3U7ZA

Crystal structure of a putative metal binding protein rumgna_00854 (zp_02040092.1) from ruminococcus gnavus atcc 29149 at 1.30 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
GEKHITVTVIHGDQTENVFEFDTDAKYLGEVLESENLVDGESGEYGLFITTVDEETADDSKQQWWCITKGGEQVNTSADQTPVSDGDAFELTLKEGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative metal binding protein RUMGNA_00854
publication title Crystal structure of a putative metal binding protein RUMGNA_00854 (ZP_02040092.1) from Ruminococcus gnavus ATCC 29149 at 1.30 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Metal binding protein
total genus 27
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3u7zA00
2BBCA 2BB6A 4ZRPA 4KKJA 2V3NA 3KQ4A 2V3PA 4KKIA 3U7ZA 2BB5A 4ZRQA 2PMVA
chains in the Genus database with same CATH superfamily
2M0AA 1JCKB 2NTTA 2NR2A 2WXQA 5FKAC 4DK5A 2IDYA 3PRZA 1XF5L 3X23A 5TR5A 3NY5A 1E8ZA 4EOYA 3ZUNA 2D3GA 1YJ1A 3EHVA 2K25A 1N63A 3AEAB 2W3SA 4HPLB 4XDCA 5G5GA 1FIQA 1WGRA 4XZ4A 3ZQ4A 4ARCA 4YT0B 1N5XA 3CIRB 2I1KA 2KJRA 2XK5B 3AE2B 4FN2A 2PVGC 2CHXA 1NDDA 2KX0A 1OEYA 3RZFA 2XNAC 1HA5A 1SIFA 2XK5A 3PSEB 2FNJB 4C00A 3L10B 3BVGA 4KZCA 1D4BA 5C2TB 2WQYB 3APCA 3WALA 1KOTA 2PE6B 2ZPNA 2DYBA 4DXGA 3N1ZC 3CWIA 4WWNA 1ET9A 2MP2B 2DWQA 2N9EB 3EA6A 3IAM1 4RM8A 3RNCC 4HCNB 2L32A 2HTME 4KGTA 3IT6B 1XLQA 1UH6A 2WXPA 2GBNA 1UBIA 1ZE3D 3V3XA 4XX5A 4LNIA 2QSDA 4HJGE 1D5MC 3V62A 2MSED 3MJ5A 3VH4B 1QOFA 1D6EC 3ZTCA 4W9LA 3JW0X 5HFYA 2O6VB 3VAWA 2BB5A 4LNFA 3LB8C 2ONQA 1E7PB 2FAZA 4KIKB 2KO3A 3VRAB 5IP4D 2O6VA 2WDRB 2WXNA 2IGGA 4HDOA 2IO2B 1KLVA 1ZXHA 5EE3A 2YVCA 1T6BX 4YTPB 2SEBD 4NQLB 2K39A 2KDMA 2BTEA 4QAYA 3LJ3A 3AE7B 4W9IA 3W1SC 2K8HA 3Q8AA 4HKZE 4MEMA 1QQRA 3VUXA 4BOSC 1OGWA 4RMAA 3Q8CA 2RD0A 1TT5B 1FMAD 4ANVA 4URKA 1WIAA 3H8HA 2CS4A 1WZ3A 2W55A 1IGDA 3ALBA 4GB9A 4ZRJA 2REXA 3K9PB 2KMCA 1XCTL 3ZNZB 2Q5WD 4W9DA 5J18A 1Z2MA 2DENB 2INDC 3L16A 1KH0A 3H7PB 2AEHA 3VR8B 3H7PA 2XN9C 1GOZA 5CHVC 1MG4A 3K9OB 4A55A 3A9JB 3DBLB 4IM3A 4A90A 1OFFA 2K6DB 3N30A 2KN4A 4ASWC 4NNJB 4W9GA 4E3CA 4HROA 1B9RA 4P6VF 1WXSA 4LTUA 5DCNA 2CHZA 1UZXB 3BK1A 3SDLC 1TKEA 1OQRA 4A3OA 2K1FA 2QHOA 4NPNA 3ZYYX 3C0RB 3URYA 3A33B 1YQBA 3TBLD 3PHXB 1PUTA 4ZOHC 1V5TA 4LLGM 5LXIB 4C56C 1RAXA 4YTNB 1WM2A 2LGIA 4OZAA 3GS2A 3ZNGC 1VR9A 4RGNA 3CSTA 3NVZA 4OVUA 3KH0A 4DXAB 1I42A 2KXJA 4ZHOA 2MH7A 1TKYA 2X8XX 3FC4A 1WWTA 2AX5A 1V1OA 4IDIA 3NVYA 4IWPA 3ONSA 3SFDB 5D94A 3KWLA 1FO4A 1M94A 3OJ3A 2PEAA 4XE0A 1PGBA 3ZXVA 2L7RA 3VR9B 4YL8A 3Q69A 4WQMA 4LJOB 1TY0A 1ZGUB 2AL6A 4WJNA 2OEDA 1T0YA 3IAS1 3NS1A 4W9HA 3RPFC 1NYQA 3CF6E 5J2RA 4BKSD 4ZDVA 1OEYJ 4F8CB 3AXCA 1KJTA 1AWDA 4RFBA 2J4XA 2NTSA 2LWPA 3A4RA 1DOIA 1V2YA 4DHZE 4DHJD 1TBEA 3AE5B 1HTOA 4IWOA 3AE9B 2RSUA 3AB5A 4JIOU 2WX0A 2QMTA 1Q10A 3I3TB 4JL9A 2WYQA 3HIZA 3L08A 3VHTC 2DZIA 4M0WB 1F1HA 2DAJA 2WU5B 1DOYA 2H89B 4KKJA 4OVZA 3BYYB 3U52E 2WXRA 4LDTD 2O2VB 2BYEA 3Q3MC 4F1SA 1SGHA 1TGZB 2YEPF 1YX5B 1S1QB 2WXJA 3ZDMC 5JXVA 2IO1B 2Z59B 2WXLA 3P63A 3QIJA 1GJZA 4NQKE 2PKOA 3RMKC 1XEEA 3MFGA 1ISNA 2C7NB 1C4PA 1FCCC 1PGAA 1QOBA 2V4LA 4K3CA 1P3QU 2I2YA 3DBHB 1ESFA 1WGYA 3AE6B 2GBKA 3P4RB 4G11A 2Z8LA 1C78A 3AI5A 5BYRA 3UINB 1GB4A 1RWSA 3B08A 2JRIB 5D6JB 4ZRKA 3IHPC 2A4ZA 4TMAB 4AWJA 4MJSB 4HWIB 1LO5D 4MSMB 1ZOYB 3P42A 1VCBA 5LLIA 3GZNI 4MT5A 2MBOA 3AEBB 4KX6B 3IT4B 2LVPA 1YMHE 4XC2A 2PTLA 5CHFA 4BAXA 2DNFA 4BBNF 5HKHA 3TEZA 5CX3A 2HJ8A 1WGKA 2N9XA 1V8CA 1FNWA 1JWSD 3FKYA 2KQ4X 2DZKA 1CQVA 5E6OA 3PZ8A 2IZVB 3NZUA 1ENFA 1J7BA 4M8NA 3A1QB 2D3BA 1PFDA 5JHAA 1VZ6A 3NHEB 1CMXB 4MGZE 1XT9B 3FAHA 3R7RA 1PDXA 1I35A 1Q0WB 3VTUA 5D3DA 2VRRB 3Q3NC 3ENEA 3MHZA 1N61A 4IOIE 1LXDA 2G4SA 1YQ3B 2W82A 4ICUA 4AUQC 1J7AA 4GLSC 2FCSA 2BQQA 3PRMB 2ZCCA 4P16A 4NZLB 2OOBB 1QILA 1HTQA 2H88B 3EUB2 4WIPA 4FHJA 4WJPA 2A5UA 2WXKA 1K53A 1V97A 3W5VB 1T0QC 3N1YC 2M19A 3AULA 3RI7C 4W9KA 1WMHB 1V86A 4DDGD 3SFEB 2ZZPB 1U4AA 2DYMA 1F0ZA 4YSZB 3Q8EA 4FHKA 1EUVB 3VVWB 3AN1A 5IKCM 1WFYA 4TV3A 1H8CA 2N9PC 2VZKD 1BXTA 3NRZA 4KGRA 5JH5C 2GLSA 2KKCA 4PK1A 5CTRC 3ZJVA 1EU4A 1SJED 4G0NB 4GXBA 2N7EA 3A4SC 2KNBA 1HZ6A 3VRBB 3H6NA 2DX5B 1C4CA 2AYOB 2KWDA 2KVRA 1WF9A 2PPHA 3HM6X 2K6QA 2K5PA 3OAWA 2KDEB 1WRIA 3EGRA 5EE9A 4ITKA 1EO6A 3MC9A 1NI2A 3U8ZA 3OLMD 2V3NA 3DVNU 4EZLA 1EWYC 4US8A 1D5XC 4FLHA 3CMMB 3WCQA 2KWCA 3PHWB 1E0ZA 3W9CB 4HPPA 2RDBC 3CSFA 3H7SA 2KDIA 2JWZA 2KANA 2QDFA 3DHHC 4RM9A 3AE8B 2CKHB 3M95A 3PTFC 1CJEA 2IBIB 3OG5A 2KX3A 3QC8B 1ZW7A 2DHZA 2NS5A 1FFUA 4L1BA 3WAOA 3FILA 3MC0B 4N59A 3M63B 2ZNVC 3NVWA 3UF8A 3ZVVA 4J6IA 1XLOA 3N20C 4D2KA 5BMIA 2GI9A 4IG7B 3QAQA 4C4VB 5AUIA 3ML8A 1L6UA 4YWGG 3RNEC 1EU3A 2KT7A 1R4MI 3N32A 3ML9A 5DPRA 2BW2A 2FCMA 3NZSA 4C4VA 1SJHD 3HUIA 1L2NA 1IPGA 3ZJTA 1RYJA 2HTHA 1WY8A 1NYRA 1MJDA 4HXDA 4LNKA 4A8XC 3IG3A 1SEBD 2M1MA 2M8SA 3GB1A 4LJPB 4I6LB 1C1YB 4FJYA 4KZ0A 4WWPA 4XYCA 2GBRA 2KACA 2PE9A 2CU1A 2INCC 3BVZA 3VTWA 1JW9D 2NPTB 3RFZB 1TS4A 3VUYA 1SBBB 4AS1A 1I4HA 2K0PA 2KFKA 2NPTA 4G3XB 1RLFA 3RNFC 2J53A 2JXXA 5E6PA 3IVFA 1KM7A 1I4RA 3T9LA 3QJZA 2BS4B 2KLGA 1TS5A 4K1RB 1YN3A 2KQSA 