3U8PA

Cytochrome b562 integral fusion with egfp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
337
structure length
336
Chain Sequence
b'KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATFGGSADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYRGGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b562 integral fusion with enhanced green fluoresc
publication title Structural basis for efficient chromophore communication and energy transfer in a constructed didomain protein scaffold.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, electron transport
total genus 111
structure length 336
sequence length 337
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3u8pA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3u8pA01
3QVYA 3U0NA 3SVNA 2H5PA 2Z6YA 2XLOA 256BA 3GL4A 3AI5A 2Q57A 1JC0A 2XL6A 3IQ5A 1F0BA 4DKMA 1JC1A 2OJKA 3BXAA 1QXTA 4ZF4A 5B3IA 1QYQA 2C9JA 1EMLA 4JEAA 1YYJA 2XLMA 4U9EA 2QZ0A 1GL4A 2Z6XA 4W7EA 3SSTA 1ZGQA 3NMJA 1GFLA 3U0KA 5DQBA 1CV7A 1JBYA 2WURA 1MOVA 2H5QA 3SG4A 5FVFA 3WCKA 2AWLA 1EMMA 2FZUA 4KW9A 3OGOA 1CPRA 3M4BA 3M79A 4KW8A 4ULVA 5EXBA 1Q4AA 5H87A 2YLIA 4JGEA 5DTLA 5JSLA 5DTYA 2G3OA 2G16B 2GW3A 4OGSA 2GW4B 4JEOA 4D4XA 3C63A 3EK8A 5EB7A 4N4WA 1XQMA 2HQKA 1Q4CA 1E85A 3VHTB 3BX9A 3PJBA 3LF4B 1YJ2A 3QVZA 3W1DA 2EMDA 5H88A 5LK4A 4IZNA 4XVPA 2ARLA 2PXSA 2ZMUA 3SSPA 2OKYA 1B9CA 3DE8A 4TZGA 3CGLA 3M24A 1S05A 4W6DA 3VHTA 3CFHA 3ADFA 2XLVA 4KGFA 3SSYA 4W7XA 1Q4BA 3ST3A 3CB9A 2J9BA 3ZQYA 1Q73A 3DQUA 1NBBA 2DDCA 3ZWIA 5JUAA 4LJBA 4EN1A 3CD9A 3GEXA 4Q9XA 5HZSA 3DQFA 5FHVA 1YZWA 4Q7RA 4W6BA 5DU0A 1QYFA 3H1OA 4ZIOA 3PJ5A 1Q4DA 3MGFA 4L1IA 3ST4A 5DY6A 4BDUA 3FOOA 4W7RA 2QU1A 2CCYA 2P4MA 1RMOA 4P1QA 5HBDA 1UISA 4JRBA 4W6JA 2A53B 2XLDA 5EBJA 4W6NA 3LSAA 2PXWA 3SSHA 4W75A 2QLIA 1KYPA 1ZGOA 1YZAA 4IAQA 3HNIA 3DQ3A 2HJOA 3EVUA 3VICA 4CDAA 3GJ1A 4H3LA 1HUYA 1YYXA 1BBHA 2Q6PA 2AWKA 2DD9A 1YHIA 2A54B 1M6TA 2A48A 4DXNA 1EMAA 3ZTZA 4L13A 4U9DA 3DQKA 2G2SB 2AWMA 3GJ2A 2WISA 4RYSA 4H47A 4W76A 1XA9A 3EVPA 1W7UA 4HE4A 2HPWA 2G5ZB 1EMCA 4LJDA 4EDSA 3VK1A 3SS0A 3SVCA 3LA1A 2V4EC 4ORNA 4WGZA 4HQCA 5BQLA 3SVUA 4HVFA 1H6RA 2QT2A 3KCSA 3U8PA 1Z1QA 4W77A 4HQ9A 2VVJA 3NT9A 4H3MA 4Z4MA 3E5WA 2FWQA 5JVEA 1QYOA 5HZUA 3NMIA 2B3QA 1RM9A 2FL1A 2YKZA 2A52B 3DQ2A 3DPZA 4GOBA 4PFEA 4ZFSA 2WSNA 4J8AA 1CGOA 3M22A 4GESB 4L6RA 2A50B 2WIQA 3WLDA 4JFGA 4CX9A 3ED8A 1CGNA 4R6BA 4ANJA 3TMTA 4DXMA 1CPQA 1ZGPA 3SSLA 3DQOA 4JEBA 4ZF3A 2YL0A 2YFPA 2QRFA 2A46A 2YLGA 3GB3A 3KCTA 4R6DA 4W6HA 2DD7A 2YL3A 3EVRA 1EKYA 4NC3A 1XSSA 2OKWA 2C9IA 2EMOA 2XLHA 2DUEA 1H4UA 3PIBA 5AGFA 2Z1OA 1EMKA 2POXA 2Y0GA 3DQNA 2DUIA 4KF5C 1E86A 2QLEA 4W6TA 1W7TA 5HZTA 5BTTB 4W6MA 5HW9A 1HCJA 1QQ3A 3ST2A 2VAEA 3DQMA 4AR7A 2OGRA 3AKOA 3ZTFA 4KPIA 4XGYA 5FVIA 3HNJA 3DQIA 4CJOA 4L12A 3U8AA 4D4NA 3WLCA 4ZF5A 3RWTA 2WHTA 1YFPA 2IB5A 4W6KA 1E84A 3ST0A 3LVCA 1Z1PA 1C4FA 3SVDA 1YJFA 3SSVA 1YZCA 4W6IA 4OY4A 2XM4A 2QLHA 3EKJA 3G9AA 4XOWA 3LF3A 2XLEA 4IK9A 2ZO6A 1ZUXA 2AH8A 4W6FA 3U0MA 1EMGA 4ZINA 3SVEA 2YE1A 4W6LA 2DUFA 2A47A 3DQ7A 4JC2A 2G3DB 4TZAA 1MYWA 5DPHA 3SRYA 4J88A 2V4EB 4GF6B 3DQ8A 1OXDA 2HFCA 3O78A 3CFAA 3SVRA 5T3IA 1GGXA 4Q7UA 2WSOA 3SV5A 3U0LA 5JT4A 3DQ1A 3P28A 2G6EA 3DQLA 2DDDA 4XL5A 4KEXA 3SVBA 4EDOA 1EMBA 3DQDA 4JE9A 4IB4A 2OTBA 3DQ6A 3SG3A 4PPLA 4PPKA 4PPJA 2B3PA 3DQ5A 4H48A 3DQJA 2A56B 4W7DA 4W6PA 3SG2A 3DQ9A 1Q4EA 4ZBLA 3ZUFA 2HGDA 3S05A 4HQ8A 4LQUA 5DPGA 3ZUJA 5EHUA 5DRGA 2ZO7A 3P8UA 2IOVA 3BXBA 4IARA 3SG6A 2BTJA 3HNLA 2YLDA 4KW4A 4DXIA 4U2VA 4W6AA 2VVHA 2VZXA 5DTZA 5BT0A 1KP5A 2OTEA 2QLGB 5DPIA 1F09A 4W7CA 5FVGA 4W69A 2DUHA 3E5VA 1YHGA 3C62A 3OSQA 4OJ0A 3SVOA 2IE2A 3A8SA 5KTGA 3SSKA 4KAGA 3AI4A 3L1MA 3NF0A 2YL1A 5HGEA 4EULA 3O77A 5LTRA 3CD1A 2QLGA 4LJDC 2XL8A 2J8WA 1MOUA 3NT3A 1E83A 1QPUA 3UG0A 3CFFA 2EMNA 1W7SA 2HRSA 4KA9A 5DQMA 3RWAA 2WHUA 4KF5A 5JS5A 4W6SA 4I2YA 3OSRA 3M15A 4Q9WA 3DQAA 4W7FA 4W6GA 4B30B 3M4CA 1RMPA 4LW5A 3SG7A 1QY3A 5EB6A 1A7VA 2BC5A 1OXEA 3CBEA 3DPWA 4N3DA 1EMEA 2H8QA 5LTPA 3DQ4A 4CIPA 4IK8A 4W6RA 3IQ6A 3TOMA 4DXQA 3DE9A 3ZTMA 3SVSA 2IB6A 3QW1A 1BFPA 4B30A 2GX2A 4DXPA 1RCPA 2G6YA 2ICRA 4J89A 2H5OA 3NEDA 2H5RA 4DKNA 4Z4KA 5F9GA 3W1CA 1APCA 2H9WA 1RMMA 2Z6ZA 4OQWA 3NMKA 1YHHA 3SG5A 2VADA 3HNKA 4UTSA 3IP2A 