3U7ZA

Crystal structure of a putative metal binding protein rumgna_00854 (zp_02040092.1) from ruminococcus gnavus atcc 29149 at 1.30 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
GEKHITVTVIHGDQTENVFEFDTDAKYLGEVLESENLVDGESGEYGLFITTVDEETADDSKQQWWCITKGGEQVNTSADQTPVSDGDAFELTLKEGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative metal binding protein RUMGNA_00854 (ZP_02040092.1) from Ruminococcus gnavus ATCC 29149 at 1.30 A resolution
rcsb
molecule keywords putative metal binding protein RUMGNA_00854
molecule tags Metal binding protein
source organism Ruminococcus gnavus
total genus 27
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3u7zA00
2BBCA 4KKIA 2BB5A 4ZRPA 3KQ4A 4KKJA 2BB6A 2V3PA 4ZRQA 3U7ZA 2PMVA 2V3NA
chains in the Genus database with same CATH superfamily
1EUVB 1XCQL 3H8HA 3ETRA 3V6CB 4M0WB 1WGDA 3AEDB 2L83A 5FR3A 3VUXA 3KW5B 3JSVB 4HJKA 2KVRA 2DZIA 2JU6X 2ZW0A 1XXGA 4FBJB 2O6VB 2IZVB 1WGGA 3VHTC 4B6WA 1VZ7A 1FCLA 1WFYA 3PHWB 2KTFA 3KWVA 4AS1A 3T3OA 4DWFA 3L54A 1E9MA 3VDZA 1GUAB 2KACA 4Q2JA 4GU2A 3NVWA 1SF0A 1P7EA 3IAS1 1T0SC 4AQ7A 1Y56A 3V62A 1J7CA 2WYQA 4FJVB 5LXIB 3ZVVA 2IO3B 5BMHA 2AL6A 4HROA 2BGFA 2WQYB 4JX1C 4NJCA 5AZFA 2KDMA 4KIKA 1MFWA 2MA9B 3AECB 4W9LA 1E90A 1WGKA 1K50A 1UGJA 1Q1OA 4BKSA 5JHBA 1Q5WB 2JRIB 1L0VB 3PV1A 1WY8A 2GRIA 3PVLA 1YJ1A 5E6OA 4KIKB 4BFRA 2KQSA 1KLUD 2VRRB 1I4GA 3SHQA 3B2GA 4MM3B 1TBEA 2J52A 4I6NB 2HJ1A 5IKCM 5C3JB 4W9CA 3UF8A 2CU1A 2FBWB 5EE3A 1E6EB 1L7YA 2LI5A 5J2RA 2BPSA 3HM6X 1F2RC 1GC7A 4DQOC 3AE7B 3WAMA 1E7UA 2N7JA 1V9JA 2BB6A 1V81A 2L00B 4AP4C 2G4DB 2DZJA 2PVOD 5IO9A 4XZ4A 4ZRQA 1K8RB 4MSMB 2LFIA 3AEEB 3W9CB 2MW5A 1BUIC 3GB1A 2HTME 4EE2A 1WM2A 2BKRB 3A4SC 2GBKA 4OVZA 5I4DA 2HTHA 4LK0M 2JPHA 3IG3A 3Q14C 4ZRJA 1UBQA 2M0XA 4YWGG 1RRBA 2OJRA 1PQSA 1R4NI 4WWMA 2B3AA 2BKFA 2KX3A 1NYQA 4IG7B 4LTUA 2HDEA 4RMAA 3Q8AA 2DAFA 2K9XA 2KDFB 5DPSA 3RUIB 4US8A 2MBQA 2KMMA 1F77A 4XYCA 1D3ZA 1WZ3A 2KK8A 2W3SA 4M00A 2JF5A 3EGRA 3UIOB 3V6EB 2KLGA 1WX7A 2D3BA 2MBHA 3RD2A 2AEHA 5EDSA 2KNBA 1UGMA 4GB9A 4M8NA 5CX3A 2WDVB 3VH4B 1HTQA 3U2SC 3A9KB 4AUQC 2RPVA 5TR5A 4TUUA 1B1ZA 3EC8A 2LWPA 2OOBB 3BVMA 5HG2A 1C78A 2BYTA 2UYZB 1J19A 4GGQA 3ZJUA 3VH3B 2WXQA 4P16A 5C23A 3C0RB 4XWTA 2TSSA 2JXXA 4FADA 3MP9A 1GAQB 4WAAA 1ZPSA 3OAWA 2WXJA 2K8BA 2A4ZA 4RNAA 5AZGA 3OJ3A 1YX6B 2AQ3B 4XGAB 4F8CB 4H2AA 3ZJTA 3ZXRA 5BYSA 2JRHA 1I42A 3N32A 1RAXA 1SJHD 4OZBA 1SJED 1XQQA 1PUTA 2LASA 3T9LA 2KT7A 4MT5A 1OTRB 3R8BA 1Z2MA 1QQRA 2MBEA 4YTPB 4YTNB 3ML8A 1RFKA 3DVNU 2LRUA 1GPXA 2PJHA 3L13A 2QC8A 1JWAD 2JX5A 3U52E 2J42A 2MBOA 1TKEA 3K9OB 4S17A 2LHDA 4RF0A 3Q6BA 2L05A 2X38A 1OGWA 2LRWA 3ZW3A 4C4VA 2WDQB 2BF8B 4NY0A 4RM9A 2NBUA 4JL9A 5H8YE 1J7BA 2NVUI 3L4PA 1EWCA 1STEA 3P63A 1L0YB 4W9HA 3D32A 3DBHI 2WU2B 4ANVA 3HRDD 1YN3A 2RR9A 2IDYA 2SEBD 2MJEA 3MJ5A 2M4NA 4RFBA 4CQNA 4DHZE 4FA6A 5G55A 2IGHA 3O13A 2KAJA 4C4VB 4W9FA 1SSNA 4A6QA 4FJYA 1FEHA 1UELA 2EMSA 2KJRA 3CIRB 2KQ7A 3I9V1 2CHWA 1V2YA 2KWUB 3SEBA 4KZCA 2DX5B 1C77A 2L3ZA 2N7EA 1UUPA 2KN5A 3RNFC 3KVFB 2W82A 1XT9B 3BYYB 4REZA 3KLSX 2K5PA 2W55A 2PPHA 3SDLC 1HTOA 1CJEA 4BVUC 2V3PA 3DBRB 1WR1A 3AV8A 3KUDB 2Y5PA 2JT4B 5HKHA 2L0TA 5BMIA 1L0XB 4YXDB 3NVZA 5LNK1 2WXLA 2BWFA 2K39A 2IO1B 3BK1A 3UQBA 5C2TB 4HDOA 2JUOA 2KC1A 2M1MA 3BINA 4BAXA 4XDCA 2N1VA 1TJEA 2V3NA 3APFA 1Z5SB 2MJ3A 2PEAA 4IW0A 2H88B 3AULA 2DWQA 1FD6A 2KXJA 3Q3NC 4IOIE 4WIPA 3VR8B 1DOYA 3AE8B 5AEKB 1GB1A 2K1FA 1IPGA 3AI5A 1AN8A 1ZGUB 1ET9A 2XBBC 2MP2A 4K81A 3Q2AC 5LXHA 1FNWA 2NS5A 1N6ZA 3OG5A 4WWPA 4A9AA 4C56C 1WXVA 4EFOA 3OWEB 2FCQA 4HDQA 4PT5A 3T3NA 2C60A 3QARA 4ZYNA 4ZHOA 2BVCA 2YEPB 2WXIA 5HFYA 1C9FA 1NYRA 1N61A 3PLUA 2MP2B 4NNJB 1KLGD 1T5XD 2QCZA 3DHIC 3PPAA 1YQ4B 1N62A 4YTMB 2ICIA 1AW7A 2FUG1 2VH2A 3DVGY 1GJZA 3VTVA 4UDUC 1GG3A 2JWZA 4G3XB 1L6VA 2VZKB 5IAAC 1C4PA 1JQ4A 3DBLI 2KYWA 4NAMA 4ICUA 3DWGC 3A33B 3NG0A 3DPDA 4KDIC 3TL5A 4CO7A 3MHZA 4ZDVA 4ITKA 1R4MI 3H6NA 1N63A 2ZNVC 2FCMA 1ZOYB 3IT6B 2N7DA 2BYVE 4RGMA 1V1PA 4M02A 3HVZA 1ZDVA 3N30A 1LO5D 3VUYA 1WE6A 3NZ3A 5FK9C 4TQ0A 3Q8CA 4FN2A 2JQRB 3N1XC 1WJNA 2JWUA 5JH5C 3NS8A 2FNJB 2QMTA 4GSWA 1FFVA 2D5GA 3RULA 1V1PB 1EU4A 3IBEA 3R66C 4B0EA 1HEZE 1JROA 2MH7A 4DHZB 4IWPA 2C5LC 4GDLA 3QHTA 4W9IA 5FKAC 2N1WA 3WANA 2V1YA 4WJOA 3TEWA 2BYEA 2DNFA 3L17A 3RNAC 1N5XA 2ZPYA 2CR5A 1YN5A 2UWQA 1WXAA 3JSVA 4XDDA 2NTSA 2LZ6A 1R4NB 2M56B 3N20C 1WMHA 4GDLB 1XLNA 3V3XA 3P4RB 3VUWA 3DCGA 1JWMD 2PVGC 1FCCC 4JWSC 2RSUA 2WXFA 1UZXB 4KV2A 3JYUA 3SD5A 3WAPA 1ROEA 1WZ0A 4LNIA 4LLGM 4N9F4 3NOBA 2VZKD 1WJ4A 4NJ7A 3ZNID 3LDZE 4TKNA 1WMHB 3PSEB 1NVID 4HPMB 3ZRFA 2LVQA 1IYFA 3IFWB 2O2VA 5T8IA 3CSFA 5JZEB 3WCQA 3GS2A 4K7WA 3KYCD 4P1BC 2PKOA 3TSSA 4BOSC 1LQBA 2ZCCA 2FCSA 3ZRCA 2J7QB 1PGAA 1IBXA 2G9HD 2Z0DB 4OW0A 3CSTA 4L1BA 1NI2A 2L7RA 1QOGA 2D3CA 4FLHA 2GI9A 3RT3B 2WGSA 3UGBB 4RH6A 5GMVA 2O2VB 4J6IA 2WDTB 4BKGA 1M94A 2KDIA 3IVFA 1YNTE 1S3SG 2IO2B 5GXGB 3LYYA 4MM3A 2ZNVB 2M8SA 1IBXB 3AXCA 4N59A 1YD8U 2WXNA 3A9JA 2WXMA 1UH6A 4JGHB 2MBBB 4K3CA 3W2DA 2WXGA 1FXIA 3SR6A 1V5OA 3RMKC 4K7UA 3NRZA 1T0RC 