2ARJQ 4PJXF 4OLYH 1LK3L 4APQB 1TFHA 1CK0L 1HHKB 1N5AB 3TYGH 5J13B 4MNGE 4GO6B 4DGYH 4CVXA 1RULH 5C70A 3WD5L 3LMJH 4MQXD 2Y6SD 3QDMA 4Y2DC 4XP4H 3C2SA 2Z93A 5JHLL 2FLRT 4FG6D 2D31A 2QSTA 4HMEA 5L8LB 2DL2A 4KQ4H 4LVOB 2DQUL 2H41A 5J4MA 1OTTD 2PYED 5GS0C 3RIAF 2IH1A 3MGTA 1NCAL 4DKFL 1VERA 4L8BB 5D7JA 2O93L 4F8QA 3G5XA 5DD5H 1TJIH 2NY4C 3BP6A 5DVKA 2FBJH 4JAMB 3VFPB 3T0EB 1RHFA 1R3JA 2JCCE 1MJ7L 2WBKA 4JLRB 3BQUB 3WEXB 4GQPH 4YPJA 5A16A 1EAPB 1H0DB 3MUZ1 1GGIL 3RJQB 2EDEA 4Y5XC 3QYCA 4KAQH 1EA9C 2DM3A 1C5CH 1NMCC 3TJEH 2XN9A 2PN5A 3U0WH 1T1ZA 4OIBA 3V2AR 4QRPE 1I8IB 2P8LB 2J8OA 3WS3B 1MSPA 3H2WA 4LF3A 3VG0L 5I73B 2QSCL 3WFZA 4R7NB 3VW3L 1BQLL 3E6HB 3QBTB 2VZVA 4F7CB 2VC2H 2AQ3A 3GGWA 3LQAC 3FFCB 5HD8D 2XACC 1C7TA 1FG2B 4HJJH 2IPUK 1FAIL 1A22B 4PRAB 1YY8A 5J6GA 4XPHL 4RAHA 3AY4C 3I6GA 3MRMB 4HIIB 4JQVA 5LBSL 2ENSA 1T2XA 4NC1E 3HZKB 4H1LG 1OAKL 4PP1D 1S9KC 2H2SC 2DLGA 2H9GB 3HRZB 3CC5A 4XNXH 4L4TE 2A6IA 4DEPB 3BZEB 3B9VA 1I7UA 3ZZ1A 1RJZA 3KPPA 4JFHE 4XBEH 3JXAA 3I3DA 2HFGL 2QKIA 1UFUA 3KPNB 2EDXA 3V6ZA 3AAZA 1U8OB 3QUZC 5DS8B 2DQFB 3O9WB 1I8KA 2O61A 3M45A 2K1MA 3VXTB 4RCAA 3P11H 3MRKB 2NW2A 3IJYB 1KV3A 5ILTH 4OV6F 5IBTL 4M3KB 3O45A 4RWYH 3VG0H 4YR6B 3VA6A 4OSUL 1JHLL 1MCOL 3ZE1E 1U3HA 2KH2B 1BD2E 1BQLH 3BESR 5H37H 5CSGA 5KSBE 1AJ7L 2VRAA 3DXAD 2HVKB 3QCVH 3L9RB 2Z91B 4M4PA 4X8XA 2DQHH 3PV6A 4F3FA 2V17H 2FWOB 3QUKA 1FNGB 4PUBH 1R5IA 4F9LA 4D94A 5JHDD 2VIRA 1ZHBB 1S8DB 1LWRA 1OF2A 4LNRA 1JRHH 1C5BL 3MCKB 2E7MA 3ARDD 3PNWA 2BSED 4Y4FB 4P2QA 2LAGB 2ZG1A 2PO6B 1E4WL 3UJTL 5C6WH 5HDBE 2XZQL 1FYHB 4U1JA 4P23A 2HFGH 3ARFB 5E6ZA 2PW2A 4EI5A 4ZOCA 3I6KA 3ZKND 3WKNA 3TN0C 1NFIB 1D6VL 4R7DB 5JW4R 2ESVB 2X42A 1NL0L 4O51A 5DJ6B 15C8H 3QIUD 4Y5VB 3MMEB 1YEFL 3VG9C 3TV3L 5K9OB 4ELMB 1K8DA 1VSCA 2OP4H 3DUSB 3QG7L 4RQQB 5T5NF 3VFUB 1T0PB 5DR5L 1NANI 3VXRB 3L3DB 2VL4A 4S1DC 3O3EA 1B0RA 1R5WA 4OSUH 1JHLH 1MCOH 5AUMB 1ZHKB 1Q94A 4FZ8H 3B6SB 3DI2B 4IRJA 2PXYB 4WFFD 1KCUH 3FOLB 4LIQE 4D9QD 1QP1A 2XY2A 2EKSA 3V6FA 4OZFB 4H8WL 4OBSA 5HI4D 3EGSA 1JYWA 1K4CB 3HZYA 1O7VA 3U9UB 4XC1L 4P5TC 5JHDA 3FO0H 3QIWC 3U0TA 2VXVL 2BNRD 2VO5A 1FGNH 1C5BH 4ZUWB 3BDBA 3IDIB 3MV01 4L9LC 5IVZB 3ARDA 5TF1H 