3U8PA

Cytochrome b562 integral fusion with egfp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
337
structure length
336
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATFGGSADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYRGGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b562 integral fusion with enhanced green fluoresc
publication title Structural basis for efficient chromophore communication and energy transfer in a constructed didomain protein scaffold.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, electron transport
total genus 111
structure length 336
sequence length 337
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3u8pA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3u8pA01
4IAQA 3DQ8A 3OGOA 3WCKA 3SG2A 3SRYA 3I19A 4DXOA 2OGRA 3M15A 2H5PA 4W6FA 1RM9A 2Z6XA 3EK7A 5JUAA 3SSLA 4ORNA 4KW4A 4PFEA 2HCGA 1Q73A 2G6YA 2O2BA 4W6AA 1Z1QA 4OGSA 4DXMA 3M79A 1E84A 1MYWA 3GEXA 5BT0A 2Q6PA 1W7UA 1YHGA 1Q4BA 2HQKA 5BTTA 2QZ0A 4ZF5A 2G16B 4PPLA 3NEZA 3ST0A 3DQIA 4LQUA 2RH7A 1YYXA 3L1MA 5JP7A 1GGXA 2YE0A 4KF5C 2WISA 1A7VA 2WIQA 2Q57A 1EMFA 1EMCA 4NWSA 1OXFA 5EXUA 3P28A 2J8WA 2AWLA 1G7KA 2ZO6A 3ST3A 4CDYA 3DQ9A 4OQWA 1OXEA 5F9GA 3TOMA 1CV7A 3SG6A 3ZQVA 5JSLA 2V4EA 4BDUA 5DQBA 4OY4A 3QVYA 3M4BA 4ER9A 1ZUXA 3A8SA 4IK4A 1CPRA 4W6SA 1F09A 2H8QA 2OTEA 3DQUA 2XLOA 3EKHA 4H48A 2VAEA 3SG3A 3NMIA 2GX0A 2XLEA 3EK4A 4PPJA 4JKVA 3SSKA 2VZXA 3E5VA 4XVPA 5FVIA 2WURA 4W6DA 3UG0A 4ZF3A 4LJDA 3E5TA 2O29A 4KF4A 2QLIA 2AWMA 3H1OA 3U8PA 4KGEA 4W69A 1YFPA 5HW9A 3DQDA 2DD7A 4W7EA 3RWAA 3S05A 5H89A 5HZOA 4HVFA 3LF3A 2V4EC 2XLWA 2Y0GA 4KEXA 1QXTA 1YJ2A 5H88A 1RMOA 3KCSA 4ANJA 1HCJA 1XA9A 4H3MA 4XOWA 4ZF4A 2A54B 3HNJA 4W77A 5JS5A 3SVBA 2EMDA 4CDAA 5DU0A 2CCYA 2WHUA 4Q9WA 3V3DA 4W6UA 4W6NA 1BFPA 3DQHA 2G3OA 4U2VA 2A47A 5HZSA 4W6HA 2ARLA 4J8AA 3MGFA 5DRGA 1KP5A 1W7SA 4EDSA 1XAEA 4RYWA 5DTLA 5FVFA 1E86A 2C9IA 4W6OA 2YFPA 3QVZA 4I2YA 2H6VA 4W6KA 2DUHA 1XQMA 4IK8A 4B30A 1JBZA 2QLGA 3ST4A 3G9AA 1APCA 4N6HA 2AWJA 3DQLA 3HNIA 3ZQYA 3CB9A 2ICRA 3LA1A 4H47A 3ZULA 3WLCA 5LTQA 2YLIA 3DPZA 3SG4A 1E83A 2XLHA 2G5ZB 3IQ5A 3BXBA 3SVEA 4KF5A 4W6JA 3SVSA 5HBDA 4L6RA 4IK1A 1RCPA 4AS8A 2G6EA 3M4CA 2HPWA 2QRFA 4HQ8A 5FHVA 1EMKA 2H5QA 4U9DA 4NC3A 4W74A 5FVGA 4W7FA 1BBHA 3CD1A 3DQJA 1M6TA 3EVUA 1QPUA 2B3QA 5DQMA 4W6BA 2G3DB 3VK1A 3SSVA 5BQLA 3DE9A 1YHIA 2YE1A 4R6BA 4Z4KA 4KA9A 3CGLA 3TOLA 2AHAA 4DXIA 4DXNA 4IK3A 2YKZA 4HQCA 2WHTA 3K1KA 4RTCA 1GL4A 1HUYA 2H5OA 3DQ5A 3SVRA 2EMOA 3W1CA 2AH8A 4GOBA 4LJBA 1Q4EA 3CFAA 3SVUA 2XM0A 3SSPA 5EJUA 3DQ4A 2YL3A 1KYSA 3DQ3A 4UTSA 1KYRA 3OSQA 4Q7UA 2HQZA 4IK5A 5EB6A 1EMMA 4R6DA 4W6MA 3SG5A 3WLDA 3DPXA 3GB3A 5EHUA 5LTRA 3NMKA 3U0LA 2DDDA 4W72A 1H6RA 3EVVA 2OKWA 5DPJA 4W6PA 2XLDA 4WGZA 1EMLA 4JFGA 4WGYA 3SVCA 4CIPA 2WHSA 4D4NA 4XOVA 4J89A 4W7CA 3HNLA 1ZGOA 5EB7A 3VRCA 5H87A 4JC2A 2WSOA 2IE2A 4EIYA 4ULVA 3CFHA 4D4XA 3SSHA 4PPKA 2A46A 3VHTB 3DQEA 4KGFA 3LVAA 4TZAA 4U9EA 1UISA 3LVDA 5DTZA 4JE9A 5J2OA 4W6LA 3U8AA 4ZFSA 2YL7A 3EVRA 2BTJA 5JT4A 2VVJA 3EKJA 4ZIOA 3CD9A 5HGEA 5AGFA 1E85A 3SV5A 1NBBA 1EMGA 1XSSA 2PXWA 4JGEA 1JC1A 4JF9A 2C9JA 3BX9A 3C63A 3CFFA 4W73A 2XLMA 3DQOA 1B9CA 3KCTA 2YLDA 2WSNA 4IK9A 5EXBA 5EXCI 4DKMA 5DPHA 2Z1OA 1H4UA 3NT9A 2IB6A 5KTGA 3DQNA 4Q9XA 4IARA 2DUFA 5DTXA 3U0KA 4CDVA 2GW4B 4ZB1A 4HE4A 2DUIA 2YLGA 2A50B 1QYQA 2VVHA 3UFZA 4DKNA 2XM4A 2PXSA 4GF6B 3VICA 1Q4CA 4JEOA 4LJCA 2A53B 4Q7RA 3PJ5A 4KAGA 5DPIA 2AWKA 2Z6ZA 3U0NA 3SVNA 3AI5A 4AR7A 1XMZA 4CX9A 2QLEA 2Z6YA 2A52B 3LSAA 2OTBA 1MOVA 2HRSA 3OSRA 5HZUA 1JAFA 2G6XA 3U8CA 1ZGPA 2XL8A 1MOUA 4ZINA 1RRXA 1RMMA 3NEDA 3IP2A 3DQ7A 4J88A 3ZUJA 5B3IA 3DQ2A 3IR8A 3PJ7A 2P4MA 3CBEA 3EK8A 2YL1A 3DE8A 4GESB 4P1QA 1QYOA 2A48A 4Q7TA 4B5YA 4W6IA 4W7RA 3IQ6A 2HGYA 3DQAA 3LVCA 3DPWA 3SSTA 4XGYA 1YZWA 5BTTB 1Z1PA 2HJOA 2QU1A 1CGOA 3ZTZA 2FWQA 5DRFA 2O24A 2ZMWA 2BC5A 2B3PA 3W1DA 4P76A 1F0BA 4TZGA 2DUGA 3RWTA 3TMRA 5JLIA 4H3NA 1S6ZA 3ZTFA 2VADA 2GW3A 3DQFA 3M24A 4DXQA 4W7DA 4EN1A 3DQMA 5DY6A 2V4EB 2DD9A 4L12A 3FOPA 3GL4A 2QLHA 2H5RA 4W7XA 3ED8A 4EULA 4JEAA 4JRBA 5DTYA 1CPQA 4W7AA 1CGNA 3FOOA 3E5WA 4DXPA 3GJ2A 1GFLA 4CJOA 5JRAA 2A56B 4KW9A 2EMNA 4XL5A 4ZBLA 4HQ9A 2H9WA 1Q4DA 1YHHA 3M22A 3PJBA 2FL1A 1YYJA 2QLAA 3C62A 4W76A 1EMEA 3ZUFA 1W7TA 4KPIA 3TMTA 3BXCA 1LM3B 2G2SB 4OHSA 3GJ1A 3NT3A 3DQ6A 3NF0A 3QW0A 2IB5A 2YDZA 2POXA 5LTPA 1EMAA 1Q4AA 4W6TA 4EDOA 2ZO7A 3SVOA 2GX2A 3VHTA 3SG7A 2HGDA 3EVPA 2HFCA 4W6GA 4N4WA 4KW8A 2OJKA 3NMJA 4JEBA 1JC0A 4CJGA 1C4FA 5T3IA 1ZGQA 3BXAA 3ZTMA 3DQ1A 5LK4A 1EMBA 1YZCA 4Z4MA 1KYPA 1RMPA 2IOVA 5JVEA 4L13A 4H3LA 4IZNA 4OJ0A 5EBJA 4LW5A 3ST2A 3U0MA 2XL6A 5AQBB 2FZUA 3PIBA 4L1IA 1GQAA 2QT2A 3AI4A 4B30B 2QLGB 4W6RA 2J9BA 1QYFA 3HNKA 2JADA 4LJDC 3DQCA 3P8UA 1JBYA 1OXDA 1QQ3A 3SS0A 3DQKA 4W6CA 3LF4B 5DPGA 1YZAA 2DUEA 3QW1A 3AKOA 2ZMUA 1QY3A 3ADFA 2OKYA 4LQTA 4W75A 1MQVA 3ZWIA 4RYSA 4EMQA 1EKYA 2YL0A 3LS3A 1YJFA 3O77A 5HZTA 3H1RA 3O78A 2DDCA 3SVDA 256BA 4IB4A 2XLVA 3SSYA 1S05A 4N3DA 2VVIA
chains in the Genus database with same CATH superfamily
4QI2A 3WCKA 4QI0A 1U89A 1QLEC 2H5PA 4MQ9F 1D1CA 3LUTB 3DKAA 3A9CA 3VM6A 2Q3TA 3M79A 1E84A 5DLJA 2A6HF 1V54C 2Q6PA 1W7UA 3WODF 1H9GA 1FMVA 1FFTC 2EPLX 4YL3A 2RSEB 2QZ0A 4PPLA 3ITFA 3DJNB 4W8KA 1C17M 1GS9A 3K66A 3EQLF 2WISA 4O7GA 2E87A 2WIQA 4GQHA 4BJTA 3P28A 2HSQA 2AWLA 4YJWA 2ZO6A 5F9GA 4YT4A 1BR2A 2HV7A 2V4EA 3ZDLA 3M4BA 4ER9A 3U2MA 2A0BA 3EZIA 3JYHA 3AG2C 3EKHA 4H48A 2AU5A 4H4KC 2GX0A 2B0JA 1FTSA 3WHNA 1OW8A 4XVPA 2WURA 4JTCB 4W6DA 4OD4A 3H1OA 1DOWA 1M2VA 1YFPA 3OWTA 4XTKA 2XL4A 3FAJA 4HVFA 1TQGA 3SXMA 2XLWA 1YJ2A 1RMOA 3DM5A 1HCJA 2LP4A 2A54B 3EGDB 5DU0A 2CCYA 4Q9WA 3V3DA 2IM8A 5A6BD 3DQHA 1O3UA 1J8YF 2NUPB 1W7SA 4EDSA 4RYWA 1T6UA 5FVFA 2Q9BA 1HMDA 5E33A 1ZHWA 2HMQA 4W6KA 4IK8A 4B30A 3G9AA 2WVNA 2AWJA 1N1CA 1S7ZA 3JTLO 2ICRA 4J7TA 2Y3DA 2YLIA 3BXBA 3UMHA 4W6JA 4IK1A 4LDKA 4AS8A 3H65A 3M4CA 2DGJA 1NG1A 2MWQA 5COMA 2IXNA 2H5QA 4XPWA 3AG4C 4J32B 4W74A 1EA8A 1M6TA 1QPUA 2C03A 2EILC 3SSVA 2P61A 1YHIA 2AWCA 3C8GA 1C03A 4KA9A 1F1MA 2AHAA 3JCUQ 3LS0A 2YKZA 2R7OA 4GEHA 1GL4A 2H5OA 1SZIA 1WOLA 