2LD9A 2MBEA 2R61A 2UYZB 4YSXB 5EE1A 4DDID 4B0EA 1BT0A 3JYUA 1FRDA 1STEA 3AE1B 2KTFA 2N7DA 4F7ZA 3NOBA 4RGTA 4L23A 4XDDA 2KQ7A 1KLUD 2M17A 1F77A 1OTRB 3DWGC 3O65B 1SE9A 2VH1A 2W54A 1NVID 1P7EA 3KWVA 2RDHA 1GNUA 2MJDA 3DVGY 4WH4A 1XD3B 1YQ4B 4ACFA 2CJOA 1XO3A 5BYSA 4K3BA 3AH7A 4DBGA 1GUAB 3DDCB 4IM0A 5AZGA 3UGBB 3ZDTA 2D11A 2L05A 3IFWB 2KD0A 2IY1B 1KTKA 2LASA 2C60A 2FCQA 1YOVB 2WXFA 4OW0A 3PT2B 1WYWB 2Y5PA 4K7WA 2SAKA 3A9KB 4GDKA 1RFKA 1JWAD 3AV8A 3ZO5B 2RMMA 3A9KA 4GU2A 3Q14C 3TEYA 1KFYB 2N1VA 5L83A 2W3RA 1JALA 4N58A 1J0GA 1TIFA 5HHDG 4S17A 4EE2A 4HDQA 3LXFA 4HPMB 2WNMA 3R66C 3TL5A 1UBQA 2PJHA 2OHFA 2G9HD 2MHJA 3L4PA 2HJ1A 2JQRB 3RNGC 2MEKA 1RM6C 3QK0A 5FR3A 4HK2A 4KSLC 1MI0A 2KDBA 4HKQA 2BVCA 2WDQB 1T3QA 1UWMA 1GB1A 1XCQL 4NAMA 1UGJA 3DHIC 3AMZA 2L3ZA 3DVNV 4BFRA 1XLPA 2N0SB 4FXCA 1FRRA 2OJRA 1Q5WB 1N62A 2K22A 4JE3B 4FJVB 3ECIA 3ZLZA 3DWMA 5E6JA 1NI3A 4GGQA 5FK9C 3L17A 1K51A 2LHEA 2RDGA 3AEFB 3RYTA 1VZ8A 3APDA 2DZMA 3HHMA 2IPKD 3R2IA 1V6EA 4BKGA 4C80A 5C3JB 2KHWB 3E56A 3ZNHB 1SIJA 1XLNA 3EC8A 1HQRD 1E9MA 1V5OA 4A3PA 1AYFA 2LMCA 1L5PA 4M8MA 4LNOA 4NJCA 1TY2A 3QHTA 4P1BC 5G5HA 3GE3C 2ZCBA 1SE2A 4C7ZA 1JWBD 2LRWA 4AOFA 3ZGZA 5HI1A 4ZYNA 1AN8A 3R8BA 1I4GA 1RRBA 2CJNA 4JLCA 2NCNA 3M3JA 1ZUD2 2RPVA 3I63C 1LQBA 1WJNA 1V1PB 4J3OD 1MHHE 4WJOA 2JWUA 3U7DA 4BVUC 2BT6A 3P4SB 1VZ7A 2K8BA 3H1UA 3DCGA 3WAPA 3ZW3A 3B2GA 4RGOS 1V1PA 2V3PA 2IO3B 1QZEA 5BMGA 2L8JA 5EE0A 1C79A 1IGCA 1WJ6A 3KUZA 2HDEA 4KGSA 3TSSA 3GZNB 1YX6B 2WXHA 4USAA 2B76B 2ZVNA 2B3AA 2YEPB 2KDFB 4B6WA 1TTNA 4K81A 3U30A 1MFWA 3KUDB 2EKIA 1HZ5A 1WM3A 2PVOD 2LJ5A 2N7JA 2DBYA 4E71A 4MH0E 4PS3A 4KDLB 2KMAA 3N3KB 1UGMA 1F2RI 4G50A 3TEXA 1M4VA 5DPWA 1L7YA 2NVUI 4I6NB 2D2QA 4JGHB 3SHQA 1HE8A 1V9JA 2KJHB 2MW5A 3LYYA 3AEEB 2MA9B 4MGIE 2NBVB 5D3IB 1WXQA 3PPAA 5LXHA 1I4XA 2IY0B 4AP4C 3PV1A 3Q3FA 2KVZA 4YTMB 1PQSA 2FE8A 4BKTA 5BO4B 3U7ZA 1VLBA 2ICIA 4AJWA 1YNTE 3APFA 4MH8A 2Y5BB 4K7SA 1V80A 2BS2B 3WIMA 4MACA 1XQQA 2V9HA 2L83A 3U4EG 1IBXB 1GC6A 2JPHA 1YN5A 5IOIA 3T3OA 2V3SA 3N9YC 1IBXA 3KVFB 1T0RC 3TCAA 1FM0D 2V4IB 1NBFC 2PLPA 1PGXA 1DOXA 4E74A 5BMHA 4IUMB 1N5WA 1ZPSA 3BINA 2BKRB 3JSVB 2AQ3B 1E8YA 2MBQA 2UWQA 4KDIC 2JZZA 5C1ZA 2D5GA 3JSVA 2DAFA 1UWXA 2JSVX 3B1LX 3ZRCA 2EELA 3MJWA 3O13A 1SF0A 2GB1A 1L0VB 2E6XA 4HEA1 3WAMA 4P1CC 4DHZB 2VH2A 5TSSA 2C5LC 5LNK1 4LK0M 3R2TA 4TKNA 3DBRI 3PRPB 2ZW0A 4N9F4 4LCDE 2R2QA 2BYFA 2MQJA 1Y8RC 4NY0A 4Q2JA 4A20A 4O1NA 2E3TA 2ZW1A 3UIPB 1TZOA 2MBHA 1E5WA 2KOXA 3Q2AC 2LEKA 2WS3B 1C4AA 5H8YE 2J42A 1AARA 4FJZA 2ASQA 1NENB 2ZEQA 2LHDA 2QC8A 3RULA 4RH6A 4DWFA 5MPOA 2IO0B 3ZJUA 4BKSA 2EMSA 2PIAA 1YJIA 4DHJB 1R4MB 3X0WA 5AZHA 1EM7A 1ZDVA 1KLGD 1L6VA 3E9SA 4WJQA 3TJPA 2QEJC 4WQOB 3ZKJC 5H92C 3W1SA 2V0GA 2WHIA 1ZXIA 3VUWA 1P9DU 2TSSA 4LDTB 1HEZE 4OZBA 2O6VD 2WGSA 2L00B 1C9FA 4DXFA 2N9KA 2M56B 2MRPA 1B1ZA 1UD7A 1R7SA 3DHGC 3AU4A 4EKUA 2QILA 4IM2A 1QOAA 1WI0A 5IA7A 3BIID 1N6ZA 1WXAA 2FBWB 4CHKA 3AU5A 3AE4B 2I1JA 3FILB 4HVBA 3MP9A 4JWUC 4WWMA 1WRDB 4ICVA 3NVVA 3QWZB 4FULA 3V6CB 2V1YA 2JZPA 4C7YA 4MGYE 4TQ1A 3RD2A 2RR9A 1EWCA 1RFAA 1S3SG 2IGDA 5IO9A 3HM3A 1FNUA 4ARIA 4K7UA 2BBCA 3ZIMA 2L0FA 3PGEA 4EUTA 3ABVB 4RGMA 4ANWA 4NJ7A 4H2AA 3PS6A 2EMTA 2N4FA 2LGSA 1GG3A 4GSWA 4BBNC 1QKZA 2KFKB 3BZDB 3W5UB 1JROA 4NAWB 1UELA 4II2B 2INNE 2G1EA 4NAWA 2DLBA 4MDKE 1E90A 5I4DA 1E10A 3S2AA 1WGGA 2WLBA 4RF1A 2DYOA 1QT9A 1A5RA 4JX1C 4MELA 1VDVA 5GMVA 4US9A 3MTNB 1E8WA 1GC7A 3UI3A 4ZRPA 1ACCA 2RGFA 2J0JA 2NBUA 1TYGB 1E6EB 2WU2B 2RPQA 1N60A 3IBEA 2BKFA 2ZPYA 1X1MA 2AQ2B 2CU3A 1MVKA 1L0XB 1WGDA 4PYZA 4W9JA 4M02A 3KQ4A 1NEKB 2JZ3B 1TZ1A 3DQVA 3VH3B 3L54A 3WANA 3TUOA 2BS3B 1UF0A 2VZKB 3MC8A 1TS3A 3UQAA 1WE6A 2AQ1B 4B95A 1C77A 3B0AA 4GIVA 2PMVA 2MP2A 1PYWD 2QJLA 2W9NA 2HE7A 2ZJDA 1KF6B 4P7IA 2L76A 5IN7A 3KUCB 3AEDB 2FIFA 1FXAA 3ETRA 4GDKB 2K8CA 2WDVB 1QOGA 4OVVA 2DZJA 1UUPA 1TJEA 1C76A 4RNAA 4GDLB 1I4QA 1YN4A 4KIKA 2G4DB 4GDLA 2CR5A 4WAFA 1WX9A 3VTVA 2JU6X 1OQYA 2L52A 5FR6A 1IP9A 3VDZA 2MJ3A 1JWMD 3PREA 1SE3A 4B9KA 2BGFA 4FBJB 3V60A 2JUOA 1L0YB 3DBSA 4DQOC 2BB6A 2L1AA 4LNNA 1LM8B 2LXAA 1ZDXA 3JVZX 3QX1A 3GE8C 2BF8B 2LZ6A 4OHJA 1FEHA 4FADA 1FPYA 1IUEA 4N6EB 2M4NA 2C7HA 2LUMA 4EZJA 2LXCA 3EFUA 2JVCA 2WXIA 5HG2A 3AM9A 3P4QB 4IW0A 3P2BA 3J9CA 4CO7A 4KV2A 4GN1A 4W9EA 2K9XA 3NJTA 3BY4B 2JXTA 3A9JA 2JY6A 1C3TA 2XEWA 4BZAA 2QIEB 4MM3B 1MHXA 5C23A 1EF1A 5L95C 3IXSA 2ZVOA 3NG0A 3RNBC 3T3NA 2AWTA 2N9LA 2JF5A 2GOWA 2M0XA 1J8CA 4MM3A 2R2OA 2GMIC 5IAAC 2WXMA 1WGHA 1SB3C 3RZWC 3P4PB 3HK0A 3QQ8B 1T0SC 3L0WB 3M62B 1FXTB 2D3CA 1VRAB 3GOEA 1K52A 1WYGA 4HLEA 2KWUB 2KN5A 1ZKHA 3Q3OC 2KC1A 4YSYB 1V49A 1L4ZB 2KJ6A 1P98A 3W1YA 4GMVA 1FFVA 2KLCA 1R4NB 3SU8X 3P1MA 2QCZA 1D3ZA 5JHBA 2Y3AA 4IWQA 2Z0DB 1YD8U 2JYEA 2X38A 1LGRA 2ON8A 1SSNA 3UIOB 1EF5A 1LFDA 3SD5A 3NS8A 2LGYA 2IYDB 4IKGA 4WWOA 2NBWB 1D5ZC 5T8IA 3V6EB 2ACZB 4NJ6A 2MCNB 3RUIB 1DYQA 1WXMA 2L0TA 1WZ0A 4PT5A 2IGHA 3KYCD 2WX1A 1E8XA 3DBLI 4R3DA 4HCPB 1QF6A 4RF0A 4I6PA 1H4RA 1J7CA 3PZ7A 3KYDD 2J0MA 2MJEA 3NUHB 1GAQB 3ZXRA 1YJJA 2LGXA 3C19A 4ANUA 1WX8A 1VD2A 4A6QA 2BPSA 