3U80A

1.60 angstrom resolution crystal structure of a 3-dehydroquinate dehydratase-like protein from bifidobacterium longum
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
127
Chain Sequence
MTKVIVVNGPNLRQDLDTLRKLCAEWGKDLGLEVEVRQTDDEAEMVRWMHQAADEKTPVVMNPAAFTHYSYALADAAHMVIDENLPLMEVHISNPSVISPVATGTITGMGFYGYKLALDAVAHLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a type II dehydroquinate dehydratase-like protein from Bifidobacterium longum.
pubmed doi rcsb
source organism Bifidobacterium longum
molecule tags Unknown function
molecule keywords 3-dehydroquinate dehydratase, type II
total genus 47
structure length 127
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 3u80A00
2Y76A 1H0SA 1GU0A 2CJFA 2C57A 3LWZA 1V1JA 2DHQA 2XB9A 1GU1A 3N87A 4CIWA 1H05A 2WKSA 2XD9A 1GQOA 2C4WA 2Y71A 1H0RA 4CL0A 4CKYA 4RHCA 3N76A 1GTZA 4KIWA 4ZC1A 4CIXA 3N86A 4B6OA 3KIPA 4B6QA 4CIYA 3N7AA 2Y77A 4KIJA 4CKWB 4L8LA 3U80A 4B6SA 2UYGA 4CIVA 1UQRA 2C4VA 4V0SA 1D0IA 5WRFA 4CKWA 5B6PA 4B6RA 3N8NA 3N8KA 1J2YA 3N59A 2BT4A 4KIUA 4KI7A 2XDAA 4CKZA 4RC9A 2XB8A 4B6PA 4CKXA
chains in the Genus database with same CATH superfamily
3HY4A 3D8SA 4JEHA 2VEOA 2ZB8A 4UQPA 5ALFA 4HWGA 1NXQA 1TKAA 3EX7C 4W63A 3FUWA 1GZSA 2YZMA 2BKLA 5IJ0B 1XTVA 2ZUBA 1T5BA 2JGRA 1CZRA 3EJWA 4P3NA 4S1TA 1ELOA 4ZA2A 1TLFA 2BAGA 3RIYA 3T7SA 1VKJA 1A98A 1ABEA 1KYVA 1KMHA 2BJHA 3L02A 4BUCA 2CDRA 2FWBA 4I4TA 2CFIA 2DQZA 2DYKA 2CUZA 2NXWA 1QWOA 3DDUA 3HHPA 2HRRA 2YHSA 3U3JA 1QF6A 2FI1A 4EENA 2VDPB 2DFNA 3NATA 5K8TA 3ELUA 2OLKA 4FI3C 5FV7A 4GE0A 4Z9AA 3GLHA 3VR6D 3OKAA 4IDPA 3ANTA 4TMXA 2XJ4A 2AJTA 3BH0A 3K6JA 5DRTA 2PKCA 1R8YA 5AW1A 1M6EX 3PLNA 3FKQA 1H3FA 2GZ1A 3U3XA 4AMYA 5B7PA 4C4TA 4Z86A 4YA6A 3D81A 1UJBA 3WLPA 1MT0A 3P9IA 3TG8A 2BTQA 1WO8A 3G2MA 2LVBA 7GPBA 1QG0A 5A02A 4RXUA 2I03A 4M49A 4IJKA 5AKHA 4DV0B 4J8PA 5FH9A 3BQNB 1RKXA 2BUCA 2ZPTX 5FO1A 1J1IA 3DOUA 3KIPA 4GR9A 4B6QA 5K0SA 1Q15A 1T10A 2LKDA 4IFBA 2MYUA 3I1JA 4KIJA 5LA6B 4L15A 4JB2A 5AD1A 4BGEA 3QSYA 1HYHA 4RO0A 1DZ3A 3LGSA 4D02A 1PWXA 4BNHA 1LS1A 3AUXA 3DXXA 3EXG1 3WYDA 4D9GA 4E30A 4GL2A 1QE3A 2RHGB 5LZ5A 3UFBA 3QVOA 1LV8A 3N2GB 1YR3A 4AG3A 2MCFA 3HDYA 4MVJF 4PCLA 2C82A 1SAYA 2MSDB 1KVQA 2XT0A 3ZLBA 2Y4OA 3FTEA 2X0JA 4K6GA 3KV1A 3QLVC 4GM0A 5AW9A 4ITUA 5AOCA 3SEAA 4U6SA 2F9MA 2IOQA 1PLJA 1T3LA 1R66A 3GEGA 1UZLA 2VT6A 4RDCA 3EWNA 3PJFA 3ZHRA 2ZYTX 4O2AF 1VHTA 2EGHA 1TFRA 1HR0B 3NWOA 1EDZA 2JCGA 3K9GA 1DXQA 2MYPA 4YRMA 3BHNA 4P7GA 4EHLA 2VPTA 4U7JA 1NXTA 2WLTA 2ZUDA 4RTRA 3U13A 4U7PB 1ADBA 1NW4A 2VP9A 1EVIA 2GERA 4UASA 3RBXA 2XAUA 4KX3A 3OQPA 3C14C 3B78A 3L0YA 2O2GA 3QNUA 1F6BA 4LMBA 1C8VB 1E5TA 4XOUA 4TQGA 4M9RA 4H4CA 3K70D 3TXAA 1YDFA 5GAJA 5FI0B 4H59A 2OCBA 5J59A 2NSLA 1VTKA 1X13A 4A0SA 4JLSA 3J80A 2X3FA 3KFVA 1X86B 2ZJ7A 5DNEA 2G07A 4ZVTA 1RQ7A 1WV1A 2IHJA 3KT6A 1D6MA 2IY7A 1LLCA 5JSYA 3O93A 4DIKA 2GKOA 1Y9ZA 1XCBA 5G02A 1HC7A 1KWKA 1DEXA 4JT2A 4AP5A 1QIGA 3VU1A 1XAGA 1I1HA 4Y7CA 1NG9A 1MV5A 1QX4A 2YN0A 2XQFA 1S6YA 1U0JA 1YDEA 4NOLA 2DOKA 3B85A 4KWTA 5AM0A 3IR7A 1TDJA 3L7IA 2OTCA 3U7IA 1JG6A 2FMUA 3M34A 3TPFA 4ZV7A 2EZTA 3RUCA 4H4DA 3VJLA 4CM5A 3O3NB 2QVGA 1PNTA 3Q2IA 4O1MA 3I3SR 4Y6LA 1NAIA 1OYVA 2PGJA 4P86A 2Y8EA 4X6LA 1RQGA 4ZVLA 1T4DA 2G0AA 3OM1A 4CIVA 1YB1A 1SUCA 2HT6A 4QDTA 3AKDA 4L9WA 4OM7A 4PLWA 3RTBA 1H3EA 1DI0A 5LMZA 4BGIA 1I80A 1V8DA 1JKJB 2IU3A 3RQIA 3X1ZA 4REMA 4ID3A 1WF6A 4PAOA 3WI7A 1E7WA 1XQ1A 3OWOA 5D7NA 2WV9A 1QQAA 1Y89A 4O8ZA 4JWKA 4ZAWA 4BNYA 1Z6TA 1OV4A 5DGTA 4UU7A 3TQFA 3KVNA 4O4LB 2VYCA 1QVZA 1JBKA 1YFJA 2X8JB 4ZVQA 4L4SA 4FFRA 4E12A 2W8BA 4I81A 1YQUA 3NTRA 3UKJA 2J0UA 2OV2A 3HWSA 3NEAA 4QLBA 3IKVA 4HUQB 5JCJA 1SXJE 4QM6A 1P17A 1BE8A 1C0PA 2OGZA 1PQUA 1VMEA 4UAVA 3H05A 5ITSA 3H84A 2YDXA 3VPFA 5TPZD 2NU9B 1EVJA 4YUVA 4ZT4A 3PUIA 2J0EA 3U44A 3ORRA 1ZGAA 2P8JA 1AK9A 2KHZA 3GWGA 4KU4A 1RJFA 2PL9A 1DMRA 3MB5A 4CQLA 2YFQA 2H2FA 3GAZA 4WVFA 1XJQA 2V96A 4OFZA 3AP1A 2V0CA 1XLTC 4Q5IA 4W82A 3UGKA 3KWMA 4DVGA 4Q05A 1KNXA 3K0SA 3PWZA 2FUCA 3E53A 1R4AA 3RHFA 3EBOA 1E2IA 2Z6QA 3AKYA 2ZB4A 3MJCA 4YJDA 4IDNA 4Q6WA 4C1BA 3V48A 4YLEA 4QFDA 1GGMA 4MQUA 2PZGA 4U1RA 4WOPA 5KVVA 3GPCA 3UH0A 4NG4A 3Q8KA 3IDFA 3TR6A 2WJGA 2IODA 5IU6A 3ASVA 4Z8XA 3R1IA 3CF4G 3K72B 3KKZA 4GAEA 2X15A 1P19A 3EZXA 5AOBA 3W1VA 1SULA 3AFNA 3R3YA 4INZA 3OTGA 2Q3DA 3KR9A 1CNFA 2Q28A 2OENG 3FW1A 1ZBDA 1U2QA 1RJ9B 4KRXA 5JISA 3H1TA 3C3DA 1AX9A 2HXSA 3T3PB 2RI0A 2Z09A 2JLZA 5LCXA 4XB1A 2XTNA 3LDUA 5KJCA 3A7DA 1JEJA 1EMDA 5LBTA 1E2NA 3WIDA 4CV0A 1RVDA 5JD3A 4XWYA 3SS9X 3QM1A 4PTLA 1L4HA 4B3RB 3OCVA 1Z08A 2DFPA 4DLWA 2O8CB 1MO3A 7AT1A 3MBIA 3P2KA 3BTSA 5JDIA 4LAFA 3D9QX 4M76B 1JMKC 4NRDA 1TU4A 4JMLA 1KXZA 3RVDA 4BZXA 5LUBA 1OBFO 1AHPA 3HXOA 1YOBA 1XRRA 3LZCA 4KEAA 2MINA 3RVRA 2R1TA 4ZDKA 5TJHA 3PP8A 1H6CA 3O8OA 1Q0SA 3IDQA 4R8RA 5F1KA 3RRNA 3OECA 3QE2A 3PPYA 4F38A 1SRQA 5JCXA 4PX9A 1E3QA 3MHTA 3SU8A 2OP1A 3DM9B 1ECFA 2R6JA 4YJHB 4YCBA 5A0FA 3UMVA 1Z0AA 3TOVA 2B7LA 3IEKA 2WFLA 4LGMA 4TL7A 3TQHA 1PF7E 3B20A 1JR3E 2EV9A 1JR3A 4L5JA 4H3KB 4RDXA 5DTQA 1L5HB 4MV1A 3K9NA 3CLRC 