3JW0X 3RNCC 2KWDA 2AL3A 1WXQA 3H7PA 4MSQB 4F7ZA 1P98A 1TKYA 2GB1A 3E9SA 2DYOA 2SAKA 2GBRA 1RLFA 2FUHB 3EUB2 4ZRPA 2G1EA 3A9JB 3OLMD 2KTRA 3MC9A 2BYFA 3Q3OC 2N0SB 3IXSA 3MTNB 2PE6B 2L52A 4BOZB 2WLBA 1KRHA 2JYEA 2QEJC 3ZIMA 2BBCA 2CU3A 1TT5B 2DHZA 4YSXB 4WQOB 2DBYA 4XX5A 3TUOA 4C7ZA 2KKCA 4ZHPA 3H7PB 4LDTB 4JE3B 4P7IA 4GIVA 1MVKA 3BVGA 1FFUA 2ZW1A 1T0YA 2O6VD 2KTRB 3RNGC 2MLBA 4MGKE 4AJWA 5DPWA 2RD0A 3AE1B 1ISNA 4O1NA 5JXVA 2K22A 2IGDA 3W5VB 1VZ6A 2AYOB 3GOEA 3FAHA 2FIDA 1JCKB 2K8CA 1OEYA 1IGDA 1CK1A 2N9KA 2QHOA 2MQJA 4LNNA 1WR6E 4ZOHC 3ENEA 3ZJVA 4K7SA 1VRAB 3A9KA 3UI3A 2FCNA 2JSVX 2M17A 3EFCA 2LUEA 2KLCA 4G0NB 3VQIA 4P6VF 1HZ5A 1ZDXA 3TIXA 3QC8B 2LVOA 1DOXA 4KKJA 1I4XA 3N9YC 1XD3B 1NENB 4R3DA 1QKZA 1F1HA 5EE1A 1LGRA 3P1MA 3U7DA 4ARCA 4B95A 2KN4A 1NBFC 1B9RA 2RDHA 5IN7A 3VVWB 4W9KA 1VCBA 1SGHA 4KSKC 4W9EA 5BMGA 3UINB 5D94A 1TZOA 2LMCA 4JPSA 4ARIA 1VJKA 3PTFC 2QIEB 4II3B 2A5UA 5CHVC 5CTRC 1TYGB 2Y5CA 2R2QA 3EECA 3ZLZA 4BBNC 2H89B 4MGZE 2NBWB 2XNAC 4BZAA 2C7NB 1NEKB 3J9CA 4BKSD 1QOBA 1MG8A 4HJGE 4MH8A 4JWUC 2MEKA 3BY4B 4RGNA 2VH1A 4WQMA 4IM2A 2YVCA 3ZNGC 4WJQA 3WALA 1SEBD 2V3SA 2G3QB 1LXDA 2M19A 3BYTB 3GE3C 2DLBA 1GNUA 3BK2A 2PE9A 3RFZB 3C19A 2HD5B 2GBJA 2ZPNA 4LCDE 3B0AA 3VTWA 1LFDA 4BBNF 2BWES 3PHXB 2WXOA 3R2TA 1KF6B 3DBLB 1QLBB 1ZXIA 3H9DA 2B76B 4ZRIA 3BVZA 1K53A 4TQ1A 4WURA 3FKYA 1J0GA 2E3TA 2EELA 4I6LB 2XEWA 3RNEC 1R4MB 1UWXA 5HHDG 2WS3B 4HPPA 2NBVB 4E74A 3CWIA 1CMXB 1QT9A 1FXAA 1PDXA 4LNKA 3R3MA 3W5UB 2ACZB 2BS2B 3DDCB 3DHGC 4DHJB 1TS5A 3W1SC 4AJYB 1V6EA 2KVZA 2YLMA 3T8MA 1EM7A 4USAA 4C7YA 3TMPB 2ZCBA 2IGGA 2IYDB 4C00A 3Q8FA 2QSDA 4LJOB 1V97A 1V8CA 1QOFA 2L8JA 1JWUD 1C76A 1V80A 4HVBA 2ZZPB 3LJ3A 1FO4A 1WSPA 1TTNA 1WJ6A 4BKTA 2N9LA 2BB5A 2CJNA 4FHKA 3AM9A 3ZO5B 3TBLD 1H4RA 4D2KA 2N9EB 2KHWB 4WWOA 1WGRA 4LNFA 1G6JA 2W54A 4OVUA 3P2BA 4HK2A 3APDA 3ABVB 1XLOA 4GLSC 1KOTA 3AU5A 1ZW7A 3L0WB 3SFDB 1HA5A 2KO3A 3NHEB 1XCTL 4IWOA 3HIZA 4A3PA 4MH0E 4W9DA 1E8XA 3FC4A 4KVGB 3L08A 1ZE3D 2PMVA 1D5ZC 3MC0B 1L4DB 4FULA 1CQVA 2DZMA 3VRAB 2WU5B 2IY0B 3NY5A 4J3OD 1BMLC 2ZJDA 2IBIB 1GOZA 2L0FA 1ZKHA 2FIFA 1MI0A 3A4RA 4ANWA 2LEKA 2PLPA 3P4PB 4XE0A 5D2MB 5HI1A 3EA6A 3AEAB 3VFKA 1KLVA 3O65B 3DVGX 2HJ8A 5KHQA 4W9JA 3AEFB 4DXAB 2NTTA 1JRPA 1T0QC 2R61A 3I57A 1EWYC 1FMAD 4PYZA 2V9HA 1BXTA 2MHJA 3TJPA 3HVDA 1SBBB 1S1QB 1P1AA 3ZKJC 5J17A 1VD2A 3PLVA 1WRDB 2CS4A 1GB4A 3URYA 2FE8A 3PREA 1SIJA 4E3CA 2N9PC 2INPE 3VR9B 1SIFA 1JWSD 3ZXVA 1EF1A 1YOVB 4GXBA 4JQWC 1XO3A 2KWCA 3Q3JA 4URKA 2D10A 1VDVA 3Q8BA 3QK0A 2IJ0A 3RNBC 4K1RB 4A20A 2DAJA 4CYEA 1DGJA 4KSLC 2OHFA 1DYQA 3U7ZA 1JALA 4MJSA 1X1MA 2Q5WD 1C1YB 1RWSA 2NCNA 5AUIA 4MGIE 1FRRA 1A5RA 2ZVOA 1KJTA 4DDID 2KD0A 2C7MB 1TS4A 3MJWA 1E0ZA 2CJOA 3PT2B 3DOWA 2G45B 1RFAA 2LGXA 4TMAB 5G5HA 2C9WB 1ZUD2 2XN9C 2MJDA 5D6JB 3RI7C 1N5WA 2ZVNA 2BT6A 1VLBA 4IM0A 1Y8RC 5D3DA 1L5PA 4MJSB 2LGYA 1E7PB 2DZKA 4LJPB 4A55A 1PGBA 5BYQA 5AZHA 1FPYA 1KTKA 3B08A 4WJNA 4WJPA 1XLPA 3B1LX 1JWBD 3ZDTA 2L76A 2GMIC 2KANA 2Z8LA 1FM0D 1P0RA 4XC2A 1ZP0B 1HXYD 3L16A 2LD9A 2KJ6A 1SE4A 1QF6A 2K8HA 4HWIB 1YX5B 1WH3A 3DQVA 4G50A 3RPFC 4A8XC 5E6NA 1AYFA 4E71A 2GBNA 1OEYJ 3KUZA 1XF5L 2MSED 3ZNHB 3RCZA 3NVYA 4II2B 4FXCA 2K6QA 2KOXA 2I1JA 5EE9A 4RF1A 1BT0A 2J0JA 2MRPA 4RCOA 3AH7A 2QDFA 2BS3B 4IDIA 4RGOS 2K0PA 4K3BA 3PZ8A 4L2YA 2AWTA 2GBMA 2M0AA 4I6PA 1UD7A 1TS3A 3JVZX 3ZUNA 1SXTA 3AEGB 3AMZA 5IOIA 1D4BA 4HPLB 1LM8B 2LUMA 3BZDB 1TZ1A 1OQYA 4CHKA 2D2QA 5BYRA 4FHJA 3QIJA 4IWQA 2BTEA 4HCNB 4KGTA 2WP9B 4M01A 3WIMA 1D6EC 2WXHA 1C3TA 4GDKA 3PRZA 1EU3A 5JHAA 1WIAA 2IPKD 3DVNV 4G11A 4JIOU 4M8MA 1WJUA 1MHHE 2LXCA 3Q8EA 4PS7A 1MPEA 2WXRA 4NQLB 1PGXA 1JW9D 2KZRA 2LGIA 3R7QA 4GDKB 2I38A 5CHFA 4HKQA 4OZAA 2KMAA 4OHJA 3APCA 1MHXA 2N4FA 2X8XX 1EO6A 4EUTA 4KDLB 1IGCA 3U4EG 3M95A 3MHSD 2JVCA 4L23A 3RYTA 3B2FA 1JRUA 2G4SA 3NS1A 5FR6A 4ICVA 2WHIA 3U30A 3ECIA 2ASQA 2KWVB 3DBHB 2BW2A 2V4LA 2LGSA 3GZNI 4AWJA 2WXKA 4IC7B 3A1QA 1WXSA 3AU4A 3PZDA 1TIFA 2W9NA 2JY6A 1I4HA 2N9XA 2J4XA 3PGEA 2RDBC 5L83A 5EE0A 3MFGA 4HCPB 4MDKE 4AOFA 3HUIA 2K6DB 5G5GA 1IP9A 4US9A 2WX0A 2INDC 3LXFA 3I3TB 3H1UA 3UIPB 3W1YA 4MEMA 5J18A 3A1QB 2RDGA 2KFJA 3WA0A 4B0MA 4KGRA 1VZ8A 1WGHA 2REXA 2QJLA 2ONQA 4ZRKA 1MJDA 2KX0A 1WWTA 4ANXA 3PO0A 4ANUA 3LB8C 3UQAA 3ZTDA 2J53A 1J8CA 4F1SA 1YQBA 1SE2A 2PTLA 3P42A 3N3KB 3TEXA 2JYTA 2D07B 3RN9C 1T3QA 1L6UA 3VRBB 4DXGA 3IHPC 3KH0A 4EKUA 3MC8A 1Q0WB 2Y3AA 2OJWA 1I4QA 2RPQA 1VR9A 2KQ4X 2NR2A 4YSZB 5AUKA 3ZNZB 3N1YC 1HZ6A 1A70A 4DDGD 3DBSA 5BO4B 1N60A 4IUMB 3V05A 2K25A 1RYJA 3N1ZC 3DHHC 3KUCB 1WE7A 3QA8A 1F0ZA 1WRIA 3AE4B 3H7SA 4RM8A 4DXFA 4A3OA 2EMTA 3VTUA 2JZPA 5D7GA 1CZPA 2NPTA 2Y5BB 1P3QU 4MELA 1PFDA 1I4PA 2UU7A 3NJTA 4TV3A 2WNMA 4KZ0A 2KFKA 1WXMA 2V0GA 1E8WA 3AN1A 4EZJA 3GP7A 3X23A 4LDTD 1UWMA 5DCNA 2BQQA 2XK5A 4FJZA 3X0WA 4MACA 1QILA 1F9JA 1WF9A 3PS6A 2ON8A 2NPTB 1T6BX 1L2NA 4A90A 1YMHE 3B9JA 4EZKA 2KC2A 4N6EB 3AE2B 2CKHB 2WXPA 1XLQA 5E6JA 2KFKB 4XWWA 5E6PA 3KYDD 1V86A 4B9KA 1XEEA 4IM3A 1L4ZB 2Z0EB 3FILA 4GMVA 1DOIA 1K52A 2EKIA 3AB5A 1SB3C 2XK5B 3CMMB 3WAOA 2JZZA 2J0MA 