1S6ZA 2JADA 3K1KA 4RTCA 3EVVA 4CDYA 3BXCA 3DQEA 3TOLA 4IK3A 5BTTA 2H6VA 3UFZA 1XMZA 3NEZA 4XOVA 5H89A 4W7AA 2HQZA 2ZMWA 2HCGA 1XAEA 1G7KA 3H1RA 2QLAA 4RYWA 4Q7TA 2XM0A 3LVDA 5AQBB 5DRFA 1OXFA 4CDVA 3TMRA 4W73A 3QW0A 4W6UA 4W72A 5JLIA 3IR8A 4P76A 4B5YA 2YL7A 4H3NA 4LQTA 5EJUA 5EXCI 4W6OA 3EK7A 5JP7A 3V3DA 3E5TA 1JBZA 4AS8A 1RRXA 2YDZA 4JF9A 3DPXA 1EMFA 2YE0A 2AWJA 4OHSA 3DQHA 5DTXA 4ZB1A 3LVAA 4EMQA 2WHSA 4CJGA 4W6CA 2O24A 2V4EA 4W74A 2O2BA 2VVIA 2AHAA 1MQVA 5JRAA 3U8CA 5EXUA 2RH7A 2DUGA 3DQCA 3I19A 4NWSA 5J2OA 3PJ7A 5DPJA 4IK4A 1KYRA 2O29A 4KGEA 4JKVA 3ZQVA 2G6XA 4LJCA 1KYSA 4ER9A 1LM3B 2GX0A 4N6HA 3VRCA 1JAFA 2XLWA 4IK5A 4IK1A 5LTQA 3EK4A 4KF4A 5HZOA 4EIYA 4WGYA 3ZULA 3LS3A 1GQAA 4DXOA 3FOPA 2HGYA 3EKHA
chains in the Genus database with same CATH superfamily
3QVYA 4JRZA 2WZLA 3TK0A 3GL4A 4GEHA 1IZMA 5EHHA 4H4KC 1M2OA 3IQ5A 2YZSA 1F0BA 1OR3A 4DKMA 3N0TA 2DI3A 1M56C 5B3IA 1QYQA 2CNWA 1BR2A 3RKOF 3VM6A 2Z6XA 3FXHA 3SSTA 1ZGQA 3NMJA 3NYLA 3U0KA 3AG1C 1CV7A 2P7VA 3CSKA 2Y3GA 4KW9A 1SMYF 5BQHA 3OGOA 3M4BA 5EXBA 2NG1A 1Q4AA 5H87A 5DTLA 5DTYA 1WTYA 1ZW3A 3DAGA 3J06A 4MVOA 4O6NA 3C63A 5EB7A 2OKUA 1J8MF 1E2XA 1Q4CA 3VYWA 3PJBA 1ZYRF 5LK4A 2PXSA 2ZMUA 3TULA 3M24A 3HTKC 4W6DA 3G4ZA 2XLVA 1O3UA 4KGFA 2LK4A 3UGPA 2IXMA 2DDCA 3T6GB 2EINC 2F22A 3CD9A 3DQFA 1YZWA 1MNEA 3H1OA 4ZLDA 4C3DA 3C18A 3POVA 1VK5A 2CCYA 4A4AA 4AL0A 4P1QA 5HBDA 2CNWD 4AK9A 2XLDA 4W6NA 4BJ5C 2KYHA 2W9YA 1KYPA 4J30B 5L0JA 3GANA 3W4YA 1OXKA 3K66A 4CDAA 1HUYA 2M4EA 1D1AA 1BBHA 2R02A 1NG1A 2A0UA 5HSWA 2A54B 1M6TA 4DXNA 3ZTZA 1I5NA 2CW0F 3VF0A 2G2SB 4XEFA 4CBEA 1W7UA 4OD4A 5A6AA 4E0HA 2OJED 3SVCA 3RQEA 2YEVA 5B1AC 4ORNA 4WGZA 4HQCA 2CDQA 4HVFA 2QT2A 3FVYA 1HE1A 3UMHA 2R7SA 3NT9A 1U6HA 3ECSA 5HZUA 3LS1A 1L7CA 1T6IA 2H7BA 3CAXA 3LESA 4GESB 3E9VA 3WLDA 1G4US 4IJJA 3S9OA 4JFGA 4JTAB 3AG4C 4YJWA 2DYRC 2HSBA 3L8JA 4ANJA 2DYSC 2NPUA 4DXMA 2WVOA 4O6YA 1ZGPA 2QRFA 3PMRA 1U0BB 1D1CA 3UNGC 5CI8A 2LFDA 3PDMP 1W2WA 2DD7A 1AEPA 3A9CA 4NC3A 3LEVA 3X2QC 3NG1A 2C9IA 2EMOA 1YVIA 2Q9BA 2POXA 2DUIA 2VASA 1E86A 2D4UA 4JVSA 4LACB 1XZQA 2IXNA 1QQ3A 4YL1A 2VAEA 2Q4FA 2WVNA 4AR7A 4XGYA 1OR2A 5DVWA 1QSPA 4D4NA 3V7OA 3WLCA 4ZF5A 4JC7A 2IB5A 4W6KA 3Q6MA 3ZIBA 4EKWA 4W8KA 3SVDA 2LFFA 3W2WA 4OY4A 1OCCC 2NSFA 2J9UA 4Q4ZF 2ZO6A 3U0MA 1EMGA 4ZINA 4O7GA 2EIKC 3S29A 2DUFA 4TZAA 1WATA 2VB6A 3V5XA 3DQ8A 2LCHA 4J7TA 3SYNA 1OCRC 4NY3A 3T6JA 2WSOA 3SV5A 5JT4A 4PR9A 4IGGA 2L7AA 3P28A 2DDDA 1J8YF 2Y3BA 3DQ6A 1SZIA 3AG2C 3EZIA 4PPLA 2FAPB 1KU2A 3DQJA 2A56B 5KYWB 4I1MA 3AOUA 3FAJA 4W6PA 2W4BA 4MVRA 3LUTB 1Q4EA 1Z63A 2J9VA 4PJNA 1WN0A 5DRGA 3P8UA 2IOVA 3BXBA 4IARA 2QNLA 2BTJA 3FAPB 4LERA 2HJMA 1ZW2A 2W4MA 4MVZA 3WODF 2VVHA 2VZXA 5DTZA 3E5VA 3C62A 3EGXA 3NYMA 4BJ6A 1VMAA 5B3SC 5KTGA 1TFKB 4BEMJ 4C3BA 5LTRA 4OIOF 3IPMO 2XSEA 1MOUA 3NT3A 4JIOA 1QPUA 2XL4A 1T01A 3RWAA 4KF5A 3H65A 1RMVA 5COFA 3M15A 4W6GA 4B30B 3CBEA 5T3TA 4G7OF 4N3DA 1EMEA 3WG7C 2H8QA 4CIPA 4W6RA 3TOMA 3K1IA 4DXQA 4AL1A 2IB6A 1BFPA 4FX5A 1NU9C 4H54A 4ZLCA 2TMVP 2H5RA 1APCA 3TJ6A 2Y3HA 2Q9AA 3GWLA 3NRHA 2QUPA 4MVQA 3NMKA 2VADA 3HNKA 2B0JA 2XS1A 1S6ZA 5KYUB 3LLKA 1SYQA 4CDYA 1F1MA 2H6VA 3UFZA 4W7AA 3V5YA 1FAPB 4J7YA 2XM0A 3O6XA 5AQBB 2NUTA 3EHMA 2Q9CA 4QI0A 3QW0A 2P6VA 5JLIA 4P76A 4W6OA 3EK7A 3B0UX 1YAUO 1RRXA 4U5DE 2OOCA 2WZGA 1EMFA 2AWJA 2XXAA 2R7WA 4PFPA 4YT5A 3DQHA 5A69A 4ZB1A 4EMQA 3SXKA 4W6CA 4W74A 2HV7A 3DQCA 2KNHA 5L3QA 2VCAA 3RIPA 4IK4A 2O29A 3ZQVA 1KYSA 3WAQA 1OCOC 3VAYA 2GX0A 3IEEA 1GGQA 4N6HA 3RW0A 2LQGA 4KF4A 3ZULA 3LS3A 3U3FA 2HGYA 1MNDA 4GYTA 256BA 4JCZA 1DOWA 2LIGA 4U5GA 2LP4A 3R7CA 3ATPA 4JEAA 2G62A 3C8ZA 2QZ0A 3W8IA 1GL4A 3JRMO 3DJNB 4N06A 5DQBA 4JCHA 1JBYA 2E87A 4G78A 2CYDA 4CS9A 5FVFA 3WCKA 1EMMA 1T5OA 1YJGA 1CPRA 4IRUA 2YLIA 4MTGA 4AE4B 3DXJF 1L3PA 1TQGA 3JYYA 2AU5A 3K7DA 2GW3A 1C02A 2GW4B 4JEOA 4N4WA 4WJ0A 1V4AA 2A69F 3U2MA 1V55C 3DMDA 4YT8A 5A6JA 2AWCA 3BX9A 2L81A 3W1DA 4IZNA 3EJNA 3SSPA 2AP3A 2QY9A 1B9CA 3DE8A 3CGLA 3VHTA 3CFHA 3FHDA 1JOGA 2IYLD 4HFKB 2ZXWC 3MFNA 1T6QA 3ST3A 1I4ZA 1Q73A 3DQUA 3ABMC 1NBBA 3WHNA 2HZ8A 2OJQA 1TR2A 1FTSA 2I8BA 5FHVA 4Q7RA 4W6BA 1O87A 4JTDB 2R05A 1VB5A 3PJ5A 3MLGA 3K1IC 3ST4A 4E0IA 3FOOA 4W7RA 1RMOA 4NQFA 1UISA 2JD3A 4W6JA 2A53B 4FAPB 3SSHA 1PV3A 3EH1A 4G7HF 2PNOA 4Q5SF 