1Y56A 4TQ0A 1HXYD 2BWES 3DBRB 4OZCA 1WH3A 4CQNA 3MHSD 1ET6A 2LGDA 4REZA 1WR6E 4PS7A 4M0WA 2MLBA 2KYWA 2ZNVB 3EFCA 2J7QB 3Q8BA 3GP7A 2LFIA 1ROEA 1DGJA 2KC2A 4ZRIA 4BOZB 4GOCA 3KLSX 2BWFA 2KFJA 4KKIA 2O2VA 3BVMA 1R4NI 4JQWC 5AEKB 2WXGA 2BYVE 3AECB 4HJKA 2JT4B 3QCAA 1CK1A 3QARA 3R7QA 3KW5B 5BYQA 4S0RA 3PVLA 3V05A 3BWUD 3I5JC 2C9WB 3WA0A 3DVGX 4CYEA 2INPE 2D10A 2WP9B 1TS2A 4M01A 3TIXA 1V81A 2AL3A 4W9FA 1A70A 4PS8A 2EKEC 2GRIA 4EFOA 5EDSA 4ZHPA 1JRUA 5DPSA 2FIDA 2FUG1 1WR1A 3T8MA 3VXWA 2J0KA 1G6JA 1WJUA 3D32A 4MJSA 4IC7B 1MG8A 1BMLC 5AZFA 5G55A 2MX2A 1JMLA 5J17A 3V61A 1FXIA 1BUIC 2K3UA 1QLBB 1WJ4A 1GPXA 1MPEA 1AW7A 2FCNA 1IYFA 4A9AA 2JYTA 3RCZA 3C8YA 3NZ3A 4B0MA 3UQBA 4XGAB 2KTRB 3PLUA 1P7FA 1E7UA 2LVOA 2G45B 2C7MB 2KTRA 3Q6BA 1UNSA 3PZDA 1KRHA 3SEBA 2KK8A 2LVQA 5KHOA 3A1QA 2FUHB 2J52A 3I9V1 1F2RC 2KMMA 3ZRFA 1I4PA 3HVZA 5KHQA 3EECA 1Q1OA 4JWSC 3TEWA 3W2DA 1F9JA 4MSQB 1F52A 3TMPB 3PLVA 2D07B 5DPTA 3HRDD 2N1WA 1WXVA 1L4DB 2GBMA 1FCLA 4AJYB 4FA6A 2LJIA 4PYUA 3VFKA 5D2MB 1ZP0B 3DBHI 5GXGB 3B2FA 2YLMA 1WE7A 4W9CA 3AE3B 2Y5CA 5JZEB 5CHWA 1FD6A 2IJ0A 3Q3JA 4ANXA 4EEWA 3H9DA 4TUUA 3LDZE 1SXTA 1WMHA 4MGKE 2PW9A 3AEGB 1FNVA 2KWVB 2KZRA 4X57B 2WDTB 3R3MA 4WURA 5E6NA 4YXDB 1XXGA 3U2SC 3DPDA 2G3QB 5D7GA 2JX5A 2OJWA 3OWEB 2D3AA 1WX7A 1J19A 3B9JA 1TKGA 2WXOA 1CZPA 4II3B 2I38A 4L2YA 4EZKA 1T5XD 4HRSA 3OJ4B 1VJKA 5G2NA 3HVDA 2NMQA 1K8RB 1JRPA 2Z0EB 2HD5B 4M00A 3PO0A 3ZTDA 1JWUD 4KSKC 3RT3B 4TSSA 4ZYSA 4XWTA 2BYTA 3L13A 1E7VA 1YIWA 2WWZA 1SE4A 1WSPA 3VQIA 1JQ4A 3BYTB 4KVGB 3DOWA 1Z5SB 2MBBB 4ZRQA 2MWSB 2XBBC 3RN9C 3ZNID 4WAAA 1P1AA 2LRUA 3QA8A 2CHWA 2GBJA 3SR6A 3Q8FA 2LUEA 1P0RA 2JRHA 5AUKA 3I57A 3RNAC 4XWWA 4UDUC 1I7HA 2UU7A 4AQ7A 1K50A 2KAJA 4RCOA 1OQQA 3N1XC 3BK2A 4JPSA 2LI5A
chains in the Genus database with same CATH topology
2M0AA 1JCKB 2NTTA 4IOIE 2EKIA 1HZ5A 1L0YB 2WXQA 5FKAC 1YQ3B 2W82A 4DQOC 2IDYA 2PVOD 2BB6A 1XF5L 2L1AA 1J7AA 2N7JA 4GLSC 2DBYA 1ZDXA 1F2RI 4P16A 1N63A 3TEXA 4NZLB 3AEAB 1QILA 2W3SA 2H88B 1M4VA 4XDCA 3EUB2 4OHJA 4WIPA 5G5GA 1FEHA 1FIQA 1IUEA 2WXKA 4N6EB 1K53A 1V97A 3W5VB 3ZQ4A 2LUMA 2M19A 2WXIA 5HG2A 4ARCA 3AM9A 3P4QB 1N5XA 4YT0B 3CIRB 3SFEB 3J9CA 3AE2B 2DYMA 3LYYA 2PVGC 1F0ZA 4YSZB 3AEEB 3Q8EA 5D3IB 1WXQA 2XNAC 1HA5A 3AN1A 2K9XA 1I4XA 2JXTA 3BVGA 2VZKD 1BXTA 4YTMB 2QIEB 2FE8A 3NRZA 4KGRA 3U7ZA 1VLBA 4MM3B 1MHXA 2ICIA 1D4BA 5C2TB 3IXSA 1YNTE 3T3NA 3ZJVA 1EU4A 2WQYB 4MH8A 2N9LA 1SJED 2BS2B 4MACA 1HZ6A 4DXGA 3VRBB 2L83A 2WXMA 3CWIA 3U4EG 1IBXB 1C4CA 1ET9A 2KWDA 1SB3C 1YN5A 3T3OA 3N9YC 2K5PA 3P4PB 1WRIA 2DWQA 3EA6A 1IBXA 3EGRA 3IAM1 5EE9A 2L32A 2HTME 4ITKA 4KGTA 3IT6B 1FM0D 1XLQA 1VRAB 2V4IB 1K52A 1WYGA 2PLPA 2WXPA 1PGXA 1DOXA 2V3NA 1ZE3D 5BMHA 3V3XA 1EWYC 4US8A 1N5WA 1D5XC 1ZPSA 2QSDA 4HJGE 1D5MC 4YSYB 3WCQA 3MJ5A 1L4ZB 1E0ZA 3W9CB 1QOFA 2AQ3B 1FFVA 1D6EC 5HFYA 3P1MA 2BB5A 3LB8C 2D5GA 2ONQA 1E7PB 1UWXA 2JSVX 3AE8B 1CJEA 2EELA 3VRAB 2Y3AA 2WDRB 2WXNA 3O13A 2IGGA 1SF0A 2GB1A 2JYEA 1L0VB 1ZXHA 2E6XA 2X38A 5EE3A 2ON8A 1SSNA 4HEA1 1T6BX 4YTPB 2SEBD 1FFUA 4L1BA 5TSSA 3FILA 3MC0B 4N59A 2KDMA 2BTEA 3NVWA 4IKGA 5LNK1 4LK0M 1D5ZC 5T8IA 3R2TA 3AE7B 2ACZB 2ZW0A 1XLOA 4D2KA 5BMIA 3Q8AA 2GI9A 4HKZE 1DYQA 1QQRA 4PT5A 2IGHA 5AUIA 1L6UA 4YWGG 1EU3A 4R3DA 3Q8CA 1QF6A 4Q2JA 1FMAD 4O1NA 2BW2A 4RF0A 2E3TA 1SJHD 3HUIA 1J7CA 3PZ7A 2ZW1A 3H8HA 2W55A 1IGDA 1TZOA 3ZJTA 1RYJA 1NYRA 4A8XC 2MJEA 1SEBD 3NUHB 1XCTL 2Q5WD 3GB1A 1GAQB 2LEKA 2WS3B 1C4AA 1YJJA 5H8YE 2J42A 1KH0A 4A6QA 1Y56A 4TQ0A 1HXYD 2KACA 1NENB 3BVZA 3VR8B 1JW9D 3RFZB 1TS4A 4OZCA 4CQNA 2LHDA 1GOZA 1ET6A 2XN9C 4RH6A 5MPOA 1SBBB 4AS1A 4A55A 1I4HA 4REZA 3ZJUA 4A90A 2K0PA 1OFFA 2PIAA 1YJIA 2KN4A 4M0WA 1EM7A 2J53A 1ZDVA 1KLGD 1L6VA 3E9SA 3Q8BA 3GP7A 1I4RA 4HROA 4P6VF 1B9RA 2LFIA 2BS4B 1ROEA 1DGJA 4LTUA 1TS5A 1YN3A 3KLSX 2QEJC 3BK1A 4KKIA 5H92C 2R61A 3W1SA 4YSXB 3BVMA 5EE1A 2V0GA 4B0EA 1TKEA 1ZXIA 1FRDA 2WXGA 1OQRA 1STEA 3AE1B 3AECB 1CK1A 3ZYYX 3URYA 2TSSA 1HEZE 4RGTA 5BYQA 4OZBA 1PUTA 4L23A 4ZOHC 3V05A 3BWUD 4XDDA 1KLUD 4LLGM 1C9FA 4C56C 4DXFA 1F77A 2INPE 4YTNB 3DWGC 2WP9B 2LGIA 4OZAA 1TS2A 3GS2A 2W54A 1NVID 1P7EA 3KWVA 1VR9A 4RGNA 2RDHA 2N9KA 3NVZA 2MJDA 2M56B 4WH4A 1A70A 1YQ4B 2GRIA 1B1ZA 1R7SA 2CJOA 1XO3A 4ZHOA 2MH7A 2QILA 1TKYA 5BYSA 1QOAA 4ZHPA 3AH7A 3FC4A 1WWTA 2AX5A 2FUG1 1V1OA 3BIID 4IDIA 3NVYA 2FBWB 3AE4B 1KTKA 3SFDB 3FILB 1BMLC 3MP9A 3KWLA 1FO4A 4JWUC 4WWMA 1JMLA 4XE0A 1FXIA 1PGBA 1BUIC 2K3UA 3NVVA 1QLBB 2WXFA 4OW0A 3VR9B 1GPXA 3Q69A 1MPEA 1AW7A 2Y5PA 2SAKA 4WQMA 4A9AA 2JYTA 1TY0A 2JZPA 4C7YA 3C8YA 3NZ3A 4TQ1A 1RFKA 1JWAD 3AV8A 2OEDA 3IAS1 3NS1A 4B0MA 2RMMA 3RPFC 1NYQA 1EWCA 1KFYB 3TEYA 1P7FA 2W3RA 2IGDA 1JALA 1FNUA 4ARIA 1UNSA 1AWDA 2BBCA 4N58A 4RFBA 2J4XA 1KRHA 2NTSA 5HHDG 3SEBA 4EE2A 3LXFA 1DOIA 2WNMA 2J52A 3I9V1 1F2RC 3ABVB 4RGMA 3AE5B 2KMMA 2OHFA 3AE9B 1I4PA 2G9HD 3HVZA 3AB5A 3L4PA 4H2AA 4JWSC 3TEWA 3W2DA 2JQRB 2MEKA 2QMTA 1Q10A 1RM6C 5FR3A 1QKZA 3HRDD 1MI0A 3BZDB 3W5UB 4HKQA 1JROA 1L4DB 2WDQB 4NAWB 1T3QA 2WU5B 1UWMA 1GB1A 1XCQL 1DOYA 2H89B 4KKJA 4NAMA 1FCLA 4OVZA 2LJIA 2INNE 1UGJA 