2WWZA 1V49A 3KQ4A 4NZLB 2CHZA 3Q3MC 3ML9A 5C1ZA 4NAWA 2MWSB 1V1OA 3FILB 4NJ6A 2HE7A 5TSSA 1ZXHA 3M3JA 4WWNA 2ZEQA 5IA7A 1ET6A 3NVVA 1KFYB 1QZEA 3NZSA 1FNVA 2YEPF 2J0KA 3NUHB 1NI3A 2BS4B 3IT4B 4NAWB 3TEYA 2LHEA 2LVPA 3VXWA 1AWDA 2GOWA 1TY0A 2MCNB 3PRPB 1YN4A 1FIQA 1I4RA 4HXDA 3AE5B 2LJIA 2QILA 4N58A 2KDEB 2KDBA 2L1AA 1MG4A 3ALBA 3AE9B 3K9PB 1TY2A 3HM3A 2DYMA 5H92C 3VAWA 1EF5A 4KGSA 1D5XC 1OQQA 4LNOA 5G2NA 1KM7A 3QX1A 1UNSA 2Z59B 5DPRA 1TS2A 1SE9A 2R2OA 3RZFA 3ZDMC 1OFFA 1C4AA 4HLEA 1OQRA 3QQ8B 3HHMA 1HQRD 1WX8A 4RGTA 3EHVA 1YQ3B 2V4IB 3Q69A 1PYWD 3NZUA 2E6XA 1FNUA 3S2AA 2INNE 5DPTA 3BWUD 4HRSA 1E8YA 1J7AA 3ZYYX 1GC6A 3BIID 1ESFA 2K3UA 3I63C 3GE8C 1WYWB 4DK5A 3SFEB 2OEDA 4PYUA 2L32A 2C7HA 3Q3FA 2JXTA 4EZLA 4DHJD 1UBIA 1YJIA 2IO0B 2LXAA 3W1SA 1RM6C 2D3AA 1FRDA 1JMLA 3L10B 2DYBA 1WI0A 2LGDA 3R2IA 1WX9A 2LJ5A 4TSSA 1C79A 1I35A 4WAFA 4YT0B 1I7HA 3QCAA 3SU8X 3QJZA 2PW9A 2RMMA 5D3IB 1H8CA 1K51A 1IUEA 1TGZB 4WH4A 1F2RI 1UF0A 1V5TA 3M62B 4PS8A 3V60A 4HKZE 2KMCA 2JZ3B 3ONSA 4S0RA 4X57B 3KWLA 3TCAA 3OJ4B 1HE8A 2W3RA 3HK0A 2KJHB 4W9GA 1FXTB 1TKGA 3ZTCA 1NDDA 3I5JC 4EEWA 1M4VA 2NMQA 1WM3A 2I2YA 3PRMB 2CHXA 1ACCA 2D3GA 3QWZB 4HEA1 3AE6B 2I1KA 3IAM1 4GOCA 5KHOA 2WDRB 3RZWC 1WGYA 4ZYSA 1E10A 2GLSA 2D11A 1Q10A 1E7VA 4P1CC 4MGYE 4YL8A 5L95C 4PK1A 3GZNB 4OVVA 1E5WA 4QAYA 4ACFA 5CHWA 4PS3A 1P9DU 3R7RA 4JLCA 4OZCA 3E56A 3P4SB 1SE3A 2FAZA 2IY1B 4NQKE 1U4AA 4KX6B 1YIWA 3AE3B 5LLIA 3TEZA 2MX2A 3C8YA 2PIAA 4C80A 4ASWC 2AX5A 2AQ2B 3M63B 3AEBB 3U8ZA 1C4CA 3P4QB 1ENFA 3DBRI 4NPNA 4DBGA 3ZQ4A 4EOYA 5IP4D 3EFUA 5MPOA 3CF6E 4M0WA 1QOAA 1AARA 2AQ1B 1P7FA 3V61A 1WYGA 2EKEC 1F52A 1R7SA 1E8ZA 2INCC 4KKIA 1YJJA 4YSYB 2RGFA 3DWMA 3ZGZA 2O6VA 1KH0A 1D5MC 3QAQA 2DENB 4IKGA 4GN1A 3PZ7A 2WX1A
chains in the Genus database with same CATH topology
1NYRA 1N61A 3BVZA 1K53A 4TQ1A 4WURA 1XCQL 2E3TA 3H8HA 2EELA 3ETRA 1KLGD 1T5XD 2RDGA 4B0MA 3AEDB 2L83A 1YQ4B 1UWXA 5FR3A 4KGRA 1N62A 4YTMB 5HHDG 2WS3B 1VZ8A 2ICIA 1AW7A 2JU6X 2FUG1 2QJLA 2ONQA 3CWIA 1QT9A 1FXAA 2ZW0A 1XXGA 1WWTA 1PDXA 3PO0A 3LB8C 2J53A 4UDUC 3W5UB 2ACZB 1L6VA 1VZ7A 2BS2B 2VZKB 1C4PA 1FCLA 1SE2A 1TS5A 2PTLA 3P42A 3KWVA 3TEXA 1JQ4A 4AS1A 2JYTA 3T3OA 1E9MA 4NAMA 2KACA 1EM7A 4Q2JA 3DWGC 1T3QA 4USAA 4C7YA 1L6UA 3NVWA 3VRBB 1SF0A 4DXGA 2IGGA 1P7EA 3MHZA 3IAS1 4ITKA 4AQ7A 1Y56A 3Q8FA 1N63A 1J7CA 2QSDA 1V97A 1V8CA 2Y3AA 1QOFA 1ZOYB 3IT6B 5BMHA 1JWUD 1I4QA 1C76A 1VR9A 2KQ4X 1V1PA 4RGMA 4YSZB 5AUKA 4HROA 2WQYB 4JX1C 1FO4A 3HVZA 4NJCA 1ZDVA 2KDMA 1WSPA 1LO5D 1HZ6A 1A70A 3NZ3A 5FK9C 2N9LA 2BB5A 2CJNA 3Q8CA 1N60A 4TQ0A 3AM9A 3AECB 3V05A 2JQRB 1RYJA 4D2KA 1F0ZA 2JWUA 1WRIA 1WGKA 1K50A 2W54A 3AE4B 1UGJA 4DXFA 2QMTA 3ABVB 1XLOA 4GLSC 1FFVA 2D5GA 3SFDB 1L0VB 1HA5A 2JZPA 5D7GA 1XCTL 1CZPA 1V1PB 1EU4A 4B0EA 1HEZE 1JROA 2MH7A 2GRIA 3FC4A 1PFDA 1I4PA 2WNMA 1KLUD 1ZE3D 2PMVA 2V0GA 3AN1A 1D5ZC 3MC0B 1I4GA 1L4DB 3B2GA 3GP7A 4MM3B 5FKAC 1CQVA 3VRAB 2WU5B 1UWMA 3TEWA 2J52A 4J3OD 1BMLC 1N5XA 5C3JB 1GOZA 2FBWB 1YN5A 4MACA 5EE3A 1E6EB 1QILA 1MI0A 2ON8A 1T6BX 1F2RC 2LEKA 1YMHE 3B9JA 4XDDA 2NTSA 4A90A 2PLPA 3P4PB 4XE0A 4DQOC 4N6EB 3AE2B 3AE7B 2WXPA 1XLQA 2M56B 5E6JA 2N7JA 5HI1A 3EA6A 4XWWA 3AEAB 4GDLB 1XLNA 2BB6A 1XEEA 3V3XA 1L4ZB 3P4RB 1JWMD 3FILA 2PVOD 1DOIA 2PVGC 3AEFB 1FCCC 1K52A 4ZRQA 4JWSC 2EKIA 3AB5A 2NTTA 2WXFA 1JRPA 1SB3C 2LFIA 3AEEB 3W9CB 1BUIC 3GB1A 2HTME 4EE2A 2R61A 3I57A 1EWYC 1FMAD 1BXTA 1ROEA 3KQ4A 4LLGM 4OVZA 3HVDA 1SBBB 4NZLB 5I4DA 2VZKD 4LK0M 1GB4A 3URYA 1NVID 2FE8A 1V1OA 4YWGG 4WWMA 3FILB 5T8IA 1SIJA 5TSSA 3WCQA 1ZXHA 2INPE 1NYQA 3VR9B 3GS2A 1JWSD 4LTUA 1XO3A 2HDEA 2PKOA 3TSSA 3Q8AA 2K9XA 4US8A 1ET6A 2KMMA 3NVVA 1F77A 1KFYB 1PGAA 1IBXA 2G9HD 4OW0A 4L1BA 1FNVA 1VDVA 3Q8BA 1QOGA 2YEPF 3NUHB 2W3SA 1NI3A 2IJ0A 2BS4B 3IT4B 2GI9A 4NAWB 3EGRA 3TEYA 2LHEA 4RH6A 1DGJA 1AWDA 2OHFA 1TY0A 1DYQA 3U7ZA 1JALA 2Q5WD 1RWSA 2WDVB 1YNTE 1YN4A 5AUIA 5GXGB 1FIQA 1FRRA 1I4RA 3LYYA 3AE5B 3U2SC 2LJIA 2RPVA 2QILA 1IBXB 4N58A 1TS4A 1E0ZA 1B1ZA 4N59A 2CJOA 2L1AA 3BVMA 5HG2A 2WXNA 1C78A 2BYTA 3AE9B 4TMAB 5G5HA 2WXMA 1TY2A 1ZUD2 2XN9C 2MJDA 3ZJUA 2WXQA 4P16A 1N5WA 2BT6A 1VLBA 3W2DA 4XWTA 2WXGA 2TSSA 1FXIA 5D3DA 3SR6A 3MP9A 1L5PA 1GAQB 3NRZA 2DYMA 1ZPSA 1E7PB 5H92C 2KWDA 2WXJA 4KGSA 4RNAA 4A55A 1D5XC 1WXQA 1PGBA 1OQQA 5BYQA 1KTKA 2AQ3B 1XLPA 1TKYA 2GB1A 1UNSA 2DYOA 3E9SA 2SAKA 4H2AA 3ZJTA 1JWBD 5BYSA 1TS2A 3EUB2 1SJHD 4ZRPA 2G1EA 4OZBA 1SJED 1OFFA 1C4AA 1PUTA 1OQRA 2Z8LA 1FM0D 2N0SB 3IXSA 1HQRD 4RGTA 2L52A 2WLBA 1KRHA 1HXYD 1ZP0B 2JYEA 1YQ3B 2QEJC 2V4IB 3Q69A 1PYWD 1SE4A 2BBCA 4MT5A 1QF6A 3R8BA 2E6XA 2CU3A 1FNUA 4YSXB 2DBYA 1QQRA 2INNE 4YTPB 4YTNB 3TUOA 4C7ZA 1RFKA 4ZHPA 1GPXA 3BWUD 4HRSA 3RPFC 1JWAD 4JE3B 4A8XC 2JX5A 3U52E 1AYFA 1J7AA 2J42A 3ZYYX 1MVKA 3BIID 3BVGA 1C9FA 1ESFA 1FFUA 2K3UA 1XF5L 1TKEA 2ZW1A 2LHDA 4RF0A 3NVYA 3SFEB 2OEDA 4FXCA 2L32A 2X38A 5EE9A 4RF1A 3AE1B 2JXTA 4O1NA 5JXVA 2K22A 2WDQB 4RCOA 3AH7A 2BS3B 2IGDA 4IDIA 4RGOS 3W5VB 1YJIA 1VZ6A 2K0PA 3PZ8A 3W1SA 4L2YA 1RM6C 5H8YE 3FAHA 1J7BA 2M0AA 1FRDA 1JMLA 1TS3A 1JCKB 1EWCA 1STEA 3L4PA 3P63A 