4CS7A 4PJMA 3SSPA 3S9OA 3U0CA 1YVIA 2LD6A 4IK5A 5EB6A 3Q7LA 3SG5A 1TKNA 3W8HA 5KYWB 5EHUA 2OKWA 2HV6A 4JFGA 3MBGA 3V7OA 4CS9C 2WHSA 1YLMA 3EFOB 3VRCA 3RQEA 3SSHA 2A46A 2BE5F 3X1OA 3LVAA 2OQMA 1IZMA 4E17A 4ZFSA 2YL7A 4MVUA 3ASNC 4XQ1A 4RDAA 3LLKA 2FAPB 2GA0A 2PXWA 1L7CA 2EIKC 2C9JA 1UG7A 2RD9A 3NRHA 2XLMA 5IY5C 4U5GA 5EGYA 4IK9A 3F47A 4Z9IA 4R32A 1I5NA 3NT9A 4FWVA 2J0XA 4Q9XA 1U6HA 1W2WA 4RD9A 5DTXA 4ZB1A 1FR0A 3PMRA 3ATPA 4LLCA 1ORSC 1Q4CA 2OCCC 5EK0A 3U0NA 3SVNA 1NSGB 1RJ9A 2A52B 2IYLD 2OTBA 3OSRA 4AL1A 3K1IA 3DQ7A 2CDQA 1QYOA 4Q7TA 3CQZA 2HGYA 2G62A 3UR3C 3SSTA 1YZWA 1EI7A 1HW1A 1CGOA 4I3MA 4BJ5A 1WWPA 4P76A 2DUGA 1S6ZA 3W2WA 2GWWA 2GW3A 1IW7F 4DXQA 4W7DA 2MHRA 2GDCA 3DQMA 2UUHA 2V4EB 4H54A 2DD9A 4L12A 2NUTA 3FOPA 2H5RA 3T6JA 4JEAA 5DTYA 3K6BA 4JZAA 1CPQA 1D1AA 4W7AA 5EHHA 2D4UA 5F28E 4XLPF 1G8XA 2ICWG 5D92A 4MVQA 3E5WA 4DXPA 4CJOA 3ABKC 4DRJB 2HJ3A 2GFHA 2CYDA 1YYJA 2QLAA 3U9MA 3MX3A 1M2VB 1V55C 3AOUA 3NT3A 2R03A 4OD5A 1VYIA 1Q4AA 3IQCA 2GX2A 3VHTA 4DXWA 4LERA 2HFCA 4KW8A 2IBFA 4G7HF 3NMJA 1VMAA 1JC0A 2Q4FA 3ZTMA 2W4MA 1EMBA 3B71A 2EPNA 2WZGA 5JVEA 2YQYA 4LW5A 1SYQA 5GPGB 4EKWA 5AQBB 2FZUA 1MMAA 3PIBA 4L1IA 3H2UA 1GQAA 2QT2A 4B30B 3VAYA 2H7OA 4G7ZF 2JADA 3Q7GA 1QQ3A 4W6CA 2KQ9A 5DPGA 2J7PD 1TWCA 4DVYP 2Y3HA 2OKYA 2LIGA 2ZXOA 4EMQA 1EKYA 4E7SA 4NTAA 1YJFA 2KC3A 2DDCA 256BA 4IB4A 3CSKA 2VVIA 2R7UA 3DQ8A 3SRYA 3UNGC 1VOMA 1Y6DA 3EG9A 4IWBA 3I19A 2PP4A 2OGRA 3H2VA 4W6FA 2Z6XA 5CI8A 1ORJA 3EK7A 5JUAA 3OEOA 3C8GB 4KW4A 4GYTA 3JRTA 3DXJF 1K04A 3DM9B 1Z1QA 4Z9JA 4DRHB 1LKXA 1YHGA 1Q4BA 3K7DA 4MNDA 2R7RA 1R4TA 4QDLA 3NEZA 3ST0A 2EIMC 3I4UA 2RH7A 4CSAC 3KMIA 2ZXPA 1NU9C 2PFDA 5JP7A 1GGXA 4KF5C 3DJUB 3S0XA 1EMFA 1EMCA 1KNYA 4NWSA 1OXFA 3AJMA 3GORA 3E9VA 4MVRA 1FMWA 1OXEA 3SXKA 1Y4CA 4BDUA 3A8SA 1OXBA 5KYWA 1CPRA 1G4WR 1F09A 3DQUA 3U3BA 4DBRA 4AX2A 4P6IC 1MMDA 4M63A 5B1AC 4KNVA 4JKVA 4I1MA 3SSKA 1MMNA 5DS6A 2R7TA 3UG0A 2LCHA 4LJDA 2EPKX 2O29A 1D1BA 1OCZC 3U8PA 4G78A 2AP3A 4NQFA 4YK5A 5E3CA 3RWAA 3LF3A 4O79A 1NFNA 4KEXA 1QKRA 1OKKA 4H3MA 3DAFA 4AE4A 5B1BC 1BFPA 2V26A 4U2VA 2XRHA 2C04A 3N0TA 4J8AA 5DQZA 1KP5A 2QTVA 1XAEA 1E86A 1JOGA 3GANA 4FX5A 2C9IA 2YFPA 3NG1A 2DUHA 2XSEA 1APCA 4N6HA 1HMOA 1OQCA 2JD3A 3DQLA 3ZQYA 3CB9A 1RJ9B 3ZULA 3SG4A 3WG7C 4AL0A 2XLHA 3IQ5A 3SVEA 3SVSA 2Z15A 4L6RA 1RCPA 4DRIB 1EMKA 3AQCA 4U9DA 4NC3A 3TJ6A 5L3VA 4NCQA 2PNOA 4U5BE 3Q6NA 4O6NA 2B3QA 5DQMA 2G3KA 1JPNA 1LPEA 3DE9A 3RFYA 4Z4KA 3CGLA 2H7VC 2J45A 3JRMO 5TJ5E 2WHTA 3VYWA 3KPHA 4CS9A 4RTCA 1HUYA 4ONSA 2AH8A 4LJBA 2NUTB 3SVUA 4CIHA 1V74B 2XM0A 2M64A 1KYRA 3OSQA 2Y39A 4Q7UA 3EPVA 3GEHA 2WZFA 3DPXA 3A11A 2HKVA 4P9FA 3JSEO 3GB3A 5HV9A 1PD1A 4CS8C 3EVVA 2HSBA 1ZW3A 4W6PA 4N6CA 4WGYA 4XOVA 4J89A 4W7CA 3ZVRA 3HNLA 2LFDA 3TD7A 4EIYA 3VHTB 3K1HA 3NKEA 4O6MA 3ZIBA 4U9EA 3LVDA 2VCCA 3U8AA 3JSZA 2BTJA 3EKJA 4ZIOA 3U2LA 1LE2A 1YA7O 1E85A 3SV5A 3FVYA 1ZHZA 4JF9A 4JTDB 3C63A 5HSWA 3U3FA 1SF8A 2WSNA 1TFOB 5EXBA 1T9KA 2R05A 1JRAA 2ZXWC 5DPHA 2L7AA 1H4UA 1Z63A 3DQNA 2X51A 2DUFA 1TWHA 3AG3C 3U0KA 2YLGA 3RQFA 2VVHA 4JEOA 4LJCA 1TWGA 2A53B 4Q7RA 4KAGA 2AWKA 2Z6ZA 3O55A 4EBBA 3AI5A 4AR7A 1HE9A 4U5FE 3EG9B 3MYFA 3IQTA 2HRSA 5HZUA 1JAFA 3U8CA 3GWNA 2H8AA 1MOUA 4ZINA 1RRXA 3IP2A 3PJ7A 4I44A 2P4MA 1QVXA 3EK8A 1YAUO 2YL1A 4P1QA 2CNWA 2D5RB 4B5YA 3DQAA 3DPWA 3TJ5A 1Z3IX 4BJ1A 4XGYA 1VK5A 1U0BB 2HJMA 2QU1A 3B29A 3ZTZA 2R7WA 2BC5A 3LEOA 4LDRA 1F0BA 2Y3GA 1ZHTA 5L0HA 1OCRC 1VTMP 3GL4A 4W7XA 1TFKB 3L34A 4JRBA 1RMVA 2H7BA 2J9UA 3UMKA 1CGNA 1RKEA 5JRAA 1DOVA 4KW9A 2HUJA 2EMNA 3CAXA 1O5HA 5BQHA 3G4XA 4ULWA 4KPIA 2P0NA 1LM3B 2G2SB 3BXCA 3R7CA 5D91A 4C7OA 3QW0A 3X2QC 1Q0KA 2POXA 1EMAA 4W6TA 5LTPA 4Z9HA 1K05A 4N4WA 2OJKA 4AE4B 4I1OB 4JEBA 4CJGA 5COGA 3BXAA 3DQ1A 3O10A 1KTMA 2IOVA 4HEAJ 1O87A 1YDIA 3M1CB 4N06A 5KYUA 3KL4A 3E70C 3LNRA 4W6RA 1ZW2A 3P8UA 1OXDA 2QY9A 2JX0A 1YARO 4PACA 4YWQA 5T3TA 4W75A 3QZCA 4RYSA 3LS3A 2BL2A 3O77A 2W4BA 3SSYA 4N3DA 4C3DA 2ZPAA 2YVKA 4CSAA 4CBEA 3AGUA 3SG2A 1LE4A 1YJGA 1RM9A 4K0DA 2HCGA 1Q73A 4EWCA 4W6AA 5KYNA 2NSGA 3BEHA 2XS8A 3RF3A 4DXMA 2LK4A 1I4ZA 1MYWA 3GEXA 5BT0A 3HTKC 1YA9A 2I8BA 2A68F 4MW3A 4IAOA 5COFA 3DQIA 3L1MA 2YE0A 2OEVA 3TULA 2Q57A 5EXUA 2F22A 2J8WA 1G7KA 3BRJA 3ST3A 4CDYA 4OQWA 3TOMA 1CV7A 1BR4A 3ZC4A 3SG6A 3ZQVA 2QUPA 3UMIA 4OY4A 2XLOA 3SG3A 1R5ID 3NMIA 2XLEA 1HE1A 1OCOC 3HLZA 2PX0A 2VASA 3E5VA 3PDMP 2KGOA 3V5ZA 5FVIA 4ZF3A 3L0IA 4KF4A 2QLIA 2AWMA 1JPJA 1FFHA 2DYSC 4KGEA 4W69A 5L0IA 2Q9CA 3ZSUA 4PJLA 4W7EA 3RKOF 3L8JA 5H89A 1T01A 2WL8A 5HZOA 3PHF2 2V3CC 2Y0GA 3KCSA 2IXPA 2R7XA 1XZQA 4ZF4A 5L0GA 3SVBA 3I5PA 4W77A 5JS5A 3FAPB 4K7BA 3JZ0A 2WHUA 2DYRC 4W6UA 4W6NA 4IJJA 2CW0F 1HY5A 2A47A 3QMKA 4W6HA 3MGFA 5DTLA 3FMSA 3LEVA 2O9XA 3W4YA 4W6OA 3QVZA 1OR2A 2YRFA 2H6VA 1Z5ZA 3LLIA 2P7VA 1XQMA 2OOCA 2QLGA 3ST4A 2KYHA 3HKKA 3CEXA 5T1DB 3LA1A 3WLCA 5E2QA 1OW7A 4OIOF 3C7JA 2YWAA 1K40A 1MNDA 4JCHA 5DVWA 2ASRA 4EBJA 2HPWA 2QRFA 3C8ZA 4W7FA 1BBHA 4BG0A 2OJQA 4PFOA 3DQJA 3EVUA 3ECSA 4B6IA 4W6BA 4Q5SF 3VK1A 2YZSA 3F46A 2A1DD 3TOLA 4CS8A 4DXNA 4KC9A 1UFBA 1TR2A 4C3BA 3DQ5A 4U5HA 3SVRA 3W1CA 1ZU5A 1LI7A 3LNMB 4DJ9A 4GOBA 1Q4EA 4UDVA 2KK1A 1V4AA 3SNHA 3EHNA 1RXQA 5L0FA 5EJUA 2YL3A 3DQ3A 4UTSA 3C18A 2J9WA 4E7ZA 5E3AA 2LQGA 2GAQA 4R6DA 1RKEB 3JT1A 3WLDA 3LJBA 5B3SC 5LTRA 3U0LA 4W72A 1H6RA 3GWLA 4WGZA 5L0CA 3MYIA 5CI9A 3SVCA 5BQGA 4D4NA 4BJ5C 1TWAA 2P6VA 5EB7A 4C7OB 5H87A 4MTOA 3DD7A 2WVQA 4PPKA 4FESA 4TZAA 5DTZA 2MYSA 5J2OA 4W6LA 2HMZA 4OIPF 5JT4A 3IPMO 5HGEA 2R25A 5AGFA 3FHDA 1NBBA 3UGOA 1BZ4A 1JC1A 3DZAA 3BX9A 3CFFA 2KSFA 1B9CA 4BEMJ 4EUKB 2YLDA 5KYUB 3S84A 2JPUA 5AC4A 3T6BA 5KTGA 2OJED 4XLNF 1SR2A 4IARA 1VLTA 3EJNA 3SEOA 5KYYA 4CDVA 3R2PA 2GW4B 4HE4A 2B0HA 2A50B 4DKNA 2XM4A 4KBLA 4GF6B 2VB6A 3PJ5A 5DPIA 4CX9A 3GEIA 2QE9A 3LESA 2Z6YA 4YT8A 1MOVA 1Z7Qc 2G6XA 5L0DA 1RMMA 3NEDA 4J88A 3ZUJA 3W2VA 1VB5A 3CBEA 3DE8A 4GESB 3O39A 3SP1A 1I4YA 1OKKD 3IQ6A 4E18A 4MVOA 5KYXA 4KI2A 1OXKA 4EHPA 2G3VA 3KYIA 5K0IA 1A7DA 1G5ZA 5A6KA 1Z23A 4F4BA 3WAQA 5DRFA 3JYYA 5CIVA 3T4RA 2B3PA 5L0JA 4TZGA 3W1DA 4JC7A 5JLIA 4H3NA 2Q9AA 2OEXA 3ZTFA 2VADA 2DB4A 2A69F 5A6BA 3MLGA 4EN1A 1OR3A 1OCCC 