5D92A 2HMZA 3GM3A 1ZGOA 1BDJB 4HE8D 4IAQA 2UUIA 5L0FA 2Y3DA 3VICA 4MTFA 5A6BA 3GJ1A 2Q6PA 2DD9A 4RDAA 4DRIB 3UMIA 2YVKA 3GJ2A 2WISA 3SXYA 1Z3IX 2EIJC 1XA9A 3EPVA 4HE4A 3F46A 2Q3TA 3CZ6A 5KYYA 3RFYA 4LJDA 1ORYA 3SS0A 3Q6NA 2GWWA 5BQLA 4PFOA 3U8PA 4G0HA 4K1OA 3H2VA 4Z4MA 3NMIA 2B3QA 2FL1A 3S84A 3DPZA 4R32A 3BRJA 1JR8A 5CI9A 4J8AA 1CGOA 3GM1A 1ZU4A 2W45A 2J0WA 4XEKA 3ED8A 1K04A 4ZF3A 3US6A 4KNVA 2A46A 1OKKD 3GB3A 3KCTA 4R6DA 4W6HA 4DBQA 2YL3A 3JZ0A 1XSSA 2J9WA 2DUEA 4WABA 4CS9C 3FMSA 3PIBA 1EMKA 4JW1A 4MNDA 3U3BA 2QLEA 2ZXPA 4MVUA 3I4UA 3ST2A 4KPIA 2R7UA 4YWQA 3U8AA 2HMQA 2NSGA 4NTFA 3RWTA 3F47A 1E84A 3HJCA 4JJFA 1RKCA 2C04A 4EBBA 3SSVA 1WOLA 4CS7A 2XM4A 2QLHA 1EA8A 3EKJA 2OCCC 3DM5A 3LF3A 1LS1A 4Z9HA 2XXAB 3SVEA 4P9TA 4K0DA 1QLEC 2J7PA 2R7TA 1OXDA 5K0IA 3CFAA 3SVRA 3KYJA 4MQ9F 4YT4A 5T3IA 4PACA 4Q7UA 1ZU5A 3DQLA 4O6MA 4HEAJ 4XL5A 1SR2A 4IB4A 2B3PA 1TFOB 3SG2A 2A0BA 2G3KA 2Y39A 4I44A 2HGDA 3ZUJA 5EHUA 2L9JA 1D0XA 1WGWA 4KNWA 3HNLA 3SZRA 4KW4A 4U2VA 4W6AA 3LEOA 4ULWA 4DRJB 3QZCA 3C8GB 1Z23A 2Y69C 3V5ZA 5L0GA 3EFOA 1F09A 4W7CA 5FVGA 4W69A 3OSQA 4OJ0A 2IE2A 5BUOA 5CIVA 4EULA 4OIQF 2I15A 2OU6A 2QLGA 4LJDC 1C03A 4P6IC 3E70C 4A2NB 5DQMA 2HRSA 3S90A 2KQ9A 3KL4A 4XWJA 4C7OA 4I2YA 1HY5A 1YA7O 1FR0A 3OSRA 1RKEB 3M4CA 1A7VA 2BE5F 3DPWA 4YL0A 2M64A 5KYXA 1T9KA 3DZAA 2KJGA 3JT1A 4XLPF 4KC9A 2B0HA 3QW1A 3K6BA 2ICRA 2H5OA 3NEDA 3G4XA 2HUJA 2P1AA 1ZHWA 2X51A 4PJLA 3O39A 4UTSA 2JADA 4RTCA 3U5SA 3EVVA 3BXCA 5BTTA 1LI7A 1XMZA 3NEZA 4XOVA 1M2VB 2ZMWA 1OW7A 3CQZA 5L0DA 2QLAA 4RYWA 3TQOA 2YL7A 3AGUA 4H3NA 4LQTA 4I1OB 3E5TA 2EPMX 4JF9A 4JTCB 3DPXA 2YE0A 1YLMA 3AQCA 4CJGA 4O79A 2V4EA 2HJ3A 3H2UA 5BQGA 2R7VA 1MQVA 2ZD9A 2ETSA 3PJ7A 5DPJA 4JKVA 2G6XA 4MVMA 4ER9A 3N24A 3VRCA 1JAFA 1FMVA 5LTQA 3EK4A 5HZOA 1B68A 3KMIA 4DXOA 5F5FA 5L0CA 3U0NA 1Q0KA 3B9QA 2H5PA 3EG9A 2XLOA 5DS4A 4Z9IA 1NFNA 1JC0A 3FDQA 2XL6A 1H9TA 2OJKA 3BXAA 4ZF4A 2C9JA 1OCZC 1EMLA 1YYJA 2XLMA 2PX3A 3W8HA 1OW6A 3PHF2 2A6HF 4RD9A 1GFLA 4J32B 4YT2A 1TWCA 2WURA 1MOVA 2AWLA 2FZUA 4JJGA 1TWHA 1LIHA 1ZHZA 4JGEA 5JSLA 2G3OA 2HV6A 4MW8A 1VTMP 4CSAA 3U0CA 4OGSA 2HS5A 2XRHA 3EK8A 1E85A 1G4WR 3JSZA 5E2QA 4AX2A 3A11A 2H7OA 1ZVZA 3LF4B 3C7JA 4OINF 1JRAA 3KPHA 2EMDA 5H88A 4XVPA 2EPNA 2ARLA 1D1BA 1OQCA 3U9MA 5BQIA 4OIRF 4NTBA 3ZQYA 2V3CC 4LDQA 5E33A 3I5QA 3ZWIA 5JUAA 4LJBA 4U5EE 5D91A 2Z15A 2O9XA 5EGYA 1QYFA 3SNHA 4ZIOA 3MGFA 4BDUA 3HLZA 4PJMA 5DS6A 4E17A 4DXWA 2MYSA 5EBJA 4W75A 2QLIA 2OEVA 2J46A 1S7ZA 1QVXA 4MVSA 1YZAA 4EUKB 3HNIA 2PX0A 1YYXA 2AWKA 2A48A 1M57C 4L13A 4U9DA 3DQKA 3MX3A 3GEEA 4H47A 4W76A 5DQTA 2YHSA 4I3MA 2A68F 3TD7A 1KNYA 1EMCA 3S28A 1ORSC 1LE4A 1R5ID 2XS8A 3SXMA 3VK1A 2H8AA 4YN0B 2V4EC 4IAOA 1H6RA 4BJ1A 1Z1QA 1WWPA 5TJ5E 4HQ9A 3OEOA 2LD6A 3ZDLA 4H3MA 5JVEA 1QYOA 3RQGA 3X1OA 2A52B 3DQ2A 5E3AA 4GOBA 4PFEA 4JZAA 1Z6AA 4L6RA 1TWGA 1QZXA 4CX9A 2FGYA 1O5HA 1Z7Qc 3T9OA 3K1HA 4ONSA 4JEBA 4BJ6C 5KYXB 2YLGA 1JMWA 2AWYA 4U5FE 3EVRA 2OKWA 5L0HA 2XLHA 4BPMA 2A6EF 4BJTA 1D0ZA 4U5HA 3ASOC 3JCUQ 2Z1OA 2Y0GA 3M1CB 4KF5C 4W6TA 5HZTA 1D0YA 5BTTB 4W6MA 3L8IA 1HCJA 3I5PA 2R7OA 3SEOA 2OGRA 4EHPA 4CSAC 5FVIA 3HNJA 3DQIA 4HFFB 4MS2A 4PK4A 4CJOA 4DOZA 4L12A 5FCLA 2WHTA 1YFPA 3ST0A 2OG2A 2QE9A 3LVCA 3LAYA 1Z1PA 3UMKA 5AC4A 1YJFA 3KYIA 1GS9A 2WL8A 1YZCA 2ZXRA 2GAQA 4W6IA 3LLIA 3RYLA 3G9AA 4XOWA 1H6GA 3O10A 1N1CA 4KI2A 1ZHYA 1BZ4A 4LDKA 2YE1A 4W6LA 4JC2A 1MYWA 2AVKA 5DPHA 2Q00A 3SRYA 4J88A 2IBFA 2V4EB 1KTMA 4GF6B 1JPJA 2IM8A 2DB4A 1LS4A 3ABKC 3DQ1A 4MW3A 3SVBA 4KEXA 4EDOA 2KSFA 4JE9A 2OTBA 2YRFA 2R7XA 3DD7A 3DQ5A 2EPLX 1ZHXA 4W7DA 4C3EA 2CGEA 2YQYA 4ZBLA 2H7VC 3RVZA 3S05A 5DPGA 4Z9JA 2ZO7A 3EGXB 3SG6A 2YLDA 4DVZA 4YK5A 4DXIA 2JX0A 1AVOB 1K40A 1PCXA 3JRTA 1FMWA 1KP5A 3Q7LA 5DPIA 3K33A 1YHGA 3T4RA 1PD0A 3SVOA 3A8SA 4KBLA 4YL3A 3NF0A 2HSQA 3O77A 3CD1A 3RF3A 2XL8A 2J8WA 3AJMA 4XEVA 1CGME 3CFFA 4XPXA 2WHUA 1C17M 1HMOA 2R25A 4W7FA 3DQAA 2PP4A 3U2LA 2L6FA 1K05A 1LI5A 4OIPF 5EB6A 1OXEA 1I4YA 5A6BD 5LTPA 3DQ4A 4E7ZA 3IQ6A 3ZTMA 3SVSA 4B30A 2GX2A 1Q0FA 1TWAA 4DKNA 1RMMA 4DJ9A 1YHHA 2NUTB 3IP2A 3HKKA 1BR4A 3K1KA 4IK3A 3DQEA 3B29A 4U5BE 2L6GA 3QTHA 1VOMA 2HQZA 3KH2A 1XAEA 1LKXA 3H1RA 3LVDA 3EQLF 5DRFA 5KYUA 1OXFA 4CDVA 4FWVA 3CEXA 2R03A 4GQHA 3TMRA 1UFBA 4W73A 4W72A 1LPEA 1A7DA 1IW7F 5JP7A 1JBZA 