3R2IA 1IGDA 1L0YB 1SXTA 1CK1A 3AEGB 2N9KA 2WU2B 4TSSA 3HRDD 1C79A 1YN3A 3AMZA 1D4BA 2IDYA 4WAFA 2SEBD 4ZOHC 4YT0B 1I7HA 2MJEA 3MJ5A 3ZJVA 1VRAB 4RFBA 4CQNA 2LUMA 2PW9A 2RMMA 5D3IB 3UI3A 2JSVX 1K51A 1IUEA 3BZDB 4WH4A 1F2RI 5BYRA 2IGHA 3O13A 2KAJA 3VQIA 4P6VF 1HZ5A 1ZDXA 4HKZE 2BTEA 1DOXA 1SSNA 4KKJA 4A6QA 1I4XA 3KWLA 3N9YC 1FEHA 4KGTA 2W3RA 1NENB 1TKGA 4R3DA 1QKZA 2WP9B 3CIRB 3I9V1 3SEBA 5EE1A 3P1MA 1D6EC 2WXHA 1C77A 1M4VA 1EU3A 2NMQA 4ARCA 1UUPA 2I2YA 2KN4A 2IPKD 1B9RA 1ACCA 2W82A 4HEA1 3AE6B 3BYYB 2RDHA 3IAM1 4REZA 3KLSX 2K5PA 2W55A 2WDRB 1CJEA 5BMGA 1MHHE 1TZOA 2V3PA 2LMCA 3Q8EA 1MPEA 4ZYSA 2WXRA 1E10A 3AV8A 2Y5PA 4JPSA 1PGXA 4ARIA 1VJKA 1JW9D 1Q10A 2QIEB 2LGIA 5BMIA 1L0XB 4YXDB 1TYGB 2Y5CA 4GDKB 2H89B 2I38A 2XNAC 3NVZA 5LNK1 2WXLA 1NEKB 3J9CA 4HKQA 3BK1A 1QOBA 4OZCA 3E56A 3P4SB 1SE3A 4HJGE 4OZAA 4MH8A 4OHJA 4JWUC 2MEKA 5C2TB 4KX6B 1MHXA 1IGCA 3U4EG 4XDCA 3AE3B 1TJEA 2V3NA 4RGNA 3TEZA 2MJ3A 4L23A 3B2FA 3C8YA 2H88B 1FD6A 2DWQA 2PIAA 3NS1A 4C80A 4WQMA 2AX5A 2AQ2B 3AEBB 1C4CA 3P4QB 4IOIE 1ENFA 4WIPA 3VR8B 1DOYA 1SEBD 3AE8B 1GB1A 3ZQ4A 1AN8A 1ET9A 2BW2A 2M19A 3BYTB 1FNWA 2WXKA 5MPOA 2DLBA 4M0WA 1QOAA 2AQ1B 3BK2A 3RFZB 1P7FA 4A9AA 4C56C 1I4HA 1WYGA 1R7SA 2J4XA 3OWEB 4KKIA 1YJJA 5EE0A 4PT5A 3MFGA 4YSYB 3T3NA 3DWMA 3ZGZA 4ZHOA 3HUIA 2WXOA 3R2TA 1KF6B 2YEPB 5G5GA 1KH0A 1D5MC 1QLBB 2WXIA 4IKGA 4US9A 1ZXIA 5HFYA 2B76B 3PZ7A 3LXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBC A;  4KKI A;  2BB5 A;  4ZRP A;  3KQ4 A;  4KKJ A;  2BB6 A;  2V3P A;  4ZRQ A;  3U7Z A;  2PMV A;  2V3N A; 
#chains in the Genus database with same CATH topology
 1EUV B;  1XCQ L;  3H8H A;  3ETR A;  3V6C B;  4M0W B;  1WGD A;  3AED B;  2L83 A;  5FR3 A;  3VUX A;  3KW5 B;  3JSV B;  4HJK A;  2KVR A;  2DZI A;  2JU6 X;  2ZW0 A;  1XXG A;  4FBJ B;  2O6V B;  2IZV B;  1WGG A;  3VHT C;  4B6W A;  1VZ7 A;  1FCL A;  1WFY A;  3PHW B;  2KTF A;  3KWV A;  4AS1 A;  3T3O A;  4DWF A;  3L54 A;  1E9M A;  3VDZ A;  1GUA B;  2KAC A;  4Q2J A;  4GU2 A;  3NVW A;  1SF0 A;  1P7E A;  3IAS 1;  1T0S C;  4AQ7 A;  1Y56 A;  3V62 A;  1J7C A;  2WYQ A;  4FJV B;  5LXI B;  3ZVV A;  2IO3 B;  5BMH A;  2AL6 A;  4HRO A;  2BGF A;  2WQY B;  4JX1 C;  4NJC A;  5AZF A;  2KDM A;  4KIK A;  1MFW A;  2MA9 B;  3AEC B;  4W9L A;  1E90 A;  1WGK A;  1K50 A;  1UGJ A;  1Q1O A;  4BKS A;  5JHB A;  1Q5W B;  2JRI B;  1L0V B;  3PV1 A;  1WY8 A;  2GRI A;  3PVL A;  1YJ1 A;  5E6O A;  4KIK B;  4BFR A;  2KQS A;  1KLU D;  2VRR B;  1I4G A;  3SHQ A;  3B2G A;  4MM3 B;  1TBE A;  2J52 A;  4I6N B;  2HJ1 A;  5IKC M;  5C3J B;  4W9C A;  3UF8 A;  2CU1 A;  2FBW B;  5EE3 A;  1E6E B;  1L7Y A;  2LI5 A;  5J2R A;  2BPS A;  3HM6 X;  1F2R C;  1GC7 A;  4DQO C;  3AE7 B;  3WAM A;  1E7U A;  2N7J A;  1V9J A;  2BB6 A;  1V81 A;  2L00 B;  4AP4 C;  2G4D B;  2DZJ A;  2PVO D;  5IO9 A;  4XZ4 A;  4ZRQ A;  1K8R B;  4MSM B;  2LFI A;  3AEE B;  3W9C B;  2MW5 A;  1BUI C;  3GB1 A;  2HTM E;  4EE2 A;  1WM2 A;  2BKR B;  3A4S C;  2GBK A;  4OVZ A;  5I4D A;  2HTH A;  4LK0 M;  2JPH A;  3IG3 A;  3Q14 C;  4ZRJ A;  1UBQ A;  2M0X A;  4YWG G;  1RRB A;  2OJR A;  1PQS A;  1R4N I;  4WWM A;  2B3A A;  2BKF A;  2KX3 A;  1NYQ A;  4IG7 B;  4LTU A;  2HDE A;  4RMA A;  3Q8A A;  2DAF A;  2K9X A;  2KDF B;  5DPS A;  3RUI B;  4US8 A;  2MBQ A;  2KMM A;  1F77 A;  4XYC A;  1D3Z A;  1WZ3 A;  2KK8 A;  2W3S A;  4M00 A;  2JF5 A;  3EGR A;  3UIO B;  3V6E B;  2KLG A;  1WX7 A;  2D3B A;  2MBH A;  3RD2 A;  2AEH A;  5EDS A;  2KNB A;  1UGM A;  4GB9 A;  4M8N A;  5CX3 A;  2WDV B;  3VH4 B;  1HTQ A;  3U2S C;  3A9K B;  4AUQ C;  2RPV A;  5TR5 A;  4TUU A;  1B1Z A;  3EC8 A;  2LWP A;  2OOB B;  3BVM A;  5HG2 A;  1C78 A;  2BYT A;  2UYZ B;  1J19 A;  4GGQ A;  3ZJU A;  3VH3 B;  2WXQ A;  4P16 A;  5C23 A;  3C0R B;  4XWT A;  2TSS A;  2JXX A;  4FAD A;  3MP9 A;  1GAQ B;  4WAA A;  1ZPS A;  3OAW A;  2WXJ A;  2K8B A;  2A4Z A;  4RNA A;  5AZG A;  3OJ3 A;  1YX6 B;  2AQ3 B;  4XGA B;  4F8C B;  4H2A A;  3ZJT A;  3ZXR A;  5BYS A;  2JRH A;  1I42 A;  3N32 A;  1RAX A;  1SJH D;  4OZB A;  1SJE D;  1XQQ A;  1PUT A;  2LAS A;  3T9L A;  2KT7 A;  4MT5 A;  1OTR B;  3R8B A;  1Z2M A;  1QQR A;  2MBE A;  4YTP B;  4YTN B;  3ML8 A;  1RFK A;  3DVN U;  2LRU A;  1GPX A;  2PJH A;  3L13 A;  2QC8 A;  1JWA D;  2JX5 A;  3U52 E;  2J42 A;  2MBO A;  1TKE A;  3K9O B;  4S17 A;  2LHD A;  4RF0 A;  3Q6B A;  2L05 A;  2X38 A;  1OGW A;  2LRW A;  3ZW3 A;  4C4V A;  2WDQ B;  2BF8 B;  4NY0 A;  4RM9 A;  2NBU A;  4JL9 A;  5H8Y E;  1J7B A;  2NVU I;  3L4P A;  1EWC A;  1STE A;  3P63 A;  1L0Y B;  4W9H A;  3D32 A;  3DBH I;  2WU2 B;  4ANV A;  3HRD D;  1YN3 A;  2RR9 A;  2IDY A;  2SEB D;  2MJE A;  3MJ5 A;  2M4N A;  4RFB A;  4CQN A;  4DHZ E;  4FA6 A;  5G55 A;  2IGH A;  3O13 A;  2KAJ A;  4C4V B;  4W9F A;  1SSN A;  4A6Q A;  4FJY A;  1FEH A;  1UEL A;  2EMS A;  2KJR A;  3CIR B;  2KQ7 A;  3I9V 1;  2CHW A;  1V2Y A;  2KWU B;  3SEB A;  4KZC A;  2DX5 B;  1C77 A;  2L3Z A;  2N7E A;  1UUP A;  2KN5 A;  3RNF C;  3KVF B;  2W82 A;  1XT9 B;  3BYY B;  4REZ A;  3KLS X;  2K5P A;  2W55 A;  2PPH A;  3SDL C;  1HTO