3U7ZA

Crystal structure of a putative metal binding protein rumgna_00854 (zp_02040092.1) from ruminococcus gnavus atcc 29149 at 1.30 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
b'GEKHITVTVIHGDQTENVFEFDTDAKYLGEVLESENLVDGESGEYGLFITTVDEETADDSKQQWWCITKGGEQVNTSADQTPVSDGDAFELTLKEGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative metal binding protein RUMGNA_00854
publication title Crystal structure of a putative metal binding protein RUMGNA_00854 (ZP_02040092.1) from Ruminococcus gnavus ATCC 29149 at 1.30 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Metal binding protein
total genus 27
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3u7zA00
4KKJA 3KQ4A 2BB5A 4ZRPA 4ZRQA 3U7ZA 2BB6A 2BBCA 2V3NA 2V3PA 2PMVA 4KKIA
chains in the Genus database with same CATH superfamily
2DNFA 2WDTB 4M01A 5G5HA 3L17A 1GPXA 3GS2A 4RGMA 2KVZA 3RCZA 3BVMA 3U2SC 4BBNF 4MGIE 3U7ZA 2L32A 3TBLD 1MVKA 2JWUA 1FCCC 3OWEB 3Q8BA 2OOBB 1ROEA 1J7BA 1OQRA 3BWUD 1TKYA 1YD8U 1JWAD 1FXIA 3B1LX 5BYSA 1IGDA 2N7EA 2OJRA 2EMTA 2RSUA 3WAOA 2NTSA 1FNVA 3BIID 4P1CC 3X0WA 1T0QC 2FBWB 3A9KA 3NRZA 4N58A 3QCAA 2ZEQA 2BKRB 2K6DB 2M1MA 4M00A 3DBLI 1VD2A 3ENEA 1TKEA 4NJ7A 3UF8A 1YQ4B 4ZYSA 1C4CA 3OJ3A 4UDUC 3MHSD 4CQNA 3A4SC 5AZFA 3LJ3A 4RMAA 3VFKA 5MPOA 1WGGA 1EF5A 1AARA 3OAWA 1XLQA 2ZPYA 4WH4A 1V86A 4HPMB 4ANXA 3P2BA 4TKNA 1ZW7A 1H8CA 1KTKA 4J3OD 2KXJA 4RH6A 1GB4A 1WSPA 2CR5A 1MHHE 4DXAB 4US9A 4PS8A 2YLMA 4F7ZA 2N4FA 1FO4A 2K8CA 2LFIA 2WYQA 4REZA 5JXVA 1QZEA 2K6QA 3AE5B 2ZVNA 2O6VD 3R3MA 5FK9C 3BVZA 2KDFB 2MRPA 2HDEA 2L0FA 4O1NA 2BYVE 4MH8A 3VRAB 3BVGA 4RF0A 3R8BA 3BYYB 5TSSA 1B9RA 1FMAD 2MJEA 2VH2A 3AMZA 3PRMB 2KWCA 1WRDB 4GLSC 1F2RI 3CF6E 2AQ2B 3H9DA 1ZOYB 5C3JB 1KFYB 3HUIA 2K8HA 1T0RC 3RN9C 2DYOA 4BVUC 4N9F4 3APFA 2VRRB 3VDZA 2SEBD 2KFKB 4JLCA 4GN1A 1WGDA 2EMSA 3ZNGC 3WA0A 5FKAC 1KLVA 4BFRA 2J0MA 3DOWA 3MP9A 2LGDA 3P4SB 4KZCA 2LASA 2NR2A 2DENB 2XEWA 4IW0A 2FCSA 5IA7A 3UI3A 5HHDG 4E3CA 4RGNA 1EF1A 1P7EA 1E9MA 3WALA 2LUEA 2QHOA 2I2YA 2GI9A 3AECB 4CO7A 3N20C 5J2RA 3MTNB 5H8YE 4CYEA 2KYWA 3KWLA 1SE4A 4LNFA 4M0WB 1C4AA 3ZRFA 2MWSB 2W54A 2LZ6A 3MHZA 3L54A 2O2VB 1YX6B 5JZEB 1EWYC 4MSQB 3Q8EA 2KMCA 2N9XA 4JGHB 1UWXA 3PPAA 1TS3A 1D3ZA 4DXFA 2K39A 4HJGE 1C76A 3UQAA 3QIJA 3KH0A 3DPDA 3JSVB 4IOIE 3HIZA 5HG2A 3APDA 4M8NA 1KOTA 2PJHA 1L6VA 1K50A 3SHQA 1L6UA 4ICVA 3RZFA 4RNAA 2LXCA 1V49A 4BKTA 3PS6A 3ZJUA 1NENB 4M8MA 2BS3B 1OEYA 3BY4B 2L52A 3CSTA 1E7UA 4L2YA 5JH5C 1C77A 3NHEB 1FIQA 3FILA 4HDQA 3SFEB 3KUDB 2CU1A 2YEPF 3ML9A 2QEJC 3Q8AA 1QLBB 2D3BA 4KIKA 5FR6A 4W9LA 2INPE 3VXWA 3MJWA 3Q2AC 1LFDA 2KTRA 2PW9A 2L0TA 1I4QA 3URYA 4G0NB 3RZWC 3TJPA 1UF0A 1EU4A 1MG8A 3EC8A 5C23A 1UBQA 1JRPA 2WWZA 2LJIA 4P6VF 1WZ3A 4AQ7A 4K7SA 3FC4A 4GDKA 5J18A 1BT0A 2NS5A 4F8CB 2Y5BB 2K3UA 1WE7A 2AQ3B 2MQJA 2CJNA 1L0VB 3ZNHB 2RDBC 4KSLC 1E8ZA 2EKIA 3PLVA 4TSSA 1V8CA 2VZKB 3D32A 3AE1B 3AE8B 2C7NB 2JX5A 3AI5A 2DAFA 4WWNA 5LLIA 1Y8RC 2KZRA 4ASWC 4MELA 4PS7A 4NQKE 4MM3B 2BKFA 1FFVA 4S17A 4OZAA 1OEYJ 4KX6B 1I4HA 2ICIA 5AUKA 2C7HA 2ZNVB 2MBBB 2HTHA 4DHZB 1IUEA 1UUPA 3MC9A 2AX5A 4E74A 4XYCA 1JROA 1XF5L 4ZRJA 1TZOA 3V05A 3ZNZB 1HZ6A 2LGXA 2MLBA 4ACFA 3LYYA 1TS2A 1TYGB 3I57A 5KHQA 3ZNID 4ZRQA 4IM2A 3RFZB 1WH3A 3V60A 3PZDA 4W9HA 3OJ4B 3ZTCA 1LGRA 3RNAC 1FPYA 2KN5A 3W1SA 2JYTA 4BAXA 2IO2B 1H4RA 4RM9A 3MJ5A 2E3TA 2ZNVC 4ZHPA 1FEHA 2LGSA 4HXDA 2KX3A 3AE3B 2KC1A 1V5OA 3T9LA 2NCNA 1X1MA 3BZDB 2UU7A 3DBRB 4WWPA 2CHWA 2I1KA 2FCNA 4A3PA 4OZCA 2X8XX 3HM3A 1PFDA 1WMHB 4LJOB 4YT0B 1CMXB 1E0ZA 2ZW1A 1MHXA 2GB1A 3Q69A 2RMMA 4P7IA 3U52E 2N7DA 2CKHB 1FM0D 2ONQA 1P7FA 2G4DB 2K9XA 1MI0A 4LNKA 4M02A 1NYQA 1J19A 3DHIC 3M63B 5GMVA 1RWSA 4II3B 2G45B 2INNE 2JRHA 2GOWA 1YQBA 2GBJA 4XGAB 1A5RA 1T6BX 1MFWA 1VDVA 1WR6E 1E5WA 3BYTB 2D07B 1JWBD 1FRDA 2WXQA 4LDTD 4LJPB 1K53A 4BOSC 2SAKA 3AH7A 1N62A 2R2QA 1EWCA 2KDEB 3NS1A 1JRUA 2WXLA 1F1HA 3KQ4A 4BZAA 1BMLC 3AEAB 4TV3A 2WLBA 1I4PA 1WXMA 2D2QA 1FNUA 4C80A 2LVOA 3IT4B 4IKGA 5G55A 2WX0A 1QOFA 2LEKA 4KKJA 3EECA 4JWUC 3A1QB 1ZGUB 2WXFA 2BS2B 2RDGA 3Q6BA 4JQWC 3RPFC 2L05A 2QCZA 2FIDA 1HXYD 1WJ6A 2YEPB 1KLGD 2MW5A 3HK0A 4I6PA 4HRSA 3AV8A 3SD5A 5KHOA 3KYCD 3GZNB 2FIFA 4MH0E 1C78A 4RM8A 2ON8A 4GU2A 3DCGA 3RNEC 3N1YC 4B0MA 1ZUD2 5LXHA 3RMKC 4J6IA 2D3GA 3IXSA 3TEYA 1QQRA 3PHWB 1EUVB 4KSKC 2FUHB 2BTEA 1N5XA 4ZYNA 2LJ5A 2LXAA 1F0ZA 3EGRA 5C1ZA 1PQSA 2ACZB 1WXQA 1J7AA 2NBWB 2HTME 2BPSA 2ZCCA 2G4SA 4K3CA 2CS4A 1P9DU 3H1UA 2M56B 1MPEA 3PSEB 4KVGB 4HCNB 1HTQA 3ZRCA 1L4ZB 3SDLC 4ZOHC 4YSYB 3ZYYX 3K9OB 4LDTB 4FHJA 2LVQA 1AWDA 3RD2A 2DX5B 2OHFA 3GE8C 4ANWA 3DBHB 5EDSA 3IBEA 5L83A 1N60A 2Z59B 4MGZE 1G6JA 1ENFA 2WXKA 4ICUA 2OJWA 2LHEA 2GBRA 3AB5A 3KUZA 2K25A 4WQOB 3UGBB 5HI1A 4XX5A 4I6NB 2NPTB 1Q10A 1XT9B 3WCQA 3IAM1 2IY0B 2LHDA 4K7WA 3NVZA 3KLSX 2V1YA 4M0WA 3IHPC 1V9JA 4IDIA 3PTFC 2NTTA 2O2VA 1DOIA 2I1JA 1FXTB 4K7UA 1GOZA 2AL3A 2TSSA 4IWOA 1P1AA 5D94A 2N7JA 3OLMD 4XC2A 3OG5A 2LUMA 3PRPB 1WE6A 1FNWA 2ZW0A 3BK1A 3QARA 2KAJA 3W5VB 2N9EB 3E9SA 4C4VB 3HVZA 3VTWA 2PLPA 1UWMA 2DZJA 4TMAB 3EFCA 2LD9A 2KFJA 