4KYTA 2P1RA 2HIMA 4FYPA 1JJBA 3QELB 4MW0A 3KQVA 9ABPA 3M9XA 3LF1A 2WI8A 1JL3A 3UJ6A 3IAFA 3EIUA 4ZVMA 5HMMA 2FEMA 3FNRA 5GINE 2AG0A 2B36A 4AQ7A 3ZW9A 5K9ZA 4N7MA 3Q3HA 3EAFA 2FR1A 3BILA 2XMSA 1E5DA 3FMVA 2DECA 5TY0A 4GXTA 1E20A 3F6YA 4U2FA 2X40A 1UMKA 5DSXA 4IUCS 2QTGA 1CQWA 1C0LA 2ZG6A 3A1TA 3BWMA 5KC8A 3CNQS 1SC9A 4HLUC 4MQ5A 4LISA 3VUEA 3QXHA 1YB6A 3D43A 3KWLA 4NWIA 3LLMA 5DLEA 4C07A 1OFVA 2QMUA 1W7AA 2GWHA 5AVWA 4BLWA 3PGMA 4OBEA 1RIFA 5FYDA 3HVHA 3WO0A 1A3CA 2IHZA 2XVXA 5HBRA 4MW1A 4FN4A 4QDJA 3QPAA 4ARUA 1QTQA 4EM6A 4LRUA 1SXJA 4KN5A 3K9QO 3VX4A 2DY1A 1VYHA 2FEKA 5L4SA 1E4EA 2O50A 4JGBA 4LDPA 3TRDA 3GNSA 3N58A 2QNRA 1IZ7A 3PNYA 4MS1A 1NOKA 4RSGA 2UYYA 4JXKA 1DOHA 2PD4A 5ENZA 4RL6A 5FTJA 4D3ZA 4F45A 1A9ZA 2B2XA 3ZLTA 4EPWA 4CKCB 2QRLA 4P3XA 1ZG3A 5BRNA 5LDHA 2CMDA 3ZI0A 1KYZA 2HREA 3H65A 4O4JA 2FRXA 2FPSA 2OQ2A 4E32A 3PNLA 5TMEA 1VHJA 1MFZA 3ZDQA 2JL1A 1MJGM 3KWJA 3QVTA 1NNEA 4E13A 5E4YA 3N2GA 2TRSB 4KDRA 4C3UA 4PM4A 2DKOA 4UE3S 4QHYA 1HI9A 3IMGA 3STXA 1KU0A 1O58A 3B3GA 3KOZA 1X8KA 1OROA 1VDZA 3ZE2B 1JUDA 2APJA 1IBRA 4FX2A 1X87A 4ZDIA 2PZ8A 3DBLA 4PBRA 5JS8A 1H85A 2ISCA 2WWGA 2XLCA 3H83A 4IIJA 2GFIA 4IVQA 1I6KA 1YVDA 3T4XA 1XZNA 4PHHA 2ZS8A 2JFGA 5MGNA 2HQ1A 4QDZA 2QN3A 2B34A 4FGSA 2FN9A 5HFAA 1IEQA 2VA9A 3EW9A 3P2JA 2EL7A 1HEIA 2DP4E 3DL0A 1KDOA 1NBMD 2I2BA 2II6A 2OVBA 1S02A 3OETA 3Q8XB 4IMPA 4MP8A 3F8TA 4OJMX 2QUIA 2IOFK 3BBPA 5IDQA 4X66B 2FN4A 4MJXA 1KYYA 2SICE 3QVKA 2P3OA 4H0FA 4ZALA 2JATA 4XOIA 1RBZA 3O82A 4CF3A 1V3TA 1OHHD 1PT5A 3HUEA 5AFSA 4QYTA 5PNTA 1Q1BA 4DV5B 3TVTA 1R1DA 3UHOA 1V4BA 1HE3A 2QVBA 3K30A 2AMFA 3QJYA 2AE1A 1EJ6A 2XF2A 3TOXA 5JRJA 1L7AA 1GNTA 5HKAA 3MINA 1JZQA 1RYEA 4DLNA 4M88A 2AC4A 1T6NA 2UYOA 3TLBA 2IIPA 4US0R 1ODCA 2ZBPA 4ALLA 1F51E 1O9BA 4N8EA 3GFSA 4PBSA 4CUKA 3CO0S 1BDBA 3K9WA 4HBGA 1YQGA 1W96A 1SK9A 2EG9A 3DSRA 4MZDA 1I7QB 1R64A 1RPTA 2VO1A 1GCUA 4DSNA 2GZSA 4JC4A 4J2TA 4HLUA 3RRFA 1SU8A 3NAMA 1XRNA 4EJ0A 2GK7A 3NU1A 5ED4A 2WE7A 3GJTA 1YJCA 2PK3A 2F3PA 3R24A 1HZJA 2HWWA 1XWFA 3A31A 4GD3Q 4YUYA 4DR5B 1T9KA 1G8SA 4QICA 4MR8B 1XZMA 4X3OA 4KN8A 3KYBA 1I6LA 1I6WA 1VMDA 1A71A 5M7EA 2E4ZA 1USKA 2HQSA 1ZFNA 1Z6AA 2O3QA 2FWPA 1A1VA 1H8HA 5AI6A 4LC0A 3WLOA 3KQOA 1GPAA 2C58A 2QSUA 3WDSA 5A3SA 1UJMA 3FSRA 2DUMA 2VF5X 3K32A 3D1JA 5B2FA 2CLIB 2YYSA 1G59A 2QRVB 2EL9A 4HRAA 1O2DA 2IYTA 3TOCA 3TZBA 2A78A 2ZIUB 4WVLA 4M1QA 3HCDA 1DHTA 2IYUA 1SIBE 2B9EA 5ES3A 1EU1A 4WBNA 1R4ZA 2XOEA 2QLTA 1C29B 1L3BA 1HLFA 4HDRA 1ISSA 4EDFA 5DT9A 3EF0A 3ADBA 1LLFA 1INLA 1VECA 4IHJA 4MKGA 4UXJA 4XPIA 3DV0A 1Z73A 1ECBA 2VVTA 2ZJ2A 4D9NA 2OCYC 2ECOA 3HXLA 1HE1C 4Q7LA 5F2OA 3VVMA 4EZEA 2KLBA 2AW5A 3FSGA 5M5BA 3GLIA 4MH0R 5JNTA 4D6XA 2NUAB 1GAXA 3HP1A 2IGBA 5ALWA 5I7UA 4UNNA 2VHEA 2COUA 3KTFA 4YAJA 4WZ6A 3FIJA 3RSZA 3TSOA 1M75A 1MH9A 1UWCA 1XXHA 2WSBA 2XE4A 3VC7A 3GRPA 1ZVQA 1UZAA 3NKLA 4R2HA 3ZWNA 3EXG2 1A5ZA 2B78A 3AR7A 3JARA 1J1UA 5CLHA 4HN2A 4PE5B 2KJQA 3AO0B 4RXMA 4BQIA 1J23A 1C80A 5JNRA 3GMDA 4RCYA 1B16A 1ECPA 5E9JA 5EZYF 5FIUA 5TRTA 1X8XA 1A04A 3TJZA 1EK2A 4R31A 5KBYA 4GLJA 5A5DA 3S81A 2PWPA 2V55B 3KSZO 2C95A 2VK8A 4FQ5A 2CKDA 1Q11A 2VSXA 3C6XA 4C3ZA 3MCWA 3TNDA 1REQA 1PCXA 2I7CA 5DASA 3DPUA 4HP8A 1KH1A 1ENPA 1S8AA 2QR3A 3LP8A 2RGBA 2RGXA 3NOOA 4L5CA 2GSDA 3AF2A 4XUGB 3M83A 5IBCA 3A6PC 2BW0A 2K2WA 5DPMA 1EXNA 5FBRB 5AM3A 2BLLA 1QO7A 3ELYA 1II8B 5I9SA 3I05A 1E9DA 4JSYA 3DFMA 3GH1A 5D3KA 3L0IB 5EIBC 1KFEB 1O96B 4WESA 3OCCA 4M53A 4Z8YA 2H7VA 4X8HA 3U81A 1ATIA 1C30A 3PU6A 2P79A 3GGGA 4WA8A 5T41A 3RHSA 1HFKA 1ZA2A 4L8VA 4XJSA 3X1XA 3M70A 1N6OA 1R37A 3V32A 3O8QB 4G4SO 3K5HA 5FL7A 1DQPA 4GSLA 1J33A 2C9ZA 4BEVA 2NZ8A 3I8XA 4O6VA 4EY8A 2OBXA 4ZAGA 4YP1A 3U17A 2GTPA 4D8WA 2GBGA 2JCVA 4V02A 3ULKA 2PWAA 3USCS 4POOA 2H2DA 3JQ9C 2P4UA 4DIMA 4YCMA 3EVEA 3KO8A 4EHNA 4B3FX 1Q21A 1ISHA 1J39A 2F17A 4QJIA 3MT9A 4IF4A 3F4KA 4IDEA 4CL8A 4JHXA 3LO5A 4EKEA 4MSUA 4WESB 3DDOA 4ZO6A 2R68A 2NYRA 2OGTA 2REOA 2V5AA 3MVEA 2ZRFA 4HQKA 3A9SA 3WLJA 4BX2A 2H9AA 4U7GA 3KPVA 4KV7A 4BVJA 2LRHA 2NU7B 1Z4JA 4YBZA 2VG8A 1N6KA 4IUYA 1M1ZA 1CY2A 5ALLA 3TVDA 4DWJA 3G7NA 2IS4A 1QZ3A 4NDAA 1XDSA 5BW8A 4M7OA 4ARBA 1YDGA 3C8MA 1F0NA 2AC7A 3DF7A 4N9QA 5T4EA 3S4YA 2E6UX 1U8FO 2ZT5A 3G1UA 3IP3A 3ZCRA 2QN7A 1EZ1A 3JRWA 2C2KA 4AY3A 1DL5A 1RPNA 1XDZA 2EEPA 2GA8A 1E2GA 5TGDA 2IU0A 5FI3A 1HQCA 3RYCA 3F2IA 1GAWA 2P77A 4NBWA 1Z16A 1S1MA 4KO1S 4K3VA 1IVYA 5CDFA 3RK4A 5LP6F 4G0NA 4Z4IA 3CCFA 1YU9A 3FWNA 3RVJA 1UZUA 3OLQA 1NKTA 4EYKA 4HNTA 1SXJB 3G23A 1E1CA 5I9MA 5IXYA 4WLEA 1FX0B 3D6UA 1N2CE 1USUA 2WTNA 2ZK7A 2YJ3A 3AX6A 2FZKA 4K2AA 2ZWPA 5CB0A 3MTIA 1JLSA 2PRIA 4GX0A 1CE8B 4PSUA 1OLOA 1WZEA 4N5MA 4CL0A 2BI7A 3QF4A 4NJMB 3ANNA 1YBFA 4YPFA 2BF7A 1YMQA 4U9UA 1YJ5A 5C52B 4ZT6A 2DPXA 2HSEA 5BNZA 5CK4A 1I2BA 3DAGA 1LQTA 2YRXA 4XYBA 3BM5A 1KWGA 3W78A 2EOAA 2YINC 3D0OA 2ZROA 3VYWA 5ELXA 3HN7A 1QGOA 1ZIYA 3ESYA 4C7BA 1G20E 2G5GX 1PL0A 4D9EA 3DOHA 4LOJA 1A96A 3A6EA 3M89A 1XR3A 4KQFA 1RHRA 1UK7A 5LP6C 1W4BA 2G76A 4JP3A 3WS7A 5FO0A 2BFMA 1DJNA 1V11A 4M9ZA 2ZSJA 3INTA 3P9QA 4BNTA 1XKLA 4ZDJA 4KIWA 3VJKA 3R9KA 1W4LA 