2R02A 2QLHA 3T6GB 2NPUA 5BQIA 2M4EA 3S29A 3RQGA 4XEKA 3GJ2A 1GFLA 2J9VA 3IHUA 4ZBLA 4HQ9A 1Q4DA 3M22A 1A7EA 1ZU4A 1OW6A 4W76A 1EMEA 1W7TA 1D0YA 2AWYA 4OHSA 1LIHA 1H6GA 2VC9A 2CGEA 2OG2A 3NF0A 2IB5A 2YDZA 4EDOA 3SVOA 3SG7A 3RIPA 3EGXA 3EVPA 3PCVA 4W6GA 3DMDA 2Y69C 3U8VA 3POVA 1RKCA 1ZGQA 4JJFA 2KNHA 2R7SA 4BJ6C 2EPOA 3KH2A 1YZCA 4Z4MA 1ZHXA 3V5YA 4FAPB 4IZNA 5EBJA 4C3EA 3GM1A 1QSPA 1BR1A 3US6A 2FFHA 3AI4A 4AK9A 1AUEA 2QLGB 2J9BA 1QYFA 3HNKA 4LJDC 1JBYA 3OA1A 4U5CE 3RW0A 3LF4B 1YZAA 3AKOA 3QW1A 4MTGA 1LS1A 2ZMUA 1QY3A 5BUOA 4LQTA 3ZWIA 2YL0A 3RH3A 1H9TA 3SXYA 2IXOA 5HZTA 1M2OA 1NLXA 2WZLA 1PV3A 2XLVA 4A2NB 1S05A 3KKBA 2YHSA 4IAQA 3OGOA 5A69A 5A6JA 4MW8A 1H7IA 2VH3A 4DXOA 1GGQA 3M15A 4OIRF 4PJNA 3S28A 3SSLA 4ORNA 1MMGA 1QZXA 4PFEA 3TK0A 4LACB 2G6YA 2O2BA 4XEVA 1FNTc 4OGSA 1VLSA 1T6IA 2KW3C 3FDQA 4G0HA 4HFKB 2HQKA 2L9JA 5FCLA 5BTTA 5DS4A 3GODA 4ZF5A 2G16B 1ZZPA 4YT2A 4LQUA 1YYXA 1B68A 1A7VA 3S90A 3DQ9A 3GEEA 2XXAA 1NZEA 4JVSA 3IEEA 5JSLA 4BEJA 5DQBA 1T5OA 3QVYA 1ZUXA 4IK4A 4NY3A 4W6SA 5AC5A 2H8QA 2OTEA 2VAEA 1ZHYA 3EK4A 4PPJA 1Q0MA 3VF0A 2VZXA 2HFIA 2A6EF 2R7VA 4Q7CA 3TQOA 2CNWD 3C8GD 3EH2A 3E5TA 4YT5A 3AQBA 1GM5A 5HW9A 3DQDA 2DD7A 2WVOA 1FAPB 1L3PA 3S05A 3L8IA 2P1AA 2V4EC 1QXTA 5H88A 5DS5A 4ANJA 1XA9A 1WGWA 4XOWA 3HNJA 4YL0A 2EMDA 3GM3A 4CDAA 2XS1A 4MVSA 4XPXA 2FGYA 1AEPA 4ZLDA 3B9QA 2G3OA 5KYYB 4O6YA 5HZSA 4DOZA 4G7OF 2ARLA 4EBKA 5DRGA 1SMYF 4MS2A 1JR8A 4E0HA 2LFFA 2NSFA 4I2YA 1WTYA 4U5EE 1ST6A 1JBZA 4IRUA 1Q0DA 1T6QA 1MNEA 3HNIA 4H47A 5LTQA 4OIQF 3EH1A 2R9RB 1Z6AA 3DPZA 1E83A 4HFFB 2G5ZB 4J7YA 2TMVP 4KF5A 5HBDA 2G6EA 4HQ8A 5FHVA 3V5XA 1ZYRF 4LDQA 5FVGA 3DAGA 3NYMA 5KYXB 2QNLA 2L6FA 2EPMX 3W8IA 3CD1A 3B0VC 1C02A 4ZLCA 2G3DB 4WJ0A 2WB7A 5BQLA 3K33A 2YE1A 4R6BA 1D0XA 1M56C 4DXIA 4IK3A 4DBQA 4HQCA 1VYKA 2PBEA 3K1KA 3FXHA 2EMOA 2J0WA 3AG1C 3CZ6A 1XWJA 3ZG1A 3ASOC 1LS4A 1PD0A 4MTFA 4MVMA 3U9JA 3ABLC 3CFAA 3N2ZB 3DQ4A 1KYSA 4JW1A 1HW2A 4BPMA 2HQZA 1EMMA 4W6MA 2UUIA 4JRZA 2AVKA 2ETSA 3J06A 3NMKA 2DDDA 3S27A 4E0IA 5DPJA 2J7PA 4NTFA 2XLDA 1EMLA 3O6XA 4CIPA 2OKUA 3LS1A 1KU2A 4U5DE 1AVOB 2X0CA 3EZHA 2L81A 1ZGOA 4JC2A 2WSOA 3DI5A 1WASA 2IE2A 4ULVA 3CFHA 4D4XA 3DQEA 3EGXB 5FZTA 4WABA 5F5FA 4KGFA 4KNWA 1UISA 4JE9A 4PFPA 3EVRA 2VVJA 3CD9A 3LAYA 1EMGA 1XSSA 4JGEA 4W73A 2L6HA 3DQOA 2LSEA 3KCTA 5EXCI 3ABMC 4DKMA 1J8MF 4PK4A 2Z1OA 5DQTA 3EGDA 2IB6A 3UGPA 1D0ZA 3T9OA 2DUIA 2NUPA 1QYQA 2J46A 3UFZA 3SXZA 1G4US 2PX3A 2PXSA 3VICA 2Y3BA 4X0RA 4Q4ZF 2W45A 3RVZA 1CGME 2IXMA 4OINF 1XMZA 2A0UA 2VCBA 2QLEA 3N24A 3LSAA 1PCXA 2ZXRA 4XEFA 1ZGPA 4K1OA 3HJCA 1ORYA 2XL8A 3NDBB 2HS5A 2L6GA 1WN0A 2PF4E 5B3IA 3DQ2A 3IR8A 3DWWA 4PJJA 2DI3A 2A48A 4W6IA 4W7RA 3LVCA 2NG1A 4XWJA 2EINC 4J30B 5BTTB 1Z1PA 1E2XA 5T3WA 2HJOA 2ZD9A 1ZVZA 4DVZA 2FWQA 2Q00A 1JMWA 2I15A 3EHMA 2IOQA 2O24A 1Q0FA 2ZMWA 4W8PA 3TMRA 3RWTA 1WATA 4RBNA 3U5SA 3NKDA 3DQFA 3M24A 3K1IC 3AGTA 2HZ8A 4A4AA 3NYJA 3G4ZA 2W9YA 4LLEA 2XXAB 5DY6A 3QTHA 1EQ1A 1XZPA 3ED8A 4EULA 3Q6MA 2Q7RA 4BJ6A 3FOOA 3SYNA 3SZRA 2A56B 4NTBA 3B0UX 4XL5A 2H9WA 1YHHA 4HE8D 3PJBA 2FL1A 5A6AA 3C62A 4P9TA 3I5QA 4IGGA 3RYLA 3ZUFA 4XPYA 2R7QA 3TMTA 3EFOA 3GJ1A 3DQ6A 3KYJA 4JTAB 2ZO7A 1Q0GA 2HGDA 4JCZA 1M57C 1NU7D 1BDJB 1C4FA 5T3IA 5LK4A 1LVKA 5L3QA 3MFNA 1KYPA 1RMPA 4L13A 2EIJC 1NFOA 4H3LA 4OJ0A 3ST2A 2KJGA 2VCAA 3U0MA 2XL6A 4YL1A 4YN0B 3G50A 5F5HA 3RVYA 4JURI 4PR9A 1A0BA 3DQCA 2YEVA 3SS0A 3DQKA 2DUEA 4JIOA 4JJGA 3NYLA 3ADFA 1MQVA 1A41A 1LI5A 3GM2A 2OU6A 3B0PA 3H1RA 3O78A 3SVDA 4MVZA
chains in the Genus database with same CATH topology
4IAQA 3DQ8A 3OGOA 3WCKA 3SG2A 3SRYA 3I19A 4DXOA 2OGRA 3M15A 2H5PA 4W6FA 1RM9A 2Z6XA 3EK7A 5JUAA 3SSLA 4ORNA 4KW4A 4PFEA 2HCGA 1Q73A 2G6YA 2O2BA 4W6AA 1Z1QA 4OGSA 4DXMA 3M79A 1E84A 1MYWA 3GEXA 5BT0A 2Q6PA 1W7UA 1YHGA 1Q4BA 2HQKA 5BTTA 2QZ0A 4ZF5A 2G16B 4PPLA 3NEZA 3ST0A 3DQIA 4LQUA 2RH7A 1YYXA 3L1MA 5JP7A 1GGXA 2YE0A 4KF5C 2WISA 1A7VA 2WIQA 2Q57A 1EMFA 1EMCA 4NWSA 1OXFA 5EXUA 3P28A 2J8WA 2AWLA 1G7KA 2ZO6A 3ST3A 4CDYA 3DQ9A 4OQWA 1OXEA 5F9GA 3TOMA 1CV7A 3SG6A 3ZQVA 5JSLA 2V4EA 4BDUA 5DQBA 4OY4A 3QVYA 3M4BA 4ER9A 1ZUXA 3A8SA 4IK4A 1CPRA 4W6SA 1F09A 2H8QA 2OTEA 3DQUA 2XLOA 3EKHA 4H48A 2VAEA 3SG3A 3NMIA 2GX0A 2XLEA 3EK4A 4PPJA 4JKVA 3SSKA 2VZXA 3E5VA 4XVPA 5FVIA 2WURA 4W6DA 3UG0A 4ZF3A 4LJDA 3E5TA 2O29A 4KF4A 2QLIA 2AWMA 3H1OA 3U8PA 4KGEA 4W69A 1YFPA 5HW9A 3DQDA 2DD7A 4W7EA 3RWAA 3S05A 5H89A 5HZOA 4HVFA 3LF3A 2V4EC 2XLWA 2Y0GA 4KEXA 1QXTA 1YJ2A 5H88A 1RMOA 3KCSA 4ANJA 1HCJA 1XA9A 4H3MA 4XOWA 4ZF4A 2A54B 3HNJA 4W77A 5JS5A 3SVBA 2EMDA 4CDAA 5DU0A 2CCYA 2WHUA 4Q9WA 3V3DA 4W6UA 4W6NA 1BFPA 3DQHA 2G3OA 4U2VA 2A47A 5HZSA 4W6HA 2ARLA 4J8AA 3MGFA 5DRGA 1KP5A 1W7SA 4EDSA 1XAEA 4RYWA 5DTLA 5FVFA 1E86A 2C9IA 4W6OA 2YFPA 3QVZA 4I2YA 2H6VA 4W6KA 2DUHA 1XQMA 4IK8A 4B30A 1JBZA 2QLGA 3ST4A 3G9AA 1APCA 4N6HA 2AWJA 3DQLA 3HNIA 3ZQYA 3CB9A 2ICRA 3LA1A 4H47A 3ZULA 3WLCA 5LTQA 2YLIA 3DPZA 3SG4A 1E83A 2XLHA 2G5ZB 3IQ5A 3BXBA 3SVEA 4KF5A 4W6JA 3SVSA 5HBDA 4L6RA 4IK1A 1RCPA 4AS8A 2G6EA 3M4CA 2HPWA 2QRFA 4HQ8A 5FHVA 1EMKA 2H5QA 4U9DA 4NC3A 4W74A 5FVGA 4W7FA 1BBHA 3CD1A 3DQJA 1M6TA 3EVUA 1QPUA 2B3QA 5DQMA 4W6BA 2G3DB 3VK1A 3SSVA 5BQLA 3DE9A 1YHIA 2YE1A 4R6BA 4Z4KA 4KA9A 3CGLA 3TOLA 2AHAA 4DXIA 4DXNA 4IK3A 2YKZA 4HQCA 2WHTA 3K1KA 4RTCA 1GL4A 1HUYA 2H5OA 3DQ5A 3SVRA 2EMOA 3W1CA 2AH8A 4GOBA 4LJBA 1Q4EA 3CFAA 3SVUA 2XM0A 3SSPA 5EJUA 3DQ4A 2YL3A 1KYSA 3DQ3A 4UTSA 1KYRA 3OSQA 4Q7UA 2HQZA 4IK5A 5EB6A 1EMMA 4R6DA 4W6MA 3SG5A 3WLDA 3DPXA 3GB3A 5EHUA 5LTRA 3NMKA 3U0LA 2DDDA 4W72A 1H6RA 3EVVA 2OKWA 5DPJA 4W6PA 2XLDA 4WGZA 1EMLA 4JFGA 4WGYA 3SVCA 4CIPA 2WHSA 4D4NA 4XOVA 4J89A 4W7CA 3HNLA 1ZGOA 5EB7A 3VRCA 5H87A 4JC2A 2WSOA 2IE2A 4EIYA 4ULVA 3CFHA 4D4XA 3SSHA 4PPKA 2A46A 3VHTB 3DQEA 4KGFA 3LVAA 4TZAA 4U9EA 1UISA 3LVDA 5DTZA 4JE9A 5J2OA 4W6LA 3U8AA 4ZFSA 2YL7A 3EVRA 2BTJA 5JT4A 2VVJA 3EKJA 4ZIOA 3CD9A 5HGEA 5AGFA 1E85A 3SV5A 1NBBA 1EMGA 1XSSA 2PXWA 4JGEA 1JC1A 4JF9A 2C9JA 3BX9A 3C63A 3CFFA 4W73A 2XLMA 3DQOA 1B9CA 3KCTA 2YLDA 2WSNA 4IK9A 5EXBA 5EXCI 4DKMA 5DPHA 2Z1OA 1H4UA 3NT9A 2IB6A 5KTGA 3DQNA 4Q9XA 4IARA 2DUFA 5DTXA 3U0KA 4CDVA 2GW4B 