A;  1CJE A;  4BVU C;  2V3P A;  3DBR B;  1WR1 A;  3AV8 A;  3KUD B;  2Y5P A;  2JT4 B;  5HKH A;  2L0T A;  5BMI A;  1L0X B;  4YXD B;  3NVZ A;  5LNK 1;  2WXL A;  2BWF A;  2K39 A;  2IO1 B;  3BK1 A;  3UQB A;  5C2T B;  4HDO A;  2JUO A;  2KC1 A;  2M1M A;  3BIN A;  4BAX A;  4XDC A;  2N1V A;  1TJE A;  2V3N A;  3APF A;  1Z5S B;  2MJ3 A;  2PEA A;  4IW0 A;  2H88 B;  3AUL A;  2DWQ A;  1FD6 A;  2KXJ A;  3Q3N C;  4IOI E;  4WIP A;  3VR8 B;  1DOY A;  3AE8 B;  5AEK B;  1GB1 A;  2K1F A;  1IPG A;  3AI5 A;  1AN8 A;  1ZGU B;  1ET9 A;  2XBB C;  2MP2 A;  4K81 A;  3Q2A C;  5LXH A;  1FNW A;  2NS5 A;  1N6Z A;  3OG5 A;  4WWP A;  4A9A A;  4C56 C;  1WXV A;  4EFO A;  3OWE B;  2FCQ A;  4HDQ A;  4PT5 A;  3T3N A;  2C60 A;  3QAR A;  4ZYN A;  4ZHO A;  2BVC A;  2YEP B;  2WXI A;  5HFY A;  1C9F A;  1NYR A;  1N61 A;  3PLU A;  2MP2 B;  4NNJ B;  1KLG D;  1T5X D;  2QCZ A;  3DHI C;  3PPA A;  1YQ4 B;  1N62 A;  4YTM B;  2ICI A;  1AW7 A;  2FUG 1;  2VH2 A;  3DVG Y;  1GJZ A;  3VTV A;  4UDU C;  1GG3 A;  2JWZ A;  4G3X B;  1L6V A;  2VZK B;  5IAA C;  1C4P A;  1JQ4 A;  3DBL I;  2KYW A;  4NAM A;  4ICU A;  3DWG C;  3A33 B;  3NG0 A;  3DPD A;  4KDI C;  3TL5 A;  4CO7 A;  3MHZ A;  4ZDV A;  4ITK A;  1R4M I;  3H6N A;  1N63 A;  2ZNV C;  2FCM A;  1ZOY B;  3IT6 B;  2N7D A;  2BYV E;  4RGM A;  1V1P A;  4M02 A;  3HVZ A;  1ZDV A;  3N30 A;  1LO5 D;  3VUY A;  1WE6 A;  3NZ3 A;  5FK9 C;  4TQ0 A;  3Q8C A;  4FN2 A;  2JQR B;  3N1X C;  1WJN A;  2JWU A;  5JH5 C;  3NS8 A;  2FNJ B;  2QMT A;  4GSW A;  1FFV A;  2D5G A;  3RUL A;  1V1P B;  1EU4 A;  3IBE A;  3R66 C;  4B0E A;  1HEZ E;  1JRO A;  2MH7 A;  4DHZ B;  4IWP A;  2C5L C;  4GDL A;  3QHT A;  4W9I A;  5FKA C;  2N1W A;  3WAN A;  2V1Y A;  4WJO A;  3TEW A;  2BYE A;  2DNF A;  3L17 A;  3RNA C;  1N5X A;  2ZPY A;  2CR5 A;  1YN5 A;  2UWQ A;  1WXA A;  3JSV A;  4XDD A;  2NTS A;  2LZ6 A;  1R4N B;  2M56 B;  3N20 C;  1WMH A;  4GDL B;  1XLN A;  3V3X A;  3P4R B;  3VUW A;  3DCG A;  1JWM D;  2PVG C;  1FCC C;  4JWS C;  2RSU A;  2WXF A;  1UZX B;  4KV2 A;  3JYU A;  3SD5 A;  3WAP A;  1ROE A;  1WZ0 A;  4LNI A;  4LLG M;  4N9F 4;  3NOB A;  2VZK D;  1WJ4 A;  4NJ7 A;  3ZNI D;  3LDZ E;  4TKN A;  1WMH B;  3PSE B;  1NVI D;  4HPM B;  3ZRF A;  2LVQ A;  1IYF A;  3IFW B;  2O2V A;  5T8I A;  3CSF A;  5JZE B;  3WCQ A;  3GS2 A;  4K7W A;  3KYC D;  4P1B C;  2PKO A;  3TSS A;  4BOS C;  1LQB A;  2ZCC A;  2FCS A;  3ZRC A;  2J7Q B;  1PGA A;  1IBX A;  2G9H D;  2Z0D B;  4OW0 A;  3CST A;  4L1B A;  1NI2 A;  2L7R A;  1QOG A;  2D3C A;  4FLH A;  2GI9 A;  3RT3 B;  2WGS A;  3UGB B;  4RH6 A;  5GMV A;  2O2V B;  4J6I A;  2WDT B;  4BKG A;  1M94 A;  2KDI A;  3IVF A;  1YNT E;  1S3S G;  2IO2 B;  5GXG B;  3LYY A;  4MM3 A;  2ZNV B;  2M8S A;  1IBX B;  3AXC A;  4N59 A;  1YD8 U;  2WXN A;  3A9J A;  2WXM A;  1UH6 A;  4JGH B;  2MBB B;  4K3C A;  3W2D A;  2WXG A;  1FXI A;  3SR6 A;  1V5O A;  3RMK C;  4K7U A;  3NRZ A;  1T0R C;  3JW0 X;  3RNC C;  2KWD A;  2AL3 A;  1WXQ A;  3H7P A;  4MSQ B;  4F7Z A;  1P98 A;  1TKY A;  2GB1 A;  3E9S A;  2DYO A;  2SAK A;  2GBR A;  1RLF A;  2FUH B;  3EUB 2;  4ZRP A;  2G1E A;  3A9J B;  3OLM D;  2KTR A;  3MC9 A;  2BYF A;  3Q3O C;  2N0S B;  3IXS A;  3MTN B;  2PE6 B;  2L52 A;  4BOZ B;  2WLB A;  1KRH A;  2JYE A;  2QEJ C;  3ZIM A;  2BBC A;  2CU3 A;  1TT5 B;  2DHZ A;  4YSX B;  4WQO B;  2DBY A;  4XX5 A;  3TUO A;  4C7Z A;  2KKC A;  4ZHP A;  3H7P B;  4LDT B;  4JE3 B;  4P7I A;  4GIV A;  1MVK A;  3BVG A;  1FFU A;  2ZW1 A;  1T0Y A;  2O6V D;  2KTR B;  3RNG C;  2MLB A;  4MGK E;  4AJW A;  5DPW A;  2RD0 A;  3AE1 B;  1ISN A;  4O1N A;  5JXV A;  2K22 A;  2IGD A;  3W5V B;  1VZ6 A;  2AYO B;  3GOE A;  3FAH A;  2FID A;  1JCK B;  2K8C A;  1OEY A;  1IGD A;  1CK1 A;  2N9K A;  2QHO A;  2MQJ A;  4LNN A;  1WR6 E;  4ZOH C;  3ENE A;  3ZJV A;  4K7S A;  1VRA B;  3A9K A;  3UI3 A;  2FCN A;  2JSV X;  2M17 A;  3EFC A;  2LUE A;  2KLC A;  4G0N B;  3VQI A;  4P6V F;  1HZ5 A;  1ZDX A;  3TIX A;  3QC8 B;  2LVO A;  1DOX A;  4KKJ A;  1I4X A;  3N9Y C;  1XD3 B;  1NEN B;  4R3D A;  1QKZ A;  1F1H A;  5EE1 A;  1LGR A;  3P1M A;  3U7D A;  4ARC A;  4B95 A;  2KN4 A;  1NBF C;  1B9R A;  2RDH A;  5IN7 A;  3VVW B;  4W9K A;  1VCB A;  1SGH A;  4KSK C;  4W9E A;  5BMG A;  3UIN B;  5D94 A;  1TZO A;  2LMC A;  4JPS A;  4ARI A;  1VJK A;  3PTF C;  2QIE B;  4II3 B;  2A5U A;  5CHV C;  5CTR C;  1TYG B;  2Y5C A;  2R2Q A;  3EEC A;  3ZLZ A;  4BBN C;  2H89 B;  4MGZ E;  2NBW B;  2XNA C;  4BZA A;  2C7N B;  1NEK B;  3J9C A;  4BKS D;  1QOB A;  1MG8 A;  4HJG E;  4MH8 A;  4JWU C;  2MEK A;  3BY4 B;  4RGN A;  2VH1 A;  4WQM A;  4IM2 A;  2YVC A;  3ZNG C;  4WJQ A;  3WAL A;  1SEB D;  2V3S A;  2G3Q B;  1LXD A;  2M19 A;  3BYT B;  3GE3 C;  2DLB A;  1GNU A;  3BK2 A;  2PE9 A;  3RFZ B;  3C19 A;  2HD5 B;  2GBJ A;  2ZPN A;  4LCD E;  3B0A A;  3VTW A;  1LFD A;  4BBN F;  2BWE S;  3PHX B;  2WXO A;  3R2T A;  1KF6 B;  3DBL B;  1QLB B;  1ZXI A;  3H9D A;  2B76 B;  4ZRI A;  3BVZ A;  1K53 A;  4TQ1 A;  4WUR A;  3FKY A;  1J0G A;  2E3T A;  2EEL A;  4I6L B;  2XEW A;  3RNE C;  1R4M B;  1UWX A;  5HHD G;  2WS3 