3L16A 1HEZE 3KWVA 2RDHA 4RGTA 1P98A 2JZPA 1TGZB 1WXVA 1N6ZA 1LM8B 3VHTC 4NAWA 2JPHA 2KO3A 4LNOA 4PK1A 1SE9A 1FCLA 1I35A 2MP2A 2XBBC 2Y3AA 1N63A 1SBBB 1R7SA 2KACA 4OHJA 1KM7A 5AEKB 3I9V1 1VLBA 3TUOA 1T5XD 1EU3A 2JF5A 4HROA 4X57B 1D5XC 1XXGA 1F52A 3UINB 2G9HD 4XWTA 4F1SA 5JHBA 2NBVB 3M3JA 2HJ8A 1VR9A 3EHVA 5IN7A 4HEA1 2K1FA 1ISNA 4JPSA 2JRIB 1XLPA 2JUOA 2BBCA 2CHXA 2WNMA 3DVGY 1GJZA 3TIXA 4FJYA 2JU6X 1ESFA 4NZLB 2KC2A 3AE6B 2IGDA 3DVNV 4WJQA 1WY8A 4N59A 2BYEA 1ZKHA 2OEDA 2Q5WD 1F9JA 2V3NA 2LVPA 2G1EA 2BW2A 2H88B 3PRZA 5EE0A 1V6EA 2DYBA 4KZ0A 4RGOS 4TUUA 3DWMA 4LNIA 1YJIA 1JQ4A 4ZRKA 4FJZA 3KW5B 1TS4A 2IY1B 4YXDB 3NUHB 4RF1A 1L4DB 2KQSA 1I4XA 3JW0X 2LGIA 2IGHA 2C5LC 3M95A 2J52A 3QX1A 4KDIC 3A9KB 3PZ7A 2X38A 3EA6A 2C60A 5GXGB 2K5PA 1HZ5A 3Q3OC 5D3IB 2LRWA 2MJ3A 2QSDA 2ZZPB 3ZKJC 5LXIB 1L0XB 2JVCA 1HA5A 1ZE3D 2K8BA 3ML8A 3VQIA 3QA8A 4WWMA 3AN1A 3R2IA 2MJDA 3R2TA 1IBXB 2W82A 3VTVA 1YQ3B 4KGTA 2O6VB 2KDMA 2Z0DB 2GLSA 2IBIB 1KLUD 2RPVA 3RUIB 3VAWA 2DZMA 1RM6C 2ZVOA 2WXGA 2BWES 4US8A 2JY6A 2JZZA 2INCC 2AYOB 3N1XC 3QC8B 1KJTA 4LTUA 2KQ4X 4MSMB 1YN5A 3N3KB 1KRHA 3HM6X 1E10A 1VZ6A 3LXFA 1RLFA 3SU8X 4ANVA 2LGYA 3AEEB 2V3SA 4WJPA 1BXTA 1UD7A 3P1MA 1ZXHA 3P4QB 1ZDXA 1XEEA 1DOYA 4LCDE 1WIAA 4DWFA 3V61A 4WQMA 3AEFB 1Q0WB 2N9LA 2PKOA 4NY0A 2N9PC 2INDC 3ZJVA 2V0GA 2WDVB 4E71A 1CQVA 1EM7A 1UGMA 3PHXB 4FBJB 1MG4A 1XQQA 5C2TB 2BS4B 4A20A 2LI5A 3DHHC 1SIJA 1E7PB 3RNGC 4MJSB 1V81A 4K1RB 2VH1A 2DBYA 3Q3JA 4W9IA 1S3SG 4TQ0A 2QDFA 3VUYA 2C7MB 3ONSA 4WURA 4XZ4A 1WJ4A 2BYTA 1S1QB 2MH7A 4MGYE 2J42A 1XCQL 1RFAA 1WGHA 1V1PB 1WX8A 2QILA 3QK0A 4WWOA 2G3QB 5BO4B 2KTFA 3UIOB 1YX5B 4EZLA 3NG0A 2PVOD 3KUCB 1N61A 4NJCA 3DBLB 5CX3A 2D11A 2CU3A 3NZ3A 3WANA 3NZSA 4KGSA 3N30A 3BK2A 3VRBB 2GRIA 2MBEA 3V3XA 4IM0A 4DQOC 2J53A 4W9FA 1YJJA 3CMMB 3KYDD 3DBSA 3TEZA 1WFYA 1WZ0A 4DDID 5BYQA 4BKGA 1WRIA 1T3QA 3JYUA 3TSSA 1ZPSA 1WX9A 5E6OA 3AEDB 3IFWB 2IO1B 4OVZA 2LWPA 4IWQA 1NBFC 3L4PA 2R2OA 2J7QB 2JSVX 1BUIC 2KJHB 1FFUA 3U8ZA 1JWUD 2M4NA 4MEMA 5EE9A 4AUQC 4B9KA 5D2MB 1YN3A 4W9EA 4IC7B 3W9CB 2JXTA 1GC6A 1UNSA 2N9KA 2WU2B 4EUTA 1XD3B 3O13A 2EKEC 1QOGA 1E8WA 3PREA 3ZGZA 1OGWA 4C7YA 2REXA 1JALA 1I42A 4KV2A 4KIKB 1SEBD 3AE4B 1SB3C 1YJ1A 2M17A 3L10B 4HCPB 4W9CA 2V4LA 4PYZA 4A90A 2L8JA 4WAAA 3MFGA 3MC0B 2KLCA 3ZTDA 5IP4D 3KVFB 3R66C 2A5UA 2BVCA 4EEWA 4RFBA 1AYFA 4GGQA 2HE7A 1DOXA 1J8CA 2QJLA 2DAJA 1KF6B 4AP4C 3VH4B 3DHGC 3AE9B 3QAQA 4GDKB 2HJ1A 2MCNB 2WP9B 4EZJA 2FAZA 2JZ3B 4ARCA 2WXOA 4L1BA 1IYFA 5E6PA 4XDCA 4DDGD 3NVYA 2WXMA 3IVFA 3WAPA 1QILA 5T8IA 3B9JA 2DZKA 3GB1A 1NVID 2KVRA 1IPGA 3ZVVA 4NPNA 2V3PA 3DVNU 1D5MC 2WQYB 2WGSA 2IJ0A 5BMGA 2J0KA 4PT5A 2QIEB 3ZXVA 5I4DA 3IT6B 4JE3B 2N1WA 3TEWA 2QC8A 4W9JA 3J9CA 2RD0A 2FE8A 2NVUI 4NQLB 2RR9A 1XLNA 2WXNA 3FAHA 3L13A 1XO3A 4ZRIA 3V6CB 4G50A 3QHTA 3ZIMA 2XK5B 2AL6A 1FD6A 4EZKA 2KOXA 2W9NA 1LO5D 1WI0A 3ZJTA 1TJEA 3U30A 5D7GA 3A9JB 4HKZE 2KFKA 1UBIA 2FCQA 2ASQA 3QJZA 5DPWA 3DWGC 1YNTE 3I5JC 1IGCA 1F77A 1HQRD 4DHJD 1V1OA 2JT4B 4G3XB 4AS1A 1Z5SB 4C7ZA 4NNJB 4WJNA 1C9FA 4HPLB 5LNK1 3A33B 2W3SA 4MACA 3W1SC 5BYRA 4N6EB 3CIRB 1V80A 5DPSA 2MA9B 2GBKA 2KJ6A 2JWZA 2NBUA 3AU5A 3NJTA 3U7DA 3SFDB 2KANA 3ZUNA 4S0RA 1L0YB 3RT3B 1HE8A 2KLGA 2M0XA 2JQRB 3SR6A 2IO0B 4DXGA 3GP7A 1TIFA 1E90A 1OFFA 5D3DA 1FRRA 1SJHD 4K81A 4QAYA 3AEGB 1FXAA 3C8YA 2XN9C 1E6EB 2BB5A 3AXCA 2E6XA 1SE3A 4HVBA 2PVGC 5BMHA 3IG3A 1YMHE 2DWQA 4W9DA 2K0PA 1C4PA 2AEHA 2CHZA 1EO6A 1UH6A 3GOEA 3JSVA 3C0RB 4ZRPA 4JWSC 3W2DA 3L08A 1N5WA 1VZ7A 2W3RA 4GDLB 3WAMA 1TTNA 3N32A 1IBXA 3I63C 2FNJB 2O6VA 4HLEA 5HKHA 1WJNA 4OVUA 2BYFA 1SE2A 3NOBA 4A8XC 2IYDB 2KD0A 5E6JA 1PUTA 1VJKA 4GB9A 1OTRB 5DPTA 2PIAA 4HK2A 1T0SC 2WXJA 3B0AA 3PLUA 5AZHA 4B0EA 3BINA 3ZDMC 1TT5B 3V62A 3A4RA 3TL5A 2Y5CA 3DBRI 1VZ8A 1WX7A 4A3OA 1GB1A 4FA6A 3AE7B 1TY0A 1ZP0B 2KMAA 3H7PB 1L5PA 4MDKE 1QKZA 2PE6B 1WJUA 3NY5A 2KWDA 1SIFA 1WYGA 2KX0A 3TEXA 3X23A 4KGRA 1K52A 4CHKA 2MBQA 3ZLZA 4EE2A 1PYWD 3C19A 3VH3B 1RYJA 3ALBA 4GMVA 3MC8A 4DHJB 1M4VA 3NZUA 1PDXA 3HVDA 3CWIA 4PYUA 5JHAA 3LDZE 1J7CA 4HPPA 2MX2A 4KDLB 5E6NA 4MJSA 1D5ZC 1UZXB 3Q3FA 4BKSA 2EELA 1VRAB 2L76A 3FKYA 1YN4A 1NI2A 3PT2B 2DZIA 2Z0EB 2KWUB 1WGYA 1Z2MA 1HTOA 2JXXA 5CHWA 4AJYB 2R61A 1JCKB 4WAFA 4MM3A 1QF6A 4FHKA 2L3ZA 2Z8LA 1V1PA 1A70A 1V97A 3ABVB 4BKSD 1R4MB 3T3NA 4LNNA 4IUMB 3IAS1 2VZKD 2IDYA 1YIWA 1R4NB 4LLGM 2WDRB 2KWVB 3ZXRA 2V9HA 1E8XA 4G11A 2DYMA 1C3TA 3NS8A 2KDIA 3VTUA 3Q3NC 4I6LB 4NJ6A 2MBOA 2L83A 5EE1A 2BQQA 4ITKA 2WXRA 1OQYA 2N1VA 4P16A 3GZNI 4FN2A 5IAAC 4HKQA 2KQ7A 4YTPB 4A9AA 2A4ZA 3JVZX 2RPQA 2WXPA 3WIMA 3RULA 1GG3A 1SF0A 2KT7A 1MJDA 5CTRC 2GBMA 3R7QA 5EE3A 1SSNA 2AQ1B 1NEKB 3AE2B 2L00B 1SXTA 4ARIA 4YSXB 5L95C 5G2NA 3Q8CA 1DGJA 1NI3A 1WMHA 3B08A 4NAWB 4HDOA 2YVCA 3R7RA 1Q5WB 2MP2B 5CHVC 1PGAA 2WX1A 3UQBA 1QOBA 1P0RA 2DHZA 3Q8FA 1IP9A 2BT6A 3RI7C 3N9YC 1T0YA 1QT9A 3UIPB 3HHMA 4WJOA 4OVVA 3ZQ4A 2GBNA 2L1AA 4JIOU 3PO0A 1PGXA 2JYEA 3Q14C 1WXSA 4BBNC 3DBHI 3P4RB 2AWTA 1L7YA 3RNBC 3T3OA 5DCNA 2MHJA 4JL9A 1JW9D 1LQBA 1SJED 4FJVB 1AW7A 5TR5A 4HWIB 2PPHA 3V6EB 4GOCA 4H2AA 