1ZP0B 2G1EA 5GXGB 3BYYB 3AMZA 2DLBA 3B2FA 3U52E 2WXRA 5I4DA 1E10A 3AE3B 1XLPA 2N0SB 2Y5CA 4FXCA 2WLBA 4RF1A 2DYOA 1FD6A 1FRRA 1QT9A 2YEPF 2IJ0A 2WXJA 1N62A 4JX1C 2K22A 1VDVA 4JE3B 5JXVA 4US9A 3UI3A 1SXTA 4ZRPA 1ACCA 1TYGB 2WXLA 3DWMA 2PW9A 3P63A 3AEGB 1FNVA 1E6EB 2WU2B 5E6JA 1NI3A 5FK9C 1N60A 1K51A 2LHEA 2RDGA 2PKOA 2AQ2B 3AEFB 1VZ8A 2CU3A 4WURA 1XEEA 2IPKD 1MVKA 1L0XB 3R2IA 4YXDB 1XXGA 3MFGA 4C80A 1C4PA 1FCCC 1PGAA 1QOBA 3U2SC 5C3JB 3E56A 5D7GA 2JX5A 1SIJA 1XLNA 2I2YA 3OWEB 3KQ4A 1ESFA 1HQRD 3AE6B 1NEKB 3B9JA 1E9MA 1TKGA 3P4RB 2WXOA 2Z8LA 1C78A 1CZPA 2I38A 5BYRA 4L2YA 1AYFA 3TUOA 2LMCA 1L5PA 1T5XD 2BS3B 1GB4A 1RWSA 4HRSA 1VJKA 2VZKB 1TS3A 4TMAB 4NJCA 1TY2A 2AQ1B 3HVDA 1C77A 2NMQA 5G5HA 1LO5D 2PMVA 1JRPA 1ZOYB 1PYWD 2QJLA 3P42A 3PO0A 1SE2A 4MT5A 4C7ZA 1JWBD 1JWUD 3AEBB 1KF6B 4KX6B 3IT4B 4TSSA 5HI1A 4XWTA 4ZYSA 3ZGZA 1AN8A 2BYTA 3R8BA 1YMHE 1I4GA 3AEDB 2CJNA 1FXAA 1SE4A 1WSPA 2PTLA 3ETRA 4GDKB 3VQIA 1JQ4A 3BYTB 2WDVB 1ZUD2 2RPVA 3TEZA 1QOGA 1V1PB 4J3OD 1WGKA 1MHHE 2JWUA 1V8CA 2BT6A 1UUPA 3P4SB 1FNWA 1TJEA 1VZ7A 1C76A 4ZRQA 4RNAA 1JWSD 4GDLB 3B2GA 1I4QA 2KQ4X 4RGOS 1V1PA 1YN4A 2V3PA 1CQVA 3PZ8A 5BMGA 3SR6A 5EE0A 3Q8FA 1C79A 1IGCA 1ENFA 4WAFA 2HDEA 4KGSA 3TSSA 1J7BA 5AUKA 2JU6X 3I57A 1PFDA 2WXHA 4USAA 4XWWA 2L52A 4UDUC 1I7HA 1VZ6A 2B76B 4AQ7A 1K50A 2KAJA 3FAHA 1PDXA 4RCOA 1OQQA 2YEPB 2MJ3A 1JWMD 3BK2A 5D3DA 1SE3A 4JPSA 3MHZA 1N61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBC A;  2BB6 A;  4ZRP A;  4KKJ A;  2V3N A;  3KQ4 A;  2V3P A;  4KKI A;  3U7Z A;  2BB5 A;  4ZRQ A;  2PMV A; 
#chains in the Genus database with same CATH topology
 2M0A A;  1JCK B;  2NTT A;  2NR2 A;  2WXQ A;  5FKA C;  4DK5 A;  2IDY A;  3PRZ A;  1XF5 L;  3X23 A;  5TR5 A;  3NY5 A;  1E8Z A;  4EOY A;  3ZUN A;  2D3G A;  1YJ1 A;  3EHV A;  2K25 A;  1N63 A;  3AEA B;  2W3S A;  4HPL B;  4XDC A;  5G5G A;  1FIQ A;  1WGR A;  4XZ4 A;  3ZQ4 A;  4ARC A;  4YT0 B;  1N5X A;  3CIR B;  2I1K A;  2KJR A;  2XK5 B;  3AE2 B;  4FN2 A;  2PVG C;  2CHX A;  1NDD A;  2KX0 A;  1OEY A;  3RZF A;  2XNA C;  1HA5 A;  1SIF A;  2XK5 A;  3PSE B;  2FNJ B;  4C00 A;  3L10 B;  3BVG A;  4KZC A;  1D4B A;  5C2T B;  2WQY B;  3APC A;  3WAL A;  1KOT A;  2PE6 B;  2ZPN A;  2DYB A;  4DXG A;  3N1Z C;  3CWI A;  4WWN A;  1ET9 A;  2MP2 B;  2DWQ A;  2N9E B;  3EA6 A;  3IAM 1;  4RM8 A;  3RNC C;  4HCN B;  2L32 A;  2HTM E;  4KGT A;  3IT6 B;  1XLQ A;  1UH6 A;  2WXP A;  2GBN A;  1UBI A;  1ZE3 D;  3V3X A;  4XX5 A;  4LNI A;  2QSD A;  4HJG E;  1D5M C;  3V62 A;  2MSE D;  3MJ5 A;  3VH4 B;  1QOF A;  1D6E C;  3ZTC A;  4W9L A;  3JW0 X;  5HFY A;  2O6V B;  3VAW A;  2BB5 A;  4LNF A;  3LB8 C;  2ONQ A;  1E7P B;  2FAZ A;  4KIK B;  2KO3 A;  3VRA B;  5IP4 D;  2O6V A;  2WDR B;  2WXN A;  2IGG A;  4HDO A;  2IO2 B;  1KLV A;  1ZXH A;  5EE3 A;  2YVC A;  1T6B X;  4YTP B;  2SEB D;  4NQL B;  2K39 A;  2KDM A;  2BTE A;  4QAY A;  3LJ3 A;  3AE7 B;  4W9I A;  3W1S C;  2K8H A;  3Q8A A;  4HKZ E;  4MEM A;  1QQR A;  3VUX A;  4BOS C;  1OGW A;  4RMA A;  3Q8C A;  2RD0 A;  1TT5 B;  1FMA D;  4ANV A;  4URK A;  1WIA A;  3H8H A;  2CS4 A;  1WZ3 A;  2W55 A;  1IGD A;  3ALB A;  4GB9 A;  4ZRJ A;  2REX A;  3K9P B;  2KMC A;  1XCT L;  3ZNZ B;  2Q5W D;  4W9D A;  5J18 A;  1Z2M A;  2DEN B;  2IND C;  3L16 A;  1KH0 A;  3H7P B;  2AEH A;  3VR8 B;  3H7P A;  2XN9 C;  1GOZ A;  5CHV C;  1MG4 A;  3K9O B;  4A55 A;  3A9J B;  3DBL B;  4IM3 A;  4A90 A;  1OFF A;  2K6D B;  3N30 A;  2KN4 A;  4ASW C;  4NNJ B;  4W9G A;  4E3C A;  4HRO A;  1B9R A;  4P6V F;  1WXS A;  4LTU A;  5DCN A;  2CHZ A;  1UZX B;  3BK1 A;  3SDL C;  1TKE A;  1OQR A;  4A3O A;  2K1F A;  2QHO A;  4NPN A;  3ZYY X;  3C0R B;  3URY A;  3A33 B;  1YQB A;  3TBL D;  3PHX B;  1PUT A;  4ZOH C;  1V5T A;  4LLG M;  5LXI B;  4C56 C;  1RAX A;  4YTN B;  1WM2 A;  2LGI A;  4OZA A;  3GS2 A;  3ZNG C;  1VR9 A;  4RGN A;  3CST A;  3NVZ A;  4OVU A;  3KH0 A;  4DXA B;  1I42 A;  2KXJ A;  4ZHO A;  2MH7 A;  1TKY A;  2X8X X;  3FC4 A;  1WWT A;  2AX5 A;  1V1O A;  4IDI A;  3NVY A;  4IWP A;  3ONS A;  3SFD B;  5D94 A;  3KWL A;  1FO4 A;  1M94 A;  3OJ3 A;  2PEA A;  4XE0 A;  1PGB A;  3ZXV A;  2L7R A;  3VR9 B;  4YL8 A;  3Q69 A;  4WQM A;  4LJO B;  1TY0 A;  1ZGU B;  2AL6 A;  4WJN A;  2OED A;  1T0Y A;  3IAS 1;  3NS1 A;  4W9H A;  3RPF C;  1NYQ A;  3CF6 E;  5J2R A;  4BKS D;  4ZDV A;  1OEY J;  4F8C B;  3AXC A;  1KJT A;  1AWD A;  4RFB A;  2J4X A;  2NTS A;  2LWP A;  3A4R A;  1DOI A;  1V2Y A;  4DHZ E;  4DHJ D;  1TBE A;  3AE5 B;  1HTO A;  4IWO A;  3AE9 B;  2RSU A;  3AB5 A;  4JIO U;  2WX0 A;  2QMT A;  1Q10 A;  3I3T B;  4JL9 A;  2WYQ A;  3HIZ A;  3L08 A;  3VHT C;  2DZI A;  4M0W B;  1F1H A;  2DAJ A;  2WU5 B;  1DOY A;  2H89 B;  4KKJ A;  4OVZ A;  3BYY B;  3U52 E;  2WXR A;  4LDT D;  2O2V B;  2BYE A;  3Q3M C;  4F1S A;  1SGH A;  1TGZ B;  2YEP F;  1YX5 B;  1S1Q B;  2WXJ A;  3ZDM C;  5JXV A;  2IO1 B;  2Z59 B;  2WXL A;  3P63 A;  3QIJ A;  1GJZ A;  4NQK E;  2PKO A;  3RMK C;  1XEE A;  3MFG A;  1ISN A;  2C7N B;  1C4P A;  1FCC C;  1PGA A;  1QOB A;  2V4L A;  4K3C A;  1P3Q U;  2I2Y A;  3DBH B;  