4U6XB 3EZJB 4KTYA 1NCTA 3I9GL 4OIIH 4Q0XL 1BAFL 5HYSG 5L9DL 2IG2H 3UC0H 5ALBL 5GGTA 1OWWA 5E8OA 3UO1L 3VGGA 1CFVL 5H35A 1A6WL 1GC1L 4BK5A 2CIKA 1EJOL 3ZT7A 3OGCB 1IM9D 4MX7A 3QCUL 1BZ7A 3VFGH 3GMOA 3HMXH 1YN7B 1IAIM 3GJFA 2FJGA 1PG7X 1DBKH 5SV3A 3IFNH 4BM7A 1RIVL 4ONFL 3GIVB 5IWLA 4JN2A 3L95B 3TT1H 3VFOB 4OFPA 3U48A 3KYNB 1N59A 3P4MB 1KLUA 2FHBA 4DZBB 1FL5A 2X5PA 4HS8L 1A21A 1URLA 5LVEA 4I3SL 1NJ9B 4Z0BL 2VLKB 5HHPB 2P5WD 5DUPH 2NW3B 2W9EL 4XC1H 4Z7UA 4HG4J 4NUGL 3HS0A 1FH5L 1BJMA 5F44A 2BNRA 5H2BA 1YEIL 2IALA 4MD0A 1J1OH 4QYOA 3S37L 4MXQC 4JR9L 4R2GB 3WDJA 3W0WA 3NTCL 1NAMA 2K7PA 1KNOB 1NGQL 1SYVB 1F2QA 4YZFE 1S9YB 4U1NA 5IGXH 3HI6H 2R0KL 3BPNB 1FGVL 5ITFB 5EFIA 1MFCH 1WTLA 1ZA6A 1EEZB 1KC5H 3RKPA 3KXFB 5ALBH 1HSAA 4HG4K 4XP9H 4YDLC 5GISL 2CK0L 1A5FH 3H9ZA 1DQTA 4ZAKA 4PRBA 4M1GL 4RBPK 1GC1H 1FFPA 3QQ3B 1EJOH 4O4YL 5DRXA 5IESL 4JE4B 4ZFZA 4I4WA 2EXYC 5ANMA 2HMIC 2Q8AL 2DWEB 4KI5F 4Y4HD 1W0VA 4RGNB 3AB0B 4P5KB 2ICEB 2Z8VC 3G6JF 4JO1L 3T0WA 5J89A 1AD9A 5EIIB 2DQGH 3CLFH 4I3SH 4EEEA 4Z0BH 1TZIA 4RX4D 5IIEB 1UCTA 3I02B 5F88A 3SY0A 1RZ8B 1ZHNB 3UZQA 4Q97A 3V0WL 5E4EC 5A2FA 2R2HB 5E2WL 4YWGH 4H0GA 4POUB 4QHLA 1CL7H 1AXSB 3QFJA 5EH1A 1MH5A 1BBDH 3O6FB 1I3GL 4ZUUB 4JFDB 4OI9A 3QWOA 5KZCB 2A83B 2G2RB 1XF3A 4LQ1A 5TDOA 4XNQB 5EBMA 4LLUA 1UKTA 4JY6A 3FQUA 1CDHA 4HX1A 4MCYA 5CEZD 4XVJH 5M95B 5IVXA 5GISH 1AXTH 5HYQB 5I30L 1VENA 1SJEB 3VWJD 3KAAA 3S98A 3GMNB 3FFDB 3PP4L 5KN5B 4GLRH 1U3ZA 2NY1D 5TE7H 5I1CL 3L5HA 4GXVH 1I8MB 3SDCB 1MJ8L 3E8UL 5CJQL 4AH2B 4KROB 5J8OA 2JB6A 4Y4HA 1ZWIB 3MV9B 4XPFH 4A6YL 2AGJH 2PCPA 1J86A 2VDQL 4GUPA 3VFMB 2DMCA 4HIHB 4TTDD 2NY2B 3PQYD 1U91A 2GTZA 4ODHH 3TBWB 1IQDB 3DYOA 1LO3H 1HI6B 4KHXH 5C2BH 3CFJA 4R9HA 1A7RL 1J87A 4JZNA 1VACB 4JFXA 2X4UB 4ZMAT 1X5GA 1JI1A 4YDJB 3WHE0 4GSDL 2I9LB 4JKPL 2NY3C 2RB8A 5JQ6L 3LS4L 1O7SA 3O2WL 4DJMA 1D5IL 1MWAH 1GGYA 2C3VA 3QXAA 3U0PB 2RGSA 2VLJE 1U95B 5SWSB 1S9XB 2DOCA 5C3LD 2ARWA 1EBPA 3BXNA 4K23H 5I1KH 4KMTL 1JJUA 3KJ4B 1VPOL 4LCUA 4B41A 4HH9A 4F37K 4J3OC 1NUNB 4UB0L 2HRPL 5TE4L 5I71B 1YYMH 2XA8H 1G7IB 5I1CH 5DLMH 3ZE2E 4HFWA 1TVHB 4PJGE 2H26A 3JUZA 3AM8C 3QAZB 5E6IB 1T6WA 4Q6IA 1FN4B 2VDQH 5CBEA 3BEWA 3STLB 4PLJC