4E7SA 1PD1A 3JYHA 3AGTA 1JPNA 1LVKA 3LVAA 3LS0A 5FZTA 1GM5A 3U8CA 2DUGA 2PF4E 5J2OA 4KGEA 3IHUA 3NKEA 1LM3B 4IK1A 1SF8A 2EILC 3SP1A 4MTOA 5EK0A 4EIYA 3L0IA 4WGYA 1YARO 3FOPA 3EKHA 3NDBB 1XZPA 4BEJA 1VYIA 3SVNA 2Z6YA 1A41A 3AI5A 2Q57A 3UR3C 3O55A 2ICWG 1JC1A 1QXTA 1A7EA 4UDVA 5F28E 4U9EA 2OEXA 1Y4CA 1BR1A 4W7EA 1Q0GA 2DGJA 4OD5A 3TJ5A 2H5QA 3SG4A 3R2PA 1A0BA 3M79A 4LLEA 4KW8A 4ULVA 1YA9A 2PFDA 2Q7RA 5GPGB 2G16B 2J7PD 4D4XA 2J45A 2NUPA 1XQMA 2HQKA 4W8PA 3U9JA 4AE4A 2PBEA 3VHTB 4DVYP 1YJ2A 1RXQA 3QVZA 1TKNA 1T6UA 3GEIA 2P61A 2OKYA 4TZGA 1FFHA 2J0XA 1S05A 3JTLO 4XTKA 3ADFA 1UG7A 3N2ZB 4FESA 3DI5A 3SSYA 1VLTA 4W7XA 1Q4BA 4CIHA 3CB9A 2J9BA 3EHNA 1Q0DA 1MMNA 1WASA 4EN1A 3GEXA 4Q9XA 5HZSA 1RJ9A 5DU0A 3AQBA 5L3VA 1Q4DA 4L1IA 5DY6A 3IQCA 3S0XA 2QU1A 2P4MA 3MYFA 4JRBA 1YDIA 1Q0MA 3LSAA 1LE2A 2PXWA 3EGDA 3OWTA 3NKDA 3NYJA 3LNRA 3DQ3A 2GFHA 2HJOA 2V26A 3EVUA 4X0RA 4H3LA 1MMDA 2BL2A 2EIMC 5COMA 5IY5C 5KYYB 1YHIA 4NTAA 1EMAA 4M63A 2AWMA 1QKRA 2OQMA 4RYSA 2KGOA 2KW3C 3EVPA 2HPWA 1EQ1A 3RQFA 2G5ZB 2VCCA 2VH3A 4EDSA 1ORJA 2R7RA 3LA1A 3BEHA 3SVUA 1H7IA 5E3CA 3KCSA 1OW8A 4W77A 1ST6A 2VVJA 1Z5ZA 3E5WA 2FWQA 1RM9A 2YKZA 3GEHA 2HKVA 2FFHA 4ZFSA 2WSNA 3M22A 2G3VA 3B0VC 2A50B 1V54C 2WIQA 2RSEB 1HE9A 1CGNA 4R6BA 2EPKX 2WB7A 3ASNC 3UGOA 3TMTA 3PCVA 2R9RB 4XPWA 1CPQA 4QI2A 3SSLA 4DRHB 3DQOA 2YL0A 2YFPA 4LLCA 2QTVA 1HMDA 3GM2A 1R4TA 4Q7CA 5B1BC 1EKYA 1ZZPA 4CS8A 1H4UA 5AGFA 3DQNA 2L6HA 1FNTc 1W7TA 3EZHA 4E18A 5HW9A 2GDCA 3DQMA 3AKOA 3ZTFA 1G5ZA 4NCQA 4RBNA 2GA0A 2WZFA 3ZC4A 4LDRA 1C4FA 2XLEA 4IK9A 3MYIA 1ZUXA 5HV9A 2AH8A 4W6FA 1HW2A 1Y6DA 3ABLC 2A47A 3DQ7A 3RVYA 3T6BA 3GODA 2G3DB 2D5RB 2HFCA 3O78A 2MHRA 3ZG1A 3G50A 3IQTA 4G7ZF 1GGXA 3KKBA 3U0LA 1OXBA 3U8VA 5COGA 4EBKA 2G6EA 2ZXOA 5DS5A 1AUEA 1EMBA 1U89A 3DQDA 1FFTC 3SG3A 3DWWA 4PPKA 4PPJA 3Q7GA 4H48A 3GORA 3QMKA 1NFOA 3DQ9A 3ZUFA 3EFOB 4HQ8A 4LQUA 1DOVA 2EPOA 5DLJA 1MMGA 3DKAA 4B6IA 5BT0A 2JPUA 2OTEA 2QLGB 2DUHA 2HFIA 2RD9A 5KYNA 3L34A 1ZHTA 1XWJA 3SSKA 4KAGA 1VLSA 3AI4A 3L1MA 5HGEA 2YL1A 2VC9A 3DJUB 3W2VA 2X0CA 4C7OB 3C8GA 1VYKA 3ITFA 2IXPA 4P9FA 1H9GA 1E83A 3UG0A 2EMNA 3JSEO 5L0IA 1W7SA 4KA9A 4XQ1A 5JS5A 4W6SA 3EH2A 3MBGA 2NUPB 2C03A 4Q9WA 4EWCA 1RMPA 4LW5A 3SG7A 1QY3A 4U5CE 2BC5A 3ZSUA 3ZVRA 3AG3C 2UUHA 4PJJA 3LNMB 4QDLA 4IK8A 3DM9B 3DE9A 3LJBA 1NU7D 1RKEA 4DXPA 5T1DB 2ASRA 1RCPA 2P0NA 2G6YA 4J89A 1HW1A 2R7QA 4Z4KA 5F9GA 3RH3A 4F4BA 3W1CA 2H9WA 4BJ5A 2IOQA 1EI7A 2Z6ZA 4OQWA 3SG5A 3GWNA 1NZEA 2KK1A 2VCBA 1RJ9B 2ZPAA 3SXZA 3TOLA 1NSGB 5H89A 1NLXA 4EBJA 2HCGA 1G7KA 2YWAA 4Q7TA 1MMAA 4CS8C 3DAFA 4W6UA 2KC3A 3EGDB 3IR8A 1V74B 4B5YA 1M2VA 5DQZA 5EJUA 5EXCI 3V3DA 3OA1A 3S27A 4AS8A 4N6CA 4DBRA 2YDZA 4JURI 5F5HA 5AC5A 2LSEA 5A6KA 1OKKA 3B0PA 4OHSA 5DTXA 4XPYA 2WHSA 2O24A 3B71A 2O2BA 3C8GD 2VVIA 2AHAA 2MWQA 4XLNF 5JRAA 5EXUA 2RH7A 5T3WA 3I19A 4NWSA 4K7BA 1KYRA 3EG9B 4LJCA 2IXOA 4BG0A 2XLWA 4IK5A 2A1DD 4IWBA 1G8XA 1GQAA 2WVQA 5KYWA
chains in the Genus database with same CATH topology
3QVYA 3U0NA 3SVNA 2H5PA 2Z6YA 2XLOA 256BA 3GL4A 3AI5A 2Q57A 1JC0A 2XL6A 3IQ5A 1F0BA 4DKMA 1JC1A 2OJKA 3BXAA 1QXTA 4ZF4A 5B3IA 1QYQA 2C9JA 1EMLA 4JEAA 1YYJA 2XLMA 4U9EA 2QZ0A 1GL4A 2Z6XA 4W7EA 3SSTA 1ZGQA 3NMJA 1GFLA 3U0KA 5DQBA 1CV7A 1JBYA 2WURA 1MOVA 2H5QA 3SG4A 5FVFA 3WCKA 2AWLA 1EMMA 2FZUA 4KW9A 3OGOA 1CPRA 3M4BA 3M79A 4KW8A 4ULVA 5EXBA 1Q4AA 5H87A 2YLIA 4JGEA 5DTLA 5JSLA 5DTYA 2G3OA 2G16B 2GW3A 4OGSA 2GW4B 4JEOA 4D4XA 3C63A 3EK8A 5EB7A 4N4WA 1XQMA 2HQKA 1Q4CA 1E85A 3VHTB 3BX9A 3PJBA 3LF4B 1YJ2A 3QVZA 3W1DA 2EMDA 5H88A 5LK4A 4IZNA 4XVPA 2ARLA 2PXSA 2ZMUA 3SSPA 2OKYA 1B9CA 3DE8A 4TZGA 3CGLA 3M24A 1S05A 4W6DA 3VHTA 3CFHA 3ADFA 2XLVA 4KGFA 3SSYA 4W7XA 1Q4BA 3ST3A 3CB9A 2J9BA 3ZQYA 1Q73A 3DQUA 1NBBA 2DDCA 3ZWIA 5JUAA 4LJBA 4EN1A 3CD9A 3GEXA 4Q9XA 5HZSA 3DQFA 5FHVA 1YZWA 4Q7RA 4W6BA 5DU0A 1QYFA 3H1OA 4ZIOA 3PJ5A 1Q4DA 3MGFA 4L1IA 3ST4A 5DY6A 4BDUA 3FOOA 4W7RA 2QU1A 2CCYA 2P4MA 1RMOA 4P1QA 5HBDA 1UISA 4JRBA 4W6JA 2A53B 2XLDA 5EBJA 4W6NA 3LSAA 2PXWA 3SSHA 4W75A 2QLIA 1KYPA 1ZGOA 1YZAA 4IAQA 3HNIA 3DQ3A 2HJOA 3EVUA 3VICA 4CDAA 3GJ1A 4H3LA 1HUYA 1YYXA 1BBHA 2Q6PA 2AWKA 2DD9A 1YHIA 2A54B 1M6TA 2A48A 4DXNA 1EMAA 3ZTZA 4L13A 4U9DA 3DQKA 2G2SB 2AWMA 3GJ2A 2WISA 4RYSA 4H47A 4W76A 1XA9A 3EVPA 1W7UA 4HE4A 