4CM3A 4PN7A 2PZAA 2MHCA 2R7MA 4EJSA 2EIXA 3H19A 4TTQA 2XXAB 2BKUA 4DCJA 1HDOA 5BWLA 2NVWA 2PU5A 4BKRA 4KE7A 4DYHA 3BREA 3QFFA 2GEFA 1NJ2A 5LQNA 2C8JA 1K8RA 5MFPA 3K6SA 1C9KA 1PW5A 4O2LA 4O2BB 3MTJA 2FEAA 2PSHA 2W2MA 2R84A 5K45A 1QXSA 1YO6A 4MB6A 4PZEA 1HL3A 4LJ5A 1YNSA 2G06A 2YNMA 2C3PA 4KXYA 3DEIA 4YFYA 2DEUA 2PAAA 3OMWA 1F8GA 1WQ4A 2N9UA 3G13A 4B3GA 2L2QA 3MWDA 5JECA 1QNFA 5HCNA 1PL7A 1S0UA 3QKWA 4A6EA 1NQTA 1C7EA 3NS7A 4KB5A 4NMLA 4QWMA 3R6WA 4ZEMA 4QSMA 2CFCA 3AEKA 3Q12A 4ZYVA 1AIPA 5LP1A 4KR3A 1KGSA 5LZ9A 3NO4A 3OD1A 1ECGA 3KQYA 3VNAA 4TSKA 4Y2TA 4LWOA 2BTOA 2QG4A 1M1YA 1Z82A 1E8DA 1VIMA 1C7QA 4J0DA 3DD5A 1E0SA 2IXGA 5K4GA 3T0FA 5AVJA 5CDTA 2XB8A 1GFWA 2V9CA 3DZDA 1BJTA 2QX6A 4K6OA 3PR2B 3Q3EA 2AN5A 4RHYA 1U8EA 4RFLA 1BFDA 3I01M 2WWWA 3NVAA 3WGJA 1OWMA 4HGOA 4TRRA 4X63A 5KYUA 3X1YA 2NNWB 4AJIA 4EKYA 4L5YA 2SKDA 1XDWA 4R8SA 4RHCA 3EIFA 3EDMA 4A2WA 1YIDA 2B5OA 1ZKDA 5BT9A 3V8QA 3ZVLA 5L51A 1PQ4A 3GLVA 4UUQA 1C3VA 4PYQA 3VR1A 3WL6A 3LZ6A 1BTOA 4HUQA 4OGWA 3S2YA 3WNBA 4E5DA 1PTJC 3ZJVA 3U40A 1ODIA 1KDPA 1XEWX 3WHPA 1CPYA 3ZQUA 3BK1A 3RSQA 1KTIA 1ZSVA 1LGYA 1XNRB 1FDSA 3T1OA 5IDVA 3HKEB 2CBXA 3NB0A 4XVQA 1IHDA 3ZHQA 4AKGA 4QM7A 4WK0B 4JP2A 2B98A 2GD1O 1L4LA 2XVYA 4HH4A 5K2MA 3GH3A 1VL8A 1LVHA 5F52A 4GSYA 2G4VA 5G41A 2OM6A 3VTFA 1RXYA 1CDZA 5AW6A 4BN0A 1U2GA 3MMXA 4B3MB 3NASA 3IEMA 2A59A 3O0TA 3R3ZA 4WOCA 5IKXA 1QV7A 5C4GB 4ITRC 4DCGA 5CRIA 3VU0A 4DT1B 1UMDB 4NZNA 1KDYA 2R62A 4HI0E 1VSVA 4YYEA 5C81A 1S01A 3EQ2A 2WJAA 5H80A 1QO0A 3MS2A 5JALA 1FYWA 2RGCA 3UWKA 2EKQA 2WSIA 4G56A 4EA6A 3T35A 2AC2A 2YCBA 3HJGA 4NESA 1KQ3A 2HTEA 4D45A 1KSJA 1G60A 1SKUA 4F4DA 1FU7A 2Z2KA 3HJRA 4FFSA 4TM8A 4CQLB 1OHHA 4RGQA 1KOJA 3BCRA 2ZBEA 1U3VA 5HRCA 4LRSB 2BVNA 4K87A 1I1NA 1V8ZA 4MX8A 5J2UB 1BCRB 3BA6A 2WQ7A 1NXPA 1GPJA 1V7PC 3IPCA 1EP9A 4LBZA 1F14A 1K8QA 4GKVA 1QIJA 4QEZA 4RH1A 1C8LA 1KEEB 1T26A 2I5PO 4QA9A 3A37A 4LDRA 3K09A 1HYGA 4NONA 3QLVA 3FMPB 1TRKA 4QDKA 4YQFA 1WMSA 1Y48E 4BFVA 4Q66C 1R74A 3EQ9A 3EZ6A 3E48A 2Q2WA 4YEDA 2RC6A 3M5PA 4IV0A 1NI3A 4ML3A 1NFQA 1Y33E 5DV9A 3TTSA 3AHCA 3PKIA 1QHYA 2IL1A 2QLNA 3A1EA 1LD3A 1WHTA 2N75A 2AF3C 1NATA 2W2KB 1AT1A 2FLKA 2FW6A 3ITDA 3LUFA 4JQYA 1N5IA 4AN1A 4NU5A 3PC6A 5NLLA 1FMLA 2WAYA 4PLHA 1J24A 3FFTA 2GB4A 4CQNA 3FJ1A 3EULA 4I6EA 1C1XB 1RVV1 5CK5A 4ZCPA 2QSYA 4WE3A 4E2FA 2B92A 1WXIA 1JEDA 2O8CA 5CT8A 1IG0A 2ZCVA 2GXQA 2Z4RA 1IN5A 3VUFA 2O2DA 5IX8A 5KIAA 1E5QA 4LF4B 2R87A 4N6NA 4UD2A 5H5JA 3IQGX 3T0GA 1Z62A 1I7DA 3EK2A 9ATCA 5LU8A 1H0SA 1BYUA 1RMTA 1H1LA 1ZAKA 1J0BA 3PQFA 3QY0A 1L4KA 2XB9A 4MGYR 4MW7A 2VHZA 4QFMA 2R3SA 5COBA 1U7PA 4MEBA 2YXNA 2YVUA 4BBPA 1TJ4A 2OL4A 1O08A 1DINA 2C3YA 1G6Q1 4P35A 2E6KA 1HX7A 1D2NA 4DIBA 2UXCB 2JLXA 1DAMA 2Y0EA 1SXJD 1I4LD 2ZJAA 4MYDA 1ZPDA 4JFAA 3RRBA 5FL7D 3O6VA 3VR0A 5JCZA 1CHDA 4M0EA 2PCJA 5A6SB 3IAS1 1BOOA 2I67A 1G6OA 3I30X 1DDOA 4HDMA 3ZTWA 2P30A 3RUEA 1V7QA 2B25A 3CNBA 4DIOA 3E9DA 5D3QA 1R3UA 3GGPA 2QTNA 1JLRA 5G4KB 3E7WA 1XELA 3KZNA 3B2EA 1CUUA 1UDRA 2I55A 4GPTA 5BR1A 1UBSB 3OUTA 3ZCPA 2JGJA 2RB4A 3VISA 5JO0A 1DX4A 2C7OA 4YJ2B 4JI7B 3Q7QA 3TI7A 1K98A 3QKTA 1ZIDA 5LXTB 5JVDF 1U9JA 2JFBA 3OU7A 1U94A 4PANA 3WLNA 5K8CA 2XZLA 4UZFA 3GFPA 5EMMA 2PR2A 3PEFA 2FMKA 1U2PA 5DBHX 3HVIA 1LSSA 3H4MA 2XTZA 5JRDS 4H27A 1YJQA 5LQDA 2RJOA 3NPAA 3KCQA 4DV7B 4B9AA 1J00A 3PYLA 5BURA 4KACA 2I1VB 3K53A 2HRQA 4ND7A 2VPPA 4YRIA 2O3UA 1SOUA 5E6RB 4KPFC 5JQGF 4R8LA 2ZCUA 2FPWA 2FP3A 2XRYA 2IT1A 4LV6A 4F1WA 3A2NA 5C1OA 1M1NB 4CE6A 3CSUA 5T3YA 5CLLA 3MTGA 4OP1A 4FW9A 3L8HA 4JJGA 5GIOE 4R9SA 3RV4A 1JBQA 4QX6A 1NX9A 3I0MA 3IUYA 3OHSX 4YASA 1F2UB 3NT2A 2VNJA 2AMYA 1OQAA 2ZAGA 1NDHA 3W2IA 4BAUA 4BFCA 2UVPB 1ZOSA 5JXGA 4ATNA 2IF0A 3LJKA 3PNKA 2BOVA 4WMLA 2C5FA 4G9EA 4J1QA 3OM8A 4XYMA 4AURA 1HG0A 1XPOA 4LRYA 3VNVA 1BHSA 3WGTA 4D7AA 2CLDX 5IP5A 1A72A 1KK1A 1M8FA 3UV3A 5HJ2A 1JLHA 4RZIA 5EKUA 4F3NA 3D8BA 3EOZA 3IQIX 4QREA 5LJLA 1A7AA 3D0KA 3OIVA 3JQAD 4FFOA 3RFVA 5HTOA 3EZLA 4NCJA 1PJ2A 1YHNA 4BZPA 3JYPA 1M2JA 3SSNA 3C3WA 1DBQA 1XDDA 1ZI6A 3DFKA 4LQCA 4GGPA 4Q15A 2PL3A 4CCWA 4I8DA 2D13A 2UDPA 1USIA 3PZRA 4UKDA 2BGMA 3K8OE 1WDLA 3Q3CA 3A6DA 4IDGA 2FP4A 1H8HD 4LVOA 5I9LA 1AKTA 3CEAA 4MV3A 4W6QA 3E9QA 3O2JA 5TQ0B 1W36C 3A14A 3PQ8A 2RMKA 5ICFA 4H7PA 1LY1A 1HE2A 1LW6E 1YS6A 1W0JA 1KFCB 1V1JA 2ZJ3A 1STOA 3KHSA 3NH6A 4N39A 2QN1A 3A36A 2GI4A 1XNJA 3V1YA 2ZQ5A 3P96A 1EM8B 1TAHA 2J3QA 4P08A 5FNVB 4KUEA 4XRRA 4ARVA 3BMQA 4CUZA 2Z5VA 1PEKE 4J7UA 4PFSA 3MUFA 4TXJA 1E2EA 1UM9A 4HWPA 1EXDA 4Y2QA 1SKYE 2RDMA 5HMLA 4A8JA 1S8FA 3M33A 4MUMA 4XCQA 4EHIA 1UQRA 4EWLA 2GD2A 3BCSA 1XP8A 4P4TA 2EJCA 1VJ5A 2Q49A 2PHZA 3NC4A 3P9PA 4P22A 5ARDA 3T06B 4C6SA 2B99A 5ITVA 3TLEA 3IILA 4ZVOA 2PRZA 3CPJB 5G4LA 5A3VA 2ODBA 4NJOA 4IM7A 4R0VA 2HA4A 4Z49A 4UHEA 5H70A 2IPMA 2M32A 2NV0A 1P2FA 2F3SA 4LXXA 1FIUA 2RHTA 2X7JA 4NBTA 3AFOA 3TR0A 1CQJB 4PYIA 1TF2A 1AZWA 2QBYA 3ZX4A 2XEXA 2FZGA 3HXPA 4O02B 1QZTA 3UV7A 2EVWX 4CKYA 2F62A 1N32B 2QNBA 1ZEJA 2ZIVB 4DPMA 4IIVA 1NTOA 5FLKA 4RPHA 3CVOA 2HU7A 4JLKA 1QF7A 1VB5A 1R2QA 4IBOA 1XN1A 2FSSA 3RGWS 4UPVA 1QGYA 4N76A 2PGAA 