1ESF A;  1WGY A;  3AE6 B;  2GBK A;  3P4R B;  4G11 A;  2Z8L A;  1C78 A;  3AI5 A;  5BYR A;  3UIN B;  1GB4 A;  1RWS A;  3B08 A;  2JRI B;  5D6J B;  4ZRK A;  3IHP C;  2A4Z A;  4TMA B;  4AWJ A;  4MJS B;  4HWI B;  1LO5 D;  4MSM B;  1ZOY B;  3P42 A;  1VCB A;  5LLI A;  3GZN I;  4MT5 A;  2MBO A;  3AEB B;  4KX6 B;  3IT4 B;  2LVP A;  1YMH E;  4XC2 A;  2PTL A;  5CHF A;  4BAX A;  2DNF A;  4BBN F;  5HKH A;  3TEZ A;  5CX3 A;  2HJ8 A;  1WGK A;  2N9X A;  1V8C A;  1FNW A;  1JWS D;  3FKY A;  2KQ4 X;  2DZK A;  1CQV A;  5E6O A;  3PZ8 A;  2IZV B;  3NZU A;  1ENF A;  1J7B A;  4M8N A;  3A1Q B;  2D3B A;  1PFD A;  5JHA A;  1VZ6 A;  3NHE B;  1CMX B;  4MGZ E;  1XT9 B;  3FAH A;  3R7R A;  1PDX A;  1I35 A;  1Q0W B;  3VTU A;  5D3D A;  2VRR B;  3Q3N C;  3ENE A;  3MHZ A;  1N61 A;  4IOI E;  1LXD A;  2G4S A;  1YQ3 B;  2W82 A;  4ICU A;  4AUQ C;  1J7A A;  4GLS C;  2FCS A;  2BQQ A;  3PRM B;  2ZCC A;  4P16 A;  4NZL B;  2OOB B;  1QIL A;  1HTQ A;  2H88 B;  3EUB 2;  4WIP A;  4FHJ A;  4WJP A;  2A5U A;  2WXK A;  1K53 A;  1V97 A;  3W5V B;  1T0Q C;  3N1Y C;  2M19 A;  3AUL A;  3RI7 C;  4W9K A;  1WMH B;  1V86 A;  4DDG D;  3SFE B;  2ZZP B;  1U4A A;  2DYM A;  1F0Z A;  4YSZ B;  3Q8E A;  4FHK A;  1EUV B;  3VVW B;  3AN1 A;  5IKC M;  1WFY A;  4TV3 A;  1H8C A;  2N9P C;  2VZK D;  1BXT A;  3NRZ A;  4KGR A;  5JH5 C;  2GLS A;  2KKC A;  4PK1 A;  5CTR C;  3ZJV A;  1EU4 A;  1SJE D;  4G0N B;  4GXB A;  2N7E A;  3A4S C;  2KNB A;  1HZ6 A;  3VRB B;  3H6N A;  2DX5 B;  1C4C A;  2AYO B;  2KWD A;  2KVR A;  1WF9 A;  2PPH A;  3HM6 X;  2K6Q A;  2K5P A;  3OAW A;  2KDE B;  1WRI A;  3EGR A;  5EE9 A;  4ITK A;  1EO6 A;  3MC9 A;  1NI2 A;  3U8Z A;  3OLM D;  2V3N A;  3DVN U;  4EZL A;  1EWY C;  4US8 A;  1D5X C;  4FLH A;  3CMM B;  3WCQ A;  2KWC A;  3PHW B;  1E0Z A;  3W9C B;  4HPP A;  2RDB C;  3CSF A;  3H7S A;  2KDI A;  2JWZ A;  2KAN A;  2QDF A;  3DHH C;  4RM9 A;  3AE8 B;  2CKH B;  3M95 A;  3PTF C;  1CJE A;  2IBI B;  3OG5 A;  2KX3 A;  3QC8 B;  1ZW7 A;  2DHZ A;  2NS5 A;  1FFU A;  4L1B A;  3WAO A;  3FIL A;  3MC0 B;  4N59 A;  3M63 B;  2ZNV C;  3NVW A;  3UF8 A;  3ZVV A;  4J6I A;  1XLO A;  3N20 C;  4D2K A;  5BMI A;  2GI9 A;  4IG7 B;  3QAQ A;  4C4V B;  5AUI A;  3ML8 A;  1L6U A;  4YWG G;  3RNE C;  1EU3 A;  2KT7 A;  1R4M I;  3N32 A;  3ML9 A;  5DPR A;  2BW2 A;  2FCM A;  3NZS A;  4C4V A;  1SJH D;  3HUI A;  1L2N A;  1IPG A;  3ZJT A;  1RYJ A;  2HTH A;  1WY8 A;  1NYR A;  1MJD A;  4HXD A;  4LNK A;  4A8X C;  3IG3 A;  1SEB D;  2M1M A;  2M8S A;  3GB1 A;  4LJP B;  4I6L B;  1C1Y B;  4FJY A;  4KZ0 A;  4WWP A;  4XYC A;  2GBR A;  2KAC A;  2PE9 A;  2CU1 A;  2INC C;  3BVZ A;  3VTW A;  1JW9 D;  2NPT B;  3RFZ B;  1TS4 A;  3VUY A;  1SBB B;  4AS1 A;  1I4H A;  2K0P A;  2KFK A;  2NPT A;  4G3X B;  1RLF A;  3RNF C;  2J53 A;  2JXX A;  5E6P A;  3IVF A;  1KM7 A;  1I4R A;  3T9L A;  3QJZ A;  2BS4 B;  2KLG A;  1TS5 A;  4K1R B;  1YN3 A;  2KQS A;  2LD9 A;  2MBE A;  2R61 A;  2UYZ B;  4YSX B;  5EE1 A;  4DDI D;  4B0E A;  1BT0 A;  3JYU A;  1FRD A;  1STE A;  3AE1 B;  2KTF A;  2N7D A;  4F7Z A;  3NOB A;  4RGT A;  4L23 A;  4XDD A;  2KQ7 A;  1KLU D;  2M17 A;  1F77 A;  1OTR B;  3DWG C;  3O65 B;  1SE9 A;  2VH1 A;  2W54 A;  1NVI D;  1P7E A;  3KWV A;  2RDH A;  1GNU A;  2MJD A;  3DVG Y;  4WH4 A;  1XD3 B;  1YQ4 B;  4ACF A;  2CJO A;  1XO3 A;  5BYS A;  4K3B A;  3AH7 A;  4DBG A;  1GUA B;  3DDC B;  4IM0 A;  5AZG A;  3UGB B;  3ZDT A;  2D11 A;  2L05 A;  3IFW B;  2KD0 A;  2IY1 B;  1KTK A;  2LAS A;  2C60 A;  2FCQ A;  1YOV B;  2WXF A;  4OW0 A;  3PT2 B;  1WYW B;  2Y5P A;  4K7W A;  2SAK A;  3A9K B;  4GDK A;  1RFK A;  1JWA D;  3AV8 A;  3ZO5 B;  2RMM A;  3A9K A;  4GU2 A;  3Q14 C;  3TEY A;  1KFY B;  2N1V A;  5L83 A;  2W3R A;  1JAL A;  4N58 A;  1J0G A;  1TIF A;  5HHD G;  4S17 A;  4EE2 A;  4HDQ A;  3LXF A;  4HPM B;  2WNM A;  3R66 C;  3TL5 A;  1UBQ A;  2PJH A;  2OHF A;  2G9H D;  2MHJ A;  3L4P A;  2HJ1 A;  2JQR B;  3RNG C;  2MEK A;  1RM6 C;  3QK0 A;  5FR3 A;  4HK2 A;  4KSL C;  1MI0 A;  2KDB A;  4HKQ A;  2BVC A;  2WDQ B;  1T3Q A;  1UWM A;  1GB1 A;  1XCQ L;  4NAM A;  1UGJ A;  3DHI C;  3AMZ A;  2L3Z A;  3DVN V;  4BFR A;  1XLP A;  2N0S B;  4FXC A;  1FRR A;  2OJR A;  1Q5W B;  1N62 A;  2K22 A;  4JE3 B;  4FJV B;  3ECI A;  3ZLZ A;  3DWM A;  5E6J A;  1NI3 A;  4GGQ A;  5FK9 C;  3L17 A;  1K51 A;  2LHE A;  2RDG A;  3AEF B;  3RYT A;  1VZ8 A;  3APD A;  2DZM A;  3HHM A;  2IPK D;  3R2I A;  1V6E A;  4BKG A;  4C80 A;  5C3J B;  2KHW B;  3E56 A;  3ZNH B;  1SIJ A;  1XLN A;  3EC8 A;  1HQR D;  1E9M A;  1V5O A;  4A3P A;  1AYF A;  2LMC A;  1L5P A;  4M8M A;  4LNO A;  4NJC A;  1TY2 A;  3QHT A;  4P1B C;  5G5H A;  3GE3 C;  2ZCB A;  1SE2 A;  4C7Z A;  1JWB D;  2LRW A;  4AOF A;  3ZGZ A;  5HI1 A;  4ZYN A;  1AN8 A;  3R8B A;  1I4G A;  1RRB A;  2CJN A;  4JLC A;  2NCN A;  3M3J A;  1ZUD 2;  2RPV A;  3I63 C;  1LQB A;  1WJN A;  1V1P B;  4J3O D;  1MHH E;  4WJO A;  2JWU A;  3U7D A;  4BVU C;  2BT6 A;  3P4S B;  1VZ7 A;  2K8B A;  3H1U A;  3DCG A;  3WAP A;  3ZW3 A;  3B2G A;  4RGO S;  1V1P A;  2V3P A;  2IO3 B;  1QZE A;  5BMG A;  2L8J