2HPWA 2G5ZB 1EMCA 4LJDA 4EDSA 3VK1A 3SS0A 3SVCA 3LA1A 2V4EC 4ORNA 4WGZA 4HQCA 5BQLA 3SVUA 4HVFA 1H6RA 2QT2A 3KCSA 3U8PA 1Z1QA 4W77A 4HQ9A 2VVJA 3NT9A 4H3MA 4Z4MA 3E5WA 2FWQA 5JVEA 1QYOA 5HZUA 3NMIA 2B3QA 1RM9A 2FL1A 2YKZA 2A52B 3DQ2A 3DPZA 4GOBA 4PFEA 4ZFSA 2WSNA 4J8AA 1CGOA 3M22A 4GESB 4L6RA 2A50B 2WIQA 3WLDA 4JFGA 4CX9A 3ED8A 1CGNA 4R6BA 4ANJA 3TMTA 4DXMA 1CPQA 1ZGPA 3SSLA 3DQOA 4JEBA 4ZF3A 2YL0A 2YFPA 2QRFA 2A46A 2YLGA 3GB3A 3KCTA 4R6DA 4W6HA 2DD7A 2YL3A 3EVRA 1EKYA 4NC3A 1XSSA 2OKWA 2C9IA 2EMOA 2XLHA 2DUEA 1H4UA 3PIBA 5AGFA 2Z1OA 1EMKA 2POXA 2Y0GA 3DQNA 2DUIA 4KF5C 1E86A 2QLEA 4W6TA 1W7TA 5HZTA 5BTTB 4W6MA 5HW9A 1HCJA 1QQ3A 3ST2A 2VAEA 3DQMA 4AR7A 2OGRA 3AKOA 3ZTFA 4KPIA 4XGYA 5FVIA 3HNJA 3DQIA 4CJOA 4L12A 3U8AA 4D4NA 3WLCA 4ZF5A 3RWTA 2WHTA 1YFPA 2IB5A 4W6KA 1E84A 3ST0A 3LVCA 1Z1PA 1C4FA 3SVDA 1YJFA 3SSVA 1YZCA 4W6IA 4OY4A 2XM4A 2QLHA 3EKJA 3G9AA 4XOWA 3LF3A 2XLEA 4IK9A 2ZO6A 1ZUXA 2AH8A 4W6FA 3U0MA 1EMGA 4ZINA 3SVEA 2YE1A 4W6LA 2DUFA 2A47A 3DQ7A 4JC2A 2G3DB 4TZAA 1MYWA 5DPHA 3SRYA 4J88A 2V4EB 4GF6B 3DQ8A 1OXDA 2HFCA 3O78A 3CFAA 3SVRA 5T3IA 1GGXA 4Q7UA 2WSOA 3SV5A 3U0LA 5JT4A 3DQ1A 3P28A 2G6EA 3DQLA 2DDDA 4XL5A 4KEXA 3SVBA 4EDOA 1EMBA 3DQDA 4JE9A 4IB4A 2OTBA 3DQ6A 3SG3A 4PPLA 4PPKA 4PPJA 2B3PA 3DQ5A 4H48A 3DQJA 2A56B 4W7DA 4W6PA 3SG2A 3DQ9A 1Q4EA 4ZBLA 3ZUFA 2HGDA 3S05A 4HQ8A 4LQUA 5DPGA 3ZUJA 5EHUA 5DRGA 2ZO7A 3P8UA 2IOVA 3BXBA 4IARA 3SG6A 2BTJA 3HNLA 2YLDA 4KW4A 4DXIA 4U2VA 4W6AA 2VVHA 2VZXA 5DTZA 5BT0A 1KP5A 2OTEA 2QLGB 5DPIA 1F09A 4W7CA 5FVGA 4W69A 2DUHA 3E5VA 1YHGA 3C62A 3OSQA 4OJ0A 3SVOA 2IE2A 3A8SA 5KTGA 3SSKA 4KAGA 3AI4A 3L1MA 3NF0A 2YL1A 5HGEA 4EULA 3O77A 5LTRA 3CD1A 2QLGA 4LJDC 2XL8A 2J8WA 1MOUA 3NT3A 1E83A 1QPUA 3UG0A 3CFFA 2EMNA 1W7SA 2HRSA 4KA9A 5DQMA 3RWAA 2WHUA 4KF5A 5JS5A 4W6SA 4I2YA 3OSRA 3M15A 4Q9WA 3DQAA 4W7FA 4W6GA 4B30B 3M4CA 1RMPA 4LW5A 3SG7A 1QY3A 5EB6A 1A7VA 2BC5A 1OXEA 3CBEA 3DPWA 4N3DA 1EMEA 2H8QA 5LTPA 3DQ4A 4CIPA 4IK8A 4W6RA 3IQ6A 3TOMA 4DXQA 3DE9A 3ZTMA 3SVSA 2IB6A 3QW1A 1BFPA 4B30A 2GX2A 4DXPA 1RCPA 2G6YA 2ICRA 4J89A 2H5OA 3NEDA 2H5RA 4DKNA 4Z4KA 5F9GA 3W1CA 1APCA 2H9WA 1RMMA 2Z6ZA 4OQWA 3NMKA 1YHHA 3SG5A 2VADA 3HNKA 4UTSA 3IP2A 1S6ZA 2JADA 3K1KA 4RTCA 3EVVA 4CDYA 3BXCA 3DQEA 3TOLA 4IK3A 5BTTA 2H6VA 3UFZA 1XMZA 3NEZA 4XOVA 5H89A 4W7AA 2HQZA 2ZMWA 2HCGA 1XAEA 1G7KA 3H1RA 2QLAA 4RYWA 4Q7TA 2XM0A 3LVDA 5AQBB 5DRFA 1OXFA 4CDVA 3TMRA 4W73A 3QW0A 4W6UA 4W72A 5JLIA 3IR8A 4P76A 4B5YA 2YL7A 4H3NA 4LQTA 5EJUA 5EXCI 4W6OA 3EK7A 5JP7A 3V3DA 3E5TA 1JBZA 4AS8A 1RRXA 2YDZA 4JF9A 3DPXA 1EMFA 2YE0A 2AWJA 4OHSA 3DQHA 5DTXA 4ZB1A 3LVAA 4EMQA 2WHSA 4CJGA 4W6CA 2O24A 2V4EA 4W74A 2O2BA 2VVIA 2AHAA 1MQVA 5JRAA 3U8CA 5EXUA 2RH7A 2DUGA 3DQCA 3I19A 4NWSA 5J2OA 3PJ7A 5DPJA 4IK4A 1KYRA 2O29A 4KGEA 4JKVA 3ZQVA 2G6XA 4LJCA 1KYSA 4ER9A 1LM3B 2GX0A 4N6HA 3VRCA 1JAFA 2XLWA 4IK5A 4IK1A 5LTQA 3EK4A 4KF4A 5HZOA 4EIYA 4WGYA 3ZULA 3LS3A 1GQAA 4DXOA 3FOPA 2HGYA 3EKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVY A;  3U0N A;  3SVN A;  2H5P A;  2Z6Y A;  2XLO A;  256B A;  3GL4 A;  3AI5 A;  2Q57 A;  1JC0 A;  2XL6 A;  3IQ5 A;  1F0B A;  4DKM A;  1JC1 A;  2OJK A;  3BXA A;  1QXT A;  4ZF4 A;  5B3I A;  1QYQ A;  2C9J A;  1EML A;  4JEA A;  1YYJ A;  2XLM A;  4U9E A;  2QZ0 A;  1GL4 A;  2Z6X A;  4W7E A;  3SST A;  1ZGQ A;  3NMJ A;  1GFL A;  3U0K A;  5DQB A;  1CV7 A;  1JBY A;  2WUR A;  1MOV A;  2H5Q A;  3SG4 A;  5FVF A;  3WCK A;  2AWL A;  1EMM A;  2FZU A;  4KW9 A;  3OGO A;  1CPR A;  3M4B A;  3M79 A;  4KW8 A;  4ULV A;  5EXB A;  1Q4A A;  5H87 A;  2YLI A;  4JGE A;  5DTL A;  5JSL A;  5DTY A;  2G3O A;  2G16 B;  2GW3 A;  4OGS A;  2GW4 B;  4JEO A;  4D4X A;  3C63 A;  3EK8 A;  5EB7 A;  4N4W A;  1XQM A;  2HQK A;  1Q4C A;  1E85 A;  3VHT B;  3BX9 A;  3PJB A;  3LF4 B;  1YJ2 A;  3QVZ A;  3W1D A;  2EMD A;  5H88 A;  5LK4 A;  4IZN A;  4XVP A;  2ARL A;  2PXS A;  2ZMU A;  3SSP A;  2OKY A;  1B9C A;  3DE8 A;  4TZG A;  3CGL A;  3M24 A;  1S05 A;  4W6D A;  3VHT A;  3CFH A;  3ADF A;  2XLV A;  4KGF A;  3SSY A;  4W7X A;  1Q4B A;  3ST3 A;  3CB9 A;  2J9B A;  3ZQY A;  1Q73 A;  3DQU A;  1NBB A;  2DDC A;  3ZWI A;  5JUA A;  4LJB A;  4EN1 A;  3CD9 A;  3GEX A;  4Q9X A;  5HZS A;  3DQF A;  5FHV A;  1YZW A;  4Q7R A;  4W6B A;  5DU0 A;  1QYF A;  