4ZB1A 4HE4A 2DUIA 2YLGA 2A50B 1QYQA 2VVHA 3UFZA 4DKNA 2XM4A 2PXSA 4GF6B 3VICA 1Q4CA 4JEOA 4LJCA 2A53B 4Q7RA 3PJ5A 4KAGA 5DPIA 2AWKA 2Z6ZA 3U0NA 3SVNA 3AI5A 4AR7A 1XMZA 4CX9A 2QLEA 2Z6YA 2A52B 3LSAA 2OTBA 1MOVA 2HRSA 3OSRA 5HZUA 1JAFA 2G6XA 3U8CA 1ZGPA 2XL8A 1MOUA 4ZINA 1RRXA 1RMMA 3NEDA 3IP2A 3DQ7A 4J88A 3ZUJA 5B3IA 3DQ2A 3IR8A 3PJ7A 2P4MA 3CBEA 3EK8A 2YL1A 3DE8A 4GESB 4P1QA 1QYOA 2A48A 4Q7TA 4B5YA 4W6IA 4W7RA 3IQ6A 2HGYA 3DQAA 3LVCA 3DPWA 3SSTA 4XGYA 1YZWA 5BTTB 1Z1PA 2HJOA 2QU1A 1CGOA 3ZTZA 2FWQA 5DRFA 2O24A 2ZMWA 2BC5A 2B3PA 3W1DA 4P76A 1F0BA 4TZGA 2DUGA 3RWTA 3TMRA 5JLIA 4H3NA 1S6ZA 3ZTFA 2VADA 2GW3A 3DQFA 3M24A 4DXQA 4W7DA 4EN1A 3DQMA 5DY6A 2V4EB 2DD9A 4L12A 3FOPA 3GL4A 2QLHA 2H5RA 4W7XA 3ED8A 4EULA 4JEAA 4JRBA 5DTYA 1CPQA 4W7AA 1CGNA 3FOOA 3E5WA 4DXPA 3GJ2A 1GFLA 4CJOA 5JRAA 2A56B 4KW9A 2EMNA 4XL5A 4ZBLA 4HQ9A 2H9WA 1Q4DA 1YHHA 3M22A 3PJBA 2FL1A 1YYJA 2QLAA 3C62A 4W76A 1EMEA 3ZUFA 1W7TA 4KPIA 3TMTA 3BXCA 1LM3B 2G2SB 4OHSA 3GJ1A 3NT3A 3DQ6A 3NF0A 3QW0A 2IB5A 2YDZA 2POXA 5LTPA 1EMAA 1Q4AA 4W6TA 4EDOA 2ZO7A 3SVOA 2GX2A 3VHTA 3SG7A 2HGDA 3EVPA 2HFCA 4W6GA 4N4WA 4KW8A 2OJKA 3NMJA 4JEBA 1JC0A 4CJGA 1C4FA 5T3IA 1ZGQA 3BXAA 3ZTMA 3DQ1A 5LK4A 1EMBA 1YZCA 4Z4MA 1KYPA 1RMPA 2IOVA 5JVEA 4L13A 4H3LA 4IZNA 4OJ0A 5EBJA 4LW5A 3ST2A 3U0MA 2XL6A 5AQBB 2FZUA 3PIBA 4L1IA 1GQAA 2QT2A 3AI4A 4B30B 2QLGB 4W6RA 2J9BA 1QYFA 3HNKA 2JADA 4LJDC 3DQCA 3P8UA 1JBYA 1OXDA 1QQ3A 3SS0A 3DQKA 4W6CA 3LF4B 5DPGA 1YZAA 2DUEA 3QW1A 3AKOA 2ZMUA 1QY3A 3ADFA 2OKYA 4LQTA 4W75A 1MQVA 3ZWIA 4RYSA 4EMQA 1EKYA 2YL0A 3LS3A 1YJFA 3O77A 5HZTA 3H1RA 3O78A 2DDCA 3SVDA 256BA 4IB4A 2XLVA 3SSYA 1S05A 4N3DA 2VVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAQ A;  3DQ8 A;  3OGO A;  3WCK A;  3SG2 A;  3SRY A;  3I19 A;  4DXO A;  2OGR A;  3M15 A;  2H5P A;  4W6F A;  1RM9 A;  2Z6X A;  3EK7 A;  5JUA A;  3SSL A;  4ORN A;  4KW4 A;  4PFE A;  2HCG A;  1Q73 A;  2G6Y A;  2O2B A;  4W6A A;  1Z1Q A;  4OGS A;  4DXM A;  3M79 A;  1E84 A;  1MYW A;  3GEX A;  5BT0 A;  2Q6P A;  1W7U A;  1YHG A;  1Q4B A;  2HQK A;  5BTT A;  2QZ0 A;  4ZF5 A;  2G16 B;  4PPL A;  3NEZ A;  3ST0 A;  3DQI A;  4LQU A;  2RH7 A;  1YYX A;  3L1M A;  5JP7 A;  1GGX A;  2YE0 A;  4KF5 C;  2WIS A;  1A7V A;  2WIQ A;  2Q57 A;  1EMF A;  1EMC A;  4NWS A;  1OXF A;  5EXU A;  3P28 A;  2J8W A;  2AWL A;  1G7K A;  2ZO6 A;  3ST3 A;  4CDY A;  3DQ9 A;  4OQW A;  1OXE A;  5F9G A;  3TOM A;  1CV7 A;  3SG6 A;  3ZQV A;  5JSL A;  2V4E A;  4BDU A;  5DQB A;  4OY4 A;  3QVY A;  3M4B A;  4ER9 A;  1ZUX A;  3A8S A;  4IK4 A;  1CPR A;  4W6S A;  1F09 A;  2H8Q A;  2OTE A;  3DQU A;  2XLO A;  3EKH A;  4H48 A;  2VAE A;  3SG3 A;  3NMI A;  2GX0 A;  2XLE A;  3EK4 A;  4PPJ A;  4JKV A;  3SSK A;  2VZX A;  3E5V A;  4XVP A;  5FVI A;  2WUR A;  4W6D A;  3UG0 A;  4ZF3 A;  4LJD A;  3E5T A;  2O29 A;  4KF4 A;  2QLI A;  2AWM A;  3H1O A;  3U8P A;  4KGE A;  4W69 A;  1YFP A;  5HW9 A;  3DQD A;  2DD7 A;  4W7E A;  3RWA A;  3S05 A;  5H89 A;  5HZO A;  4HVF A;  3LF3 A;  2V4E C;  2XLW A;  2Y0G A;  4KEX A;  1QXT A;  1YJ2 A;  5H88 A;  1RMO A;  3KCS A;  4ANJ A;  1HCJ A;  1XA9 A;  4H3M A;  4XOW A;  4ZF4 A;  2A54 B;  3HNJ A;  4W77 A;  5JS5 A;  3SVB A;  2EMD A;  4CDA A;  5DU0 A;  2CCY A;  2WHU A;  4Q9W A;  3V3D A;  4W6U A;  4W6N A;  1BFP A;  3DQH A;  2G3O A;  4U2V A;  2A47 A;  5HZS A;  4W6H A;  2ARL A;  4J8A A;  3MGF A;  5DRG A;  1KP5 A;  1W7S A;  4EDS A;  1XAE A;  4RYW A;  5DTL A;  5FVF A;  1E86 A;  2C9I A;  4W6O A;  2YFP A;  3QVZ A;  4I2Y A;  2H6V A;  4W6K A;  2DUH A;  1XQM A;  4IK8 A;  4B30 A;  1JBZ A;  2QLG A;  3ST4 A;  3G9A A;  1APC A;  4N6H A;  2AWJ A;  3DQL A;  3HNI A;  3ZQY A;  3CB9 A;  2ICR A;  3LA1 A;  4H47 A;  3ZUL A;  3WLC A;  5LTQ A;  2YLI A;  3DPZ A;  3SG4 A;  1E83 A;  2XLH A;  2G5Z B;  3IQ5 A;  3BXB A;  3SVE A;  4KF5 A;  4W6J A;  3SVS A;  5HBD A;  4L6R A;  4IK1 A;  1RCP A;  4AS8 A;  2G6E A;  3M4C A;  2HPW A;  2QRF A;  4HQ8 A;  5FHV A;  1EMK A;  2H5Q A;  4U9D A;  4NC3 A;  4W74 A;  5FVG A;  4W7F A;  1BBH A;  3CD1 A;  3DQJ A;  1M6T A;  3EVU A;  1QPU A;  2B3Q A;  5DQM A;  4W6B A;  2G3D B;  3VK1 A;  3SSV A;  5BQL A;  3DE9 A;  1YHI A;  2YE1 A;  4R6B A;  4Z4K A;  4KA9 A;  3CGL A;  3TOL A;  2AHA A;  4DXI A;  4DXN A;  4IK3 A;  2YKZ A;  4HQC A;  2WHT A;  3K1K A;  4RTC A;  1GL4 A;  1HUY A;  2H5O A;  3DQ5 A;  3SVR A;  2EMO A;  3W1C A;  2AH8 A;  4GOB A;  4LJB A;  1Q4E A;  3CFA A;  3SVU A;  2XM0 A;  3SSP A;  5EJU A;  3DQ4 A;  2YL3 A;  1KYS A;  3DQ3 A;  4UTS A;  1KYR A;  3OSQ A;  4Q7U A;  2HQZ A;  4IK5 A;  5EB6 A;  1EMM A;  4R6D A;  4W6M A;  3SG5 A;  3WLD A;  3DPX A;  3GB3 A;  5EHU A;  5LTR A;  3NMK A;  3U0L A;  2DDD A;  4W72 A;  1H6R A;  3EVV A;  2OKW A;  5DPJ A;  4W6P A;  2XLD A;  4WGZ A;  1EML A;  4JFG A;  4WGY A;  3SVC A;  4CIP A;  2WHS A;  4D4N A;  4XOV A;  4J89 A;  4W7C A;  3HNL A;  1ZGO A;  5EB7 A;  3VRC A;  5H87 A;  4JC2 A;  2WSO A;  2IE2 A;  4EIY A;  4ULV A;  3CFH A;  4D4X A;  3SSH A;  4PPK A;  2A46 A;  3VHT B;  3DQE A;  4KGF A;  3LVA A;  4TZA A;  4U9E A;  1UIS A;  3LVD A;  5DTZ A;  4JE9 A;  5J2O A;  4W6L A;  3U8A A;  4ZFS A;  2YL7 A;  3EVR A;  2BTJ A;  5JT4 A;  2VVJ A;  3EKJ A;  4ZIO A;  3CD9 A;  5HGE A;  5AGF A;  1E85 A;  3SV5 A;  1NBB A;  1EMG A;  1XSS A;  2PXW A;  4JGE A;  1JC1 A;  4JF9 A;  2C9J A;  3BX9 A;  3C63 A;  3CFF A;  4W73 A;  2XLM A;  3DQO A;  1B9C A;  3KCT A;  2YLD A;  2WSN A;  4IK9 A;  5EXB A;  5EXC I;  4DKM A;  5DPH A;  2Z1O A;  1H4U A;  3NT9 A;  2IB6 A;  5KTG A;  3DQN A;  4Q9X A;  4IAR A;  2DUF A;  5DTX A;  3U0K A;  4CDV A;  2GW4 B;  4ZB1 A;  4HE4 A;  2DUI A;  2YLG A;  2A50 B;  1QYQ A;  2VVH A;  3UFZ A;  4DKN A;  2XM4 A;  2PXS A;  4GF6 B;  3VIC A;  1Q4C A;  4JEO A;  4LJC A;  2A53 B;  4Q7R A;  3PJ5 A;  4KAG A;  5DPI A;  2AWK A;  2Z6Z A;  3U0N A;  3SVN A;  3AI5 A;  4AR7 A;  1XMZ A;  4CX9 A;  2QLE A;  2Z6Y A;  2A52 B;  3LSA A;  2OTB A;  1MOV A;  2HRS A;  3OSR A;  5HZU A;  1JAF A;  2G6X A;  3U8C A;  1ZGP A;  2XL8 A;  1MOU A;  4ZIN A;  1RRX A;  1RMM A;  3NED A;  3IP2 A;  3DQ7 A;  4J88 A;  3ZUJ A;  5B3I A;  3DQ2 A;  3IR8 A;  3PJ7 A;  2P4M A;  3CBE A;  3EK8 A;  