B;  4HPP A;  2NBV B;  4E74 A;  3CWI A;  1CMX B;  1QT9 A;  1FXA A;  1PDX A;  4LNK A;  3R3M A;  3W5U B;  2ACZ B;  2BS2 B;  3DDC B;  3DHG C;  4DHJ B;  1TS5 A;  3W1S C;  4AJY B;  1V6E A;  2KVZ A;  2YLM A;  3T8M A;  1EM7 A;  4USA A;  4C7Y A;  3TMP B;  2ZCB A;  2IGG A;  2IYD B;  4C00 A;  3Q8F A;  2QSD A;  4LJO B;  1V97 A;  1V8C A;  1QOF A;  2L8J A;  1JWU D;  1C76 A;  1V80 A;  4HVB A;  2ZZP B;  3LJ3 A;  1FO4 A;  1WSP A;  1TTN A;  1WJ6 A;  4BKT A;  2N9L A;  2BB5 A;  2CJN A;  4FHK A;  3AM9 A;  3ZO5 B;  3TBL D;  1H4R A;  4D2K A;  2N9E B;  2KHW B;  4WWO A;  1WGR A;  4LNF A;  1G6J A;  2W54 A;  4OVU A;  3P2B A;  4HK2 A;  3APD A;  3ABV B;  1XLO A;  4GLS C;  1KOT A;  3AU5 A;  1ZW7 A;  3L0W B;  3SFD B;  1HA5 A;  2KO3 A;  3NHE B;  1XCT L;  4IWO A;  3HIZ A;  4A3P A;  4MH0 E;  4W9D A;  1E8X A;  3FC4 A;  4KVG B;  3L08 A;  1ZE3 D;  2PMV A;  1D5Z C;  3MC0 B;  1L4D B;  4FUL A;  1CQV A;  2DZM A;  3VRA B;  2WU5 B;  2IY0 B;  3NY5 A;  4J3O D;  1BML C;  2ZJD A;  2IBI B;  1GOZ A;  2L0F A;  1ZKH A;  2FIF A;  1MI0 A;  3A4R A;  4ANW A;  2LEK A;  2PLP A;  3P4P B;  4XE0 A;  5D2M B;  5HI1 A;  3EA6 A;  3AEA B;  3VFK A;  1KLV A;  3O65 B;  3DVG X;  2HJ8 A;  5KHQ A;  4W9J A;  3AEF B;  4DXA B;  2NTT A;  1JRP A;  1T0Q C;  2R61 A;  3I57 A;  1EWY C;  1FMA D;  4PYZ A;  2V9H A;  1BXT A;  2MHJ A;  3TJP A;  3HVD A;  1SBB B;  1S1Q B;  1P1A A;  3ZKJ C;  5J17 A;  1VD2 A;  3PLV A;  1WRD B;  2CS4 A;  1GB4 A;  3URY A;  2FE8 A;  3PRE A;  1SIJ A;  4E3C A;  2N9P C;  2INP E;  3VR9 B;  1SIF A;  1JWS D;  3ZXV A;  1EF1 A;  1YOV B;  4GXB A;  4JQW C;  1XO3 A;  2KWC A;  3Q3J A;  4URK A;  2D10 A;  1VDV A;  3Q8B A;  3QK0 A;  2IJ0 A;  3RNB C;  4K1R B;  4A20 A;  2DAJ A;  4CYE A;  1DGJ A;  4KSL C;  2OHF A;  1DYQ A;  3U7Z A;  1JAL A;  4MJS A;  1X1M A;  2Q5W D;  1C1Y B;  1RWS A;  2NCN A;  5AUI A;  4MGI E;  1FRR A;  1A5R A;  2ZVO A;  1KJT A;  4DDI D;  2KD0 A;  2C7M B;  1TS4 A;  3MJW A;  1E0Z A;  2CJO A;  3PT2 B;  3DOW A;  2G45 B;  1RFA A;  2LGX A;  4TMA B;  5G5H A;  2C9W B;  1ZUD 2;  2XN9 C;  2MJD A;  5D6J B;  3RI7 C;  1N5W A;  2ZVN A;  2BT6 A;  1VLB A;  4IM0 A;  1Y8R C;  5D3D A;  1L5P A;  4MJS B;  2LGY A;  1E7P B;  2DZK A;  4LJP B;  4A55 A;  1PGB A;  5BYQ A;  5AZH A;  1FPY A;  1KTK A;  3B08 A;  4WJN A;  4WJP A;  1XLP A;  3B1L X;  1JWB D;  3ZDT A;  2L76 A;  2GMI C;  2KAN A;  2Z8L A;  1FM0 D;  1P0R A;  4XC2 A;  1ZP0 B;  1HXY D;  3L16 A;  2LD9 A;  2KJ6 A;  1SE4 A;  1QF6 A;  2K8H A;  4HWI B;  1YX5 B;  1WH3 A;  3DQV A;  4G50 A;  3RPF C;  4A8X C;  5E6N A;  1AYF A;  4E71 A;  2GBN A;  1OEY J;  3KUZ A;  1XF5 L;  2MSE D;  3ZNH B;  3RCZ A;  3NVY A;  4II2 B;  4FXC A;  2K6Q A;  2KOX A;  2I1J A;  5EE9 A;  4RF1 A;  1BT0 A;  2J0J A;  2MRP A;  4RCO A;  3AH7 A;  2QDF A;  2BS3 B;  4IDI A;  4RGO S;  2K0P A;  4K3B A;  3PZ8 A;  4L2Y A;  2AWT A;  2GBM A;  2M0A A;  4I6P A;  1UD7 A;  1TS3 A;  3JVZ X;  3ZUN A;  1SXT A;  3AEG B;  3AMZ A;  5IOI A;  1D4B A;  4HPL B;  1LM8 B;  2LUM A;  3BZD B;  1TZ1 A;  1OQY A;  4CHK A;  2D2Q A;  5BYR A;  4FHJ A;  3QIJ A;  4IWQ A;  2BTE A;  4HCN B;  4KGT A;  2WP9 B;  4M01 A;  3WIM A;  1D6E C;  2WXH A;  1C3T A;  4GDK A;  3PRZ A;  1EU3 A;  5JHA A;  1WIA A;  2IPK D;  3DVN V;  4G11 A;  4JIO U;  4M8M A;  1WJU A;  1MHH E;  2LXC A;  3Q8E A;  4PS7 A;  1MPE A;  2WXR A;  4NQL B;  1PGX A;  1JW9 D;  2KZR A;  2LGI A;  3R7Q A;  4GDK B;  2I38 A;  5CHF A;  4HKQ A;  4OZA A;  2KMA A;  4OHJ A;  3APC A;  1MHX A;  2N4F A;  2X8X X;  1EO6 A;  4EUT A;  4KDL B;  1IGC A;  3U4E G;  3M95 A;  3MHS D;  2JVC A;  4L23 A;  3RYT A;  3B2F A;  1JRU A;  2G4S A;  3NS1 A;  5FR6 A;  4ICV A;  2WHI A;  3U30 A;  3ECI A;  2ASQ A;  2KWV B;  3DBH B;  2BW2 A;  2V4L A;  2LGS A;  3GZN I;  4AWJ A;  2WXK A;  4IC7 B;  3A1Q A;  1WXS A;  3AU4 A;  3PZD A;  1TIF A;  2W9N A;  2JY6 A;  1I4H A;  2N9X A;  2J4X A;  3PGE A;  2RDB C;  5L83 A;  5EE0 A;  3MFG A;  4HCP B;  4MDK E;  4AOF A;  3HUI A;  2K6D B;  5G5G A;  1IP9 A;  4US9 A;  2WX0 A;  2IND C;  3LXF A;  3I3T B;  3H1U A;  3UIP B;  3W1Y A;  4MEM A;  5J18 A;  3A1Q B;  2RDG A;  2KFJ A;  3WA0 A;  4B0M A;  4KGR A;  1VZ8 A;  1WGH A;  2REX A;  2QJL A;  2ONQ A;  4ZRK A;  1MJD A;  2KX0 A;  1WWT A;  4ANX A;  3PO0 A;  4ANU A;  3LB8 C;  3UQA A;  3ZTD A;  2J53 A;  1J8C A;  4F1S A;  1YQB A;  1SE2 A;  2PTL A;  3P42 A;  3N3K B;  3TEX A;  2JYT A;  2D07 B;  3RN9 C;  1T3Q A;  1L6U A;  3VRB B;  4DXG A;  3IHP C;  3KH0 A;  4EKU A;  3MC8 A;  1Q0W B;  2Y3A A;  2OJW A;  1I4Q A;  2RPQ A;  1VR9 A;  2KQ4 X;  2NR2 A;  4YSZ B;  5AUK A;  3ZNZ B;  3N1Y C;  1HZ6 A;  1A70 A;  4DDG D;  3DBS A;  5BO4 B;  1N60 A;  4IUM B;  3V05 A;  2K25 A;  1RYJ A;  3N1Z C;  3DHH C;  3KUC B;  1WE7 A;  3QA8 A;  1F0Z A;  1WRI A;  3AE4 B;  3H7S A;  4RM8 A;  4DXF A;  4A3O A;  2EMT A;  3VTU A;  2JZP A;  5D7G A;  1CZP A;  2NPT A;  2Y5B B;  1P3Q U;  4MEL A;  1PFD A;  1I4P A;  2UU7 A;  3NJT A;  4TV3 A;  2WNM A;  4KZ0 A;  2KFK A;  1WXM A;  2V0G A;  1E8W A;  3AN1 A;  4EZJ A;  3GP7 A;  3X23 A;  4LDT D;  1UWM A;  5DCN A;  2BQQ A;  2XK5 A;  4FJZ A;  3X0W A;  4MAC A;  