3NVVA 1TZ1A 5IKCM 4FLHA 2WXHA 4W9KA 3E56A 2KJRA 4EKUA 3P42A 3PVLA 3O65B 5CHFA 4HJKA 3APCA 1K51A 1TY2A 2LRUA 2QMTA 1WGKA 3M62B 3H6NA 4Q2JA 4ZHOA 2MSED 2GMIC 4AOFA 3A1QA 1WWTA 4II2B 1B1ZA 1LXDA 2CJOA 4C00A 4DK5A 2H89B 2ZPNA 3DVGX 3HRDD 1Y56A 1M94A 3P4PB 5IOIA 4URKA 2C9WB 3AEBB 1ET6A 2ZJDA 1UGJA 4YSZB 2J0JA 4GSWA 3PGEA 4JX1C 1V5TA 1WF9A 4NAMA 1WXAA 4USAA 5G5GA 4KKIA 5AZGA 3ECIA 1C1YB 3VUXA 2KN4A 2D3CA 2K22A 3PZ8A 2WU5B 1P3QU 2V4IB 3QQ8B 1U4AA 4AWJA 2L7RA 2IO3B 4YL8A 4GIVA 3I3TB 2XK5A 2B3AA 1TS5A 1E7VA 1JWMD 1E8YA 2KDBA 4EOYA 2PE9A 1ZXIA 2D5GA 3A9JA 4DHZE 2XNAC 4FULA 3B2FA 3NVWA 4D2KA 3L0WB 1WR1A 2D3AA 1AN8A 3W1YA 1DYQA 1D6EC 2FUG1 3FILB 1D4BA 1RFKA 4FADA 4B6WA 1XLOA 4YWGG 1L2NA 4MT5A 1ET9A 3PV1A 1QOAA 3VUWA 3TMPB 4OW0A 1SGHA 3EFUA 4YTNB 2ZCBA 2NMQA 2KTRB 4A6QA 3AULA 1YOVB 1I7HA 2D10A 2NPTA 2BB6A 1NYRA 1OQQA 3AU4A 1XCTL 2Y5PA 2J4XA 1GC7A 4OZBA 2M19A 3ETRA 1GNUA 2WXIA 1F2RC 4GXBA 4IG7B 1WYWB 3QWZB 5IO9A 2IGGA 4WIPA 5J17A 4ZDVA 3EUB2 3GE3C 4A55A 4MGKE 2I38A 1TBEA 1JMLA 3P63A 4IWPA 2KHWB 4BOZB 2WS3B 1GUAB 2WHIA 1R4MI 4C4VA 3TCAA 1CK1A 5DPRA 4XDDA 5BMIA 4XE0A 2W55A 1R4NI 3DDCB 2DLBA 2HD5B 1KH0A 4GDLA 4DBGA 2UYZB 4R3DA 4K3BA 4ANUA 4XWWA 3VR9B 1CZPA 3RNCC 1NDDA 1C79A 2IPKD 3ZO5B 4LK0M 2KKCA 5D6JB 1CJEA 2KK8A 5HFYA 5AUIA 1RAXA 3N1ZC 5FR3A 4TQ1A 3LB8C 1UELA 3H8HA 2IZVB 3K9PB 2B76B 4PS3A 3Q3MC 4RCOA 2FCMA 3SEBA 2M8SA 4L23A 2BWFA 3S2AA 1JWSD 1ACCA 3CSFA 4YTMB 2N0SB 1WGRA 3T8MA 1V2YA 3U4EG 1WM2A 1PGBA 2RGFA 3W5UB 3H7PA 1I4RA 1STEA 4AJWA 1ZDVA 3ZDTA 1GAQB 3VVWB 3VR8B 4C56C 4P1BC 2PTLA 3H7SA 1TKGA 2KMMA 3B2GA 4FXCA 2UWQA 3AM9A 2PEAA 1VCBA 2BF8B 2KNBA 3RYTA 1RRBA 2MEKA 2MBHA 1Q1OA 1WM3A 3DQVA 4W9GA 2WDQB 2PMVA 1J0GA 3RNFC 4EFOA 1I4GA 2LMCA 3ZW3A 2BGFA 1K8RB 4IM3A 4B95A 2M0AA 5H92C
chains in the Genus database with same CATH topology
1CQVA 1EM7A 1J7CA 1T6BX 1VDVA 5C2TB 3BYTB 5G5HA 1GPXA 1JWBD 1D5ZC 1FRDA 2BS4B 2WXQA 3GS2A 4RGMA 3BVMA 1K53A 2EELA 3U2SC 2SAKA 3AH7A 1N62A 1VRAB 1SIJA 1YN4A 2L32A 1E7PB 1EWCA 3U7ZA 1MVKA 2JWUA 3NS1A 1FCCC 2WXLA 3OWEB 3Q8BA 3KQ4A 1ROEA 1J7BA 1OQRA 3BWUD 2DBYA 1TKYA 4TQ0A 1JWAD 2R61A 1JCKB 1FXIA 4WAFA 5BYSA 1QF6A 2Z8LA 1IGDA 1BMLC 1V1PA 1A70A 4WURA 1V97A 3AEAB 2WLBA 2BYTA 2NTSA 1I4PA 2MH7A 2J42A 1XCQL 3ABVB 1FNVA 3BIID 1FNUA 1V1PB 2QILA 2FBWB 3NRZA 4N58A 4C80A 3T3NA 3IAS1 3IT4B 2VZKD 2IDYA 4IKGA 4LLGM 2WDRB 2PVOD 1QOFA 2LEKA 1N61A 1TKEA 4NJCA 4KKJA 1YQ4B 4JWUC 2WXFA 4ZYSA 2BS2B 2DYMA 2RDGA 2CU3A 3RPFC 1C4CA 3NZ3A 1HXYD 2YEPB 4KGSA 4UDUC 4CQNA 3BK2A 3VRBB 1KLGD 5MPOA 2GRIA 2L83A 5EE1A 4ITKA 2WXRA 1XLQA 4WH4A 4P16A 3V3XA 4HRSA 3AV8A 4HKQA 4YTPB 4A9AA 4DQOC 2J53A 1YJJA 1C78A 2WXPA 1KTKA 4J3OD 1SF0A 4RH6A 1GB4A 1WSPA 2ON8A 1MHHE 4US9A 1FO4A 3TEZA 5EE3A 1SSNA 2AQ1B 2LFIA 4B0MA 1NEKB 3AE2B 1ZUD2 4REZA 5BYQA 5JXVA 1SXTA 3IXSA 1WRIA 3TEYA 1QQRA 4YSXB 4ARIA 3AE5B 1T3QA 2BTEA 3Q8CA 1DGJA 1N5XA 3TSSA 1NI3A 1ZPSA 1F0ZA 5FK9C 3EGRA 4NAWB 3BVZA 3AEDB 4OVZA 2HDEA 2ACZB 3L4PA 2JSVX 1BUIC 1WXQA 1J7AA 1FFUA 2HTME 1JWUD 4MH8A 4O1NA 3VRAB 1PGAA 3BVGA 4RF0A 3R8BA 3BYYB 5TSSA 5EE9A 1B9RA 1QOBA 1FMAD 3Q8FA 2MJEA 3AMZA 2BT6A 3N9YC 1QT9A 1YN3A 2M56B 4GLSC 1MPEA 3W9CB 1F2RI 2AQ2B 2JXTA 1UNSA 2N9KA 2WU2B 3O13A 1QOGA 1ZOYB 5C3JB 1KFYB 3HUIA 3ZQ4A 3ZGZA 2L1AA 2DYOA 4C7YA 1L4ZB 3PO0A 4ZOHC 4YSYB 3ZYYX 1PGXA 2JYEA 1AWDA 1JALA 3P4RB 2OHFA 2SEBD 3T3OA 1SEBD 1JW9D 3AE4B 1SB3C 1N60A 1SJED 1AW7A 5FKAC 1ENFA 2WXKA 4A90A 4H2AA 3NVVA 2LHEA 3MP9A 3AB5A 3P4SB 3MFGA 3MC0B 2WXHA 3E56A 5HI1A 3P42A 3UI3A 5HHDG 1Q10A 1K51A 4RFBA 1TY2A 4RGNA 1AYFA 1P7EA 2QMTA 1DOXA 3WCQA 1E9MA 3IAM1 1WGKA 2QJLA 2LHDA 1KF6B 3NVZA 4Q2JA 2I2YA 4ZHOA 3KLSX 2GI9A 3AECB 3AE9B 4GDKB 1WWTA 4M0WA 2WP9B 5H8YE 4IDIA 3KWLA 1B1ZA 2CJOA 2NTTA 1SE4A 1DOIA 2H89B 4ARCA 2WXOA 4L1BA 3HRDD 1Y56A 1C4AA 4XDCA 3P4PB 2W54A 1GOZA 3MHZA 2TSSA 3NVYA 3AEBB 2WXMA 2N7JA 1ET6A 1QILA 5T8IA 3B9JA 1UGJA 4YSZB 3GB1A 2LUMA 1NVID 1EWYC 1FNWA 2ZW0A 3BK1A 3Q8EA 2KAJA 3W5VB 1UWXA 3E9SA 3HVZA 1TS3A 2PLPA 4JX1C 4DXFA 1UWMA 4HJGE 4TMAB 1C76A 4NAMA 2V3PA 4USAA 1D5MC 5G5GA 4KKIA 1HEZE 2WQYB 3KWVA 2IJ0A 5BMGA 2KN4A 2RDHA 4IOIE 2JZPA 4RGTA 5HG2A 4PT5A 2K22A 2QIEB 3PZ8A 2WU5B 2V4IB 1L6VA 1K50A 5I4DA 3IT6B 4JE3B 1FCLA 3TEWA 3J9CA 2Y3AA 1L6UA 2FE8A 4RNAA 1N63A 1SBBB 1R7SA 1XLNA 2KACA 2WXNA 3FAHA 3ZJUA 1XO3A 4OHJA 1TS5A 1NENB 3I9V1 1VLBA 3TUOA 1T5XD 2BS3B 1EU3A 1JWMD 1FD6A 4HROA 2L52A 1D5XC 4L2YA 1XXGA 1ZXIA 2D5GA 1LO5D 2XNAC 1C77A 3SFEB 1FIQA 3FILA 3ZJTA 2G9HD 3B2FA 1TJEA 4XWTA 3NVWA 4D2KA 2YEPF 1VR9A 2QEJC 1AN8A 5D7GA 1DYQA 3Q8AA 1D6EC 2FUG1 1QLBB 3FILB 4HEA1 4HKZE 1D4BA 4JPSA 1RFKA 1XLPA 2INPE 1XLOA 2BBCA 4YWGG 3DWGC 2WNMA 1YNTE 1IGCA 1F77A 4MT5A 1HQRD 1ET9A 1QOAA 2JU6X 1ESFA 4NZLB 4OW0A 2PW9A 1V1OA 3AE6B 2IGDA 4AS1A 1I4QA 4YTNB 3URYA 4C7ZA 2NMQA 4A6QA 4N59A 1C9FA 1I7HA 5LNK1 2W3SA 1EU4A 2OEDA 4MACA 5BYRA 2Q5WD 2BB6A 2V3NA 3CIRB 1NYRA 1OQQA 4N6EB 1JRPA 1XCTL 2Y5PA 2LJIA 4P6VF 2J4XA 4AQ7A 4OZBA 2G1EA 2BW2A 2M19A 2H88B 3ETRA 3FC4A 5EE0A 2WXIA 4RGOS 1F2RC 3SFDB 2K3UA 3DWMA 1YJIA 1L0YB 2AQ3B 2CJNA 1L0VB 1JQ4A 2IGGA 2EKIA 4WIPA 4TSSA 1V8CA 