2YL1 A;  3DE8 A;  4GES B;  4P1Q A;  1QYO A;  2A48 A;  4Q7T A;  4B5Y A;  4W6I A;  4W7R A;  3IQ6 A;  2HGY A;  3DQA A;  3LVC A;  3DPW A;  3SST A;  4XGY A;  1YZW A;  5BTT B;  1Z1P A;  2HJO A;  2QU1 A;  1CGO A;  3ZTZ A;  2FWQ A;  5DRF A;  2O24 A;  2ZMW A;  2BC5 A;  2B3P A;  3W1D A;  4P76 A;  1F0B A;  4TZG A;  2DUG A;  3RWT A;  3TMR A;  5JLI A;  4H3N A;  1S6Z A;  3ZTF A;  2VAD A;  2GW3 A;  3DQF A;  3M24 A;  4DXQ A;  4W7D A;  4EN1 A;  3DQM A;  5DY6 A;  2V4E B;  2DD9 A;  4L12 A;  3FOP A;  3GL4 A;  2QLH A;  2H5R A;  4W7X A;  3ED8 A;  4EUL A;  4JEA A;  4JRB A;  5DTY A;  1CPQ A;  4W7A A;  1CGN A;  3FOO A;  3E5W A;  4DXP A;  3GJ2 A;  1GFL A;  4CJO A;  5JRA A;  2A56 B;  4KW9 A;  2EMN A;  4XL5 A;  4ZBL A;  4HQ9 A;  2H9W A;  1Q4D A;  1YHH A;  3M22 A;  3PJB A;  2FL1 A;  1YYJ A;  2QLA A;  3C62 A;  4W76 A;  1EME A;  3ZUF A;  1W7T A;  4KPI A;  3TMT A;  3BXC A;  1LM3 B;  2G2S B;  4OHS A;  3GJ1 A;  3NT3 A;  3DQ6 A;  3NF0 A;  3QW0 A;  2IB5 A;  2YDZ A;  2POX A;  5LTP A;  1EMA A;  1Q4A A;  4W6T A;  4EDO A;  2ZO7 A;  3SVO A;  2GX2 A;  3VHT A;  3SG7 A;  2HGD A;  3EVP A;  2HFC A;  4W6G A;  4N4W A;  4KW8 A;  2OJK A;  3NMJ A;  4JEB A;  1JC0 A;  4CJG A;  1C4F A;  5T3I A;  1ZGQ A;  3BXA A;  3ZTM A;  3DQ1 A;  5LK4 A;  1EMB A;  1YZC A;  4Z4M A;  1KYP A;  1RMP A;  2IOV A;  5JVE A;  4L13 A;  4H3L A;  4IZN A;  4OJ0 A;  5EBJ A;  4LW5 A;  3ST2 A;  3U0M A;  2XL6 A;  5AQB B;  2FZU A;  3PIB A;  4L1I A;  1GQA A;  2QT2 A;  3AI4 A;  4B30 B;  2QLG B;  4W6R A;  2J9B A;  1QYF A;  3HNK A;  2JAD A;  4LJD C;  3DQC A;  3P8U A;  1JBY A;  1OXD A;  1QQ3 A;  3SS0 A;  3DQK A;  4W6C A;  3LF4 B;  5DPG A;  1YZA A;  2DUE A;  3QW1 A;  3AKO A;  2ZMU A;  1QY3 A;  3ADF A;  2OKY A;  4LQT A;  4W75 A;  1MQV A;  3ZWI A;  4RYS A;  4EMQ A;  1EKY A;  2YL0 A;  3LS3 A;  1YJF A;  3O77 A;  5HZT A;  3H1R A;  3O78 A;  2DDC A;  3SVD A;  256B A;  4IB4 A;  2XLV A;  3SSY A;  1S05 A;  4N3D A;  2VVI A; 
#chains in the Genus database with same CATH topology
 4QI2 A;  3WCK A;  4QI0 A;  1U89 A;  1QLE C;  2H5P A;  4MQ9 F;  1D1C A;  3LUT B;  3DKA A;  3A9C A;  3VM6 A;  2Q3T A;  3M79 A;  1E84 A;  5DLJ A;  2A6H F;  1V54 C;  2Q6P A;  1W7U A;  3WOD F;  1H9G A;  1FMV A;  1FFT C;  2EPL X;  4YL3 A;  2RSE B;  2QZ0 A;  4PPL A;  3ITF A;  3DJN B;  4W8K A;  1C17 M;  1GS9 A;  3K66 A;  3EQL F;  2WIS A;  4O7G A;  2E87 A;  2WIQ A;  4GQH A;  4BJT A;  3P28 A;  2HSQ A;  2AWL A;  4YJW A;  2ZO6 A;  5F9G A;  4YT4 A;  1BR2 A;  2HV7 A;  2V4E A;  3ZDL A;  3M4B A;  4ER9 A;  3U2M A;  2A0B A;  3EZI A;  3JYH A;  3AG2 C;  3EKH A;  4H48 A;  2AU5 A;  4H4K C;  2GX0 A;  2B0J A;  1FTS A;  3WHN A;  1OW8 A;  4XVP A;  2WUR A;  4JTC B;  4W6D A;  4OD4 A;  3H1O A;  1DOW A;  1M2V A;  1YFP A;  3OWT A;  4XTK A;  2XL4 A;  3FAJ A;  4HVF A;  1TQG A;  3SXM A;  2XLW A;  1YJ2 A;  1RMO A;  3DM5 A;  1HCJ A;  2LP4 A;  2A54 B;  3EGD B;  5DU0 A;  2CCY A;  4Q9W A;  3V3D A;  2IM8 A;  5A6B D;  3DQH A;  1O3U A;  1J8Y F;  2NUP B;  1W7S A;  4EDS A;  4RYW A;  1T6U A;  5FVF A;  2Q9B A;  1HMD A;  5E33 A;  1ZHW A;  2HMQ A;  4W6K A;  4IK8 A;  4B30 A;  3G9A A;  2WVN A;  2AWJ A;  1N1C A;  1S7Z A;  3JTL O;  2ICR A;  4J7T A;  2Y3D A;  2YLI A;  3BXB A;  3UMH A;  4W6J A;  4IK1 A;  4LDK A;  4AS8 A;  3H65 A;  3M4C A;  2DGJ A;  1NG1 A;  2MWQ A;  5COM A;  2IXN A;  2H5Q A;  4XPW A;  3AG4 C;  4J32 B;  4W74 A;  1EA8 A;  1M6T A;  1QPU A;  2C03 A;  2EIL C;  3SSV A;  2P61 A;  1YHI A;  2AWC A;  3C8G A;  1C03 A;  4KA9 A;  1F1M A;  2AHA A;  3JCU Q;  3LS0 A;  2YKZ A;  2R7O A;  4GEH A;  1GL4 A;  2H5O A;  1SZI A;  1WOL A;  4CS7 A;  4PJM A;  3SSP A;  3S9O A;  3U0C A;  1YVI A;  2LD6 A;  4IK5 A;  5EB6 A;  3Q7L A;  3SG5 A;  1TKN A;  3W8H A;  5KYW B;  5EHU A;  2OKW A;  2HV6 A;  4JFG A;  3MBG A;  3V7O A;  4CS9 C;  2WHS A;  1YLM A;  3EFO B;  3VRC A;  3RQE A;  3SSH A;  2A46 A;  2BE5 F;  3X1O A;  3LVA A;  2OQM A;  1IZM A;  4E17 A;  4ZFS A;  2YL7 A;  4MVU A;  3ASN C;  4XQ1 A;  4RDA A;  3LLK A;  2FAP B;  2GA0 A;  2PXW A;  1L7C A;  2EIK C;  2C9J A;  1UG7 A;  2RD9 A;  3NRH A;  2XLM A;  5IY5 C;  4U5G A;  5EGY A;  4IK9 A;  3F47 A;  4Z9I A;  4R32 A;  1I5N A;  3NT9 A;  4FWV A;  2J0X A;  4Q9X A;  1U6H A;  1W2W A;  4RD9 A;  5DTX A;  4ZB1 A;  1FR0 A;  3PMR A;  3ATP A;  4LLC A;  1ORS C;  1Q4C A;  2OCC C;  5EK0 A;  3U0N A;  3SVN A;  1NSG B;  1RJ9 A;  2A52 B;  2IYL D;  2OTB A;  3OSR A;  4AL1 A;  3K1I A;  3DQ7 A;  2CDQ A;  1QYO A;  4Q7T A;  3CQZ A;  2HGY A;  2G62 A;  3UR3 C;  3SST A;  1YZW A;  1EI7 A;  1HW1 A;  1CGO A;  4I3M A;  4BJ5 A;  1WWP A;  4P76 A;  2DUG A;  1S6Z A;  3W2W A;  2GWW A;  2GW3 A;  1IW7 F;  4DXQ A;  4W7D A;  2MHR A;  2GDC A;  3DQM A;  2UUH A;  2V4E B;  4H54 A;  2DD9 A;  4L12 A;  2NUT A;  3FOP A;  2H5R A;  3T6J A;  4JEA A;  5DTY A;  3K6B A;  4JZA A;  1CPQ A;  1D1A A;  4W7A A;  5EHH A;  2D4U A;  5F28 E;  4XLP F;  1G8X A;  2ICW G;  5D92 A;  4MVQ A;  3E5W A;  4DXP A;  4CJO A;  3ABK C;  4DRJ B;  2HJ3 A;  2GFH A;  2CYD A;  1YYJ A;  2QLA A;  3U9M A;  3MX3 A;  1M2V B;  1V55 C;  3AOU A;  3NT3 A;  2R03 A;  4OD5 A;  1VYI A;  1Q4A A;  3IQC A;  2GX2 A;  3VHT A;  4DXW A;  4LER A;  2HFC A;  4KW8 A;  2IBF A;  4G7H F;  3NMJ A;  1VMA A;  1JC0 A;  2Q4F A;  3ZTM A;  2W4M A;  1EMB A;  3B71 A;  2EPN A;  2WZG A;  5JVE A;  2YQY A;  4LW5 A;  1SYQ A;  5GPG B;  4EKW A;  5AQB B;  2FZU A;  1MMA A;  3PIB A;  4L1I A;  3H2U A;  1GQA A;  2QT2 A;  4B30 B;  3VAY A;  2H7O A;  4G7Z F;  2JAD A;  3Q7G A;  1QQ3 A;  4W6C A;  2KQ9 A;  5DPG A;  2J7P D;  1TWC A;  4DVY P;  2Y3H A;  2OKY A;  2LIG A;  2ZXO A;  4EMQ A;  1EKY A;  4E7S A;  4NTA A;  1YJF A;  2KC3 A;  2DDC A;  256B A;  4IB4 A;  3CSK A;  2VVI A;  2R7U A;  3DQ8 A;  3SRY A;  3UNG C;  1VOM A;  1Y6D A;  3EG9 A;  4IWB A;  3I19 A;  2PP4 A;  2OGR A;  3H2V A;  4W6F A;  2Z6X A;  5CI8 A;  1ORJ A;  3EK7 A;  5JUA A;  3OEO A;  3C8G B;  4KW4 A;  4GYT A;  3JRT A;  3DXJ F;  1K04 A;  3DM9 B;  1Z1Q A;  4Z9J A;  4DRH B;  1LKX A;  1YHG A;  1Q4B A;  3K7D A;  4MND A;  2R7R A;  1R4T A;  4QDL A;  3NEZ A;  3ST0 A;  2EIM C;  3I4U A;  2RH7 A;  4CSA C;  3KMI A;  2ZXP A;  1NU9 C;  2PFD A;  5JP7 A;  1GGX A;  