1QIL A;  1F9J A;  1WF9 A;  3PS6 A;  2ON8 A;  2NPT B;  1T6B X;  1L2N A;  4A90 A;  1YMH E;  3B9J A;  4EZK A;  2KC2 A;  4N6E B;  3AE2 B;  2CKH B;  2WXP A;  1XLQ A;  5E6J A;  2KFK B;  4XWW A;  5E6P A;  3KYD D;  1V86 A;  4B9K A;  1XEE A;  4IM3 A;  1L4Z B;  2Z0E B;  3FIL A;  4GMV A;  1DOI A;  1K52 A;  2EKI A;  3AB5 A;  1SB3 C;  2XK5 B;  3CMM B;  3WAO A;  2JZZ A;  2J0M A;  2WWZ A;  1V49 A;  3KQ4 A;  4NZL B;  2CHZ A;  3Q3M C;  3ML9 A;  5C1Z A;  4NAW A;  2MWS B;  1V1O A;  3FIL B;  4NJ6 A;  2HE7 A;  5TSS A;  1ZXH A;  3M3J A;  4WWN A;  2ZEQ A;  5IA7 A;  1ET6 A;  3NVV A;  1KFY B;  1QZE A;  3NZS A;  1FNV A;  2YEP F;  2J0K A;  3NUH B;  1NI3 A;  2BS4 B;  3IT4 B;  4NAW B;  3TEY A;  2LHE A;  2LVP A;  3VXW A;  1AWD A;  2GOW A;  1TY0 A;  2MCN B;  3PRP B;  1YN4 A;  1FIQ A;  1I4R A;  4HXD A;  3AE5 B;  2LJI A;  2QIL A;  4N58 A;  2KDE B;  2KDB A;  2L1A A;  1MG4 A;  3ALB A;  3AE9 B;  3K9P B;  1TY2 A;  3HM3 A;  2DYM A;  5H92 C;  3VAW A;  1EF5 A;  4KGS A;  1D5X C;  1OQQ A;  4LNO A;  5G2N A;  1KM7 A;  3QX1 A;  1UNS A;  2Z59 B;  5DPR A;  1TS2 A;  1SE9 A;  2R2O A;  3RZF A;  3ZDM C;  1OFF A;  1C4A A;  4HLE A;  1OQR A;  3QQ8 B;  3HHM A;  1HQR D;  1WX8 A;  4RGT A;  3EHV A;  1YQ3 B;  2V4I B;  3Q69 A;  1PYW D;  3NZU A;  2E6X A;  1FNU A;  3S2A A;  2INN E;  5DPT A;  3BWU D;  4HRS A;  1E8Y A;  1J7A A;  3ZYY X;  1GC6 A;  3BII D;  1ESF A;  2K3U A;  3I63 C;  3GE8 C;  1WYW B;  4DK5 A;  3SFE B;  2OED A;  4PYU A;  2L32 A;  2C7H A;  3Q3F A;  2JXT A;  4EZL A;  4DHJ D;  1UBI A;  1YJI A;  2IO0 B;  2LXA A;  3W1S A;  1RM6 C;  2D3A A;  1FRD A;  1JML A;  3L10 B;  2DYB A;  1WI0 A;  2LGD A;  3R2I A;  1WX9 A;  2LJ5 A;  4TSS A;  1C79 A;  1I35 A;  4WAF A;  4YT0 B;  1I7H A;  3QCA A;  3SU8 X;  3QJZ A;  2PW9 A;  2RMM A;  5D3I B;  1H8C A;  1K51 A;  1IUE A;  1TGZ B;  4WH4 A;  1F2R I;  1UF0 A;  1V5T A;  3M62 B;  4PS8 A;  3V60 A;  4HKZ E;  2KMC A;  2JZ3 B;  3ONS A;  4S0R A;  4X57 B;  3KWL A;  3TCA A;  3OJ4 B;  1HE8 A;  2W3R A;  3HK0 A;  2KJH B;  4W9G A;  1FXT B;  1TKG A;  3ZTC A;  1NDD A;  3I5J C;  4EEW A;  1M4V A;  2NMQ A;  1WM3 A;  2I2Y A;  3PRM B;  2CHX A;  1ACC A;  2D3G A;  3QWZ B;  4HEA 1;  3AE6 B;  2I1K A;  3IAM 1;  4GOC A;  5KHO A;  2WDR B;  3RZW C;  1WGY A;  4ZYS A;  1E10 A;  2GLS A;  2D11 A;  1Q10 A;  1E7V A;  4P1C C;  4MGY E;  4YL8 A;  5L95 C;  4PK1 A;  3GZN B;  4OVV A;  1E5W A;  4QAY A;  4ACF A;  5CHW A;  4PS3 A;  1P9D U;  3R7R A;  4JLC A;  4OZC A;  3E56 A;  3P4S B;  1SE3 A;  2FAZ A;  2IY1 B;  4NQK E;  1U4A A;  4KX6 B;  1YIW A;  3AE3 B;  5LLI A;  3TEZ A;  2MX2 A;  3C8Y A;  2PIA A;  4C80 A;  4ASW C;  2AX5 A;  2AQ2 B;  3M63 B;  3AEB B;  3U8Z A;  1C4C A;  3P4Q B;  1ENF A;  3DBR I;  4NPN A;  4DBG A;  3ZQ4 A;  4EOY A;  5IP4 D;  3EFU A;  5MPO A;  3CF6 E;  4M0W A;  1QOA A;  1AAR A;  2AQ1 B;  1P7F A;  3V61 A;  1WYG A;  2EKE C;  1F52 A;  1R7S A;  1E8Z A;  2INC C;  4KKI A;  1YJJ A;  4YSY B;  2RGF A;  3DWM A;  3ZGZ A;  2O6V A;  1KH0 A;  1D5M C;  3QAQ A;  2DEN B;  4IKG A;  4GN1 A;  3PZ7 A;  2WX1 A; 
#chains in the Genus database with same CATH homology
 1NYR A;  1N61 A;  3BVZ A;  1K53 A;  4TQ1 A;  4WUR A;  1XCQ L;  2E3T A;  3H8H A;  2EEL A;  3ETR A;  1KLG D;  1T5X D;  2RDG A;  4B0M A;  3AED B;  2L83 A;  1YQ4 B;  1UWX A;  5FR3 A;  4KGR A;  1N62 A;  4YTM B;  5HHD G;  2WS3 B;  1VZ8 A;  2ICI A;  1AW7 A;  2JU6 X;  2FUG 1;  2QJL A;  2ONQ A;  3CWI A;  1QT9 A;  1FXA A;  2ZW0 A;  1XXG A;  1WWT A;  1PDX A;  3PO0 A;  3LB8 C;  2J53 A;  4UDU C;  3W5U B;  2ACZ B;  1L6V A;  1VZ7 A;  2BS2 B;  2VZK B;  1C4P A;  1FCL A;  1SE2 A;  1TS5 A;  2PTL A;  3P42 A;  3KWV A;  3TEX A;  1JQ4 A;  4AS1 A;  2JYT A;  3T3O A;  1E9M A;  4NAM A;  2KAC A;  1EM7 A;  4Q2J A;  3DWG C;  1T3Q A;  4USA A;  4C7Y A;  1L6U A;  3NVW A;  3VRB B;  1SF0 A;  4DXG A;  2IGG A;  1P7E A;  3MHZ A;  3IAS 1;  4ITK A;  4AQ7 A;  1Y56 A;  3Q8F A;  1N63 A;  1J7C A;  2QSD A;  1V97 A;  1V8C A;  2Y3A A;  1QOF A;  1ZOY B;  3IT6 B;  5BMH A;  1JWU D;  1I4Q A;  1C76 A;  1VR9 A;  2KQ4 X;  1V1P A;  4RGM A;  4YSZ B;  5AUK A;  4HRO A;  2WQY B;  4JX1 C;  1FO4 A;  3HVZ A;  4NJC A;  1ZDV A;  2KDM A;  1WSP A;  1LO5 D;  1HZ6 A;  1A70 A;  3NZ3 A;  5FK9 C;  2N9L A;  2BB5 A;  2CJN A;  3Q8C A;  1N60 A;  4TQ0 A;  3AM9 A;  3AEC B;  3V05 A;  2JQR B;  1RYJ A;  4D2K A;  1F0Z A;  2JWU A;  1WRI A;  1WGK A;  1K50 A;  2W54 A;  3AE4 B;  1UGJ A;  4DXF A;  2QMT A;  3ABV B;  1XLO A;  4GLS C;  1FFV A;  2D5G A;  3SFD B;  1L0V B;  1HA5 A;  2JZP A;  5D7G A;  1XCT L;  1CZP A;  1V1P B;  1EU4 A;  4B0E A;  1HEZ E;  1JRO A;  2MH7 A;  2GRI A;  3FC4 A;  1PFD A;  1I4P A;  2WNM A;  1KLU D;  1ZE3 D;  2PMV A;  2V0G A;  3AN1 A;  1D5Z C;  3MC0 B;  1I4G A;  1L4D B;  3B2G A;  3GP7 A;  4MM3 B;  5FKA C;  1CQV A;  3VRA B;  2WU5 B;  1UWM A;  3TEW A;  2J52 A;  4J3O D;  1BML C;  1N5X A;  5C3J B;  1GOZ A;  2FBW B;  1YN5 A;  4MAC A;  5EE3 A;  1E6E B;  1QIL A;  1MI0 A;  2ON8 A;  1T6B X;  1F2R C;  2LEK A;  1YMH E;  3B9J A;  4XDD A;  2NTS A;  4A90 A;  2PLP A;  3P4P B;  4XE0 A;  4DQO C;  4N6E B;  3AE2 B;  3AE7 B;  