2JQRB 3SR6A 2VZKB 4DXGA 3EUB2 3AE1B 1TS4A 3AE8B 3GP7A 2JX5A 4A55A 4YXDB 2I38A 1OFFA 5D3DA 1FRRA 3NUHB 4RF1A 1SJHD 1JMLA 3P63A 2WS3B 1L4DB 3AEGB 4MM3B 1FXAA 3C8YA 2XN9C 1I4XA 1FFVA 1E6EB 2BB5A 1CK1A 4OZAA 4XDDA 2E6XA 4XE0A 1SE3A 5BMIA 2W55A 2LGIA 4KX6B 1I4HA 2ICIA 2IGHA 2PVGC 5AUKA 2J52A 5BMHA 2DLBA 1KH0A 1YMHE 2DWQA 4R3DA 1IUEA 2K0PA 1C4PA 1UUPA 4XWWA 3VR9B 1CZPA 2AX5A 3PZ7A 2X38A 4ZRPA 1C79A 2IPKD 3EA6A 4JWSC 5GXGB 3W2DA 1JROA 1XF5L 1N5WA 1VZ7A 2K5PA 2W3RA 1HZ5A 4GDLB 4LK0M 1TZOA 3V05A 5D3IB 1HZ6A 2MJ3A 2QSDA 1CJEA 1L0XB 1IBXA 5HFYA 5AUIA 3LYYA 1HA5A 1TS2A 1ZE3D 3VQIA 5FR3A 1TYGB 4TQ1A 3I57A 1SE2A 3LB8C 4WWMA 3AN1A 3H8HA 2MJDA 3R2IA 3R2TA 2W82A 4A8XC 1IBXB 4ZRQA 1YQ3B 4KGTA 2B76B 3RFZB 2KDMA 4RCOA 3SEBA 5E6JA 1KLUD 4L23A 2RPVA 1PUTA 3W1SA 2JYTA 1JWSD 1ACCA 1VJKA 1RM6C 2WXGA 4YTMB 2N0SB 3MJ5A 2E3TA 4US8A 2PIAA 4ZHPA 2WXJA 3U4EG 4B0EA 1FEHA 1PGBA 3AE3B 3W5UB 4LTUA 1I4RA 2KQ4X 2Y5CA 1STEA 1YN5A 1ZDVA 1KRHA 1E10A 1VZ6A 3LXFA 1GAQB 1VZ8A 3BZDB 1GB1A 3AEEB 3AE7B 1TY0A 1ZP0B 3VR8B 4C56C 1BXTA 2PTLA 1L5PA 1QKZA 1TKGA 2KMMA 3B2GA 4OZCA 2KWDA 3TEXA 1WYGA 1PFDA 4KGRA 4FXCA 4YT0B 1K52A 3AM9A 3P1MA 1E0ZA 2ZW1A 1ZXHA 1MHXA 4EE2A 2GB1A 3Q69A 1PYWD 3P4QB 1ZDXA 1XEEA 2RMMA 3U52E 1DOYA 2MEKA 1RYJA 1M4VA 1PDXA 1FM0D 2ONQA 2WDQB 2PMVA 4WQMA 1P7FA 3AEFB 2K9XA 1I4GA 1MI0A 3HVDA 3CWIA 2LMCA 2N9LA 1NYQA 2PKOA 2M0AA 1RWSA 3ZJVA 2V0GA 2WDVB 5H92C 2INNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKJ A;  3KQ4 A;  2BB5 A;  4ZRP A;  4ZRQ A;  3U7Z A;  2BB6 A;  2BBC A;  2V3N A;  2V3P A;  2PMV A;  4KKI A; 
#chains in the Genus database with same CATH topology
 2DNF A;  2WDT B;  4M01 A;  5G5H A;  3L17 A;  1GPX A;  3GS2 A;  4RGM A;  2KVZ A;  3RCZ A;  3BVM A;  3U2S C;  4BBN F;  4MGI E;  3U7Z A;  2L32 A;  3TBL D;  1MVK A;  2JWU A;  1FCC C;  3OWE B;  3Q8B A;  2OOB B;  1ROE A;  1J7B A;  1OQR A;  3BWU D;  1TKY A;  1YD8 U;  1JWA D;  1FXI A;  3B1L X;  5BYS A;  1IGD A;  2N7E A;  2OJR A;  2EMT A;  2RSU A;  3WAO A;  2NTS A;  1FNV A;  3BII D;  4P1C C;  3X0W A;  1T0Q C;  2FBW B;  3A9K A;  3NRZ A;  4N58 A;  3QCA A;  2ZEQ A;  2BKR B;  2K6D B;  2M1M A;  4M00 A;  3DBL I;  1VD2 A;  3ENE A;  1TKE A;  4NJ7 A;  3UF8 A;  1YQ4 B;  4ZYS A;  1C4C A;  3OJ3 A;  4UDU C;  3MHS D;  4CQN A;  3A4S C;  5AZF A;  3LJ3 A;  4RMA A;  3VFK A;  5MPO A;  1WGG A;  1EF5 A;  1AAR A;  3OAW A;  1XLQ A;  2ZPY A;  4WH4 A;  1V86 A;  4HPM B;  4ANX A;  3P2B A;  4TKN A;  1ZW7 A;  1H8C A;  1KTK A;  4J3O D;  2KXJ A;  4RH6 A;  1GB4 A;  1WSP A;  2CR5 A;  1MHH E;  4DXA B;  4US9 A;  4PS8 A;  2YLM A;  4F7Z A;  2N4F A;  1FO4 A;  2K8C A;  2LFI A;  2WYQ A;  4REZ A;  5JXV A;  1QZE A;  2K6Q A;  3AE5 B;  2ZVN A;  2O6V D;  3R3M A;  5FK9 C;  3BVZ A;  2KDF B;  2MRP A;  2HDE A;  2L0F A;  4O1N A;  2BYV E;  4MH8 A;  3VRA B;  3BVG A;  4RF0 A;  3R8B A;  3BYY B;  5TSS A;  1B9R A;  1FMA D;  2MJE A;  2VH2 A;  3AMZ A;  3PRM B;  2KWC A;  1WRD B;  4GLS C;  1F2R I;  3CF6 E;  2AQ2 B;  3H9D A;  1ZOY B;  5C3J B;  1KFY B;  3HUI A;  2K8H A;  1T0R C;  3RN9 C;  2DYO A;  4BVU C;  4N9F 4;  3APF A;  2VRR B;  3VDZ A;  2SEB D;  2KFK B;  4JLC A;  4GN1 A;  1WGD A;  2EMS A;  3ZNG C;  3WA0 A;  5FKA C;  1KLV A;  4BFR A;  2J0M A;  3DOW A;  3MP9 A;  2LGD A;  3P4S B;  4KZC A;  2LAS A;  2NR2 A;  2DEN B;  2XEW A;  4IW0 A;  2FCS A;  5IA7 A;  3UI3 A;  5HHD G;  4E3C A;  4RGN A;  1EF1 A;  1P7E A;  1E9M A;  3WAL A;  2LUE A;  2QHO A;  2I2Y A;  2GI9 A;  3AEC B;  4CO7 A;  3N20 C;  5J2R A;  3MTN B;  5H8Y E;  4CYE A;  2KYW A;  3KWL A;  1SE4 A;  4LNF A;  4M0W B;  1C4A A;  3ZRF A;  2MWS B;  2W54 A;  2LZ6 A;  3MHZ A;  3L54 A;  2O2V B;  1YX6 B;  5JZE B;  1EWY C;  4MSQ B;  3Q8E A;  2KMC A;  2N9X A;  4JGH B;  1UWX A;  3PPA A;  1TS3 A;  1D3Z A;  4DXF A;  2K39 A;  4HJG E;  1C76 A;  3UQA A;  3QIJ A;  3KH0 A;  3DPD A;  3JSV B;  4IOI E;  3HIZ A;  5HG2 A;  3APD A;  4M8N A;  1KOT A;  2PJH A;  1L6V A;  1K50 A;  3SHQ A;  1L6U A;  4ICV A;  3RZF A;  4RNA A;  2LXC A;  1V49 A;  4BKT A;  3PS6 A;  3ZJU A;  1NEN B;  4M8M A;  2BS3 B;  1OEY A;  3BY4 B;  2L52 A;  3CST A;  1E7U A;  4L2Y A;  5JH5 C;  1C77 A;  3NHE B;  1FIQ A;  3FIL A;  4HDQ A;  3SFE B;  3KUD B;  2CU1 A;  2YEP F;  3ML9 A;  2QEJ C;  3Q8A A;  1QLB B;  2D3B A;  4KIK A;  5FR6 A;  4W9L A;  2INP E;  3VXW A;  3MJW A;  3Q2A C;  1LFD A;  2KTR A;  2PW9 A;  2L0T A;  1I4Q A;  3URY A;  4G0N B;  3RZW C;  3TJP A;  1UF0 A;  1EU4 A;  1MG8 A;  3EC8 A;  5C23 A;  1UBQ A;  1JRP A;  2WWZ A;  2LJI A;  4P6V F;  1WZ3 A;  4AQ7 A;  4K7S A;  3FC4 A;  4GDK A;  5J18 A;  1BT0 A;  2NS5 A;  4F8C B;  2Y5B B;  2K3U A;  1WE7 A;  2AQ3 B;  2MQJ A;  2CJN A;  1L0V B;  3ZNH B;  2RDB C;  4KSL C;  1E8Z A;  2EKI A;  3PLV A;  4TSS A;  1V8C A;  2VZK B;  3D32 A;  3AE1 B;  3AE8 B;  2C7N B;  2JX5 A;  3AI5 A;  2DAF A;  4WWN A;  5LLI A;  1Y8R C;  2KZR A;  4ASW C;  4MEL A;  4PS7 A;  4NQK E;  4MM3 B;  2BKF A;  1FFV A;  4S17 A;  4OZA A;  1OEY J;  4KX6 B;  1I4H A;  2ICI A;  5AUK A;  2C7H A;  2ZNV B;  2MBB B;  2HTH A;  4DHZ B;  1IUE A;  1UUP A;  3MC9 A;  2AX5 A;  4E74 A;  4XYC A;  1JRO A;  1XF5 L;  4ZRJ A;  1TZO A;  3V05 A;  3ZNZ B;  1HZ6 A;  2LGX A;  2MLB A;  4ACF A;  3LYY A;  1TS2 A;  1TYG B;  3I57 A;  5KHQ A;  3ZNI D;  4ZRQ A;  4IM2 A;  3RFZ B;  1WH3 A;  3V60 A;  3PZD A;  4W9H A;  3OJ4 B;  3ZTC A;  1LGR A;  3RNA C;  1FPY A;  2KN5 A;  3W1S A;  2JYT A;  4BAX A;  2IO2 B;  1H4R A;  4RM9 A;  3MJ5 A;  2E3T A;  2ZNV C;  4ZHP A;  1FEH A;  2LGS A;  4HXD A;  2KX3 A;  3AE3 B;  2KC1 A;  1V5O A;  3T9L A;  2NCN A;  1X1M A;  3BZD B;  2UU7 A;  3DBR B;  4WWP A;  2CHW A;  2I1K A;  2FCN A;  4A3P A;  4OZC A;  2X8X X;  3HM3 A;  1PFD A;  1WMH B;  4LJO B;  4YT0 B;  1CMX B;  1E0Z A;  2ZW1 A;  1MHX A;  2GB1 A;  3Q69 A;  2RMM A;  4P7I A;  3U52 E;  2N7D A;  2CKH B;  1FM0 D;  2ONQ A;  1P7F A;  2G4D B;  2K9X A;  1MI0 A;  4LNK A;  4M02 A;  1NYQ A;  1J19 A;  3DHI C;  3M63 B;  5GMV A;  1RWS A;  4II3 B;  2G45 B;  2INN E;  2JRH A;  2GOW A;  1YQB A;  2GBJ A;  4XGA B;  1A5R A;  1T6B X;  1MFW A;  1VDV A;  1WR6 E;  1E5W A;  3BYT B;  2D07 B;  1JWB D;  1FRD A;  2WXQ A;  4LDT D;  4LJP B;  1K53 A;  4BOS C;  2SAK A;  3AH7 A;  1N62 A;  2R2Q A;  1EWC A;  2KDE B;  3NS1 A;  1JRU A;  2WXL A;  1F1H A;  3KQ4 A;  4BZA A;  1BML C;  3AEA B;  4TV3 A;  2WLB A;  1I4P A;  1WXM A;  2D2Q A;  1FNU A;  4C80 A;  2LVO A;  3IT4 B;  4IKG A;  5G55 A;  2WX0 A;  1QOF A;  2LEK A;  4KKJ A;  3EEC A;  4JWU C;  3A1Q B;  1ZGU B;  2WXF A;  2BS2 B;  2RDG A;  3Q6B A;  4JQW C;  3RPF C;  2L05 A;  2QCZ A;  2FID A;  1HXY D;  1WJ6 A;  2YEP B;  1KLG D;  2MW5 A;  3HK0 A;  4I6P A;  4HRS A;  3AV8 A;  3SD5 A;  5KHO A;  3KYC D;  3GZN B;  2FIF A;  4MH0 E;  1C78 A;  4RM8 A;  2ON8 A;  4GU2 A;  3DCG A;  3RNE C;  3N1Y C;  4B0M A;  1ZUD 2;  5LXH A;  3RMK C;  4J6I A;  2D3G A;  3IXS A;  3TEY A;  1QQR A;  3PHW B;  1EUV B;  4KSK C;  2FUH B;  2BTE A;  1N5X A;  4ZYN A;  2LJ5 A;  2LXA A;  1F0Z A;  3EGR A;  5C1Z A;  1PQS A;  2ACZ B;  1WXQ A;  1J7A A;  2NBW B;  2HTM E;  2BPS A;  2ZCC A;  2G4S A;  4K3C A;  2CS4 A;  1P9D U;  3H1U A;  2M56 B;  1MPE A;  3PSE B;  4KVG B;  4HCN B;  1HTQ A;  3ZRC A;  1L4Z B;  3SDL C;  4ZOH C;  4YSY B;  3ZYY X;  3K9O B;  4LDT B;  4FHJ A;  2LVQ A;  1AWD A;  3RD2 A;  2DX5 B;  2OHF A;  3GE8 C;  4ANW A;  3DBH B;  5EDS A;  3IBE A;  5L83 A;  1N60 A;  2Z59 B;  4MGZ E;  1G6J A;  1ENF A;  2WXK A;  4ICU A;  2OJW A;  2LHE A;  2GBR A;  3AB5 A;  3KUZ A;  2K25 A;  4WQO B;  3UGB B;  5HI1 A;  4XX5 A;  4I6N B;  2NPT B;  1Q10 A;  1XT9 B;  3WCQ A;  3IAM 1;  2IY0 B;  2LHD A;  4K7W A;  3NVZ A;  3KLS X;  2V1Y A;  4M0W A;  3IHP C;  1V9J A;  4IDI A;  3PTF C;  2NTT A;  2O2V A;  1DOI A;  2I1J A;  1FXT B;  4K7U A;  1GOZ A;  2AL3 A;  2TSS A;  4IWO A;  1P1A A;  5D94 A;  2N7J A;  3OLM D;  4XC2 A;  3OG5 A;  2LUM A;  3PRP B;  1WE6 A;  1FNW A;  2ZW0 A;  3BK1 A;  3QAR A;  2KAJ A;  3W5V B;  2N9E B;  3E9S A;  4C4V B;  3HVZ A;  3VTW A;  2PLP A;  1UWM A;  2DZJ A;  4TMA B;  3EFC A;  2LD9 A;  2KFJ A;  3L16 A;  1HEZ E;  3KWV A;  2RDH A;  4RGT A;  1P98 A;  2JZP A;  1TGZ B;  1WXV A;  1N6Z A;  1LM8 B;  3VHT C;  4NAW A;  2JPH A;  2KO3 A;  4LNO A;  4PK1 A;  1SE9 A;  1FCL A;  1I35 A;  2MP2 A;  2XBB C;  2Y3A A;  1N63 A;  1SBB B;  1R7S A;  2KAC A;  4OHJ A;  1KM7 A;  5AEK B;  3I9V 1;  1VLB A;  3TUO A;  1T5X D;  1EU3 A;  2JF5 A;  4HRO A;  4X57 B;  1D5X C;  1XXG A;  1F52 A;  3UIN B;  2G9H D;  4XWT A;  4F1S A;  5JHB A;  2NBV B;  3M3J A;  2HJ8 A;  1VR9 A;  3EHV A;  5IN7 A;  4HEA 1;  2K1F A;  1ISN A;  4JPS A;  2JRI B;  1XLP A;  2JUO A;  2BBC A;  2CHX A;  2WNM A;  3DVG Y;  1GJZ A;  3TIX A;  4FJY A;  2JU6 X;  1ESF A;  4NZL B;  2KC2 A;  3AE6 B;  2IGD A;  3DVN V;  4WJQ A;  1WY8 A;  4N59 A;  2BYE A;  1ZKH A;  2OED A;  2Q5W D;  1F9J A;  2V3N A;  2LVP A;  2G1E A;  2BW2 A;  2H88 B;  3PRZ A;  5EE0 A;  1V6E A;  2DYB A;  4KZ0 A;  4RGO S;  4TUU A;  3DWM A;  4LNI A;  1YJI A;  1JQ4 A;  4ZRK A;  4FJZ A;  3KW5 B;  1TS4 A;  2IY1 B;  4YXD B;  3NUH B;  4RF1 A;  1L4D B;  2KQS A;  1I4X A;  3JW0 X;  2LGI A;  2IGH A;  2C5L C;  3M95 A;  2J52 A;  3QX1 A;  4KDI C;  3A9K B;  3PZ7 A;  2X38 A;  3EA6 A;  2C60 A;  5GXG B;  2K5P A;  1HZ5 A;  3Q3O C;  5D3I B;  2LRW A;  2MJ3 A;  2QSD A;  2ZZP B;  3ZKJ C;  5LXI B;  1L0X B;  2JVC A;  1HA5 A;  1ZE3 D;  2K8B A;  3ML8 A;  3VQI A;  3QA8 A;  4WWM A;  3AN1 A;  3R2I A;  2MJD A;  3R2T A;  1IBX B;  2W82 A;  3VTV A;  1YQ3 B;  4KGT A;  2O6V B;  2KDM A;  2Z0D B;  2GLS A;  2IBI B;  1KLU D;  2RPV A;  3RUI B;  3VAW A;  2DZM A;  1RM6 C;  2ZVO A;  2WXG A;  2BWE S;  4US8 A;  2JY6 A;  2JZZ A;  2INC C;  2AYO B;  3N1X C;  3QC8 B;  1KJT A;  4LTU A;  2KQ4 X;  4MSM B;  1YN5 A;  3N3K B;  1KRH A;  3HM6 X;  1E10 A;  1VZ6 A;  3LXF A;  1RLF A;  3SU8 X;  4ANV A;  2LGY A;  3AEE B;  2V3S A;  4WJP A;  1BXT A;  1UD7 A;  3P1M A;  1ZXH A;  3P4Q B;  1ZDX A;  1XEE A;  1DOY A;  4LCD E;  1WIA A;  4DWF A;  3V61 A;  4WQM A;  3AEF B;  1Q0W B;  2N9L A;  2PKO A;  4NY0 A;  2N9P C;  2IND C;  3ZJV A;  2V0G A;  2WDV B;  4E71 A;  1CQV A;  1EM7 A;  1UGM A;  3PHX B;  4FBJ B;  1MG4 A;  1XQQ A;  5C2T B;  2BS4 B;  4A20 A;  2LI5 A;  3DHH C;  1SIJ A;  1E7P B;  3RNG C;  4MJS