A;  5EE0 A;  1C79 A;  1IGC A;  1WJ6 A;  3KUZ A;  2HDE A;  4KGS A;  3TSS A;  3GZN B;  1YX6 B;  2WXH A;  4USA A;  2B76 B;  2ZVN A;  2B3A A;  2YEP B;  2KDF B;  4B6W A;  1TTN A;  4K81 A;  3U30 A;  1MFW A;  3KUD B;  2EKI A;  1HZ5 A;  1WM3 A;  2PVO D;  2LJ5 A;  2N7J A;  2DBY A;  4E71 A;  4MH0 E;  4PS3 A;  4KDL B;  2KMA A;  3N3K B;  1UGM A;  1F2R I;  4G50 A;  3TEX A;  1M4V A;  5DPW A;  1L7Y A;  2NVU I;  4I6N B;  2D2Q A;  4JGH B;  3SHQ A;  1HE8 A;  1V9J A;  2KJH B;  2MW5 A;  3LYY A;  3AEE B;  2MA9 B;  4MGI E;  2NBV B;  5D3I B;  1WXQ A;  3PPA A;  5LXH A;  1I4X A;  2IY0 B;  4AP4 C;  3PV1 A;  3Q3F A;  2KVZ A;  4YTM B;  1PQS A;  2FE8 A;  4BKT A;  5BO4 B;  3U7Z A;  1VLB A;  2ICI A;  4AJW A;  1YNT E;  3APF A;  4MH8 A;  2Y5B B;  4K7S A;  1V80 A;  2BS2 B;  3WIM A;  4MAC A;  1XQQ A;  2V9H A;  2L83 A;  3U4E G;  1IBX B;  1GC6 A;  2JPH A;  1YN5 A;  5IOI A;  3T3O A;  2V3S A;  3N9Y C;  1IBX A;  3KVF B;  1T0R C;  3TCA A;  1FM0 D;  2V4I B;  1NBF C;  2PLP A;  1PGX A;  1DOX A;  4E74 A;  5BMH A;  4IUM B;  1N5W A;  1ZPS A;  3BIN A;  2BKR B;  3JSV B;  2AQ3 B;  1E8Y A;  2MBQ A;  2UWQ A;  4KDI C;  2JZZ A;  5C1Z A;  2D5G A;  3JSV A;  2DAF A;  1UWX A;  2JSV X;  3B1L X;  3ZRC A;  2EEL A;  3MJW A;  3O13 A;  1SF0 A;  2GB1 A;  1L0V B;  2E6X A;  4HEA 1;  3WAM A;  4P1C C;  4DHZ B;  2VH2 A;  5TSS A;  2C5L C;  5LNK 1;  4LK0 M;  3R2T A;  4TKN A;  3DBR I;  3PRP B;  2ZW0 A;  4N9F 4;  4LCD E;  2R2Q A;  2BYF A;  2MQJ A;  1Y8R C;  4NY0 A;  4Q2J A;  4A20 A;  4O1N A;  2E3T A;  2ZW1 A;  3UIP B;  1TZO A;  2MBH A;  1E5W A;  2KOX A;  3Q2A C;  2LEK A;  2WS3 B;  1C4A A;  5H8Y E;  2J42 A;  1AAR A;  4FJZ A;  2ASQ A;  1NEN B;  2ZEQ A;  2LHD A;  2QC8 A;  3RUL A;  4RH6 A;  4DWF A;  5MPO A;  2IO0 B;  3ZJU A;  4BKS A;  2EMS A;  2PIA A;  1YJI A;  4DHJ B;  1R4M B;  3X0W A;  5AZH A;  1EM7 A;  1ZDV A;  1KLG D;  1L6V A;  3E9S A;  4WJQ A;  3TJP A;  2QEJ C;  4WQO B;  3ZKJ C;  5H92 C;  3W1S A;  2V0G A;  2WHI A;  1ZXI A;  3VUW A;  1P9D U;  2TSS A;  4LDT B;  1HEZ E;  4OZB A;  2O6V D;  2WGS A;  2L00 B;  1C9F A;  4DXF A;  2N9K A;  2M56 B;  2MRP A;  1B1Z A;  1UD7 A;  1R7S A;  3DHG C;  3AU4 A;  4EKU A;  2QIL A;  4IM2 A;  1QOA A;  1WI0 A;  5IA7 A;  3BII D;  1N6Z A;  1WXA A;  2FBW B;  4CHK A;  3AU5 A;  3AE4 B;  2I1J A;  3FIL B;  4HVB A;  3MP9 A;  4JWU C;  4WWM A;  1WRD B;  4ICV A;  3NVV A;  3QWZ B;  4FUL A;  3V6C B;  2V1Y A;  2JZP A;  4C7Y A;  4MGY E;  4TQ1 A;  3RD2 A;  2RR9 A;  1EWC A;  1RFA A;  1S3S G;  2IGD A;  5IO9 A;  3HM3 A;  1FNU A;  4ARI A;  4K7U A;  2BBC A;  3ZIM A;  2L0F A;  3PGE A;  4EUT A;  3ABV B;  4RGM A;  4ANW A;  4NJ7 A;  4H2A A;  3PS6 A;  2EMT A;  2N4F A;  2LGS A;  1GG3 A;  4GSW A;  4BBN C;  1QKZ A;  2KFK B;  3BZD B;  3W5U B;  1JRO A;  4NAW B;  1UEL A;  4II2 B;  2INN E;  2G1E A;  4NAW A;  2DLB A;  4MDK E;  1E90 A;  5I4D A;  1E10 A;  3S2A A;  1WGG A;  2WLB A;  4RF1 A;  2DYO A;  1QT9 A;  1A5R A;  4JX1 C;  4MEL A;  1VDV A;  5GMV A;  4US9 A;  3MTN B;  1E8W A;  1GC7 A;  3UI3 A;  4ZRP A;  1ACC A;  2RGF A;  2J0J A;  2NBU A;  1TYG B;  1E6E B;  2WU2 B;  2RPQ A;  1N60 A;  3IBE A;  2BKF A;  2ZPY A;  1X1M A;  2AQ2 B;  2CU3 A;  1MVK A;  1L0X B;  1WGD A;  4PYZ A;  4W9J A;  4M02 A;  3KQ4 A;  1NEK B;  2JZ3 B;  1TZ1 A;  3DQV A;  3VH3 B;  3L54 A;  3WAN A;  3TUO A;  2BS3 B;  1UF0 A;  2VZK B;  3MC8 A;  1TS3 A;  3UQA A;  1WE6 A;  2AQ1 B;  4B95 A;  1C77 A;  3B0A A;  4GIV A;  2PMV A;  2MP2 A;  1PYW D;  2QJL A;  2W9N A;  2HE7 A;  2ZJD A;  1KF6 B;  4P7I A;  2L76 A;  5IN7 A;  3KUC B;  3AED B;  2FIF A;  1FXA A;  3ETR A;  4GDK B;  2K8C A;  2WDV B;  1QOG A;  4OVV A;  2DZJ A;  1UUP A;  1TJE A;  1C76 A;  4RNA A;  4GDL B;  1I4Q A;  1YN4 A;  4KIK A;  2G4D B;  4GDL A;  2CR5 A;  4WAF A;  1WX9 A;  3VTV A;  2JU6 X;  1OQY A;  2L52 A;  5FR6 A;  1IP9 A;  3VDZ A;  2MJ3 A;  1JWM D;  3PRE A;  1SE3 A;  4B9K A;  2BGF A;  4FBJ B;  3V60 A;  2JUO A;  1L0Y B;  3DBS A;  4DQO C;  2BB6 A;  2L1A A;  4LNN A;  1LM8 B;  2LXA A;  1ZDX A;  3JVZ X;  3QX1 A;  3GE8 C;  2BF8 B;  2LZ6 A;  4OHJ A;  1FEH A;  4FAD A;  1FPY A;  1IUE A;  4N6E B;  2M4N A;  2C7H A;  2LUM A;  4EZJ A;  2LXC A;  3EFU A;  2JVC A;  2WXI A;  5HG2 A;  3AM9 A;  3P4Q B;  4IW0 A;  3P2B A;  3J9C A;  4CO7 A;  4KV2 A;  4GN1 A;  4W9E A;  2K9X A;  3NJT A;  3BY4 B;  2JXT A;  3A9J A;  2JY6 A;  1C3T A;  2XEW A;  4BZA A;  2QIE B;  4MM3 B;  1MHX A;  5C23 A;  1EF1 A;  5L95 C;  3IXS A;  2ZVO A;  3NG0 A;  3RNB C;  3T3N A;  2AWT A;  2N9L A;  2JF5 A;  2GOW A;  2M0X A;  1J8C A;  4MM3 A;  2R2O A;  2GMI C;  5IAA C;  2WXM A;  1WGH A;  1SB3 C;  3RZW C;  3P4P B;  3HK0 A;  3QQ8 B;  1T0S C;  3L0W B;  3M62 B;  1FXT B;  2D3C A;  1VRA B;  3GOE A;  1K52 A;  1WYG A;  4HLE A;  2KWU B;  2KN5 A;  1ZKH A;  3Q3O C;  2KC1 A;  4YSY B;  1V49 A;  1L4Z B;  2KJ6 A;  1P98 A;  3W1Y A;  4GMV A;  1FFV A;  2KLC A;  1R4N B;  3SU8 X;  3P1M A;  2QCZ A;  1D3Z A;  5JHB A;  2Y3A A;  4IWQ A;  2Z0D B;  1YD8 U;  2JYE A;  2X38 A;  1LGR A;  2ON8 A;  1SSN A;  3UIO B;  1EF5 A;  1LFD A;  3SD5 A;  3NS8 A;  2LGY A;  2IYD B;  4IKG A;  4WWO A;  