4KF5 C;  3DJU B;  3S0X A;  1EMF A;  1EMC A;  1KNY A;  4NWS A;  1OXF A;  3AJM A;  3GOR A;  3E9V A;  4MVR A;  1FMW A;  1OXE A;  3SXK A;  1Y4C A;  4BDU A;  3A8S A;  1OXB A;  5KYW A;  1CPR A;  1G4W R;  1F09 A;  3DQU A;  3U3B A;  4DBR A;  4AX2 A;  4P6I C;  1MMD A;  4M63 A;  5B1A C;  4KNV A;  4JKV A;  4I1M A;  3SSK A;  1MMN A;  5DS6 A;  2R7T A;  3UG0 A;  2LCH A;  4LJD A;  2EPK X;  2O29 A;  1D1B A;  1OCZ C;  3U8P A;  4G78 A;  2AP3 A;  4NQF A;  4YK5 A;  5E3C A;  3RWA A;  3LF3 A;  4O79 A;  1NFN A;  4KEX A;  1QKR A;  1OKK A;  4H3M A;  3DAF A;  4AE4 A;  5B1B C;  1BFP A;  2V26 A;  4U2V A;  2XRH A;  2C04 A;  3N0T A;  4J8A A;  5DQZ A;  1KP5 A;  2QTV A;  1XAE A;  1E86 A;  1JOG A;  3GAN A;  4FX5 A;  2C9I A;  2YFP A;  3NG1 A;  2DUH A;  2XSE A;  1APC A;  4N6H A;  1HMO A;  1OQC A;  2JD3 A;  3DQL A;  3ZQY A;  3CB9 A;  1RJ9 B;  3ZUL A;  3SG4 A;  3WG7 C;  4AL0 A;  2XLH A;  3IQ5 A;  3SVE A;  3SVS A;  2Z15 A;  4L6R A;  1RCP A;  4DRI B;  1EMK A;  3AQC A;  4U9D A;  4NC3 A;  3TJ6 A;  5L3V A;  4NCQ A;  2PNO A;  4U5B E;  3Q6N A;  4O6N A;  2B3Q A;  5DQM A;  2G3K A;  1JPN A;  1LPE A;  3DE9 A;  3RFY A;  4Z4K A;  3CGL A;  2H7V C;  2J45 A;  3JRM O;  5TJ5 E;  2WHT A;  3VYW A;  3KPH A;  4CS9 A;  4RTC A;  1HUY A;  4ONS A;  2AH8 A;  4LJB A;  2NUT B;  3SVU A;  4CIH A;  1V74 B;  2XM0 A;  2M64 A;  1KYR A;  3OSQ A;  2Y39 A;  4Q7U A;  3EPV A;  3GEH A;  2WZF A;  3DPX A;  3A11 A;  2HKV A;  4P9F A;  3JSE O;  3GB3 A;  5HV9 A;  1PD1 A;  4CS8 C;  3EVV A;  2HSB A;  1ZW3 A;  4W6P A;  4N6C A;  4WGY A;  4XOV A;  4J89 A;  4W7C A;  3ZVR A;  3HNL A;  2LFD A;  3TD7 A;  4EIY A;  3VHT B;  3K1H A;  3NKE A;  4O6M A;  3ZIB A;  4U9E A;  3LVD A;  2VCC A;  3U8A A;  3JSZ A;  2BTJ A;  3EKJ A;  4ZIO A;  3U2L A;  1LE2 A;  1YA7 O;  1E85 A;  3SV5 A;  3FVY A;  1ZHZ A;  4JF9 A;  4JTD B;  3C63 A;  5HSW A;  3U3F A;  1SF8 A;  2WSN A;  1TFO B;  5EXB A;  1T9K A;  2R05 A;  1JRA A;  2ZXW C;  5DPH A;  2L7A A;  1H4U A;  1Z63 A;  3DQN A;  2X51 A;  2DUF A;  1TWH A;  3AG3 C;  3U0K A;  2YLG A;  3RQF A;  2VVH A;  4JEO A;  4LJC A;  1TWG A;  2A53 B;  4Q7R A;  4KAG A;  2AWK A;  2Z6Z A;  3O55 A;  4EBB A;  3AI5 A;  4AR7 A;  1HE9 A;  4U5F E;  3EG9 B;  3MYF A;  3IQT A;  2HRS A;  5HZU A;  1JAF A;  3U8C A;  3GWN A;  2H8A A;  1MOU A;  4ZIN A;  1RRX A;  3IP2 A;  3PJ7 A;  4I44 A;  2P4M A;  1QVX A;  3EK8 A;  1YAU O;  2YL1 A;  4P1Q A;  2CNW A;  2D5R B;  4B5Y A;  3DQA A;  3DPW A;  3TJ5 A;  1Z3I X;  4BJ1 A;  4XGY A;  1VK5 A;  1U0B B;  2HJM A;  2QU1 A;  3B29 A;  3ZTZ A;  2R7W A;  2BC5 A;  3LEO A;  4LDR A;  1F0B A;  2Y3G A;  1ZHT A;  5L0H A;  1OCR C;  1VTM P;  3GL4 A;  4W7X A;  1TFK B;  3L34 A;  4JRB A;  1RMV A;  2H7B A;  2J9U A;  3UMK A;  1CGN A;  1RKE A;  5JRA A;  1DOV A;  4KW9 A;  2HUJ A;  2EMN A;  3CAX A;  1O5H A;  5BQH A;  3G4X A;  4ULW A;  4KPI A;  2P0N A;  1LM3 B;  2G2S B;  3BXC A;  3R7C A;  5D91 A;  4C7O A;  3QW0 A;  3X2Q C;  1Q0K A;  2POX A;  1EMA A;  4W6T A;  5LTP A;  4Z9H A;  1K05 A;  4N4W A;  2OJK A;  4AE4 B;  4I1O B;  4JEB A;  4CJG A;  5COG A;  3BXA A;  3DQ1 A;  3O10 A;  1KTM A;  2IOV A;  4HEA J;  1O87 A;  1YDI A;  3M1C B;  4N06 A;  5KYU A;  3KL4 A;  3E70 C;  3LNR A;  4W6R A;  1ZW2 A;  3P8U A;  1OXD A;  2QY9 A;  2JX0 A;  1YAR O;  4PAC A;  4YWQ A;  5T3T A;  4W75 A;  3QZC A;  4RYS A;  3LS3 A;  2BL2 A;  3O77 A;  2W4B A;  3SSY A;  4N3D A;  4C3D A;  2ZPA A;  2YVK A;  4CSA A;  4CBE A;  3AGU A;  3SG2 A;  1LE4 A;  1YJG A;  1RM9 A;  4K0D A;  2HCG A;  1Q73 A;  4EWC A;  4W6A A;  5KYN A;  2NSG A;  3BEH A;  2XS8 A;  3RF3 A;  4DXM A;  2LK4 A;  1I4Z A;  1MYW A;  3GEX A;  5BT0 A;  3HTK C;  1YA9 A;  2I8B A;  2A68 F;  4MW3 A;  4IAO A;  5COF A;  3DQI A;  3L1M A;  2YE0 A;  2OEV A;  3TUL A;  2Q57 A;  5EXU A;  2F22 A;  2J8W A;  1G7K A;  3BRJ A;  3ST3 A;  4CDY A;  4OQW A;  3TOM A;  1CV7 A;  1BR4 A;  3ZC4 A;  3SG6 A;  3ZQV A;  2QUP A;  3UMI A;  4OY4 A;  2XLO A;  3SG3 A;  1R5I D;  3NMI A;  2XLE A;  1HE1 A;  1OCO C;  3HLZ A;  2PX0 A;  2VAS A;  3E5V A;  3PDM P;  2KGO A;  3V5Z A;  5FVI A;  4ZF3 A;  3L0I A;  4KF4 A;  2QLI A;  2AWM A;  1JPJ A;  1FFH A;  2DYS C;  4KGE A;  4W69 A;  5L0I A;  2Q9C A;  3ZSU A;  4PJL A;  4W7E A;  3RKO F;  3L8J A;  5H89 A;  1T01 A;  2WL8 A;  5HZO A;  3PHF 2;  2V3C C;  2Y0G A;  3KCS A;  2IXP A;  2R7X A;  1XZQ A;  4ZF4 A;  5L0G A;  3SVB A;  3I5P A;  4W77 A;  5JS5 A;  3FAP B;  4K7B A;  3JZ0 A;  2WHU A;  2DYR C;  4W6U A;  4W6N A;  4IJJ A;  2CW0 F;  1HY5 A;  2A47 A;  3QMK A;  4W6H A;  3MGF A;  5DTL A;  3FMS A;  3LEV A;  2O9X A;  3W4Y A;  4W6O A;  3QVZ A;  1OR2 A;  2YRF A;  2H6V A;  1Z5Z A;  3LLI A;  2P7V A;  1XQM A;  2OOC A;  2QLG A;  3ST4 A;  2KYH A;  3HKK A;  3CEX A;  5T1D B;  3LA1 A;  3WLC A;  5E2Q A;  1OW7 A;  4OIO F;  3C7J A;  2YWA A;  1K40 A;  1MND A;  4JCH A;  5DVW A;  2ASR A;  4EBJ A;  2HPW A;  2QRF A;  3C8Z A;  4W7F A;  1BBH A;  4BG0 A;  2OJQ A;  4PFO A;  3DQJ A;  3EVU A;  3ECS A;  4B6I A;  4W6B A;  4Q5S F;  3VK1 A;  2YZS A;  3F46 A;  2A1D D;  3TOL A;  4CS8 A;  4DXN A;  4KC9 A;  1UFB A;  1TR2 A;  4C3B A;  3DQ5 A;  4U5H A;  3SVR A;  3W1C A;  1ZU5 A;  1LI7 A;  3LNM B;  4DJ9 A;  4GOB A;  1Q4E A;  4UDV A;  2KK1 A;  1V4A A;  3SNH A;  3EHN A;  1RXQ A;  5L0F A;  5EJU A;  2YL3 A;  3DQ3 A;  4UTS A;  3C18 A;  2J9W A;  4E7Z A;  5E3A A;  2LQG A;  2GAQ A;  4R6D A;  1RKE B;  3JT1 A;  3WLD A;  3LJB A;  5B3S C;  5LTR A;  3U0L A;  4W72 A;  1H6R A;  3GWL A;  4WGZ A;  5L0C A;  3MYI A;  5CI9 A;  3SVC A;  5BQG A;  4D4N A;  4BJ5 C;  1TWA A;  2P6V A;  5EB7 A;  4C7O B;  5H87 A;  4MTO A;  3DD7 A;  2WVQ A;  4PPK A;  4FES A;  4TZA A;  5DTZ A;  2MYS A;  5J2O A;  4W6L A;  2HMZ A;  4OIP F;  5JT4 A;  3IPM O;  5HGE A;  2R25 A;  5AGF A;  3FHD A;  1NBB A;  3UGO A;  1BZ4 A;  1JC1 A;  3DZA A;  3BX9 A;  3CFF A;  2KSF A;  1B9C A;  4BEM J;  4EUK B;  2YLD A;  5KYU B;  3S84 A;  2JPU A;  5AC4 A;  3T6B A;  5KTG A;  2OJE D;  4XLN F;  1SR2 A;  4IAR A;  1VLT A;  3EJN A;  3SEO A;  5KYY A;  4CDV A;  3R2P A;  2GW4 B;  4HE4 A;  2B0H A;  2A50 B;  4DKN A;  2XM4 A;  4KBL A;  4GF6 B;  2VB6 A;  3PJ5 A;  5DPI A;  4CX9 A;  3GEI A;  2QE9 A;  3LES A;  2Z6Y A;  