4ZOLB 2HHLA 5F12A 1USWA 1DV1A 3VV3A 3KJEA 1B8UA 1QRRA 5JZBA 3H9EO 5A62A 4JJAA 2DCMA 2XZTA 4GBJA 2H29A 5HOQA 3PUKA 1WU7A 2QJRA 4CNBA 2IRWA 3Q7TA 4JI1B 1WB9A 1HDZA 2QWXA 2AOUA 4XW2A 1YMUA 4E51A 4QU8A 5IYZA 4OO3A 4QOIA 2V6MA 4KK3A 1XZLA 4P3OA 3TZKA 1AB6A 3UM9A 4KVZA 2YWCA 2ZYVX 1GZ3A 2Q5OA 1ONOA 3CJTA 5AKZA 3DO5A 3H9JA 3OFJA 2PJRA 4Q47A 4XGKA 3R7LA 1JU3A 4FNGA 3OFVA 3V8RA 2XQIA 5KHAA 1RC0A 1NRWA 2R7AA 3G9QA 3GEDA 3MG9A 2B20A 4UCWA 5EZSA 3WGLA 1XNQB 4PC7A 2CF6A 3KEMA 3V3TA 1WMEA 2L17A 3E3NA 1NYTA 4R1OA 1L7DA 2I4IA 2HQOA 4ZEOA 3WL8A 5KVSA 2O9JA 2PUCA 4J16A 3ZHYA 1PUJA 3C3BA 1KXJA 3NLLA 2RHOA 3HEMA 2QDXA 2JJ8A 4L75A 4RELA 3I32A 5CXSA 1ZNXA 4LJLA 1GPKA 1UJ6A 3CU5A 4XA8A 2AZ4A 3PDJA 3Q9SA 1SB8A 2J0UB 1QTNA 2A0UA 3ANXA 4GC9A 1KEEA 3EEQA 4YO8A 2PV7A 3THRA 5A4JA 2J31A 3L04A 1SBQA 3QVLA 1UT6A 1MC8A 5CNKA 4P3YA 3IERA 3MOIA 3UHAA 4AJHA 4D5GA 3HVKA 1PR0A 1ZH8A 4WOBA 2A6PA 3TFWA 4RKEA 4RA9A 1CY7A 2I78A 1NVEA 1SUFA 3FTQA 2AD1A 3WFIA 1DAFA 3V55A 2Q8PA 3T95A 4EKNB 4NCBA 1XHFA 4NPHA 1F9EA 4AI6A 4EK9A 4UOZA 4OREX 2A0KA 4B79A 4CWAA 5IJ9A 3UQYS 1ZR4A 3GVXA 3RNLA 2Q7XA 1EWYA 3IAUA 2PXHA 3M4ZA 2J67A 4DJ5X 1X80B 1PL6A 2QAGA 4OHRA 4BO7A 1E9RA 1USGA 2KQUA 3KG2A 1H2BA 3EZ7A 1V6SA 1DDGA 3JWGA 3LWBA 4YTEA 1HLPA 5L7TA 1IN6A 3IGFA 1ZOIA 3WB1A 4P4LA 4RNCA 4Q3OA 2HCFA 2YN4A 1IG3A 3QEMB 2OD7A 4HLCA 3TN7A 4LJ4A 4B17A 2OR3A 3BT7A 4HSGA 1WB4A 3GNQA 4E5KA 2QUAA 3KJFA 1VI5A 5IVPA 1OZHA 821PA 5FEUA 3FWKA 3QOWA 3DVAB 3OG9A 1NM5C 4NCKA 1E7MA 4ND8A 2C07A 4QUBA 1VKOA 3AB8A 3OPNA 4D2IA 5CXQA 1ONNA 721PA 2JBHA 5KQGA 1L3CA 1UAYA 1Y1LA 4QBKA 1XLUA 2O7RA 4KNWA 2H2HA 3GYBA 4NULA 1U3WA 1T2UA 3F98A 1KSHA 2I6SA 2Y71A 3G7UA 2CV2A 3OIDA 4RY8A 1G3UA 2G5PA 4LNHA 3WOHA 4BGVA 2OVFA 4LMRA 1Z28A 1A2KC 4OK5A 3RH0A 2HMUA 3GD5A 3LTEA 2PU7A 4OBXA 3TEFA 3BMNB 5G1NA 5IW8A 5ICSA 3BK7A 1Z06A 5IAJA 4KCGA 5GOTA 3RU7A 3IMFA 2JLRA 2CK3A 2PKQP 3LECA 3F1LA 3U3RA 4CGYA 4F9GA 5HK9A 4WRRA 3CEPB 1MMFB 3AINA 1T2VA 1R8XA 2FZ5A 4LKOA 4U9IS 4U63A 5E9WA 4DY6A 3S2IA 1C8BA 2VHYA 3FVWA 3TD9A 4NE9A 2P7IA 3GEEA 3KPUA 3OX1A 4UQOA 4BECA 4PY2A 3WAJA 3L84A 3PNOA 1IDN1 5CX4A 4N4AA 1XZGA 2WZDA 4KH1A 1WUYA 3I0NA 4AN0A 1GGFA 2R1UA 1SCKA 2VUSA 4MWEA 1PD1A 1PO7A 1R10A 2NO5A 3GCXA 2GRAA 4WY8A 2IYWA 4JCCA 3WX0A 1MZPA 4F3RA 2J9GA 1ZONA 3RSLA 2YQZA 3C7AA 4M1MA 1BMFD 2I3ZA 3OCWA 5E2IA 3TZEA 3C1AA 3L3BA 3EARA 1MB3A 2YC2C 3GLSA 3W5BA 3F3KA 4KXXA 2HF9A 1PZNA 2FCAA 2X1HA 4Q19A 3VGJA 5BY2A 4J0CA 5BYAA 5LWQA 4AMZA 3PHLA 4IDFA 1EB9A 3BSWA 4QULA 1M72A 2HPHA 4RE6A 2XDQA 4E4YA 1T8WA 3H4VA 1CZLA 1M6NA 4BVEA 2GBLC 3M3PA 3PXCX 5C5CA 5M04A 1Z5ZA 1CS4C 2YQ5A 3WMXA 2M98A 2WSSD 2BBOA 2VC2B 4FYJA 3DBVO 4F8EA 3GLFE 5G3ZA 3ZUPA 4YROA 4Z9YA 3UAVA 5KYYB 1U0OC 1KBZA 3C5WP 1HFJA 3LLVA 5T57A 4BDTA 1F1JA 2G88A 2LR0A 2I9PA 4ZCQA 2ASVA 4DBVO 2UXDB 3MZ0A 3I6YA 1JIXA 3P4XA 2B0CA 1K6XA 3C7DB 1AS0A 1P8JA 1D4ZA 2RKWA 3QHPA 1B4DA 1SOAA 3V97A 2IBTA 1ZLXA 3R76A 4MVJD 4RH0A 1JVNA 1P1JA 2ZATA 3A4TA 3C2QA 4UBNA 2DT8A 3WLQA 4MIOA 3ZEIA 2RK6A 4QQFA 3LHDA 5JHGB 3GGJA 1G7TA 1OI7A 1H42A 2PMFA 3OU6A 4WFIA 3JQGA 4UARA 2HO4A 3P2OA 5C80A 1XMOB 2O8BB 1ISJA 4ZXPA 5JTTA 3UW1A 3OCXA 1NQOA 4QQKA 3KOOA 3TNYA 4FYYA 5EE5B 1QVAA 2E5FA 3W7VA 2HADA 3CTMA 1XEAA 4H77A 2B4AA 3RT9A 1WPQA 5FNVF 3U44B 1G5RA 1WBJB 2W6OA 3CBGA 3OP4A 4WCFC 1EK0A 2O2XA 3QW2A 5L3SA 1SQSA 1XTJA 3CVWA 1LX6A 3AF3A 1A2OA 4ZVVA 4R2LA 3F67A 3WKDA 2Q0XA 3CPEA 1NOJA 1P5RA 1G6HA 1ZEMA 3KNZA 4HC4A 10MHA 1U63A 1NVWQ 2JIRA 2Q8QA 2WUEA 1UPCA 3FSEA 5DHQA 4YMVA 2E4YA 3C5VA 4IJMA 4RK1A 4AK9A 3DP9A 2AR0A 1ULZA 1K6IA 3F7MA 4FFVA 1PJTA 1QQ6A 2J3EA 4HMQA 4DJDC 5AM4A 4K9DA 3ZXXA 3P4YA 1RXCA 2RKOA 3JD4A 2I87A 4XVCA 1S3FA 3SAJA 2OXIA 1HE8B 2P90A 2W22A 3I6QA 4QOFA 5F2NA 3E9CA 3S1LA 1OIXA 4UD6A 1ZXBA 4PIPA 4CIDA 3WSVA 3JWIA 3EH2A 4Q7MB 3LBYA 2PAFA 1FJ2A 4H7JA 2G04A 3DHNA 2HC9A 4C0HA 2IQIA 5K0TA 3GLIB 3ZYZA 2JW5A 3VR2D 5FQNA 2QSJA 2X14A 4ZT7A 4W5NA 2P11A 2HCBA 3KC2A 1ZOPA 3DZKA 4GWLA 4ER6A 4QATA 3PQ3A 1TVCA 2ESRA 4CLXA 1FFXA 3D7KA 5LVAA 1W93A 2ZPUA 2QE7D 3EXIA 2JG3A 2BM1A 3LOUA 1GCAA 3WTCA 3WVNA 4PYNA 5HS6A 4R1UA 3MERA 2Z30A 2J4CA 4W6ZA 1N8TA 4JLBA 1XMJA 4LNAA 4XCXA 3PEUA 2OHJA 2J5QA 3C87A 3QEJA 5B7QA 1G20A 3OLXA 1JKIA 2VPYA 4O4IA 2D2IA 4F3TA 4N03A 2EJUA 1U1EA 2J9RA 3I5MA 3LUHA 3JV7A 4MCAA 4UU8A 3TCXB 5C1PA 2CBGA 4AS3A 5IASA 1VA4A 2TS1A 1O5IA 3K0CC 1E3LA 1QAOA 1X3SA 2P6MA 3ESAA 1JNXX 3OTWA 4YJHA 2V58A 2W00A 1PT9A 1LUAA 1UZNA 3C3EA 1ABBA 2H6EA 2B5WA 5KNBA 2J9XB 1P45A 4BAZA 1Q3HA 4CT5A 3AVYA 2AG5A 5LD2B 2ZYIA 2A9KA 4PNEA 5EWMB 4IOKA 2Y2UA 4DBLC 5K3OA 1Y4AE 1QPZA 3F5SA 3JQPA 3P9NA 2Q3MA 5GM1A 1O96A 4YUWA 3G7SA 4F12A 3FTFA 4DZZA 4RTOA 2H5IA 1VCMA 4AO7A 4AVYA 2NZWA 1G3RA 5FUXA 5FBQB 1QFXA 4I5EA 3BFVA 3RU9A 4A73A 3KAJA 3AVUA 3G2IA 2PSDA 4QPZA 5BW6B 1G21B 1AV6A 5FUQA 2AN4A 1NBME 4OJNA 3Q3IA 3BE5A 3MTEA 4KMRA 1CF9A 4QD3A 1GM5A 4ZRMA 1V3VA 4M0MA 3HU1A 4WW0A 4YB8A 2X0EA 4FPXA 5HQ3B 5ELMA 4TSRA 1YQXA 4Q1VA 5DLPA 3GB9A 3GLRA 1E9CA 3BFXA 5AI5A 1SZPA 3S3TA 2AOXA 3Q8MA 2GNAA 1KARA 4JIGA 3E8XA 1FE8A 1RZRD 4Y3UA 2B61A 2X3YA 1KYQA 1KETA 4O2AA 2WV7A 3DO8A 2N1MA 4WKOA 3ZU2A 1QUEA 