2NBW B;  1D5Z C;  5T8I A;  3V6E B;  2ACZ B;  4NJ6 A;  2MCN B;  3RUI B;  1DYQ A;  1WXM A;  2L0T A;  1WZ0 A;  4PT5 A;  2IGH A;  3KYC D;  2WX1 A;  1E8X A;  3DBL I;  4R3D A;  4HCP B;  1QF6 A;  4RF0 A;  4I6P A;  1H4R A;  1J7C A;  3PZ7 A;  3KYD D;  2J0M A;  2MJE A;  3NUH B;  1GAQ B;  3ZXR A;  1YJJ A;  2LGX A;  3C19 A;  4ANU A;  1WX8 A;  1VD2 A;  4A6Q A;  2BPS A;  1Y56 A;  4TQ0 A;  1HXY D;  2BWE S;  3DBR B;  4OZC A;  1WH3 A;  4CQN A;  3MHS D;  1ET6 A;  2LGD A;  4REZ A;  1WR6 E;  4PS7 A;  4M0W A;  2MLB A;  2KYW A;  2ZNV B;  3EFC A;  2J7Q B;  3Q8B A;  3GP7 A;  2LFI A;  1ROE A;  1DGJ A;  2KC2 A;  4ZRI A;  4BOZ B;  4GOC A;  3KLS X;  2BWF A;  2KFJ A;  4KKI A;  2O2V A;  3BVM A;  1R4N I;  4JQW C;  5AEK B;  2WXG A;  2BYV E;  3AEC B;  4HJK A;  2JT4 B;  3QCA A;  1CK1 A;  3QAR A;  3R7Q A;  3KW5 B;  5BYQ A;  4S0R A;  3PVL A;  3V05 A;  3BWU D;  3I5J C;  2C9W B;  3WA0 A;  3DVG X;  4CYE A;  2INP E;  2D10 A;  2WP9 B;  1TS2 A;  4M01 A;  3TIX A;  1V81 A;  2AL3 A;  4W9F A;  1A70 A;  4PS8 A;  2EKE C;  2GRI A;  4EFO A;  5EDS A;  4ZHP A;  1JRU A;  5DPS A;  2FID A;  2FUG 1;  1WR1 A;  3T8M A;  3VXW A;  2J0K A;  1G6J A;  1WJU A;  3D32 A;  4MJS A;  4IC7 B;  1MG8 A;  1BML C;  5AZF A;  5G55 A;  2MX2 A;  1JML A;  5J17 A;  3V61 A;  1FXI A;  1BUI C;  2K3U A;  1QLB B;  1WJ4 A;  1GPX A;  1MPE A;  1AW7 A;  2FCN A;  1IYF A;  4A9A A;  2JYT A;  3RCZ A;  3C8Y A;  3NZ3 A;  4B0M A;  3UQB A;  4XGA B;  2KTR B;  3PLU A;  1P7F A;  1E7U A;  2LVO A;  2G45 B;  2C7M B;  2KTR A;  3Q6B A;  1UNS A;  3PZD A;  1KRH A;  3SEB A;  2KK8 A;  2LVQ A;  5KHO A;  3A1Q A;  2FUH B;  2J52 A;  3I9V 1;  1F2R C;  2KMM A;  3ZRF A;  1I4P A;  3HVZ A;  5KHQ A;  3EEC A;  1Q1O A;  4JWS C;  3TEW A;  3W2D A;  1F9J A;  4MSQ B;  1F52 A;  3TMP B;  3PLV A;  2D07 B;  5DPT A;  3HRD D;  2N1W A;  1WXV A;  1L4D B;  2GBM A;  1FCL A;  4AJY B;  4FA6 A;  2LJI A;  4PYU A;  3VFK A;  5D2M B;  1ZP0 B;  3DBH I;  5GXG B;  3B2F A;  2YLM A;  1WE7 A;  4W9C A;  3AE3 B;  2Y5C A;  5JZE B;  5CHW A;  1FD6 A;  2IJ0 A;  3Q3J A;  4ANX A;  4EEW A;  3H9D A;  4TUU A;  3LDZ E;  1SXT A;  1WMH A;  4MGK E;  2PW9 A;  3AEG B;  1FNV A;  2KWV B;  2KZR A;  4X57 B;  2WDT B;  3R3M A;  4WUR A;  5E6N A;  4YXD B;  1XXG A;  3U2S C;  3DPD A;  2G3Q B;  5D7G A;  2JX5 A;  2OJW A;  3OWE B;  2D3A A;  1WX7 A;  1J19 A;  3B9J A;  1TKG A;  2WXO A;  1CZP A;  4II3 B;  2I38 A;  4L2Y A;  4EZK A;  1T5X D;  4HRS A;  3OJ4 B;  1VJK A;  5G2N A;  3HVD A;  2NMQ A;  1K8R B;  1JRP A;  2Z0E B;  2HD5 B;  4M00 A;  3PO0 A;  3ZTD A;  1JWU D;  4KSK C;  3RT3 B;  4TSS A;  4ZYS A;  4XWT A;  2BYT A;  3L13 A;  1E7V A;  1YIW A;  2WWZ A;  1SE4 A;  1WSP A;  3VQI A;  1JQ4 A;  3BYT B;  4KVG B;  3DOW A;  1Z5S B;  2MBB B;  4ZRQ A;  2MWS B;  2XBB C;  3RN9 C;  3ZNI D;  4WAA A;  1P1A A;  2LRU A;  3QA8 A;  2CHW A;  2GBJ A;  3SR6 A;  3Q8F A;  2LUE A;  1P0R A;  2JRH A;  5AUK A;  3I57 A;  3RNA C;  4XWW A;  4UDU C;  1I7H A;  2UU7 A;  4AQ7 A;  1K50 A;  2KAJ A;  4RCO A;  1OQQ A;  3N1X C;  3BK2 A;  4JPS A;  2LI5 A; 
#chains in the Genus database with same CATH homology
 2M0A A;  1JCK B;  2NTT A;  4IOI E;  2EKI A;  1HZ5 A;  1L0Y B;  2WXQ A;  5FKA C;  1YQ3 B;  2W82 A;  4DQO C;  2IDY A;  2PVO D;  2BB6 A;  1XF5 L;  2L1A A;  1J7A A;  2N7J A;  4GLS C;  2DBY A;  1ZDX A;  1F2R I;  4P16 A;  1N63 A;  3TEX A;  4NZL B;  3AEA B;  1QIL A;  2W3S A;  2H88 B;  1M4V A;  4XDC A;  3EUB 2;  4OHJ A;  4WIP A;  5G5G A;  1FEH A;  1FIQ A;  1IUE A;  2WXK A;  4N6E B;  1K53 A;  1V97 A;  3W5V B;  3ZQ4 A;  2LUM A;  2M19 A;  2WXI A;  5HG2 A;  4ARC A;  3AM9 A;  3P4Q B;  1N5X A;  4YT0 B;  3CIR B;  3SFE B;  3J9C A;  3AE2 B;  2DYM A;  3LYY A;  2PVG C;  1F0Z A;  4YSZ B;  3AEE B;  3Q8E A;  5D3I B;  1WXQ A;  2XNA C;  1HA5 A;  3AN1 A;  2K9X A;  1I4X A;  2JXT A;  3BVG A;  2VZK D;  1BXT A;  4YTM B;  2QIE B;  2FE8 A;  3NRZ A;  4KGR A;  3U7Z A;  1VLB A;  4MM3 B;  1MHX A;  2ICI A;  1D4B A;  5C2T B;  3IXS A;  1YNT E;  3T3N A;  3ZJV A;  1EU4 A;  2WQY B;  4MH8 A;  2N9L A;  1SJE D;  2BS2 B;  4MAC A;  1HZ6 A;  4DXG A;  3VRB B;  2L83 A;  2WXM A;  3CWI A;  3U4E G;  1IBX B;  1C4C A;  1ET9 A;  2KWD A;  1SB3 C;  1YN5 A;  3T3O A;  3N9Y C;  2K5P A;  3P4P B;  1WRI A;  2DWQ A;  3EA6 A;  1IBX A;  3EGR A;  3IAM 1;  5EE9 A;  2L32 A;  2HTM E;  4ITK A;  4KGT A;  3IT6 B;  1FM0 D;  1XLQ A;  1VRA B;  2V4I B;  1K52 A;  1WYG A;  2PLP A;  2WXP A;  1PGX A;  1DOX A;  2V3N A;  1ZE3 D;  5BMH A;  3V3X A;  1EWY C;  4US8 A;  1N5W A;  1D5X C;  1ZPS A;  2QSD A;  4HJG E;  1D5M C;  4YSY B;  3WCQ A;  3MJ5 A;  1L4Z B;  1E0Z A;  3W9C B;  1QOF A;  2AQ3 B;  1FFV A;  1D6E C;  5HFY A;  3P1M A;  2BB5 A;  3LB8 C;  2D5G A;  2ONQ A;  1E7P B;  1UWX A;  2JSV X;  3AE8 B;  1CJE A;  2EEL A;  3VRA B;  2Y3A A;  2WDR B;  2WXN A;  3O13 A;  2IGG A;  1SF0 A;  2GB1 A;  2JYE A;  1L0V B;  1ZXH A;  2E6X A;  2X38 A;  5EE3 A;  2ON8 A;  1SSN A;  4HEA 1;  1T6B X;  4YTP B;  2SEB D;  1FFU A;  4L1B A;  5TSS A;  3FIL A;  3MC0 B;  4N59 A;  2KDM A;  2BTE A;  3NVW A;  4IKG A;  5LNK 1;  4LK0 M;  1D5Z C;  5T8I A;  3R2T A;  