B;  1V81 A;  4K1R B;  2VH1 A;  2DBY A;  3Q3J A;  4W9I A;  1S3S G;  4TQ0 A;  2QDF A;  3VUY A;  2C7M B;  3ONS A;  4WUR A;  4XZ4 A;  1WJ4 A;  2BYT A;  1S1Q B;  2MH7 A;  4MGY E;  2J42 A;  1XCQ L;  1RFA A;  1WGH A;  1V1P B;  1WX8 A;  2QIL A;  3QK0 A;  4WWO A;  2G3Q B;  5BO4 B;  2KTF A;  3UIO B;  1YX5 B;  4EZL A;  3NG0 A;  2PVO D;  3KUC B;  1N61 A;  4NJC A;  3DBL B;  5CX3 A;  2D11 A;  2CU3 A;  3NZ3 A;  3WAN A;  3NZS A;  4KGS A;  3N30 A;  3BK2 A;  3VRB B;  2GRI A;  2MBE A;  3V3X A;  4IM0 A;  4DQO C;  2J53 A;  4W9F A;  1YJJ A;  3CMM B;  3KYD D;  3DBS A;  3TEZ A;  1WFY A;  1WZ0 A;  4DDI D;  5BYQ A;  4BKG A;  1WRI A;  1T3Q A;  3JYU A;  3TSS A;  1ZPS A;  1WX9 A;  5E6O A;  3AED B;  3IFW B;  2IO1 B;  4OVZ A;  2LWP A;  4IWQ A;  1NBF C;  3L4P A;  2R2O A;  2J7Q B;  2JSV X;  1BUI C;  2KJH B;  1FFU A;  3U8Z A;  1JWU D;  2M4N A;  4MEM A;  5EE9 A;  4AUQ C;  4B9K A;  5D2M B;  1YN3 A;  4W9E A;  4IC7 B;  3W9C B;  2JXT A;  1GC6 A;  1UNS A;  2N9K A;  2WU2 B;  4EUT A;  1XD3 B;  3O13 A;  2EKE C;  1QOG A;  1E8W A;  3PRE A;  3ZGZ A;  1OGW A;  4C7Y A;  2REX A;  1JAL A;  1I42 A;  4KV2 A;  4KIK B;  1SEB D;  3AE4 B;  1SB3 C;  1YJ1 A;  2M17 A;  3L10 B;  4HCP B;  4W9C A;  2V4L A;  4PYZ A;  4A90 A;  2L8J A;  4WAA A;  3MFG A;  3MC0 B;  2KLC A;  3ZTD A;  5IP4 D;  3KVF B;  3R66 C;  2A5U A;  2BVC A;  4EEW A;  4RFB A;  1AYF A;  4GGQ A;  2HE7 A;  1DOX A;  1J8C A;  2QJL A;  2DAJ A;  1KF6 B;  4AP4 C;  3VH4 B;  3DHG C;  3AE9 B;  3QAQ A;  4GDK B;  2HJ1 A;  2MCN B;  2WP9 B;  4EZJ A;  2FAZ A;  2JZ3 B;  4ARC A;  2WXO A;  4L1B A;  1IYF A;  5E6P A;  4XDC A;  4DDG D;  3NVY A;  2WXM A;  3IVF A;  3WAP A;  1QIL A;  5T8I A;  3B9J A;  2DZK A;  3GB1 A;  1NVI D;  2KVR A;  1IPG A;  3ZVV A;  4NPN A;  2V3P A;  3DVN U;  1D5M C;  2WQY B;  2WGS A;  2IJ0 A;  5BMG A;  2J0K A;  4PT5 A;  2QIE B;  3ZXV A;  5I4D A;  3IT6 B;  4JE3 B;  2N1W A;  3TEW A;  2QC8 A;  4W9J A;  3J9C A;  2RD0 A;  2FE8 A;  2NVU I;  4NQL B;  2RR9 A;  1XLN A;  2WXN A;  3FAH A;  3L13 A;  1XO3 A;  4ZRI A;  3V6C B;  4G50 A;  3QHT A;  3ZIM A;  2XK5 B;  2AL6 A;  1FD6 A;  4EZK A;  2KOX A;  2W9N A;  1LO5 D;  1WI0 A;  3ZJT A;  1TJE A;  3U30 A;  5D7G A;  3A9J B;  4HKZ E;  2KFK A;  1UBI A;  2FCQ A;  2ASQ A;  3QJZ A;  5DPW A;  3DWG C;  1YNT E;  3I5J C;  1IGC A;  1F77 A;  1HQR D;  4DHJ D;  1V1O A;  2JT4 B;  4G3X B;  4AS1 A;  1Z5S B;  4C7Z A;  4NNJ B;  4WJN A;  1C9F A;  4HPL B;  5LNK 1;  3A33 B;  2W3S A;  4MAC A;  3W1S C;  5BYR A;  4N6E B;  3CIR B;  1V80 A;  5DPS A;  2MA9 B;  2GBK A;  2KJ6 A;  2JWZ A;  2NBU A;  3AU5 A;  3NJT A;  3U7D A;  3SFD B;  2KAN A;  3ZUN A;  4S0R A;  1L0Y B;  3RT3 B;  1HE8 A;  2KLG A;  2M0X A;  2JQR B;  3SR6 A;  2IO0 B;  4DXG A;  3GP7 A;  1TIF A;  1E90 A;  1OFF A;  5D3D A;  1FRR A;  1SJH D;  4K81 A;  4QAY A;  3AEG B;  1FXA A;  3C8Y A;  2XN9 C;  1E6E B;  2BB5 A;  3AXC A;  2E6X A;  1SE3 A;  4HVB A;  2PVG C;  5BMH A;  3IG3 A;  1YMH E;  2DWQ A;  4W9D A;  2K0P A;  1C4P A;  2AEH A;  2CHZ A;  1EO6 A;  1UH6 A;  3GOE A;  3JSV A;  3C0R B;  4ZRP A;  4JWS C;  3W2D A;  3L08 A;  1N5W A;  1VZ7 A;  2W3R A;  4GDL B;  3WAM A;  1TTN A;  3N32 A;  1IBX A;  3I63 C;  2FNJ B;  2O6V A;  4HLE A;  5HKH A;  1WJN A;  4OVU A;  2BYF A;  1SE2 A;  3NOB A;  4A8X C;  2IYD B;  2KD0 A;  5E6J A;  1PUT A;  1VJK A;  4GB9 A;  1OTR B;  5DPT A;  2PIA A;  4HK2 A;  1T0S C;  2WXJ A;  3B0A A;  3PLU A;  5AZH A;  4B0E A;  3BIN A;  3ZDM C;  1TT5 B;  3V62 A;  3A4R A;  3TL5 A;  2Y5C A;  3DBR I;  1VZ8 A;  1WX7 A;  4A3O A;  1GB1 A;  4FA6 A;  3AE7 B;  1TY0 A;  1ZP0 B;  2KMA A;  3H7P B;  1L5P A;  4MDK E;  1QKZ A;  2PE6 B;  1WJU A;  3NY5 A;  2KWD A;  1SIF A;  1WYG A;  2KX0 A;  3TEX A;  3X23 A;  4KGR A;  1K52 A;  4CHK A;  2MBQ A;  3ZLZ A;  4EE2 A;  1PYW D;  3C19 A;  3VH3 B;  1RYJ A;  3ALB A;  4GMV A;  3MC8 A;  4DHJ B;  1M4V A;  3NZU A;  1PDX A;  3HVD A;  3CWI A;  4PYU A;  5JHA A;  3LDZ E;  1J7C A;  4HPP A;  2MX2 A;  4KDL B;  5E6N A;  4MJS A;  1D5Z C;  1UZX B;  3Q3F A;  4BKS A;  2EEL A;  1VRA B;  2L76 A;  3FKY A;  1YN4 A;  1NI2 A;  3PT2 B;  2DZI A;  2Z0E B;  2KWU B;  1WGY A;  1Z2M A;  1HTO A;  2JXX A;  5CHW A;  4AJY B;  2R61 A;  1JCK B;  4WAF A;  4MM3 A;  1QF6 A;  4FHK A;  2L3Z A;  2Z8L A;  1V1P A;  1A70 A;  1V97 A;  3ABV B;  4BKS D;  1R4M B;  3T3N A;  4LNN A;  4IUM B;  3IAS 1;  2VZK D;  2IDY A;  1YIW A;  1R4N B;  4LLG M;  2WDR B;  2KWV B;  3ZXR A;  2V9H A;  1E8X A;  4G11 A;  2DYM A;  1C3T A;  3NS8 A;  2KDI A;  3VTU A;  3Q3N C;  4I6L B;  4NJ6 A;  2MBO A;  2L83 A;  5EE1 A;  2BQQ A;  4ITK A;  2WXR A;  1OQY A;  2N1V A;  4P16 A;  3GZN I;  4FN2 A;  5IAA C;  4HKQ A;  2KQ7 A;  4YTP B;  4A9A A;  2A4Z A;  3JVZ X;  2RPQ A;  2WXP A;  3WIM A;  3RUL A;  1GG3 A;  1SF0 A;  2KT7 A;  1MJD A;  5CTR C;  2GBM A;  3R7Q A;  5EE3 A;  1SSN A;  2AQ1 B;  1NEK B;  3AE2 B;  2L00 B;  1SXT A;  4ARI A;  4YSX B;  5L95 C;  5G2N A;  3Q8C A;  1DGJ A;  1NI3 A;  1WMH A;  3B08 A;  4NAW B;  4HDO A;  2YVC A;  3R7R A;  1Q5W B;  2MP2 B;  5CHV C;  1PGA A;  2WX1 A;  3UQB A;  1QOB A;  1P0R A;  2DHZ A;  3Q8F A;  1IP9 A;  