4KSBA 1MUUA 3I37X 4OYYA 4RSRA 2GH1A 3KYJB 1EJBA 1UEIA 3L8ZA 5HA5A 1NUQA 1E1QD 2OQIA 5BNTA 2JHGA 5A4FS 1CJUC 5A06A 5ICMA 2ZUFA 1HQKA 5ALXA 3GDHA 5U4XA 2GJ4A 2BL4A 4RU1A 1ADCA 5JSHA 5JSZA 2AOWA 3FFWA 1XSEA 2PTHA 2ON6A 4JCOA 4LBYA 4XEHA 3P9KA 3EQ7A 4UM5A 1WUHS 1NVXQ 1X1AA 2IW1A 1WABA 3V00A 4AFNA 5IMSA 1KZ7B 3N0VA 3GG9A 1WTAA 2C5BA 4DHEA 1G4HA 1R5BA 1M1YE 1Y3DE 2PBFA 3HBLA 3SVZA 3IKMB 2PEZA 4YJ2A 3AR2A 4S1VA 1DXHA 2H2WA 4IHJB 2Z1NA 3GO4A 4LE2A 3ZWCA 4GMFA 4IOMA 1F4PA 3HJNA 4XWWA 1NGSA 2Q2NA 4MV6A 3L6EA 4FNMA 1U9IA 4ZHQA 1PZFA 3QWIA 2D5BA 4RY9A 2EFEB 2CXXA 4TUYB 1QIKA 3WWOA 3AERA 2IYPA 3PFFA 2NUBA 3GYGA 3BERA 3PX3A 4D0GA 2JIOA 3GJSA 3T9DA 2F43A 1SR8A 1YUNA 3SS7X 1E6CA 1G8YA 1Q0TA 4U7DA 1LSOA 4BO8A 4BNIA 2MOKA 2Y76A 5DLYA 4DMUB 4DR6B 2IH2A 4ZVUA 1O87A 2DBQA 5LBUA 3RAJA 1B6GA 3EBPA 3EYWA 1GPUA 2SECE 2XMGA 1L7RA 4AY6A 1J6UA 3QOYA 3CQ9A 3KALA 4AROA 1XTBA 1DAOA 3SJCA 3OLWA 2D0PB 2WT8A 4ND5A 3L49A 3O7WA 4V0KA 4X1KB 5ARCA 2C9CA 2P62A 4IDDA 3I23A 2JJ2D 3F6BX 2V4MA 3GY0A 2ZJYA 4QJ5A 3WNCA 3TKLA 2BGLA 4CDGA 1IQUA 2YXDA 3M2PA 3GQBA 4PV7A 3R9IA 3LD9A 4KMSA 2WR8A 1RMQA 3FFXA 2D0IA 4YMTA 2X2EA 4TWIA 4D82A 2XDAA 5FF9A 2AJBA 3OCZA 5F78A 1P74A 2VS1A 1RLTA 2Z2ZA 3FCXA 1H2WA 1R5JA 4KREA 1CZOA 4BB6A 1P2TA 3Q6IA 3L8FA 5JOQA 2AJ8A 1SZDA 5DBIA 1SNYA 3L0SA 4HDRB 1KP9A 2O5VA 4DQ0A 5TT1A 3W9YA 4EPYA 3AW8A 2X5KO 1DPGA 2H4YA 1TW2A 2K2QB 4HEQA 1K27A 3OEEA 4FD3A 4BEJA 2WWYA 1LBQA 2X4GA 3NVMB 3G1TA 1ZWLA 3GPBA 3KDPA 5EKTA 1T25A 2DLNA 2GM9A 1ODJA 5DK4A 3FN4A 4EMBA 1MNQA 1PK8A 3EA0A 2QP9X 3HDVA 4EF5A 5BPFA 4CW7A 1DKPA 4CMIA 1ADFA 3L1KA 1N0IA 2PCLA 3JQAB 3NXSA 2JRLA 4E0BA 3QBEA 1P4HA 2Z9DA 4GOMD 3UA3A 3FKSA 1QFSA 4QDXA 4XSVA 1JSXA 5LNK1 4CM7A 1QP0A 1JRLA 5HDQA 3VNSA 4B31A 2Q50A 5BSGA 1XZBA 4V1CA 2CXTA 3GLFA 1W8DA 3THOA 2I1QA 1MIOB 5EE3A 2C0QA 4HXYA 1HYBA 2WVJA 4D57A 2BSAA 5BOSA 3AM3A 3D7LA 1NXXA 4QQRA 4WFJA 5JARA 3H3XA 1X8JA 4QFCA 5DEOA 4KBFA 1RQRA 4IHQA 5BMVB 4RD6A 1ULAA 1SPBS 2CLCX 1BX1A 1LNZA 1U7XA 5SV2A 1AQJA 2G17A 2PPLA 1P33A 4HRYA 5K0ZA 5THXA 2OHGA 4EW3A 5AW3A 1U8YA 4K86A 4MLDA 4MVWA 1D0VA 1YC2A 3ME5A 4HGRA 1NWCA 4PSVA 4G2TA 3EIQA 1OJ7A 3QE3A 2LIPA 1E3EA 1G5PA 4LMAA 3RF7A 1KZGB 4PQYA 2IGTA 3TLYA 4ARIA 3L7MA 3G0BA 3WYEA 4UTXA 2DH5A 3LBFA 3KQSA 2W6MA 5B1EA 1J1ZA 2J6BA 2ONKA 2WKSA 5IN4A 1QCDA 1QLJA 4RVHA 1N6IA 3K0BA 2ID4A 4B75A 4DCSA 1EFPA 2BE7A 4Q1DA 3UK2A 3MYYA 1GJRA 1TLTA 1ZW1A 1ESMA 2ZDGA 5JXIA 4IGAA 1ZUNB 4ZQBA 1CDEA 3I1YA 3EFEA 4RIIA 4ZTUB 4CR6A 3QMMA 3FI0A 2NU8A 2YZGA 3T9AA 2H1VA 1BA2A 2Q9BA 3R40A 4OHWA 3NZEA 3PNMA 1TVKA 3BK2A 1T1GA 2H08A 3OQ1A 1GOTA 4Y2XA 4D44A 1WCYA 3K0EA 2JFPA 3P52A 3I52A 3K6SB 4JOSA 1CB0A 2BE9A 1PZHA 3SBEA 3WISA 1T0UA 2H4WA 4UDYX 2C2BA 4KTTE 5U1PA 3USZA 5LQKA 4TZ0A 1AV7A 3G8AA 1BDIA 1JFTA 4OQZA 2Y1GA 2VPWA 1NDQA 3UMCA 1TQ6A 3G0OA 4BUZA 2WJ4A 3BRSA 3OZSA 5TB5A 3O47A 4LWQA 4Q9JA 2A1TR 1V39A 4ND4A 5C46F 4LQ4A 3LFUA 4MRVA 2WEKA 4AJOA 1VGRA 5CX1B 1KQFA 1VJ1A 1IJFA 1QGZA 2JH3A 4QT4A 1PV2A 4F9TA 3RWOA 4YT8A 3FDXA 1JYFA 3GDFA 4IRMA 2JLSA 4YP6A 2VQ3A 5FBWB 4J91A 1R0LA 2J9FB 2O7VA 3COZA 9MHTA 2FEXA 1P77A 2BBWA 3S40A 1PNRA 1NN5A 2QEQA 4QHTA 4ZQHA 3JS5A 5BO5A 4EP1A 5A4AA 3QITA 4GF5A 1Y3FE 4ZODA 4CMJA 2CXHA 2D59A 5HIMA 4LMPA 3RS2A 1OMOA 1P2GA 1TKRA 3A1NA 4L1KA 1MVLA 1DLIA 4LXHA 4F4CA 1XMSA 2CLFB 5E3HA 2WYWA 1K97A 1XQ6A 4IMIB 3Q2OA 1P2BA 3QOXA 4CMEA 3UYKA 1G1MA 3AUTA 4RTKA 4OFWA 4C7XA 3TECE 2J48A 2VPZA 5B6PA 3REGA 3H11A 5DM0A 3DE2X 4Y6PA 1SUDA 3NNDA 3QUQA 3KE8A 5JG7A 5P8WA 3FB4A 2Y05A 2WTUA 1RWMA 1SO8A 2H4ZA 3TR5A 1Y7TA 4URZR 4C2AA 2DJIA 5BPHA 2GO7A 3IIKA 4B82A 4LY3A 5JZSA 2WT4A 5I9IA 3CZCA 2R25B 1WCWA 4R7GA 4DG9A 1S2LA 4KIGA 5C5IA 5LFAA 2XX3A 5GJVC 2WPNA 4W1QA 5AI0A 2HDOA 1SB9A 2HXYA 2XA2A 1GTRA 2J1LA 2HPVA 1R8JA 2PKXA 3UMGA 4PGMA 2CXNA 3G02A 3DNPA 2I2XB 2IZ5A 1WV0A 4BX9A 5KX5A 4KWEA 1JYSA 1JGTA 1SD2A 3AT1A 1GG8A 3DOEA 3L0OA 3MJEA 4ZP1A 5EUMA 2ZZKA 2AK3A 1O77A 4B3HA 4QG3A 4P2GA 1FJHA 1JPNA 5IBPA 3UC9A 4JXXA 4OJKA 2R8BA 1G2PA 3NQ41 1FP1D 1NVMB 2H8KA 2J41A 4QXQA 3WLTA 2EP7A 3OFKA 1KVRA 3JD3A 5BQPA 4XDZA 1FDVA 1T8YA 3DEZA 1R4NB 4OM8A 2AB0A 3R7SA 3WADA 4YI3A 3LBNA 3NV9A 3G0IA 3RSCA 1A9PA 1HDEA 4RF5A 5JFGA 2BTQB 2H4FA 2P67A 2IEZA 2V54A 3H9UA 4V03A 1JAYA 2VXYA 2FX5A 1X7GA 1T0PA 4NS1A 4Q01A 3RANA 5LMNB 1E2FA 4DLKA 5LKRA 3F47A 3A9WA 2NXCA 1AKWA 2DQ4A 3PHJA 4GR5A 2POCA 4MV0A 2DUJA 1DC4A 2MINB 1QQTA 1FP4A 1QJCA 1F6WA 2AFIA 3IPRA 2PS9A 1VHDA 1XD2B 4R3WA 2IV2X 5GADl 4QGHA 3FHLA 5HKBA 1CF4A 3GR6A 1H9AA 4XGRA 1ZM3A 3HO8A 5LUAA 1OAKA 1OIVA 5H1YA 3O2NA 3IBSA 3PUHA 2RK4A 3HP4A 3IUJA 5GV7A 5CITA 4A10A 3H3JA 1RKUA 2ST1A 3LI2A 4MPDA 1VL1A 4DQVA 1JWBB 2ATCA 2CUNA 2W70A 3E5HA 4EJ2A 5KJ1A 1G42A 2VATA 3IO5A 4LJ9A 5I6DA 5JZMA 2BH2A 3MTAA 1ZUIA 4DAOA 2W9XA 3AEUA 3CLSD 5DIFA 1ZD9A 1YDMA 3JRNA 3ENQA 4CIXA 2IH4A 1W2HA 3FTCA 1NUHA 1QP8A 3GNLA 4G5SA 4JR2A 5TEVA 2IEIA 3TPZA 2WU3A 1RNLA 4FC6A 1Z37A 2J0SA 2GN1A 3IO3A 5KNLA 4RS3A 2PXCA 3PXAA 4O4HF 3TAHA 3U62A 1JU4A 4DDKA 1H1DA 3K9FC 1W0KA 3V6MA 2NACA 3HKCA 5L8VA 2Y27A 3ER8A 3ND6A 5GONB 2HA0A 1NZDA 2CMHA 1TT5A 1YZGA 1Y0BA 4RKQA 4O2BA 4RPGA 1Z6QA 1X3LA 2BKEA 