2WXP A;  1XLQ A;  2M56 B;  5E6J A;  2N7J A;  5HI1 A;  3EA6 A;  4XWW A;  3AEA B;  4GDL B;  1XLN A;  2BB6 A;  1XEE A;  3V3X A;  1L4Z B;  3P4R B;  1JWM D;  3FIL A;  2PVO D;  1DOI A;  2PVG C;  3AEF B;  1FCC C;  1K52 A;  4ZRQ A;  4JWS C;  2EKI A;  3AB5 A;  2NTT A;  2WXF A;  1JRP A;  1SB3 C;  2LFI A;  3AEE B;  3W9C B;  1BUI C;  3GB1 A;  2HTM E;  4EE2 A;  2R61 A;  3I57 A;  1EWY C;  1FMA D;  1BXT A;  1ROE A;  3KQ4 A;  4LLG M;  4OVZ A;  3HVD A;  1SBB B;  4NZL B;  5I4D A;  2VZK D;  4LK0 M;  1GB4 A;  3URY A;  1NVI D;  2FE8 A;  1V1O A;  4YWG G;  4WWM A;  3FIL B;  5T8I A;  1SIJ A;  5TSS A;  3WCQ A;  1ZXH A;  2INP E;  1NYQ A;  3VR9 B;  3GS2 A;  1JWS D;  4LTU A;  1XO3 A;  2HDE A;  2PKO A;  3TSS A;  3Q8A A;  2K9X A;  4US8 A;  1ET6 A;  2KMM A;  3NVV A;  1F77 A;  1KFY B;  1PGA A;  1IBX A;  2G9H D;  4OW0 A;  4L1B A;  1FNV A;  1VDV A;  3Q8B A;  1QOG A;  2YEP F;  3NUH B;  2W3S A;  1NI3 A;  2IJ0 A;  2BS4 B;  3IT4 B;  2GI9 A;  4NAW B;  3EGR A;  3TEY A;  2LHE A;  4RH6 A;  1DGJ A;  1AWD A;  2OHF A;  1TY0 A;  1DYQ A;  3U7Z A;  1JAL A;  2Q5W D;  1RWS A;  2WDV B;  1YNT E;  1YN4 A;  5AUI A;  5GXG B;  1FIQ A;  1FRR A;  1I4R A;  3LYY A;  3AE5 B;  3U2S C;  2LJI A;  2RPV A;  2QIL A;  1IBX B;  4N58 A;  1TS4 A;  1E0Z A;  1B1Z A;  4N59 A;  2CJO A;  2L1A A;  3BVM A;  5HG2 A;  2WXN A;  1C78 A;  2BYT A;  3AE9 B;  4TMA B;  5G5H A;  2WXM A;  1TY2 A;  1ZUD 2;  2XN9 C;  2MJD A;  3ZJU A;  2WXQ A;  4P16 A;  1N5W A;  2BT6 A;  1VLB A;  3W2D A;  4XWT A;  2WXG A;  2TSS A;  1FXI A;  5D3D A;  3SR6 A;  3MP9 A;  1L5P A;  1GAQ B;  3NRZ A;  2DYM A;  1ZPS A;  1E7P B;  5H92 C;  2KWD A;  2WXJ A;  4KGS A;  4RNA A;  4A55 A;  1D5X C;  1WXQ A;  1PGB A;  1OQQ A;  5BYQ A;  1KTK A;  2AQ3 B;  1XLP A;  1TKY A;  2GB1 A;  1UNS A;  2DYO A;  3E9S A;  2SAK A;  4H2A A;  3ZJT A;  1JWB D;  5BYS A;  1TS2 A;  3EUB 2;  1SJH D;  4ZRP A;  2G1E A;  4OZB A;  1SJE D;  1OFF A;  1C4A A;  1PUT A;  1OQR A;  2Z8L A;  1FM0 D;  2N0S B;  3IXS A;  1HQR D;  4RGT A;  2L52 A;  2WLB A;  1KRH A;  1HXY D;  1ZP0 B;  2JYE A;  1YQ3 B;  2QEJ C;  2V4I B;  3Q69 A;  1PYW D;  1SE4 A;  2BBC A;  4MT5 A;  1QF6 A;  3R8B A;  2E6X A;  2CU3 A;  1FNU A;  4YSX B;  2DBY A;  1QQR A;  2INN E;  4YTP B;  4YTN B;  3TUO A;  4C7Z A;  1RFK A;  4ZHP A;  1GPX A;  3BWU D;  4HRS A;  3RPF C;  1JWA D;  4JE3 B;  4A8X C;  2JX5 A;  3U52 E;  1AYF A;  1J7A A;  2J42 A;  3ZYY X;  1MVK A;  3BII D;  3BVG A;  1C9F A;  1ESF A;  1FFU A;  2K3U A;  1XF5 L;  1TKE A;  2ZW1 A;  2LHD A;  4RF0 A;  3NVY A;  3SFE B;  2OED A;  4FXC A;  2L32 A;  2X38 A;  5EE9 A;  4RF1 A;  3AE1 B;  2JXT A;  4O1N A;  5JXV A;  2K22 A;  2WDQ B;  4RCO A;  3AH7 A;  2BS3 B;  2IGD A;  4IDI A;  4RGO S;  3W5V B;  1YJI A;  1VZ6 A;  2K0P A;  3PZ8 A;  3W1S A;  4L2Y A;  1RM6 C;  5H8Y E;  3FAH A;  1J7B A;  2M0A A;  1FRD A;  1JML A;  1TS3 A;  1JCK B;  1EWC A;  1STE A;  3L4P A;  3P63 A;  3R2I A;  1IGD A;  1L0Y B;  1SXT A;  1CK1 A;  3AEG B;  2N9K A;  2WU2 B;  4TSS A;  3HRD D;  1C79 A;  1YN3 A;  3AMZ A;  1D4B A;  2IDY A;  4WAF A;  2SEB D;  4ZOH C;  4YT0 B;  1I7H A;  2MJE A;  3MJ5 A;  3ZJV A;  1VRA B;  4RFB A;  4CQN A;  2LUM A;  2PW9 A;  2RMM A;  5D3I B;  3UI3 A;  2JSV X;  1K51 A;  1IUE A;  3BZD B;  4WH4 A;  1F2R I;  5BYR A;  2IGH A;  3O13 A;  2KAJ A;  3VQI A;  4P6V F;  1HZ5 A;  1ZDX A;  4HKZ E;  2BTE A;  1DOX A;  1SSN A;  4KKJ A;  4A6Q A;  1I4X A;  3KWL A;  3N9Y C;  1FEH A;  4KGT A;  2W3R A;  1NEN B;  1TKG A;  4R3D A;  1QKZ A;  2WP9 B;  3CIR B;  3I9V 1;  3SEB A;  5EE1 A;  3P1M A;  1D6E C;  2WXH A;  1C77 A;  1M4V A;  1EU3 A;  2NMQ A;  4ARC A;  1UUP A;  2I2Y A;  2KN4 A;  2IPK D;  1B9R A;  1ACC A;  2W82 A;  4HEA 1;  3AE6 B;  3BYY B;  2RDH A;  3IAM 1;  4REZ A;  3KLS X;  2K5P A;  2W55 A;  2WDR B;  1CJE A;  5BMG A;  1MHH E;  1TZO A;  2V3P A;  2LMC A;  3Q8E A;  1MPE A;  4ZYS A;  2WXR A;  1E10 A;  3AV8 A;  2Y5P A;  4JPS A;  1PGX A;  4ARI A;  1VJK A;  1JW9 D;  1Q10 A;  2QIE B;  2LGI A;  5BMI A;  1L0X B;  4YXD B;  1TYG B;  2Y5C A;  4GDK B;  2H89 B;  2I38 A;  2XNA C;  3NVZ A;  5LNK 1;  2WXL A;  1NEK B;  3J9C A;  4HKQ A;  3BK1 A;  1QOB A;  4OZC A;  3E56 A;  3P4S B;  1SE3 A;  4HJG E;  4OZA A;  4MH8 A;  4OHJ A;  4JWU C;  2MEK A;  5C2T B;  4KX6 B;  1MHX A;  1IGC A;  3U4E G;  4XDC A;  3AE3 B;  1TJE A;  2V3N A;  4RGN A;  3TEZ A;  2MJ3 A;  4L23 A;  3B2F A;  3C8Y A;  2H88 B;  1FD6 A;  2DWQ A;  2PIA A;  3NS1 A;  4C80 A;  4WQM A;  2AX5 A;  2AQ2 B;  3AEB B;  1C4C A;  3P4Q B;  4IOI E;  1ENF A;  4WIP A;  3VR8 B;  1DOY A;  1SEB D;  3AE8 B;  1GB1 A;  3ZQ4 A;  1AN8 A;  1ET9 A;  2BW2 A;  2M19 A;  3BYT B;  1FNW A;  2WXK A;  5MPO A;  2DLB A;  4M0W A;  1QOA A;  2AQ1 B;  3BK2 A;  3RFZ B;  1P7F A;  4A9A A;  4C56 C;  1I4H A;  1WYG A;  1R7S A;  2J4X A;  3OWE B;  4KKI A;  1YJJ A;  5EE0 A;  4PT5 A;  3MFG A;  4YSY B;  3T3N A;  3DWM A;  3ZGZ A;  4ZHO A;  3HUI A;  2WXO A;  3R2T A;  1KF6 B;  2YEP B;  5G5G A;  1KH0 A;  1D5M C;  1QLB B;  2WXI A;  4IKG A;  4US9 A;  1ZXI A;  5HFY A;  2B76 B;  3PZ7 A;  3LXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...