3AE7 B;  2ACZ B;  2ZW0 A;  1XLO A;  4D2K A;  5BMI A;  3Q8A A;  2GI9 A;  4HKZ E;  1DYQ A;  1QQR A;  4PT5 A;  2IGH A;  5AUI A;  1L6U A;  4YWG G;  1EU3 A;  4R3D A;  3Q8C A;  1QF6 A;  4Q2J A;  1FMA D;  4O1N A;  2BW2 A;  4RF0 A;  2E3T A;  1SJH D;  3HUI A;  1J7C A;  3PZ7 A;  2ZW1 A;  3H8H A;  2W55 A;  1IGD A;  1TZO A;  3ZJT A;  1RYJ A;  1NYR A;  4A8X C;  2MJE A;  1SEB D;  3NUH B;  1XCT L;  2Q5W D;  3GB1 A;  1GAQ B;  2LEK A;  2WS3 B;  1C4A A;  1YJJ A;  5H8Y E;  2J42 A;  1KH0 A;  4A6Q A;  1Y56 A;  4TQ0 A;  1HXY D;  2KAC A;  1NEN B;  3BVZ A;  3VR8 B;  1JW9 D;  3RFZ B;  1TS4 A;  4OZC A;  4CQN A;  2LHD A;  1GOZ A;  1ET6 A;  2XN9 C;  4RH6 A;  5MPO A;  1SBB B;  4AS1 A;  4A55 A;  1I4H A;  4REZ A;  3ZJU A;  4A90 A;  2K0P A;  1OFF A;  2PIA A;  1YJI A;  2KN4 A;  4M0W A;  1EM7 A;  2J53 A;  1ZDV A;  1KLG D;  1L6V A;  3E9S A;  3Q8B A;  3GP7 A;  1I4R A;  4HRO A;  4P6V F;  1B9R A;  2LFI A;  2BS4 B;  1ROE A;  1DGJ A;  4LTU A;  1TS5 A;  1YN3 A;  3KLS X;  2QEJ C;  3BK1 A;  4KKI A;  5H92 C;  2R61 A;  3W1S A;  4YSX B;  3BVM A;  5EE1 A;  2V0G A;  4B0E A;  1TKE A;  1ZXI A;  1FRD A;  2WXG A;  1OQR A;  1STE A;  3AE1 B;  3AEC B;  1CK1 A;  3ZYY X;  3URY A;  2TSS A;  1HEZ E;  4RGT A;  5BYQ A;  4OZB A;  1PUT A;  4L23 A;  4ZOH C;  3V05 A;  3BWU D;  4XDD A;  1KLU D;  4LLG M;  1C9F A;  4C56 C;  4DXF A;  1F77 A;  2INP E;  4YTN B;  3DWG C;  2WP9 B;  2LGI A;  4OZA A;  1TS2 A;  3GS2 A;  2W54 A;  1NVI D;  1P7E A;  3KWV A;  1VR9 A;  4RGN A;  2RDH A;  2N9K A;  3NVZ A;  2MJD A;  2M56 B;  4WH4 A;  1A70 A;  1YQ4 B;  2GRI A;  1B1Z A;  1R7S A;  2CJO A;  1XO3 A;  4ZHO A;  2MH7 A;  2QIL A;  1TKY A;  5BYS A;  1QOA A;  4ZHP A;  3AH7 A;  3FC4 A;  1WWT A;  2AX5 A;  2FUG 1;  1V1O A;  3BII D;  4IDI A;  3NVY A;  2FBW B;  3AE4 B;  1KTK A;  3SFD B;  3FIL B;  1BML C;  3MP9 A;  3KWL A;  1FO4 A;  4JWU C;  4WWM A;  1JML A;  4XE0 A;  1FXI A;  1PGB A;  1BUI C;  2K3U A;  3NVV A;  1QLB B;  2WXF A;  4OW0 A;  3VR9 B;  1GPX A;  3Q69 A;  1MPE A;  1AW7 A;  2Y5P A;  2SAK A;  4WQM A;  4A9A A;  2JYT A;  1TY0 A;  2JZP A;  4C7Y A;  3C8Y A;  3NZ3 A;  4TQ1 A;  1RFK A;  1JWA D;  3AV8 A;  2OED A;  3IAS 1;  3NS1 A;  4B0M A;  2RMM A;  3RPF C;  1NYQ A;  1EWC A;  1KFY B;  3TEY A;  1P7F A;  2W3R A;  2IGD A;  1JAL A;  1FNU A;  4ARI A;  1UNS A;  1AWD A;  2BBC A;  4N58 A;  4RFB A;  2J4X A;  1KRH A;  2NTS A;  5HHD G;  3SEB A;  4EE2 A;  3LXF A;  1DOI A;  2WNM A;  2J52 A;  3I9V 1;  1F2R C;  3ABV B;  4RGM A;  3AE5 B;  2KMM A;  2OHF A;  3AE9 B;  1I4P A;  2G9H D;  3HVZ A;  3AB5 A;  3L4P A;  4H2A A;  4JWS C;  3TEW A;  3W2D A;  2JQR B;  2MEK A;  2QMT A;  1Q10 A;  1RM6 C;  5FR3 A;  1QKZ A;  3HRD D;  1MI0 A;  3BZD B;  3W5U B;  4HKQ A;  1JRO A;  1L4D B;  2WDQ B;  4NAW B;  1T3Q A;  2WU5 B;  1UWM A;  1GB1 A;  1XCQ L;  1DOY A;  2H89 B;  4KKJ A;  4NAM A;  1FCL A;  4OVZ A;  2LJI A;  2INN E;  1UGJ A;  1ZP0 B;  2G1E A;  5GXG B;  3BYY B;  3AMZ A;  2DLB A;  3B2F A;  3U52 E;  2WXR A;  5I4D A;  1E10 A;  3AE3 B;  1XLP A;  2N0S B;  2Y5C A;  4FXC A;  2WLB A;  4RF1 A;  2DYO A;  1FD6 A;  1FRR A;  1QT9 A;  2YEP F;  2IJ0 A;  2WXJ A;  1N62 A;  4JX1 C;  2K22 A;  1VDV A;  4JE3 B;  5JXV A;  4US9 A;  3UI3 A;  1SXT A;  4ZRP A;  1ACC A;  1TYG B;  2WXL A;  3DWM A;  2PW9 A;  3P63 A;  3AEG B;  1FNV A;  1E6E B;  2WU2 B;  5E6J A;  1NI3 A;  5FK9 C;  1N60 A;  1K51 A;  2LHE A;  2RDG A;  2PKO A;  2AQ2 B;  3AEF B;  1VZ8 A;  2CU3 A;  4WUR A;  1XEE A;  2IPK D;  1MVK A;  1L0X B;  3R2I A;  4YXD B;  1XXG A;  3MFG A;  4C80 A;  1C4P A;  1FCC C;  1PGA A;  1QOB A;  3U2S C;  5C3J B;  3E56 A;  5D7G A;  2JX5 A;  1SIJ A;  1XLN A;  2I2Y A;  3OWE B;  3KQ4 A;  1ESF A;  1HQR D;  3AE6 B;  1NEK B;  3B9J A;  1E9M A;  1TKG A;  3P4R B;  2WXO A;  2Z8L A;  1C78 A;  1CZP A;  2I38 A;  5BYR A;  4L2Y A;  1AYF A;  3TUO A;  2LMC A;  1L5P A;  1T5X D;  2BS3 B;  1GB4 A;  1RWS A;  4HRS A;  1VJK A;  2VZK B;  1TS3 A;  4TMA B;  4NJC A;  1TY2 A;  2AQ1 B;  3HVD A;  1C77 A;  2NMQ A;  5G5H A;  1LO5 D;  2PMV A;  1JRP A;  1ZOY B;  1PYW D;  2QJL A;  3P42 A;  3PO0 A;  1SE2 A;  4MT5 A;  4C7Z A;  1JWB D;  1JWU D;  3AEB B;  1KF6 B;  4KX6 B;  3IT4 B;  4TSS A;  5HI1 A;  4XWT A;  4ZYS A;  3ZGZ A;  1AN8 A;  2BYT A;  3R8B A;  1YMH E;  1I4G A;  3AED B;  2CJN A;  1FXA A;  1SE4 A;  1WSP A;  2PTL A;  3ETR A;  4GDK B;  3VQI A;  1JQ4 A;  3BYT B;  2WDV B;  1ZUD 2;  2RPV A;  3TEZ A;  1QOG A;  1V1P B;  4J3O D;  1WGK A;  1MHH E;  2JWU A;  1V8C A;  2BT6 A;  1UUP A;  3P4S B;  1FNW A;  1TJE A;  1VZ7 A;  1C76 A;  4ZRQ A;  4RNA A;  1JWS D;  4GDL B;  3B2G A;  1I4Q A;  2KQ4 X;  4RGO S;  1V1P A;  1YN4 A;  2V3P A;  1CQV A;  3PZ8 A;  5BMG A;  3SR6 A;  5EE0 A;  3Q8F A;  1C79 A;  1IGC A;  1ENF A;  4WAF A;  2HDE A;  4KGS A;  3TSS A;  1J7B A;  5AUK A;  2JU6 X;  3I57 A;  1PFD A;  2WXH A;  4USA A;  4XWW A;  2L52 A;  4UDU C;  1I7H A;  1VZ6 A;  2B76 B;  4AQ7 A;  1K50 A;  2KAJ A;  3FAH A;  1PDX A;  4RCO A;  1OQQ A;  2YEP B;  2MJ3 A;  1JWM D;  3BK2 A;  5D3D A;  1SE3 A;  4JPS A;  3MHZ A;  1N61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...