4YPOA 3B51X 3OEHD 4L8YA 2I65A 1JHPA 2JA1A 5YASA 2P78A 4MWCA 1B26A 1BQ4A 1DC5A 4HH1A 1CP2A 3HQ4O 1VRCA 2JD2A 3NHBA 3O92A 5HZKA 3DDNA 4WH0A 3F46A 4S24A 1NUPA 1G3QA 4J6FA 3EBLA 3OZIA 3VOTA 1F2TB 2FUKA 2WJYA 4Y2RA 5AHKA 1XZAA 3RU2A 2A14A 2UUPA 3DXZA 1RLJA 4IWYA 4WADA 2GYWA 4R7ZA 4A3SA 2VJPA 4KGDA 4F9FA 3PGLA 3G5LA 3TLAA 3IULA 2WSLA 4H6PA 1QAQA 4IO0A 3NXKA 1BC5A 2D54A 4MQEA 1KFBB 4HUJA 4INAA 3AM4A 4NSNA 2I2AA 2V5UA 3TM5A 1MRNA 1WZCA 3VC3A 5B12A 4HKTA 3NTQA 5T64A 1EEHA 3MWEA 3L7CA 4BO2A 2MR5A 1BX0A 1Z6PA 3BGOS 4FIZA 4MUNA 4NY1A 5C3UA 2QG6A 1IPHA 1CIJA 3WG9A 4BJHB 1XXLA 4E22A 1O03A 4EGQA 3D4PA 3VHQA 3S8EA 2QTZA 1BE1A 1CS0B 2BP7B 3RVNA 1HZZC 4TTRA 4JJ8A 4GGMX 5JQWA 4MI6A 4WQMA 1TEVA 4OHXA 5BOVA 1BNCA 4M1YA 4JKYA 1YSCA 2YZ2A 3DPIA 2PN1A 2EERA 1GUYA 3KVVA 3KDSE 4FINA 2XQKA 4H3HB 5CJPA 5DNAA 5AUQA 2W7TA 1L5HA 3SYNA 4DEXA 4MPRA 4DJAA 2HA2A 4YJFB 3X2FA 5EXSA 4HDKB 1G9TA 1XZKA 2H00A 2AZXA 3C8DA 1B3BA 1WDWB 1G9SA 3HP7A 3BZWA 3L6DA 4M83A 1XPUA 1SQGA 3A8TA 2F1RA 3R7BA 1ADJA 4DLAA 4KODA 3CVXA 4ROTA 1O57A 4YCAA 3TXXA 3UTDA 4DNQA 3JARB 1HE4A 1JXMA 3CE9A 2MIIA 4DA8A 1HLGA 5KS2A 4NHOA 3T1YB 3MJHA 4RKYA 2G4CA 4HNRA 3V42A 3WJ2A 1M5TA 2NPIA 1H2XA 1Y63A 1TMGE 4TRJA 1YR7A 3SSMA 1KYTA 2H5JA 3R20A 3W6UA 5ADHA 1SCUB 1QG2A 2JI4A 4ZO4A 2VTDA 2XODA 3BGIA 1Z39A 5I7AA 2PG3A 2IYRA 5CDUA 3HDTA 5AJXA 2PYZA 4HLNA 3TW8A 4ES6A 1TC2A 1N7HA 4UPEA 1UC4B 3ESRA 5CA0A 3IXMA 2NV2B 4JJFA 1VI6A 3CEMA 3GRZA 3RNOA 2BD0A 3DQZA 3K15A 2P3QA 3ZWPA 3A1FA 4JEIA 4S04A 2OCXA 3FTDA 3SF8B 3DM5A 3CIFA 4BKPA 1FW8A 1OI2A 3MTQA 4G36A 2P27A 4F1JA 1A9XB 1VM6A 4AZ3B 1C3XA 1LSUA 2HUNA 1V26A 3HSYA 3KQPA 1ULSA 3LQQA 2QYHA 4D9MA 1XTSA 3VYVA 3RFXA 5JJ5A 2P2DA 1I7NA 4G0XA 3CNLA 2ZSIA 4BVKA 5BSFA 4RUKA 3SE7A 1K5DA 5FUVA 5I7VA 2O48X 1MTOA 4RANA 3OPYI 4J4HA 1N2BA 5ARBA 2ERXA 1CRLA 1A9QA 2AH5A 2BRUC 4YRDA 5GWXA 2FV8A 3L1JA 2VDRB 4Q16A 2ZGVA 3ABRB 5GVRA 2RGAA 1NQ5A 4IMJB 3FPCA 4BNDA 4EAAA 2WD7B 2Z8YM 1DHRA 1PW7A 5FBZA 4QYWA 2FRDA 3ZW7A 3HLYA 4K0RA 5DWQA 2VJOA 4IL5A 1S3SA 2J6IA 2MMGA 3I2GA 4X64B 2EGUA 3QIVA 4NF2A 5F76A 3F78A 4G2NA 2ECPA 4Q4LA 4DJFC 4BBJA 4TLLB 4HEA1 3VAYA 2HFJA 4YIKA 4C6TB 4RD1A 5INTA 1PWHA 2QUHA 5CLGA 3U4QA 3AU8A 5HM6A 1XROA 4XM0A 5KSWB 2G77B 5JLAA 3AKEA 2POQX 1PJCA 3AEKB 4ACBA 2WF5A 5F4BA 3DO6A 5DM70 2VJLA 4N0DA 1V1MA 3WY9A 3LPNA 3UCEA 5IDWA 3BFJA 4P53A 5TEWA 4I9FA 1HZZA 2WF9A 3IDZA 4CMEC 1TM7E 2ODAA 1KJ9A 1GUZA 3OTIA 4I14A 3ZZNA 4XVUA 1SCUA 1ZJ4A 2ORED 3PUZA 5BYKA 5M29A 2QT0A 2EKPA 5C31A 1AGNA 4QL3A 2OBFA 2VT3A 3SZUA 4CM8A 1SVMA 2CJFA 3W8EA 5KO2A 1FPQA 4CI0B 1IQRA 3NUGA 2J07A 1ZIXA 2QIOA 1E3JA 4J43A 4I9NA 1EEXB 2IXTA 1RXIA 3LUDA 5CA1A 3OD5A 4RZ3A 5IRCD 4MRRA 1UXGA 2F1IA 3R3SA 1B23P 2W0SA 3R74A 4RGVA 4BNKA 5KTOA 4YMIA 1VKHA 4JYCA 2YV3A 4WCVA 3R0IA 1YZHA 2EP8A 3PWSA 2WU8A 6ABPA 3VTAA 1PNQA 1NJFA 3IMKA 3EEIA 2R6HA 2JFUA 5BWNA 1KOLA 3A1CA 3RVKA 3V4OA 3EWSA 3OE5A 5E6RA 2PANA 1S96A 2A5FA 3RVQA 2NGRA 3SC6A 3GROA 3DVSX 2C2HA 2WKQA 4M8IA 3NC0C 1GXSB 3F3SA 1YS7A 4WEQA 1MTZA 4WKGA 1TIBA 4XIIA 2FW8A 1WCIB 3OOSA 4KKXB 4MB2A 4K88A 5IK2A 2C78A 2BRUA 1JDBC 5KHLB 1QU3A 5CFRA 4FE3A 1JLMA 2NUPB 4PGHA 2C7VA 2ZJ1A 3AHGA 1IAVA 4XIFA 5AM1A 3OTQA 3T4EA 1LBEA 2X23A 1P3DA 4DCNA 1JS1X 1B74A 1PYOA 4R3UC 2L18A 2NX2A 5H4HA 1QDEA 2ETXA 3NMUF 3M9WA 1X1QA 1J9GA 2W6PA 2XTJA 8OHMA 1YZKA 1DBIA 3Q6MA 4UBMA 5G1OA 1QYVA 4RVGA 2IHTA 3FZQA 3H2SA 4DA9A 1L1QA 2CE7A 1R6XA 3CUSA 1LBSA 4UXIA 3RWBA 2XCQA 2YUIA 1TX4B 2PVSA 3NTUA 4ZVNA 4OQ4A 3VPGA 3O4VA 4OP2A 2JANA 4ZARA 3EZ9A 1O0SA 1TO6A 1TTTA 4G63A 3AUUA 1FJXA 2P3SA 2RHRA 4MJLA 2CJWB 2QA5A 4NZPA 4RWZA 5BYBA 2OCDA 4IF6A 1OXVA 1NHGA 3GP3A 1ZN9A 1AOXA 3QYPA 5CGZA 2A1IA 5D87A 4TXLA 1ZQ1A 4Q7KA 2PMWB 4Q03A 3ZJ5A 4URVR 4UUAA 2EKBA 4LQLA 1Q0PA 1S1CA 1I7PA 1RCUA 1TD1A 1PFUA 1AUXA 1RAAA 1RW4A 2XB6A 5C4IA 4Y1RA 4Q7QA 4CYMA 4Z54A 2QD2A 4JJIA 2E55A 1AQYA 3RTGA 1RQLA 5AUPB 2CDCA 3LRTA 4QNMA 4Z7OB 4BMZA 4MRMB 3P9SA 4Z4QA 4BATA 1PGOA 1T3HA 4QE3A 1NP7A 4E5NA 4HOYA 3B9QA 1NIPA 3M4XA 4OI2A 4P7BA 5JQGB 1GDDA 1L4BA 3IEUA 4TVKA 3TJMA 2C1XA 3IQDB 3BBLA 3WSWA 1RSZA 2CVZA 3FPKA 2BDEA 1GRVA 3BORA 1JHDA 2VNIA 5IPFA 1UJCA 3SIPA 2J0VA 3SOPA 3AI3A 4ILEA 4FJ0A 1L9KA 1SVLA 2EJTA 2Q62A 4LHYA 2VBIA 5BWOA 5GZ3A 4J0JA 3FKSD 3FX2A 4QO7A 4ZVPA 5I5GA 5TDHA 1QK4A 2XGOA 4BC0A 3AJ9A 3QW4B 2DE0X 5B1HA 4CMAA 2O52A 1WB5A 3JYLA 2OCIA 3V1LA 4TLDA 5DEIA 4HAOA 4BASA 3KZVA 1YZUA 2GF0A 4DM4A 4YXWD 5DE3A 3R4VA 3CYFA 1CKEA 3TFOA 1K86A 2AXQA 4AL4A 2ATIA 1Z45A 5JYEA 1TMOA 4ARCA 2E0IA 3N8DA 1ES9A 4KVGA 2CY0A 1J0EA 3MRSA 3OMLA 3UCXA 2Y9PB 3QPCA 3ONVA 3T9CA 3WFZA 4DMCA 4KOAA 3E7XA 4FMCB 4MS4A 2H59A 5CBKA 4MV5A 1XTKA 3F2VA 4M87A 4XH9B 1MKYA 5EHIA 1M2GA 4FS3A 1VHWA 2X1MA 1E3MA 2P69A 2JK1A 3D8RA 2IK8A 2UZ4A 4W5HA 1QHIA 2EEZA 1GARA 1UBLS 2VYQA 4Q4CA 2SKCA 3CLUC 4NTZA 4HZUB 2YFYA 3AF6A 4KQHA 1CFZA 3DWIA 4TV8B 4N18A 4UEQA 3SQMA 3WZ2A 4N41A 2A4MA 4ENUA 7MHTA 1LFAA 2IX3A 4AP9A 5CNJA 1J09A 2AKYA 5EA2A 3IOEA 4KITB 5EPEA 4BFZA 5KPDA 1EWQA 4Z2YA 4BXOB 2G83A 4P9NA 5DT2A 2PT5A 2QDKA 3KYCB 4EG6A 3I9JA 4KGVA 2XPCA 1J0CA 1Z7YA 3ST7A 2H5EA 2GCEA 2WPDA 4IS2A 4QJBA 5LLTA 2RCYA 