2BT6 A;  3RI7 C;  3N9Y C;  1T0Y A;  1QT9 A;  3UIP B;  3HHM A;  4WJO A;  4OVV A;  3ZQ4 A;  2GBN A;  2L1A A;  4JIO U;  3PO0 A;  1PGX A;  2JYE A;  3Q14 C;  1WXS A;  4BBN C;  3DBH I;  3P4R B;  2AWT A;  1L7Y A;  3RNB C;  3T3O A;  5DCN A;  2MHJ A;  4JL9 A;  1JW9 D;  1LQB A;  1SJE D;  4FJV B;  1AW7 A;  5TR5 A;  4HWI B;  2PPH A;  3V6E B;  4GOC A;  4H2A A;  3NVV A;  1TZ1 A;  5IKC M;  4FLH A;  2WXH A;  4W9K A;  3E56 A;  2KJR A;  4EKU A;  3P42 A;  3PVL A;  3O65 B;  5CHF A;  4HJK A;  3APC A;  1K51 A;  1TY2 A;  2LRU A;  2QMT A;  1WGK A;  3M62 B;  3H6N A;  4Q2J A;  4ZHO A;  2MSE D;  2GMI C;  4AOF A;  3A1Q A;  1WWT A;  4II2 B;  1B1Z A;  1LXD A;  2CJO A;  4C00 A;  4DK5 A;  2H89 B;  2ZPN A;  3DVG X;  3HRD D;  1Y56 A;  1M94 A;  3P4P B;  5IOI A;  4URK A;  2C9W B;  3AEB B;  1ET6 A;  2ZJD A;  1UGJ A;  4YSZ B;  2J0J A;  4GSW A;  3PGE A;  4JX1 C;  1V5T A;  1WF9 A;  4NAM A;  1WXA A;  4USA A;  5G5G A;  4KKI A;  5AZG A;  3ECI A;  1C1Y B;  3VUX A;  2KN4 A;  2D3C A;  2K22 A;  3PZ8 A;  2WU5 B;  1P3Q U;  2V4I B;  3QQ8 B;  1U4A A;  4AWJ A;  2L7R A;  2IO3 B;  4YL8 A;  4GIV A;  3I3T B;  2XK5 A;  2B3A A;  1TS5 A;  1E7V A;  1JWM D;  1E8Y A;  2KDB A;  4EOY A;  2PE9 A;  1ZXI A;  2D5G A;  3A9J A;  4DHZ E;  2XNA C;  4FUL A;  3B2F A;  3NVW A;  4D2K A;  3L0W B;  1WR1 A;  2D3A A;  1AN8 A;  3W1Y A;  1DYQ A;  1D6E C;  2FUG 1;  3FIL B;  1D4B A;  1RFK A;  4FAD A;  4B6W A;  1XLO A;  4YWG G;  1L2N A;  4MT5 A;  1ET9 A;  3PV1 A;  1QOA A;  3VUW A;  3TMP B;  4OW0 A;  1SGH A;  3EFU A;  4YTN B;  2ZCB A;  2NMQ A;  2KTR B;  4A6Q A;  3AUL A;  1YOV B;  1I7H A;  2D10 A;  2NPT A;  2BB6 A;  1NYR A;  1OQQ A;  3AU4 A;  1XCT L;  2Y5P A;  2J4X A;  1GC7 A;  4OZB A;  2M19 A;  3ETR A;  1GNU A;  2WXI A;  1F2R C;  4GXB A;  4IG7 B;  1WYW B;  3QWZ B;  5IO9 A;  2IGG A;  4WIP A;  5J17 A;  4ZDV A;  3EUB 2;  3GE3 C;  4A55 A;  4MGK E;  2I38 A;  1TBE A;  1JML A;  3P63 A;  4IWP A;  2KHW B;  4BOZ B;  2WS3 B;  1GUA B;  2WHI A;  1R4M I;  4C4V A;  3TCA A;  1CK1 A;  5DPR A;  4XDD A;  5BMI A;  4XE0 A;  2W55 A;  1R4N I;  3DDC B;  2DLB A;  2HD5 B;  1KH0 A;  4GDL A;  4DBG A;  2UYZ B;  4R3D A;  4K3B A;  4ANU A;  4XWW A;  3VR9 B;  1CZP A;  3RNC C;  1NDD A;  1C79 A;  2IPK D;  3ZO5 B;  4LK0 M;  2KKC A;  5D6J B;  1CJE A;  2KK8 A;  5HFY A;  5AUI A;  1RAX A;  3N1Z C;  5FR3 A;  4TQ1 A;  3LB8 C;  1UEL A;  3H8H A;  2IZV B;  3K9P B;  2B76 B;  4PS3 A;  3Q3M C;  4RCO A;  2FCM A;  3SEB A;  2M8S A;  4L23 A;  2BWF A;  3S2A A;  1JWS D;  1ACC A;  3CSF A;  4YTM B;  2N0S B;  1WGR A;  3T8M A;  1V2Y A;  3U4E G;  1WM2 A;  1PGB A;  2RGF A;  3W5U B;  3H7P A;  1I4R A;  1STE A;  4AJW A;  1ZDV A;  3ZDT A;  1GAQ B;  3VVW B;  3VR8 B;  4C56 C;  4P1B C;  2PTL A;  3H7S A;  1TKG A;  2KMM A;  3B2G A;  4FXC A;  2UWQ A;  3AM9 A;  2PEA A;  1VCB A;  2BF8 B;  2KNB A;  3RYT A;  1RRB A;  2MEK A;  2MBH A;  1Q1O A;  1WM3 A;  3DQV A;  4W9G A;  2WDQ B;  2PMV A;  1J0G A;  3RNF C;  4EFO A;  1I4G A;  2LMC A;  3ZW3 A;  2BGF A;  1K8R B;  4IM3 A;  4B95 A;  2M0A A;  5H92 C; 
#chains in the Genus database with same CATH homology
 1CQV A;  1EM7 A;  1J7C A;  1T6B X;  1VDV A;  5C2T B;  3BYT B;  5G5H A;  1GPX A;  1JWB D;  1D5Z C;  1FRD A;  2BS4 B;  2WXQ A;  3GS2 A;  4RGM A;  3BVM A;  1K53 A;  2EEL A;  3U2S C;  2SAK A;  3AH7 A;  1N62 A;  1VRA B;  1SIJ A;  1YN4 A;  2L32 A;  1E7P B;  1EWC A;  3U7Z A;  1MVK A;  2JWU A;  3NS1 A;  1FCC C;  2WXL A;  3OWE B;  3Q8B A;  3KQ4 A;  1ROE A;  1J7B A;  1OQR A;  3BWU D;  2DBY A;  1TKY A;  4TQ0 A;  1JWA D;  2R61 A;  1JCK B;  1FXI A;  4WAF A;  5BYS A;  1QF6 A;  2Z8L A;  1IGD A;  1BML C;  1V1P A;  1A70 A;  4WUR A;  1V97 A;  3AEA B;  2WLB A;  2BYT A;  2NTS A;  1I4P A;  2MH7 A;  2J42 A;  1XCQ L;  3ABV B;  1FNV A;  3BII D;  1FNU A;  1V1P B;  2QIL A;  2FBW B;  3NRZ A;  4N58 A;  4C80 A;  3T3N A;  3IAS 1;  3IT4 B;  2VZK D;  2IDY A;  4IKG A;  4LLG M;  2WDR B;  2PVO D;  1QOF A;  2LEK A;  1N61 A;  1TKE A;  4NJC A;  4KKJ A;  1YQ4 B;  4JWU C;  2WXF A;  4ZYS A;  2BS2 B;  2DYM A;  2RDG A;  2CU3 A;  3RPF C;  1C4C A;  3NZ3 A;  1HXY D;  2YEP B;  4KGS A;  4UDU C;  4CQN A;  3BK2 A;  3VRB B;  1KLG D;  5MPO A;  2GRI A;  2L83 A;  5EE1 A;  4ITK A;  2WXR A;  1XLQ A;  4WH4 A;  4P16 A;  3V3X A;  4HRS A;  3AV8 A;  4HKQ A;  4YTP B;  4A9A A;  4DQO C;  2J53 A;  1YJJ A;  1C78 A;  2WXP A;  1KTK A;  4J3O D;  1SF0 A;  4RH6 A;  1GB4 A;  1WSP A;  2ON8 A;  1MHH E;  4US9 A;  1FO4 A;  3TEZ A;  5EE3 A;  1SSN A;  2AQ1 B;  2LFI A;  4B0M A;  1NEK B;  3AE2 B;  1ZUD 2;  4REZ A;  5BYQ A;  5JXV A;  1SXT A;  3IXS A;  1WRI A;  3TEY A;  1QQR A;  4YSX B;  4ARI A;  3AE5 B;  1T3Q A;  2BTE A;  3Q8C A;  1DGJ A;  1N5X A;  3TSS A;  1NI3 A;  1ZPS A;  1F0Z A;  5FK9 C;  3EGR A;  4NAW B;  3BVZ A;  3AED B;  4OVZ A;  2HDE A;  2ACZ B;  3L4P A;  2JSV X;  1BUI C;  1WXQ A;  1J7A A;  1FFU A;  2HTM E;  1JWU D;  4MH8 A;  4O1N A;  3VRA B;  1PGA A;  3BVG A;  4RF0 A;  3R8B A;  3BYY B;  5TSS A;  5EE9 A;  1B9R A;  1QOB A;  1FMA D;  3Q8F A;  2MJE A;  3AMZ A;  2BT6 A;  3N9Y C;  1QT9 A;  1YN3 A;  2M56 B;  4GLS C;  