4YT8 A;  1MOV A;  1Z7Q c;  2G6X A;  5L0D A;  1RMM A;  3NED A;  4J88 A;  3ZUJ A;  3W2V A;  1VB5 A;  3CBE A;  3DE8 A;  4GES B;  3O39 A;  3SP1 A;  1I4Y A;  1OKK D;  3IQ6 A;  4E18 A;  4MVO A;  5KYX A;  4KI2 A;  1OXK A;  4EHP A;  2G3V A;  3KYI A;  5K0I A;  1A7D A;  1G5Z A;  5A6K A;  1Z23 A;  4F4B A;  3WAQ A;  5DRF A;  3JYY A;  5CIV A;  3T4R A;  2B3P A;  5L0J A;  4TZG A;  3W1D A;  4JC7 A;  5JLI A;  4H3N A;  2Q9A A;  2OEX A;  3ZTF A;  2VAD A;  2DB4 A;  2A69 F;  5A6B A;  3MLG A;  4EN1 A;  1OR3 A;  1OCC C;  2R02 A;  2QLH A;  3T6G B;  2NPU A;  5BQI A;  2M4E A;  3S29 A;  3RQG A;  4XEK A;  3GJ2 A;  1GFL A;  2J9V A;  3IHU A;  4ZBL A;  4HQ9 A;  1Q4D A;  3M22 A;  1A7E A;  1ZU4 A;  1OW6 A;  4W76 A;  1EME A;  1W7T A;  1D0Y A;  2AWY A;  4OHS A;  1LIH A;  1H6G A;  2VC9 A;  2CGE A;  2OG2 A;  3NF0 A;  2IB5 A;  2YDZ A;  4EDO A;  3SVO A;  3SG7 A;  3RIP A;  3EGX A;  3EVP A;  3PCV A;  4W6G A;  3DMD A;  2Y69 C;  3U8V A;  3POV A;  1RKC A;  1ZGQ A;  4JJF A;  2KNH A;  2R7S A;  4BJ6 C;  2EPO A;  3KH2 A;  1YZC A;  4Z4M A;  1ZHX A;  3V5Y A;  4FAP B;  4IZN A;  5EBJ A;  4C3E A;  3GM1 A;  1QSP A;  1BR1 A;  3US6 A;  2FFH A;  3AI4 A;  4AK9 A;  1AUE A;  2QLG B;  2J9B A;  1QYF A;  3HNK A;  4LJD C;  1JBY A;  3OA1 A;  4U5C E;  3RW0 A;  3LF4 B;  1YZA A;  3AKO A;  3QW1 A;  4MTG A;  1LS1 A;  2ZMU A;  1QY3 A;  5BUO A;  4LQT A;  3ZWI A;  2YL0 A;  3RH3 A;  1H9T A;  3SXY A;  2IXO A;  5HZT A;  1M2O A;  1NLX A;  2WZL A;  1PV3 A;  2XLV A;  4A2N B;  1S05 A;  3KKB A;  2YHS A;  4IAQ A;  3OGO A;  5A69 A;  5A6J A;  4MW8 A;  1H7I A;  2VH3 A;  4DXO A;  1GGQ A;  3M15 A;  4OIR F;  4PJN A;  3S28 A;  3SSL A;  4ORN A;  1MMG A;  1QZX A;  4PFE A;  3TK0 A;  4LAC B;  2G6Y A;  2O2B A;  4XEV A;  1FNT c;  4OGS A;  1VLS A;  1T6I A;  2KW3 C;  3FDQ A;  4G0H A;  4HFK B;  2HQK A;  2L9J A;  5FCL A;  5BTT A;  5DS4 A;  3GOD A;  4ZF5 A;  2G16 B;  1ZZP A;  4YT2 A;  4LQU A;  1YYX A;  1B68 A;  1A7V A;  3S90 A;  3DQ9 A;  3GEE A;  2XXA A;  1NZE A;  4JVS A;  3IEE A;  5JSL A;  4BEJ A;  5DQB A;  1T5O A;  3QVY A;  1ZUX A;  4IK4 A;  4NY3 A;  4W6S A;  5AC5 A;  2H8Q A;  2OTE A;  2VAE A;  1ZHY A;  3EK4 A;  4PPJ A;  1Q0M A;  3VF0 A;  2VZX A;  2HFI A;  2A6E F;  2R7V A;  4Q7C A;  3TQO A;  2CNW D;  3C8G D;  3EH2 A;  3E5T A;  4YT5 A;  3AQB A;  1GM5 A;  5HW9 A;  3DQD A;  2DD7 A;  2WVO A;  1FAP B;  1L3P A;  3S05 A;  3L8I A;  2P1A A;  2V4E C;  1QXT A;  5H88 A;  5DS5 A;  4ANJ A;  1XA9 A;  1WGW A;  4XOW A;  3HNJ A;  4YL0 A;  2EMD A;  3GM3 A;  4CDA A;  2XS1 A;  4MVS A;  4XPX A;  2FGY A;  1AEP A;  4ZLD A;  3B9Q A;  2G3O A;  5KYY B;  4O6Y A;  5HZS A;  4DOZ A;  4G7O F;  2ARL A;  4EBK A;  5DRG A;  1SMY F;  4MS2 A;  1JR8 A;  4E0H A;  2LFF A;  2NSF A;  4I2Y A;  1WTY A;  4U5E E;  1ST6 A;  1JBZ A;  4IRU A;  1Q0D A;  1T6Q A;  1MNE A;  3HNI A;  4H47 A;  5LTQ A;  4OIQ F;  3EH1 A;  2R9R B;  1Z6A A;  3DPZ A;  1E83 A;  4HFF B;  2G5Z B;  4J7Y A;  2TMV P;  4KF5 A;  5HBD A;  2G6E A;  4HQ8 A;  5FHV A;  3V5X A;  1ZYR F;  4LDQ A;  5FVG A;  3DAG A;  3NYM A;  5KYX B;  2QNL A;  2L6F A;  2EPM X;  3W8I A;  3CD1 A;  3B0V C;  1C02 A;  4ZLC A;  2G3D B;  4WJ0 A;  2WB7 A;  5BQL A;  3K33 A;  2YE1 A;  4R6B A;  1D0X A;  1M56 C;  4DXI A;  4IK3 A;  4DBQ A;  4HQC A;  1VYK A;  2PBE A;  3K1K A;  3FXH A;  2EMO A;  2J0W A;  3AG1 C;  3CZ6 A;  1XWJ A;  3ZG1 A;  3ASO C;  1LS4 A;  1PD0 A;  4MTF A;  4MVM A;  3U9J A;  3ABL C;  3CFA A;  3N2Z B;  3DQ4 A;  1KYS A;  4JW1 A;  1HW2 A;  4BPM A;  2HQZ A;  1EMM A;  4W6M A;  2UUI A;  4JRZ A;  2AVK A;  2ETS A;  3J06 A;  3NMK A;  2DDD A;  3S27 A;  4E0I A;  5DPJ A;  2J7P A;  4NTF A;  2XLD A;  1EML A;  3O6X A;  4CIP A;  2OKU A;  3LS1 A;  1KU2 A;  4U5D E;  1AVO B;  2X0C A;  3EZH A;  2L81 A;  1ZGO A;  4JC2 A;  2WSO A;  3DI5 A;  1WAS A;  2IE2 A;  4ULV A;  3CFH A;  4D4X A;  3DQE A;  3EGX B;  5FZT A;  4WAB A;  5F5F A;  4KGF A;  4KNW A;  1UIS A;  4JE9 A;  4PFP A;  3EVR A;  2VVJ A;  3CD9 A;  3LAY A;  1EMG A;  1XSS A;  4JGE A;  4W73 A;  2L6H A;  3DQO A;  2LSE A;  3KCT A;  5EXC I;  3ABM C;  4DKM A;  1J8M F;  4PK4 A;  2Z1O A;  5DQT A;  3EGD A;  2IB6 A;  3UGP A;  1D0Z A;  3T9O A;  2DUI A;  2NUP A;  1QYQ A;  2J46 A;  3UFZ A;  3SXZ A;  1G4U S;  2PX3 A;  2PXS A;  3VIC A;  2Y3B A;  4X0R A;  4Q4Z F;  2W45 A;  3RVZ A;  1CGM E;  2IXM A;  4OIN F;  1XMZ A;  2A0U A;  2VCB A;  2QLE A;  3N24 A;  3LSA A;  1PCX A;  2ZXR A;  4XEF A;  1ZGP A;  4K1O A;  3HJC A;  1ORY A;  2XL8 A;  3NDB B;  2HS5 A;  2L6G A;  1WN0 A;  2PF4 E;  5B3I A;  3DQ2 A;  3IR8 A;  3DWW A;  4PJJ A;  2DI3 A;  2A48 A;  4W6I A;  4W7R A;  3LVC A;  2NG1 A;  4XWJ A;  2EIN C;  4J30 B;  5BTT B;  1Z1P A;  1E2X A;  5T3W A;  2HJO A;  2ZD9 A;  1ZVZ A;  4DVZ A;  2FWQ A;  2Q00 A;  1JMW A;  2I15 A;  3EHM A;  2IOQ A;  2O24 A;  1Q0F A;  2ZMW A;  4W8P A;  3TMR A;  3RWT A;  1WAT A;  4RBN A;  3U5S A;  3NKD A;  3DQF A;  3M24 A;  3K1I C;  3AGT A;  2HZ8 A;  4A4A A;  3NYJ A;  3G4Z A;  2W9Y A;  4LLE A;  2XXA B;  5DY6 A;  3QTH A;  1EQ1 A;  1XZP A;  3ED8 A;  4EUL A;  3Q6M A;  2Q7R A;  4BJ6 A;  3FOO A;  3SYN A;  3SZR A;  2A56 B;  4NTB A;  3B0U X;  4XL5 A;  2H9W A;  1YHH A;  4HE8 D;  3PJB A;  2FL1 A;  5A6A A;  3C62 A;  4P9T A;  3I5Q A;  4IGG A;  3RYL A;  3ZUF A;  4XPY A;  2R7Q A;  3TMT A;  3EFO A;  3GJ1 A;  3DQ6 A;  3KYJ A;  4JTA B;  2ZO7 A;  1Q0G A;  2HGD A;  4JCZ A;  1M57 C;  1NU7 D;  1BDJ B;  1C4F A;  5T3I A;  5LK4 A;  1LVK A;  5L3Q A;  3MFN A;  1KYP A;  1RMP A;  4L13 A;  2EIJ C;  1NFO A;  4H3L A;  4OJ0 A;  3ST2 A;  2KJG A;  2VCA A;  3U0M A;  2XL6 A;  4YL1 A;  4YN0 B;  3G50 A;  5F5H A;  3RVY A;  4JUR I;  4PR9 A;  1A0B A;  3DQC A;  2YEV A;  3SS0 A;  3DQK A;  2DUE A;  4JIO A;  4JJG A;  3NYL A;  3ADF A;  1MQV A;  1A41 A;  1LI5 A;  3GM2 A;  2OU6 A;  3B0P A;  3H1R A;  3O78 A;  3SVD A;  4MVZ A; 
#chains in the Genus database with same CATH homology