3H1O A;  4ZIO A;  3PJ5 A;  1Q4D A;  3MGF A;  4L1I A;  3ST4 A;  5DY6 A;  4BDU A;  3FOO A;  4W7R A;  2QU1 A;  2CCY A;  2P4M A;  1RMO A;  4P1Q A;  5HBD A;  1UIS A;  4JRB A;  4W6J A;  2A53 B;  2XLD A;  5EBJ A;  4W6N A;  3LSA A;  2PXW A;  3SSH A;  4W75 A;  2QLI A;  1KYP A;  1ZGO A;  1YZA A;  4IAQ A;  3HNI A;  3DQ3 A;  2HJO A;  3EVU A;  3VIC A;  4CDA A;  3GJ1 A;  4H3L A;  1HUY A;  1YYX A;  1BBH A;  2Q6P A;  2AWK A;  2DD9 A;  1YHI A;  2A54 B;  1M6T A;  2A48 A;  4DXN A;  1EMA A;  3ZTZ A;  4L13 A;  4U9D A;  3DQK A;  2G2S B;  2AWM A;  3GJ2 A;  2WIS A;  4RYS A;  4H47 A;  4W76 A;  1XA9 A;  3EVP A;  1W7U A;  4HE4 A;  2HPW A;  2G5Z B;  1EMC A;  4LJD A;  4EDS A;  3VK1 A;  3SS0 A;  3SVC A;  3LA1 A;  2V4E C;  4ORN A;  4WGZ A;  4HQC A;  5BQL A;  3SVU A;  4HVF A;  1H6R A;  2QT2 A;  3KCS A;  3U8P A;  1Z1Q A;  4W77 A;  4HQ9 A;  2VVJ A;  3NT9 A;  4H3M A;  4Z4M A;  3E5W A;  2FWQ A;  5JVE A;  1QYO A;  5HZU A;  3NMI A;  2B3Q A;  1RM9 A;  2FL1 A;  2YKZ A;  2A52 B;  3DQ2 A;  3DPZ A;  4GOB A;  4PFE A;  4ZFS A;  2WSN A;  4J8A A;  1CGO A;  3M22 A;  4GES B;  4L6R A;  2A50 B;  2WIQ A;  3WLD A;  4JFG A;  4CX9 A;  3ED8 A;  1CGN A;  4R6B A;  4ANJ A;  3TMT A;  4DXM A;  1CPQ A;  1ZGP A;  3SSL A;  3DQO A;  4JEB A;  4ZF3 A;  2YL0 A;  2YFP A;  2QRF A;  2A46 A;  2YLG A;  3GB3 A;  3KCT A;  4R6D A;  4W6H A;  2DD7 A;  2YL3 A;  3EVR A;  1EKY A;  4NC3 A;  1XSS A;  2OKW A;  2C9I A;  2EMO A;  2XLH A;  2DUE A;  1H4U A;  3PIB A;  5AGF A;  2Z1O A;  1EMK A;  2POX A;  2Y0G A;  3DQN A;  2DUI A;  4KF5 C;  1E86 A;  2QLE A;  4W6T A;  1W7T A;  5HZT A;  5BTT B;  4W6M A;  5HW9 A;  1HCJ A;  1QQ3 A;  3ST2 A;  2VAE A;  3DQM A;  4AR7 A;  2OGR A;  3AKO A;  3ZTF A;  4KPI A;  4XGY A;  5FVI A;  3HNJ A;  3DQI A;  4CJO A;  4L12 A;  3U8A A;  4D4N A;  3WLC A;  4ZF5 A;  3RWT A;  2WHT A;  1YFP A;  2IB5 A;  4W6K A;  1E84 A;  3ST0 A;  3LVC A;  1Z1P A;  1C4F A;  3SVD A;  1YJF A;  3SSV A;  1YZC A;  4W6I A;  4OY4 A;  2XM4 A;  2QLH A;  3EKJ A;  3G9A A;  4XOW A;  3LF3 A;  2XLE A;  4IK9 A;  2ZO6 A;  1ZUX A;  2AH8 A;  4W6F A;  3U0M A;  1EMG A;  4ZIN A;  3SVE A;  2YE1 A;  4W6L A;  2DUF A;  2A47 A;  3DQ7 A;  4JC2 A;  2G3D B;  4TZA A;  1MYW A;  5DPH A;  3SRY A;  4J88 A;  2V4E B;  4GF6 B;  3DQ8 A;  1OXD A;  2HFC A;  3O78 A;  3CFA A;  3SVR A;  5T3I A;  1GGX A;  4Q7U A;  2WSO A;  3SV5 A;  3U0L A;  5JT4 A;  3DQ1 A;  3P28 A;  2G6E A;  3DQL A;  2DDD A;  4XL5 A;  4KEX A;  3SVB A;  4EDO A;  1EMB A;  3DQD A;  4JE9 A;  4IB4 A;  2OTB A;  3DQ6 A;  3SG3 A;  4PPL A;  4PPK A;  4PPJ A;  2B3P A;  3DQ5 A;  4H48 A;  3DQJ A;  2A56 B;  4W7D A;  4W6P A;  3SG2 A;  3DQ9 A;  1Q4E A;  4ZBL A;  3ZUF A;  2HGD A;  3S05 A;  4HQ8 A;  4LQU A;  5DPG A;  3ZUJ A;  5EHU A;  5DRG A;  2ZO7 A;  3P8U A;  2IOV A;  3BXB A;  4IAR A;  3SG6 A;  2BTJ A;  3HNL A;  2YLD A;  4KW4 A;  4DXI A;  4U2V A;  4W6A A;  2VVH A;  2VZX A;  5DTZ A;  5BT0 A;  1KP5 A;  2OTE A;  2QLG B;  5DPI A;  1F09 A;  4W7C A;  5FVG A;  4W69 A;  2DUH A;  3E5V A;  1YHG A;  3C62 A;  3OSQ A;  4OJ0 A;  3SVO A;  2IE2 A;  3A8S A;  5KTG A;  3SSK A;  4KAG A;  3AI4 A;  3L1M A;  3NF0 A;  2YL1 A;  5HGE A;  4EUL A;  3O77 A;  5LTR A;  3CD1 A;  2QLG A;  4LJD C;  2XL8 A;  2J8W A;  1MOU A;  3NT3 A;  1E83 A;  1QPU A;  3UG0 A;  3CFF A;  2EMN A;  1W7S A;  2HRS A;  4KA9 A;  5DQM A;  3RWA A;  2WHU A;  4KF5 A;  5JS5 A;  4W6S A;  4I2Y A;  3OSR A;  3M15 A;  4Q9W A;  3DQA A;  4W7F A;  4W6G A;  4B30 B;  3M4C A;  1RMP A;  4LW5 A;  3SG7 A;  1QY3 A;  5EB6 A;  1A7V A;  2BC5 A;  1OXE A;  3CBE A;  3DPW A;  4N3D A;  1EME A;  2H8Q A;  5LTP A;  3DQ4 A;  4CIP A;  4IK8 A;  4W6R A;  3IQ6 A;  3TOM A;  4DXQ A;  3DE9 A;  3ZTM A;  3SVS A;  2IB6 A;  3QW1 A;  1BFP A;  4B30 A;  2GX2 A;  4DXP A;  1RCP A;  2G6Y A;  2ICR A;  4J89 A;  2H5O A;  3NED A;  2H5R A;  4DKN A;  4Z4K A;  5F9G A;  3W1C A;  1APC A;  2H9W A;  1RMM A;  2Z6Z A;  4OQW A;  3NMK A;  1YHH A;  3SG5 A;  2VAD A;  3HNK A;  4UTS A;  3IP2 A;  1S6Z A;  2JAD A;  3K1K A;  4RTC A;  3EVV A;  4CDY A;  3BXC A;  3DQE A;  3TOL A;  4IK3 A;  5BTT A;  2H6V A;  3UFZ A;  1XMZ A;  3NEZ A;  4XOV A;  5H89 A;  4W7A A;  2HQZ A;  2ZMW A;  2HCG A;  1XAE A;  1G7K A;  3H1R A;  2QLA A;  4RYW A;  4Q7T A;  2XM0 A;  3LVD A;  5AQB B;  5DRF A;  1OXF A;  4CDV A;  3TMR