1VHLA 3ZQKA 1OUMA 1DCKA 4RE5A 4MWDA 2OEPA 2W2OA 3BDIA 3DV9A 3OE1A 1O9HA 1NVVQ 2GN0A 4M1ZA 4ZJYA 2R7LA 1WCV1 4TLEA 2MWMA 3AEYA 4EOGA 1C3LA 2G40A 3C98A 5KUTA 2RBKA 2X4IA 1D07A 4LOLA 2G0TA 4XPIB 3V7YA 2UYCA 1BVUA 4BFXA 3T1VA 4LX0A 2I4TA 3H1FA 3JYNA 4WWHA 4J0HA 2I80A 4K9OA 1RXSA 2AMVA 5AW5A 4MIEA 5JAIA 1ZINA 1E8MA 1S2NA 1U28C 3GCWA 3OT1B 2QRQA 4U39A 3P94A 1T4CA 3FDFA 1IRXA 1V45E 5B3JC 3GLGB 4D6YA 1NE2A 1GYQA 1L7QA 1NMZA 2GVNA 5CDFE 1X2BA 4W9NA 1GYPA 1NJ6A 5FOQA 1UC5B 1W4ZA 2MSCB 1X8LA 3D6HA 3VAZA 1AKEA 4ZCIA 9GPBA 2A58A 3AETA 2P4HX 2VAWA 5JSKA 4CLRA 3C4JA 4LYDA 3ZHVA 1NVAA 4ENRA 5CFZA 5F64A 3CGWA 4FJ1A 3WB2A 1YRYE 3BIWA 3U2QA 3G8CA 2EDAA 4MKRA 4QRHA 1VI2A 2YIJA 4ENQA 1JA1A 2JCSA 4G1BA 1UPAA 4HEA6 1GCIA 4V1CI 2P9CA 2DHQA 2P5YA 2R0QC 4JASB 3CUKA 4OI4A 1RXUA 4XJXA 5ICGA 2M9MA 3A3KA 4D74A 3SXJA 4QXRA 4TS3A 1NLZA 4GRAA 4JUAA 4Q9LA 3V34A 1D09A 2JLCA 1YCGA 1KFKB 2P5UA 3JW8A 2XMPA 1NN1A 3HE3A 4MI9A 1A0OA 3FPGA 1ZAYA 4IH1A 3H2JA 5LL6P 1KEZA 1R0KA 2EW2A 5AIAA 1G5IA 1ORRA 4GRDA 1Q7RA 3ZE8A 3F8WA 4K9NA 1QCCA 3VR4D 2JHFA 3MRXA 2A0YA 2TMYA 3KQWA 1ETHA 2GZAA 3B36A 3IPAA 3HB0A 3DE3X 4MW6A 4CVNA 4EF4A 4F72A 3VOBA 4RD4A 5L3RA 2NO9A 4RH3A 4I50F 3I72A 2W2NA 1EK1A 4DV4B 1CY1A 1M2EA 3SMQA 2EFJA 1V3QE 1RM4A 3ET4A 4A0QA 1S4MA 2X42A 3FFBA 5C9ZA 5JANA 2AIRA 1AO3A 1IUPA 2QLLA 2G36A 2VXBA 4A1FA 2FDXA 1GN9A 3PEEA 4XJVA 3DJYA 3RTEA 1WD7A 4LWZA 2VAPA 5JMOA 1E0JA 5IDXA 3QLUC 1NFFA 4L85A 4WZAE 1IYZA 2QNIA 1TQ2A 4W1SA 3QYFA 4B35A 4RTPA 4NU8X 5ALNA 3SC2A 2ZAIA 1WKCA 2UKDA 1RQNA 2OAP1 3LNCA 1XQ9A 3SF0A 1IJKA 1Q83A 4PZ0A 4EFDA 3CX7A 2R7NA 4LCBA 2CYCA 2FPMA 1JJFA 2BR5A 3MT0A 3GJZA 3H5TA 3N0TA 1UC9A 4M7RA 4YVFA 1M2KA 1E96A 1CETA 1II8A 1VLQA 2WFZA 3DAFA 1GTVA 4GOND 5ALGA 4RGYA 3AOGA 3H6HA 1EDBA 1TL7C 2JFOA 4EW6A 4F7WA 5AVXA 3NP9A 2GPTA 3WL4A 2E5WA 1VKNA 3KJQA 1Y1KE 3DW1X 1NF8A 1QQ7A 3FTNA 4Y2YA 4UNQA 5LLSA 2ZIFA 3IJ5A 2PS0A 4I55B 3NGLA 1L5KA 4A0RA 2Z58A 5HM8A 3WDMA 1B0ZA 1A69A 2WYUA 5CA0B 1VL2A 4OUDA 3ZV7A 1XXHE 5CTJA 2FGKA 4RC9A 2HEIA 3ROEA 2OM2A 5IULC 3FRHA 4JROA 2DBYA 4OHCA 2CWWA 3SHVA 1P7PA 3FZEA 4L7VA 3AL2A 4TS1A 1VBMA 2B1JA 2VKQA 3UGJA 2GK3A 2PYIA 4O2BF 3RAEC 2PUEA 1QWSA 2WUDA 3H5IA 3UUWA 1JFFB 2DH6A 1RAHA 2CVHA 1GV0A 1RKQA 2WYIA 3JQ8A 1OOEA 2XQJA 4K6KA 5F5LA 3SJAA 2UXBB 1N5MA 1P9WA 5GJBA 2IUTA 3MW8A 5KWSA 2F8SA 1SCQA 3JVVA 4I2NA 2R97A 3E8MA 4KLRA 5I48A 2O1EA 3Q7SA 5K51A 1SELA 3OJFA 4M98A 4WL0A 4B2YA 3G2OA 4ZYWA 5HF9A 3DMHA 1CBUA 1AS3A 3ZK9A 3E7FA 2P9GA 4DS3A 1EFHA 5BVGB 2EJBA 1NBWB 1ZI9A 4JUCA 3DZIA 5EGNA 3WK6A 2UZ0A 3SQWA 3AY7A 1M0EA 3C3JA 2OBLA 1Y5NA 1LNSA 2P6UA 3BB3A 1DSSG 3D02A 3MXOA 2ODEA 3AM5A 5T67A 5K7SA 5LN1A 3EDCA 1ZJWA 3CLUD 1P2UA 2BMWA 2FP4B 2ONCA 3E4DA 5GM2A 2PSEA 5HF5A 3GLGA 1BVHA 5REQA 3LHSA 2A4KA 3LMKA 3W7AA 1BROA 2WILA 3W4JA 3W8FA 2IELA 4RTJA 5TVGA 2PZFA 1RZUA 2PS1A 1BOFA 4QUJA 3WV4A 3BMOB 4FGZA 1JHMA 2A9VA 1G8KA 3VZRA 1PG2A 2AZTA 1KI9A 1P60A 4ECAA 5HHTA 4GPZA 1CUAA 4WZBB 4Y0AA 3EEYA 4NLLA 1LWOA 4KRYA 3T7EA 1CE8A 5DGHA 3UT0A 1CUGA 1SQ0A 2YWEA 3A2LA 3C85A 4OTZA 5GJWC 3ADOA 3TRKA 3V1TC 4CKWA 2QTLA 4ESEA 3QEBZ 3E5NA 2GNPA 3ES9A 4L0DA 4JLAA 5L7WA 2CFSA 3C15C 3GV0A 1MX5A 3LQFA 5F21A 1CTQA 2Q3FA 1XO1A 1EFKA 1KO7A 1IMOA 2D5LA 4KQ9A 2BP7A 4RQAA 1CHNA 1AXEA 2YRFA 3MGKA 4P4SA 5M2QA 3SYMA 4DTCA 3DKRA 4J0QA 1KC1A 1JHQA 3S68A 5CDYA 5C0OE 4ZCLA 2D7CA 4NYJQ 4U5XA 4H31A 3VSEA 4UTPA 2VDOB 2O2HA 4X7PA 1YE5A 4CN9A 1NPTO 5HIAA 3FAZA 1DO0A 1E4OA 3HHEA 4TLAA 3KKPA 4REQB 2Q21A 1FYFA 1KSGA 5E9QA 1P1FA 2PGXA 4WINA 3KEGA 3GX1A 1GUDA 3NR2A 1XTRA 4KQJA 4B2LA 5J4KA 2G0NA 1OZAA 4EGSA 2F3UA 2JLBA 4ZAYA 3DC7A 1TC1A 2YMLA 4CT4B 3BOSA 2WG1A 4PAGA 1OX5A 4DMFA 4OF4A 4LRQA 2I66A 2PZMA 4PAQA 1WY7A 3H2HA 4EQ6B 4KV9A 3HCBA 5JD4A 3I61A 3C4QA 4HX2A 4J0FA 5JSZB 3EFOB 1RAIA 5SZIA 1MAWA 2PX8A 3E22B 3DTTA 2HY7A 4M1WA 2KBFA 3IAXA 2BKXA 5J5VA 3GZNA 3NIGB 1AKNA 2NU6B 4YJ3A 4PSAA 4ZZ1A 3OICA 4K1LA 2HSWA 2OO3A 3K5PA 3REQA 2IF2A 1ORTA 2YZNA 3IV7A 2PWYA 4MYSA 1BDMA 2RC5A 3DMDA 4XDGA 4KXWA 3TQSA 4BO0A 4F04A 5CDGA 3IUQA 1S8NA 2R2AA 4PGGA 1GLNA 1M34E 2GCOB 2Y1CA 2CB0A 2W37A 2AEFA 4FOSA 1XDBA 1TUBB 2X9LA 4PR3A 4R0MA 4P6VF 3DH0A 1G7CA 4NCXA 2V7UA 1EJ2A 4TTSA 2XECA 3GLUA 4WZBA 5EJ2A 2R4TA 1H9BA 5DGXA 4QBIA 1YWGO 5ALZA 2FPXA 2XOKA 2EQAA 2M6KA 5A9SB 1Y5LA 3TXYA 3O8RA 3AMVA 4Z0NA 1B0PA 1ZGZA 3E9RA 3FY4A 4ZAXA 4UXHA 3ZHXA 4E1BA 3ENWA 4RPKA 3PT9A 4OHUA 1YBVA 3KSMA 2B4QA 3KD3A 3HDHA 1LI4A 2YV4A 4MULA 2GT1A 2HK7A 3ZDCA 3UGTA 4JLVA 1DEOA 4YDSA 2DFTA 2IYQA 3HCCA 1W44A 3I6ZA 3KPYA 4BB9A 1EFTA 3UMFA 1CJBA 1RI3A 2VAXA 2XYGA 3OX4A 3I9LA 2LP4Y 4EPRA 3KB2A 4K1XA 1PGJA 1IDOA 1NVBA 1T3SA 3AWDA 3NWEA 4L73A 4KQMA 5EZYB 1FMFA 3GUUA 3AEZA 1ID8A 1JXQA 4CKBA 3CH4B 2V74B 3LY5A 4LDJA 2VPXA 4B2PA 4D4KA 5KYKA 5HZHA 3S55A 2RG1A 2JAQA 5E2BA 2CFTA 4H1VA 1PFGA 2VJKA 1QRSA 2HLPA 3AV3A 3QA9A 4HWKA 1ZGGA 4WKNA 4FONA 3VH1A 5H59A 3HO6A 2AGVA 1X80A 3ANYB 1EE2A 2CSUA 3VZCA 5FV4A 3WR5A 2R6GA 5D3ZA 4J9UE 4F3YA 2A92A 1HYEA 3BJIC 2PSFA 5FWNA 1RQ2A 3AVPA 3HBJA 1V16A 1Z3CA 1E79D 3JVEA 3H6GA 2IP2A 3MGBA 1JV2B 2Z56A 3L0CA 1SQ6A 4L8WB 2FYTA 2BZ1A 4F5DA 1BEUB 3I64A 5C2JB 