 4IAQ A;  3DQ8 A;  3OGO A;  3WCK A;  3SG2 A;  3SRY A;  3I19 A;  4DXO A;  2OGR A;  3M15 A;  2H5P A;  4W6F A;  1RM9 A;  2Z6X A;  3EK7 A;  5JUA A;  3SSL A;  4ORN A;  4KW4 A;  4PFE A;  2HCG A;  1Q73 A;  2G6Y A;  2O2B A;  4W6A A;  1Z1Q A;  4OGS A;  4DXM A;  3M79 A;  1E84 A;  1MYW A;  3GEX A;  5BT0 A;  2Q6P A;  1W7U A;  1YHG A;  1Q4B A;  2HQK A;  5BTT A;  2QZ0 A;  4ZF5 A;  2G16 B;  4PPL A;  3NEZ A;  3ST0 A;  3DQI A;  4LQU A;  2RH7 A;  1YYX A;  3L1M A;  5JP7 A;  1GGX A;  2YE0 A;  4KF5 C;  2WIS A;  1A7V A;  2WIQ A;  2Q57 A;  1EMF A;  1EMC A;  4NWS A;  1OXF A;  5EXU A;  3P28 A;  2J8W A;  2AWL A;  1G7K A;  2ZO6 A;  3ST3 A;  4CDY A;  3DQ9 A;  4OQW A;  1OXE A;  5F9G A;  3TOM A;  1CV7 A;  3SG6 A;  3ZQV A;  5JSL A;  2V4E A;  4BDU A;  5DQB A;  4OY4 A;  3QVY A;  3M4B A;  4ER9 A;  1ZUX A;  3A8S A;  4IK4 A;  1CPR A;  4W6S A;  1F09 A;  2H8Q A;  2OTE A;  3DQU A;  2XLO A;  3EKH A;  4H48 A;  2VAE A;  3SG3 A;  3NMI A;  2GX0 A;  2XLE A;  3EK4 A;  4PPJ A;  4JKV A;  3SSK A;  2VZX A;  3E5V A;  4XVP A;  5FVI A;  2WUR A;  4W6D A;  3UG0 A;  4ZF3 A;  4LJD A;  3E5T A;  2O29 A;  4KF4 A;  2QLI A;  2AWM A;  3H1O A;  3U8P A;  4KGE A;  4W69 A;  1YFP A;  5HW9 A;  3DQD A;  2DD7 A;  4W7E A;  3RWA A;  3S05 A;  5H89 A;  5HZO A;  4HVF A;  3LF3 A;  2V4E C;  2XLW A;  2Y0G A;  4KEX A;  1QXT A;  1YJ2 A;  5H88 A;  1RMO A;  3KCS A;  4ANJ A;  1HCJ A;  1XA9 A;  4H3M A;  4XOW A;  4ZF4 A;  2A54 B;  3HNJ A;  4W77 A;  5JS5 A;  3SVB A;  2EMD A;  4CDA A;  5DU0 A;  2CCY A;  2WHU A;  4Q9W A;  3V3D A;  4W6U A;  4W6N A;  1BFP A;  3DQH A;  2G3O A;  4U2V A;  2A47 A;  5HZS A;  4W6H A;  2ARL A;  4J8A A;  3MGF A;  5DRG A;  1KP5 A;  1W7S A;  4EDS A;  1XAE A;  4RYW A;  5DTL A;  5FVF A;  1E86 A;  2C9I A;  4W6O A;  2YFP A;  3QVZ A;  4I2Y A;  2H6V A;  4W6K A;  2DUH A;  1XQM A;  4IK8 A;  4B30 A;  1JBZ A;  2QLG A;  3ST4 A;  3G9A A;  1APC A;  4N6H A;  2AWJ A;  3DQL A;  3HNI A;  3ZQY A;  3CB9 A;  2ICR A;  3LA1 A;  4H47 A;  3ZUL A;  3WLC A;  5LTQ A;  2YLI A;  3DPZ A;  3SG4 A;  1E83 A;  2XLH A;  2G5Z B;  3IQ5 A;  3BXB A;  3SVE A;  4KF5 A;  4W6J A;  3SVS A;  5HBD A;  4L6R A;  4IK1 A;  1RCP A;  4AS8 A;  2G6E A;  3M4C A;  2HPW A;  2QRF A;  4HQ8 A;  5FHV A;  1EMK A;  2H5Q A;  4U9D A;  4NC3 A;  4W74 A;  5FVG A;  4W7F A;  1BBH A;  3CD1 A;  3DQJ A;  1M6T A;  3EVU A;  1QPU A;  2B3Q A;  5DQM A;  4W6B A;  2G3D B;  3VK1 A;  3SSV A;  5BQL A;  3DE9 A;  1YHI A;  2YE1 A;  4R6B A;  4Z4K A;  4KA9 A;  3CGL A;  3TOL A;  2AHA A;  4DXI A;  4DXN A;  4IK3 A;  2YKZ A;  4HQC A;  2WHT A;  3K1K A;  4RTC A;  1GL4 A;  1HUY A;  2H5O A;  3DQ5 A;  3SVR A;  2EMO A;  3W1C A;  2AH8 A;  4GOB A;  4LJB A;  1Q4E A;  3CFA A;  3SVU A;  2XM0 A;  3SSP A;  5EJU A;  3DQ4 A;  2YL3 A;  1KYS A;  3DQ3 A;  4UTS A;  1KYR A;  3OSQ A;  4Q7U A;  2HQZ A;  4IK5 A;  5EB6 A;  1EMM A;  4R6D A;  4W6M A;  3SG5 A;  3WLD A;  3DPX A;  3GB3 A;  5EHU A;  5LTR A;  3NMK A;  3U0L A;  2DDD A;  4W72 A;  1H6R A;  3EVV A;  2OKW A;  5DPJ A;  4W6P A;  2XLD A;  4WGZ A;  1EML A;  4JFG A;  4WGY A;  3SVC A;  4CIP A;  2WHS A;  4D4N A;  4XOV A;  4J89 A;  4W7C A;  3HNL A;  1ZGO A;  5EB7 A;  3VRC A;  5H87 A;  4JC2 A;  2WSO A;  2IE2 A;  4EIY A;  4ULV A;  3CFH A;  4D4X A;  3SSH A;  4PPK A;  2A46 A;  3VHT B;  3DQE A;  4KGF A;  3LVA A;  4TZA A;  4U9E A;  1UIS A;  3LVD A;  5DTZ A;  4JE9 A;  5J2O A;  4W6L A;  3U8A A;  4ZFS A;  2YL7 A;  3EVR A;  2BTJ A;  5JT4 A;  2VVJ A;  3EKJ A;  4ZIO A;  3CD9 A;  5HGE A;  5AGF A;  1E85 A;  3SV5 A;  1NBB A;  1EMG A;  1XSS A;  2PXW A;  4JGE A;  1JC1 A;  4JF9 A;  2C9J A;  3BX9 A;  3C63 A;  3CFF A;  4W73 A;  2XLM A;  3DQO A;  1B9C A;  3KCT A;  2YLD A;  2WSN A;  4IK9 A;  5EXB A;  5EXC I;  4DKM A;  5DPH A;  2Z1O A;  1H4U A;  3NT9 A;  2IB6 A;  5KTG A;  3DQN A;  4Q9X A;  4IAR A;  2DUF A;  5DTX A;  3U0K A;  4CDV A;  2GW4 B;  4ZB1 A;  4HE4 A;  2DUI A;  2YLG A;  2A50 B;  1QYQ A;  2VVH A;  3UFZ A;  4DKN A;  2XM4 A;  2PXS A;  4GF6 B;  3VIC A;  1Q4C A;  4JEO A;  4LJC A;  2A53 B;  4Q7R A;  3PJ5 A;  4KAG A;  5DPI A;  2AWK A;  2Z6Z A;  3U0N A;  3SVN A;  3AI5 A;  4AR7 A;  1XMZ A;  4CX9 A;  2QLE A;  2Z6Y A;  2A52 B;  3LSA A;  2OTB A;  1MOV A;  2HRS A;  3OSR A;  5HZU A;  1JAF A;  2G6X A;  3U8C A;  1ZGP A;  2XL8 A;  1MOU A;  4ZIN A;  1RRX A;  1RMM A;  3NED A;  3IP2 A;  3DQ7 A;  4J88 A;  3ZUJ A;  5B3I A;  3DQ2 A;  3IR8 A;  3PJ7 A;  2P4M A;  3CBE A;  3EK8 A;  2YL1 A;  3DE8 A;  4GES B;  4P1Q A;  1QYO A;  2A48 A;  4Q7T A;  4B5Y A;  4W6I A;  4W7R A;  3IQ6 A;  2HGY A;  3DQA A;  3LVC A;  3DPW A;  3SST A;  4XGY A;  1YZW A;  5BTT B;  1Z1P A;  2HJO A;  2QU1 A;  1CGO A;  3ZTZ A;  2FWQ A;  5DRF A;  2O24 A;  2ZMW A;  2BC5 A;  2B3P A;  3W1D A;  4P76 A;  1F0B A;  4TZG A;  2DUG A;  3RWT A;  3TMR A;  5JLI A;  4H3N A;  1S6Z A;  3ZTF A;  2VAD A;  2GW3 A;  3DQF A;  3M24 A;  4DXQ A;  4W7D A;  4EN1 A;  3DQM A;  5DY6 A;  2V4E B;  2DD9 A;  4L12 A;  3FOP A;  3GL4 A;  2QLH A;  2H5R A;  4W7X A;  3ED8 A;  4EUL A;  4JEA A;  4JRB A;  5DTY A;  1CPQ A;  4W7A A;  1CGN A;  3FOO A;  3E5W A;  4DXP A;  3GJ2 A;  1GFL A;  4CJO A;  5JRA A;  2A56 B;  4KW9 A;  2EMN A;  4XL5 A;  4ZBL A;  4HQ9 A;  2H9W A;  1Q4D A;  1YHH A;  3M22 A;  3PJB A;  2FL1 A;  1YYJ A;  2QLA A;  3C62 A;  4W76 A;  1EME A;  3ZUF A;  1W7T A;  4KPI A;  3TMT A;  3BXC A;  1LM3 B;  2G2S B;  4OHS A;  3GJ1 A;  3NT3 A;  3DQ6 A;  3NF0 A;  3QW0 A;  2IB5 A;  2YDZ A;  2POX A;  5LTP A;  1EMA A;  1Q4A A;  4W6T A;  4EDO A;  2ZO7 A;  3SVO A;  2GX2 A;  3VHT A;  3SG7 A;  2HGD A;  3EVP A;  2HFC A;  4W6G A;  4N4W A;  4KW8 A;  2OJK A;  3NMJ A;  4JEB A;  1JC0 A;  4CJG A;  1C4F A;  5T3I A;  1ZGQ A;  3BXA A;  3ZTM A;  3DQ1 A;  5LK4 A;  1EMB A;  1YZC A;  4Z4M A;  1KYP A;  1RMP A;  2IOV A;  5JVE A;  4L13 A;  4H3L A;  4IZN A;  4OJ0 A;  5EBJ A;  4LW5 A;  3ST2 A;  3U0M A;  2XL6 A;  5AQB B;  2FZU A;  3PIB A;  4L1I A;  1GQA A;  2QT2 A;  3AI4 A;  4B30 B;  2QLG B;  4W6R A;  2J9B A;  1QYF A;  3HNK A;  2JAD A;  4LJD C;  3DQC A;  3P8U A;  1JBY A;  1OXD A;  1QQ3 A;  3SS0 A;  3DQK A;  4W6C A;  3LF4 B;  5DPG A;  1YZA A;  2DUE A;  3QW1 A;  3AKO A;  2ZMU A;  1QY3 A;  3ADF A;  2OKY A;  4LQT A;  4W75 A;  1MQV A;  3ZWI A;  4RYS A;  4EMQ A;  1EKY A;  2YL0 A;  3LS3 A;  1YJF A;  3O77 A;  5HZT A;  3H1R A;  3O78 A;  2DDC A;  3SVD A;  256B A;  4IB4 A;  2XLV A;  3SSY A;  1S05 A;  4N3D A;  2VVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...