1MPE A;  3W9C B;  1F2R I;  2AQ2 B;  2JXT A;  1UNS A;  2N9K A;  2WU2 B;  3O13 A;  1QOG A;  1ZOY B;  5C3J B;  1KFY B;  3HUI A;  3ZQ4 A;  3ZGZ A;  2L1A A;  2DYO A;  4C7Y A;  1L4Z B;  3PO0 A;  4ZOH C;  4YSY B;  3ZYY X;  1PGX A;  2JYE A;  1AWD A;  1JAL A;  3P4R B;  2OHF A;  2SEB D;  3T3O A;  1SEB D;  1JW9 D;  3AE4 B;  1SB3 C;  1N60 A;  1SJE D;  1AW7 A;  5FKA C;  1ENF A;  2WXK A;  4A90 A;  4H2A A;  3NVV A;  2LHE A;  3MP9 A;  3AB5 A;  3P4S B;  3MFG A;  3MC0 B;  2WXH A;  3E56 A;  5HI1 A;  3P42 A;  3UI3 A;  5HHD G;  1Q10 A;  1K51 A;  4RFB A;  1TY2 A;  4RGN A;  1AYF A;  1P7E A;  2QMT A;  1DOX A;  3WCQ A;  1E9M A;  3IAM 1;  1WGK A;  2QJL A;  2LHD A;  1KF6 B;  3NVZ A;  4Q2J A;  2I2Y A;  4ZHO A;  3KLS X;  2GI9 A;  3AEC B;  3AE9 B;  4GDK B;  1WWT A;  4M0W A;  2WP9 B;  5H8Y E;  4IDI A;  3KWL A;  1B1Z A;  2CJO A;  2NTT A;  1SE4 A;  1DOI A;  2H89 B;  4ARC A;  2WXO A;  4L1B A;  3HRD D;  1Y56 A;  1C4A A;  4XDC A;  3P4P B;  2W54 A;  1GOZ A;  3MHZ A;  2TSS A;  3NVY A;  3AEB B;  2WXM A;  2N7J A;  1ET6 A;  1QIL A;  5T8I A;  3B9J A;  1UGJ A;  4YSZ B;  3GB1 A;  2LUM A;  1NVI D;  1EWY C;  1FNW A;  2ZW0 A;  3BK1 A;  3Q8E A;  2KAJ A;  3W5V B;  1UWX A;  3E9S A;  3HVZ A;  1TS3 A;  2PLP A;  4JX1 C;  4DXF A;  1UWM A;  4HJG E;  4TMA B;  1C76 A;  4NAM A;  2V3P A;  4USA A;  1D5M C;  5G5G A;  4KKI A;  1HEZ E;  2WQY B;  3KWV A;  2IJ0 A;  5BMG A;  2KN4 A;  2RDH A;  4IOI E;  2JZP A;  4RGT A;  5HG2 A;  4PT5 A;  2K22 A;  2QIE B;  3PZ8 A;  2WU5 B;  2V4I B;  1L6V A;  1K50 A;  5I4D A;  3IT6 B;  4JE3 B;  1FCL A;  3TEW A;  3J9C A;  2Y3A A;  1L6U A;  2FE8 A;  4RNA A;  1N63 A;  1SBB B;  1R7S A;  1XLN A;  2KAC A;  2WXN A;  3FAH A;  3ZJU A;  1XO3 A;  4OHJ A;  1TS5 A;  1NEN B;  3I9V 1;  1VLB A;  3TUO A;  1T5X D;  2BS3 B;  1EU3 A;  1JWM D;  1FD6 A;  4HRO A;  2L52 A;  1D5X C;  4L2Y A;  1XXG A;  1ZXI A;  2D5G A;  1LO5 D;  2XNA C;  1C77 A;  3SFE B;  1FIQ A;  3FIL A;  3ZJT A;  2G9H D;  3B2F A;  1TJE A;  4XWT A;  3NVW A;  4D2K A;  2YEP F;  1VR9 A;  2QEJ C;  1AN8 A;  5D7G A;  1DYQ A;  3Q8A A;  1D6E C;  2FUG 1;  1QLB B;  3FIL B;  4HEA 1;  4HKZ E;  1D4B A;  4JPS A;  1RFK A;  1XLP A;  2INP E;  1XLO A;  2BBC A;  4YWG G;  3DWG C;  2WNM A;  1YNT E;  1IGC A;  1F77 A;  4MT5 A;  1HQR D;  1ET9 A;  1QOA A;  2JU6 X;  1ESF A;  4NZL B;  4OW0 A;  2PW9 A;  1V1O A;  3AE6 B;  2IGD A;  4AS1 A;  1I4Q A;  4YTN B;  3URY A;  4C7Z A;  2NMQ A;  4A6Q A;  4N59 A;  1C9F A;  1I7H A;  5LNK 1;  2W3S A;  1EU4 A;  2OED A;  4MAC A;  5BYR A;  2Q5W D;  2BB6 A;  2V3N A;  3CIR B;  1NYR A;  1OQQ A;  4N6E B;  1JRP A;  1XCT L;  2Y5P A;  2LJI A;  4P6V F;  2J4X A;  4AQ7 A;  4OZB A;  2G1E A;  2BW2 A;  2M19 A;  2H88 B;  3ETR A;  3FC4 A;  5EE0 A;  2WXI A;  4RGO S;  1F2R C;  3SFD B;  2K3U A;  3DWM A;  1YJI A;  1L0Y B;  2AQ3 B;  2CJN A;  1L0V B;  1JQ4 A;  2IGG A;  2EKI A;  4WIP A;  4TSS A;  1V8C A;  2JQR B;  3SR6 A;  2VZK B;  4DXG A;  3EUB 2;  3AE1 B;  1TS4 A;  3AE8 B;  3GP7 A;  2JX5 A;  4A55 A;  4YXD B;  2I38 A;  1OFF A;  5D3D A;  1FRR A;  3NUH B;  4RF1 A;  1SJH D;  1JML A;  3P63 A;  2WS3 B;  1L4D B;  3AEG B;  4MM3 B;  1FXA A;  3C8Y A;  2XN9 C;  1I4X A;  1FFV A;  1E6E B;  2BB5 A;  1CK1 A;  4OZA A;  4XDD A;  2E6X A;  4XE0 A;  1SE3 A;  5BMI A;  2W55 A;  2LGI A;  4KX6 B;  1I4H A;  2ICI A;  2IGH A;  2PVG C;  5AUK A;  2J52 A;  5BMH A;  2DLB A;  1KH0 A;  1YMH E;  2DWQ A;  4R3D A;  1IUE A;  2K0P A;  1C4P A;  1UUP A;  4XWW A;  3VR9 B;  1CZP A;  2AX5 A;  3PZ7 A;  2X38 A;  4ZRP A;  1C79 A;  2IPK D;  3EA6 A;  4JWS C;  5GXG B;  3W2D A;  1JRO A;  1XF5 L;  1N5W A;  1VZ7 A;  2K5P A;  2W3R A;  1HZ5 A;  4GDL B;  4LK0 M;  1TZO A;  3V05 A;  5D3I B;  1HZ6 A;  2MJ3 A;  2QSD A;  1CJE A;  1L0X B;  1IBX A;  5HFY A;  5AUI A;  3LYY A;  1HA5 A;  1TS2 A;  1ZE3 D;  3VQI A;  5FR3 A;  1TYG B;  4TQ1 A;  3I57 A;  1SE2 A;  3LB8 C;  4WWM A;  3AN1 A;  3H8H A;  2MJD A;  3R2I A;  3R2T A;  2W82 A;  4A8X C;  1IBX B;  4ZRQ A;  1YQ3 B;  4KGT A;  2B76 B;  3RFZ B;  2KDM A;  4RCO A;  3SEB A;  5E6J A;  1KLU D;  4L23 A;  2RPV A;  1PUT A;  3W1S A;  2JYT A;  1JWS D;  1ACC A;  1VJK A;  1RM6 C;  2WXG A;  4YTM B;  2N0S B;  3MJ5 A;  2E3T A;  4US8 A;  2PIA A;  4ZHP A;  2WXJ A;  3U4E G;  4B0E A;  1FEH A;  1PGB A;  3AE3 B;  3W5U B;  4LTU A;  1I4R A;  2KQ4 X;  2Y5C A;  1STE A;  1YN5 A;  1ZDV A;  1KRH A;  1E10 A;  1VZ6 A;  3LXF A;  1GAQ B;  1VZ8 A;  3BZD B;  1GB1 A;  3AEE B;  3AE7 B;  1TY0 A;  1ZP0 B;  3VR8 B;  4C56 C;  1BXT A;  2PTL A;  1L5P A;  1QKZ A;  1TKG A;  2KMM A;  3B2G A;  4OZC A;  2KWD A;  3TEX A;  1WYG A;  1PFD A;  4KGR A;  4FXC A;  4YT0 B;  1K52 A;  3AM9 A;  3P1M A;  1E0Z A;  2ZW1 A;  1ZXH A;  1MHX A;  4EE2 A;  2GB1 A;  3Q69 A;  1PYW D;  3P4Q B;  1ZDX A;  1XEE A;  2RMM A;  3U52 E;  1DOY A;  2MEK A;  1RYJ A;  1M4V A;  1PDX A;  1FM0 D;  2ONQ A;  2WDQ B;  2PMV A;  4WQM A;  1P7F A;  3AEF B;  2K9X A;  1I4G A;  1MI0 A;  3HVD A;  3CWI A;  2LMC A;  2N9L A;  1NYQ A;  2PKO A;  2M0A A;  1RWS A;  3ZJV A;  2V0G A;  2WDV B;  5H92 C;  2INN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...