1YQTA 2PRJA 1ZIOA 2VL7A 3S2UA 4KJZA 2FMIA 4IFTA 3DXFA 1ECCA 2JNWA 4Y2HA 1LI5A 3OCJA 5ALYA 2AJDA 1A95A 1UM8A 1KNQA 1LDGA 3TAXA 3UK1A 3WGKA 4DV6B 2GXUA 3ZX5A 4UOQA 2WHPA 2WJJA 2I8AA 1YE8A 3COWA 3ZDFA 4QYSA 5DN6A 2BCGY 4G23A 4MS1B 4XJTA 2CDAA 3AFGA 4CGZA 3U4QB 4IEFB 4MPPA 1YL5A 4JP1A 1WDKA 1UUFA 2WP8J 4HYYA 4MB0A 4FI3F 2ET6A 1B43A 3DE4X 4Q4JB 3ZGOA 2V7XA 2VDLB 4OEHA 1N0UA 3OSZA 1TCVA 4RPLA 1L8OA 2QTHA 3DMNA 2PBLA 3D3NA 1XJWA 1V16B 4TTJA 1XU7A 4JQOA 2J87A 2C5SA 5E8JA 1P8AA 4F4JA 3WZMA 5E2AA 4B81A 1P0IA 3FSJX 4PSCA 3CONA 4GOXA 2XGGA 1IEXA 2WZBA 4Y9RA 1QKKA 3A3PA 4G4GA 3WTBA 2O7QA 4DEVA 1Z5NA 2GCIA 2VTBB 3SBOA 3NOVA 4YRRA 3EUEA 3H5NA 3GCZA 1XK7A 3STVA 2W4QA 3AHJA 1RZRA 3MLAA 3KFLA 2BI8A 5K0GA 3C3PA 4UQLA 4UC0A 5KNBH 1EWVA 1YHYA 3X1JA 1VL5A 1N7IA 1V6CA 3CS3A 4HN4B 3WNZA 4LSWA 3UBMA 2LZ0A 4NYIQ 2XKJE 1XWWA 4DF3A 3FVVA 1LJ8A 3ILVA 5L7YA 5JEEA 3RAFC 3BHJA 3STUA 2VSNA 3VM6A 1C50A 1DV2A 4MGIR 1IVSA 3K4HA 2DMRA 2XWJI 1SC1A 3OC0A 2V3CC 1YVPA 1ICEA 3DEKA 3MRTA 2W6JA 4ENTA 1Q1NA 3QUSA 1FZTA 1QANA 3AJDA 2P8SA 1FK8A 4RTMA 1XV5A 1Y7LA 2J6HA 2QD3A 3NX4A 3E4CA 4JBNA 4DSAA 3ZD7A 3ZD6A 1XZCA 1UK6A 3FSGD 3O1JC 2Q5LA 2BH9A 2FR0A 3BIOA 3PF9A 3HGTA 4K9SA 1M3SA 2IY9A 2IITA 2YH2A 2JIZD 4FCTA 3H4TA 4H9GA 5F9FA 2RGNC 4Q3NA 5EY5B 3WO1A 4EITA 5L3QA 4YO7A 4NH0A 3T5TA 1KAEA 1QO9A 2R8ZA 3D0RA 3C6ZA 4GVXA 4HAZA 1E1MA 4UHKA 5TXGA 1W36B 2QTFA 4CHGA 3D4OA 2FMTA 3U4MA 2DQKA 3ETLA 5AJZA 3WK4A 3BTVA 4H0CA 5FFFA 2WY2D 1GNVA 1Z63A 1AC5A 2P91A 1XTUA 5JSFA 1IK6A 1M73E 2COKA 2J7PD 3C7CB 3PHHA 4FEEA 2R8RA 4G89A 4MS3B 1DBPA 1T8PA 3WJAA 1QH9A 1UM9B 1XCMA 1VSQA 4D9KA 4D8TA 4AZ0B 2ZI9A 3TB6A 3DL7A 4IWXA 3VR5D 1H6DA 1KIAA 4X94A 4QOEA 3UTCA 2VHVA 3N8GA 3DQQA 4OHVA 4X92A 3A9UA 3IEIA 1L5ZA 4IDHA 2XUKA 4GXNA 4UHCA 1DC3A 1KZ4A 3E7DA 3H16A 1L4EA 1SUAA 5KJFA 1I4WA 1PFVA 1QDUA 2VHXA 2VZ0A 1CQJA 3GRCA 2OV3A 4WZAB 4EY6A 1DX6A 3AV0B 1APBA 5DB4A 1U2DC 2ZRHA 3BG5A 1I8TA 2Y0BA 1XNGA 3OZUA 1OH5A 2XVZA 3ZJTA 2NP6A 5EMHA 3RM3A 1YFKA 5CLJA 1ML3A 1WPXA 3B6EA 1A9YA 3R09A 4PO8A 1UT8A 2V7WA 1JXOA 2PGDA 4C08A 2V0NA 3P9XA 1SBIA 4BFYA 5E7MA 4H7FA 1O5OA 2FUNB 4US2R 2FRDC 3I2KA 4TZTA 3QIAA 4L22A 3W3ZB 5A03A 1CUDA 2BWJA 5CFNA 3GF4A 4DNOA 4HFJA 1SOVA 3EJ6A 2YJ5A 3QUCA 5C53B 3P0EA 2IV7A 1AA9A 1FPMA 1G5HA 2B8JA 3A26A 3HM9A 5THKA 1W5TA 4I1VA 4W5JA 1N92A 4BJ6A 1YR6A 4W5WA 1EX1A 1ZUHA 2P2YA 5CVEA 1QPBA 2QM3A 1Z47A 1E2KA 1S7CA 1Z0KA 1ZMRA 3QNWA 4IRXA 5FPQA 3FNFA 3AKZA 2CCGA 2HX1A 2DWOA 4Y30A 4PVDA 4NFLA 5KU7A 3EPJA 4ZVRA 1OI4A 5F7OA 2WDZA 1DEHA 3AF5A 1J8DA 1JI0A 1RDFA 2RH5A 1OKKA 2ZAYA 3F3YA 3JVIA 4KBGA 1QVRA 4OK6A 2AFIE 1CRZA 4MVJM 1BX3A 3ZNQA 1OB2A 4R8VA 1WR8A 1LF0A 2CGEA 3FJYA 4FE7A 3QE4A 1N2EA 3MELA 4OOEA 4X1YB 5GV8A 1QYDA 3TS1A 5FOVA 1V5WA 1O54A 2O8FB 1SVNA 1J7KA 1HDYA 2DTXA 3E70C 2D06A 3IESA 1CUZA 1QFMA 3GJ8A 3RFFA 1E3WA 3SLGA 4E11A 1GA6A 2CZGA 1KOGA 1R50A 5FUBA 3WBBA 5L6LB 3A6FA 3OBIA 2VDJA 1C4KA 1G5QA 4EHKA 4LJ6A 1ZL2A 1TNDA 2D3TA 4NR0A 2VP3A 5ECDA 3H5AA 3ZBTA 1K92A 5BN4B 3U09A 1T2EA 3VTZA 3KXKA 2JIZA 3LK7A 1FXWF 3TSYA 5LB2A 1X74A 4BL5A 3G49A 2BGNA 1DUVG 1E1KA 3HCEA 2NAPA 1JG2A 1CUWA 2QT1A 2XUDA 2PXAA 4HTFB 4L3WA 3U4AA 3IELA 3GFQA 1GYRA 1NBHA 2O3RA 1JEAA 3H04A 4I1OA 4OV6B 5TF0A 4JI8B 2GJ9A 3OLCX 3AEUB 1CNEA 4FFLA 4LRXA 1ECJA 2HHAA 2OECA 2C59A 1R16A 1QIEA 4ISBA 2D1YA 3PLRA 2Z98A 3E2IA 2JZOA 2OYRA 4MW4A 2DSNA 3HA7A 3NFRA 1RPJA 1O5TA 1IBCA 1ODKA 3DR5A 3QU4A 4K6CA 4FR5A 1M5UA 1S3IA 2C7RA 1JQJC 1PBNA 3B38A 3K94A 4I50A 5ITWA 3IVCA 3FE2A 1X0XA 2ZSUA 4PS1A 3ILXA 1AHIA 5ALJA 4L74A 1PVVA 1V9LA 3DV2A 2VHQA 4ZYLA 3URMA 3QKRA 3MJRA 4XSHA 3UW3A 3GLKA 4MJ3A 4TYNA 2N47A 1SUPA 4CODB 2ZSAA 4TMWA 4A82A 1TM4E 3KQHA 3CRMA 1GQ2A 3WGNA 4NOKA 4HADA 1H93A 2PLNA 1K1EA 2JAXA 2OZLA 5FTLA 4YMGA 3LXMA 1KH2A 4XYGA 3OZRA 4GFDA 3O4FA 1NY5A 1P6UA 3CE6A 5HRUA 1GUBA 3Q2KA 3AZOA 3AYXB 4KRFA 5BOSB 5HYVA 2XB2A 2HNAA 3CN9A 2K4MA 4MYHA 5EXPA 1DG1G 1SN7A 2ZUVA 1CR1A 1GKLA 1DUSA 5AVTA 3C7TA 3GJ3A 4MGEA 4YJ2F 2UU9B 2WM3A 4YCNA 1UJ5A 1XLTA 3K0FB 3SHQA 2W43A 4CDMA 2XCRB 2AI3A 2BSXA 2J32A 2LBPA 4ND3A 1DE0A 1OTHA 4ZHQF 1QFJA 3SQNA 4LFBB 1Z6GA 1ZW6A 1OASA 2H92A 4ZZ2A 3C3KA 1KK2A 3M1AA 1P4JA 4MEJA 1CEQA 1HBJA 2GBCA 1EFVB 3NEPX 1QKJA 4MUJA 5F7ZA 4ZK2A 2YRWA 1ZICA 2DFDA 2OV4A 2BEUB 3SQLA 1NOIA 3GRAA 1RP7A 2P4EA 5IH7A 1G16A 4JDPA 4MAFA 1E18A 2RCNA 4P93A 2R5NA 5F77A 3LQ4A 2YWJA 4H60A 4OQNA 5CPFA 3ZC3A 3FYDA 1NFRA 1UCFA 1Y3HA 1EVLA 1YJBA 4KE6A 1ZGHA 2AN9A 4CLOB 3RC9A 3I5XA 1VLMA 1JWLA 1N2ZA 3F97A 5EHZA 3TKYA 1IU9A 3Q88A 1ZC3A 4WN9A 3VDQA 4LDAA 2PUWA 5AVZA 3NNSA 3I6IA 4I46A 3OH8A 5AUNB 3KRTA 5KQSA 5SYMA 5LU9A 1KRWA 1NQXA 2HGZA 1J99A 2OYSA 1G3IA 4YMSA 2X3UA 5TLSA 4EUHA 5DYTA 2IEDA 4KL8S 3Q0EA 4C0QC 2G63A 3ZH9B 1F3LA 2REXB 3TF5A 3JQ8B 4D5EA 1Z2EA 4YT2A 2Y3IA 3B8EA 1U65A 1Z0ZA 4I5IA 4EJFA 3VMFA 3ZWXA 2EIHA 2QMQA 1C41A 1ISGA 4G5QA 5K3SA 2DBZA 3L8MA 1IXKA 3UKOA 2YKGA 3B3JA 2ONJA 5JROA 5CX1A 4FDLA 4X5OA 2NQ2C 3NM5A 3FWHA 2L82A 5ADUS 1GIAA 4H17A 2GVDC 2A5DA 1M2VB 1G21E 1CUXA 2MT9A 2WWFA 4JS0A 2X1VA 5FP0A 3QF4B 2F1HA 5T8KA 5EIBD 4L0MA 3OVMA 5J2UF 2WJ6A 4DLZA 1OIWA 1KDRA 1AQLA 1KY2A 2ZRGA