A;  4W73 A;  3QW0 A;  4W6U A;  4W72 A;  5JLI A;  3IR8 A;  4P76 A;  4B5Y A;  2YL7 A;  4H3N A;  4LQT A;  5EJU A;  5EXC I;  4W6O A;  3EK7 A;  5JP7 A;  3V3D A;  3E5T A;  1JBZ A;  4AS8 A;  1RRX A;  2YDZ A;  4JF9 A;  3DPX A;  1EMF A;  2YE0 A;  2AWJ A;  4OHS A;  3DQH A;  5DTX A;  4ZB1 A;  3LVA A;  4EMQ A;  2WHS A;  4CJG A;  4W6C A;  2O24 A;  2V4E A;  4W74 A;  2O2B A;  2VVI A;  2AHA A;  1MQV A;  5JRA A;  3U8C A;  5EXU A;  2RH7 A;  2DUG A;  3DQC A;  3I19 A;  4NWS A;  5J2O A;  3PJ7 A;  5DPJ A;  4IK4 A;  1KYR A;  2O29 A;  4KGE A;  4JKV A;  3ZQV A;  2G6X A;  4LJC A;  1KYS A;  4ER9 A;  1LM3 B;  2GX0 A;  4N6H A;  3VRC A;  1JAF A;  2XLW A;  4IK5 A;  4IK1 A;  5LTQ A;  3EK4 A;  4KF4 A;  5HZO A;  4EIY A;  4WGY A;  3ZUL A;  3LS3 A;  1GQA A;  4DXO A;  3FOP A;  2HGY A;  3EKH A; 
#chains in the Genus database with same CATH topology
 3QVY A;  4JRZ A;  2WZL A;  3TK0 A;  3GL4 A;  4GEH A;  1IZM A;  5EHH A;  4H4K C;  1M2O A;  3IQ5 A;  2YZS A;  1F0B A;  1OR3 A;  4DKM A;  3N0T A;  2DI3 A;  1M56 C;  5B3I A;  1QYQ A;  2CNW A;  1BR2 A;  3RKO F;  3VM6 A;  2Z6X A;  3FXH A;  3SST A;  1ZGQ A;  3NMJ A;  3NYL A;  3U0K A;  3AG1 C;  1CV7 A;  2P7V A;  3CSK A;  2Y3G A;  4KW9 A;  1SMY F;  5BQH A;  3OGO A;  3M4B A;  5EXB A;  2NG1 A;  1Q4A A;  5H87 A;  5DTL A;  5DTY A;  1WTY A;  1ZW3 A;  3DAG A;  3J06 A;  4MVO A;  4O6N A;  3C63 A;  5EB7 A;  2OKU A;  1J8M F;  1E2X A;  1Q4C A;  3VYW A;  3PJB A;  1ZYR F;  5LK4 A;  2PXS A;  2ZMU A;  3TUL A;  3M24 A;  3HTK C;  4W6D A;  3G4Z A;  2XLV A;  1O3U A;  4KGF A;  2LK4 A;  3UGP A;  2IXM A;  2DDC A;  3T6G B;  2EIN C;  2F22 A;  3CD9 A;  3DQF A;  1YZW A;  1MNE A;  3H1O A;  4ZLD A;  4C3D A;  3C18 A;  3POV A;  1VK5 A;  2CCY A;  4A4A A;  4AL0 A;  4P1Q A;  5HBD A;  2CNW D;  4AK9 A;  2XLD A;  4W6N A;  4BJ5 C;  2KYH A;  2W9Y A;  1KYP A;  4J30 B;  5L0J A;  3GAN A;  3W4Y A;  1OXK A;  3K66 A;  4CDA A;  1HUY A;  2M4E A;  1D1A A;  1BBH A;  2R02 A;  1NG1 A;  2A0U A;  5HSW A;  2A54 B;  1M6T A;  4DXN A;  3ZTZ A;  1I5N A;  2CW0 F;  3VF0 A;  2G2S B;  4XEF A;  4CBE A;  1W7U A;  4OD4 A;  5A6A A;  4E0H A;  2OJE D;  3SVC A;  3RQE A;  2YEV A;  5B1A C;  4ORN A;  4WGZ A;  4HQC A;  2CDQ A;  4HVF A;  2QT2 A;  3FVY A;  1HE1 A;  3UMH A;  2R7S A;  3NT9 A;  1U6H A;  3ECS A;  5HZU A;  3LS1 A;  1L7C A;  1T6I A;  2H7B A;  3CAX A;  3LES A;  4GES B;  3E9V A;  3WLD A;  1G4U S;  4IJJ A;  3S9O A;  4JFG A;  4JTA B;  3AG4 C;  4YJW A;  2DYR C;  2HSB A;  3L8J A;  4ANJ A;  2DYS C;  2NPU A;  4DXM A;  2WVO A;  4O6Y A;  1ZGP A;  2QRF A;  3PMR A;  1U0B B;  1D1C A;  3UNG C;  5CI8 A;  2LFD A;  3PDM P;  1W2W A;  2DD7 A;  1AEP A;  3A9C A;  4NC3 A;  3LEV A;  3X2Q C;  3NG1 A;  2C9I A;  2EMO A;  1YVI A;  2Q9B A;  2POX A;  2DUI A;  2VAS A;  1E86 A;  2D4U A;  4JVS A;  4LAC B;  1XZQ A;  2IXN A;  1QQ3 A;  4YL1 A;  2VAE A;  2Q4F A;  2WVN A;  4AR7 A;  4XGY A;  1OR2 A;  5DVW A;  1QSP A;  4D4N A;  3V7O A;  3WLC A;  4ZF5 A;  4JC7 A;  2IB5 A;  4W6K A;  3Q6M A;  3ZIB A;  4EKW A;  4W8K A;  3SVD A;  2LFF A;  3W2W A;  4OY4 A;  1OCC C;  2NSF A;  2J9U A;  4Q4Z F;  2ZO6 A;  3U0M A;  1EMG A;  4ZIN A;  4O7G A;  2EIK C;  3S29 A;  2DUF A;  4TZA A;  1WAT A;  2VB6 A;  3V5X A;  3DQ8 A;  2LCH A;  4J7T A;  3SYN A;  1OCR C;  4NY3 A;  3T6J A;  2WSO A;  3SV5 A;  5JT4 A;  4PR9 A;  4IGG A;  2L7A A;  3P28 A;  2DDD A;  1J8Y F;  2Y3B A;  3DQ6 A;  1SZI A;  3AG2 C;  3EZI A;  4PPL A;  2FAP B;  1KU2 A;  3DQJ A;  2A56 B;  5KYW B;  4I1M A;  3AOU A;  3FAJ A;  4W6P A;  2W4B A;  4MVR A;  3LUT B;  1Q4E A;  1Z63 A;  2J9V A;  4PJN A;  1WN0 A;  5DRG A;  3P8U A;  2IOV A;  3BXB A;  4IAR A;  2QNL A;  2BTJ A;  3FAP B;  4LER A;  2HJM A;  1ZW2 A;  2W4M A;  4MVZ A;  3WOD F;  2VVH A;  2VZX A;  5DTZ A;  3E5V A;  3C62 A;  3EGX A;  3NYM A;  4BJ6 A;  1VMA A;  5B3S C;  5KTG A;  1TFK B;  4BEM J;  4C3B A;  5LTR A;  4OIO F;  3IPM O;  2XSE A;  1MOU A;  3NT3 A;  4JIO A;  1QPU A;  2XL4 A;  1T01 A;  3RWA A;  4KF5 A;  3H65 A;  1RMV A;  5COF A;  3M15 A;  4W6G A;  4B30 B;  3CBE A;  5T3T A;  4G7O F;  4N3D A;  1EME A;  3WG7 C;  2H8Q A;  4CIP A;  4W6R A;  3TOM A;  3K1I A;  4DXQ A;  4AL1 A;  2IB6 A;  1BFP A;  4FX5 A;  1NU9 C;  4H54 A;  4ZLC A;  2TMV P;  2H5R A;  1APC A;  3TJ6 A;  2Y3H A;  2Q9A A;  3GWL A;  3NRH A;  2QUP A;  4MVQ A;  3NMK A;  2VAD A;  3HNK A;  2B0J A;  2XS1 A;  1S6Z A;  5KYU B;  3LLK A;  1SYQ A;  4CDY A;  1F1M A;  2H6V A;  3UFZ A;  4W7A A;  3V5Y A;  1FAP B;  4J7Y A;  2XM0 A;  3O6X A;  5AQB B;  2NUT A;  3EHM A;  2Q9C A;  4QI0 A;  3QW0 A;  2P6V A;  5JLI A;  4P76 A;  4W6O A;  3EK7 A;  3B0U X;  1YAU O;  1RRX A;  4U5D E;  2OOC A;  2WZG A;  1EMF A;  2AWJ A;  2XXA A;  2R7W A;  4PFP A;  4YT5 A;  3DQH A;  5A69 A;  4ZB1 A;  4EMQ A;  3SXK A;  4W6C A;  4W74 A;  2HV7 A;  3DQC A;  2KNH A;  5L3Q A;  2VCA A;  3RIP A;  4IK4 A;  2O29 A;  3ZQV A;  1KYS A;  3WAQ A;  1OCO C;  3VAY A;  2GX0 A;  3IEE A;  1GGQ A;  4N6H A;  3RW0 A;  2LQG A;  4KF4 A;  3ZUL A;  3LS3 A;  3U3F A;  2HGY A;  1MND A;  4GYT A;  256B A;  4JCZ A;  1DOW A;  2LIG A;  4U5G A;  2LP4 A;  3R7C A;  3ATP A;  4JEA A;  2G62 A;  3C8Z A;  2QZ0 A;  3W8I A;  1GL4 A;  3JRM O;  3DJN B;  4N06 A;  5DQB A;  4JCH A;  1JBY A;  2E87 A;  4G78 A;  2CYD A;  4CS9 A;  5FVF A;  3WCK A;  1EMM A;  1T5O A;  1YJG A;  1CPR A;  4IRU A;  2YLI A;  4MTG A;  4AE4 B;  3DXJ F;  1L3P A;  1TQG A;  3JYY A;  2AU5 A;  3K7D A;  2GW3 A;  1C02 A;  2GW4 B;  4JEO A;  4N4W A;  4WJ0 A;  1V4A A;  2A69 F;  3U2M A;  1V55 C;  3DMD A;  4YT8 A;  5A6J A;  2AWC A;  3BX9 A;  2L81 A;  3W1D A;  4IZN A;  3EJN A;  3SSP A;  2AP3 A;  2QY9 A;  1B9C A;  3DE8 A;  3CGL A;  3VHT A;  3CFH A;  3FHD A;  1JOG A;  2IYL D;  4HFK B;  2ZXW C;  3MFN A;  1T6Q A;  3ST3 A;  1I4Z A;  1Q73 A;  3DQU A;  3ABM C;  1NBB A;  3WHN A;  2HZ8 A;  2OJQ A;  1TR2 A;  1FTS A;  2I8B A;  5FHV A;  4Q7R A;  4W6B A;  1O87 A;  4JTD B;  2R05 A;  1VB5 A;  3PJ5 A;  3MLG A;  3K1I C;  3ST4 A;  4E0I A;  3FOO A;  4W7R A;  1RMO A;  4NQF A;  1UIS A;  2JD3 A;  4W6J A;  2A53 B;  4FAP B;  3SSH A;  1PV3 A;  3EH1 A;  4G7H F;  2PNO A;  4Q5S F;  5D92 A;  2HMZ A;  3GM3 A;  1ZGO A;  1BDJ B;  4HE8 D;  4IAQ A;  2UUI A;  5L0F A;  2Y3D A;  3VIC A;  4MTF A;  5A6B A;  3GJ1 A;  2Q6P A;  2DD9 A;  4RDA A;  4DRI B;  3UMI A;  2YVK A;  3GJ2 A;  2WIS A;  3SXY A;  1Z3I X;  2EIJ C;  1XA9 A;  3EPV A;  4HE4 A;  3F46 A;  2Q3T A;  3CZ6 A;  5KYY A;  3RFY A;  4LJD A;  1ORY A;  3SS0 A;  3Q6N A;  2GWW A;  5BQL A;  4PFO A;  3U8P A;  4G0H A;  4K1O A;  3H2V A;  4Z4M A;  3NMI A;  2B3Q A;  2FL1 A;  3S84 A;  3DPZ A;  4R32 A;  3BRJ A;  1JR8 A;  5CI9 A;  4J8A A;  1CGO A;  3GM1 A;  1ZU4 A;  2W45 A;  2J0W A;  4XEK A;  3ED8 A;  1K04 A;  4ZF3 A;  3US6 A;  4KNV A;  2A46 A;  1OKK D;  3GB3 A;  3KCT A;  4R6D A;  4W6H A;  4DBQ A;  2YL3 A;  3JZ0 A;  1XSS A;  2J9W A;  2DUE A;  4WAB A;  4CS9 C;  3FMS A;  3PIB A;  1EMK A;  4JW1 A;  4MND A;  3U3B A;  2QLE A;  2ZXP A;  4MVU A;  3I4U A;  3ST2 A;  4KPI A;  2R7U A;  4YWQ A;  3U8A A;  2HMQ A;  2NSG A;  4NTF A;  3RWT A;  3F47 A;  1E84 A;  3HJC A;  4JJF A;  1RKC A;  2C04 A;  4EBB A;  3SSV A;  1WOL A;  4CS7 A;  2XM4 A;  2QLH A;  1EA8 A;  3EKJ A;  2OCC C;  3DM5 A;  3LF3 A;  1LS1 A;  4Z9H A;  2XXA B;  3SVE A;  4P9T A;  4K0D A;  1QLE C;  2J7P A;  2R7T A;  1OXD A;  5K0I A;  3CFA A;  3SVR A;  3KYJ A;  4MQ9 F;  4YT4 A;  5T3I A;  4PAC A;  4Q7U A;  1ZU5 A;  3DQL A;  4O6M A;  4HEA J;  4XL5 A;  1SR2 A;  4IB4 A;  2B3P A;  1TFO B;  3SG2 A;  2A0B A;  2G3K A;  2Y39 A;  4I44 A;  2HGD A;  3ZUJ A;  5EHU A;  2L9J A;  1D0X A;  1WGW A;  4KNW A;  3HNL A;  3SZR A;  4KW4 A;  4U2V A;  4W6A A;  3LEO A;  4ULW A;  4DRJ B;  3QZC A;  3C8G B;  1Z23 A;  2Y69 C;  3V5Z A;  5L0G A;  3EFO A;  1F09 A;  4W7C A;  5FVG A;  4W69 A;  3OSQ A;  4OJ0 A;  2IE2 A;  5BUO A;  5CIV A;  4EUL A;  4OIQ F;  2I15 A;  2OU6 A;  2QLG A;  4LJD C;  1C03 A;  4P6I C;  3E70 C;  4A2N B;  5DQM A;  2HRS A;  3S90 A;  2KQ9 A;  3KL4 A;  4XWJ A;  4C7O A;  4I2Y A;  1HY5 A;  1YA7 O;  1FR0 A;  3OSR A;  1RKE B;  3M4C A;  1A7V A;  2BE5 F;  3DPW A;  4YL0 A;  2M64 A;  5KYX A;  1T9K A;  3DZA A;  2KJG A;  3JT1 A;  4XLP F;  4KC9 A;  2B0H A;  3QW1 A;  3K6B A;  2ICR A;  2H5O A;  3NED A;  3G4X A;  2HUJ A;  2P1A A;  1ZHW A;  2X51 A;  4PJL A;  3O39 A;  4UTS A;  2JAD A;  4RTC A;  3U5S A;  3EVV A;  3BXC A;  5BTT A;  1LI7 A;  1XMZ A;  3NEZ A;  4XOV A;  1M2V B;  2ZMW A;  1OW7 A;  3CQZ A;  5L0D A;  2QLA A;  4RYW A;  3TQO A;  2YL7 A;  3AGU A;  4H3N A;  4LQT A;  4I1O B;  3E5T A;  2EPM X;  4JF9 A;  4JTC B;  3DPX A;  2YE0 A;  1YLM A;  3AQC A;  4CJG A;  4O79 A;  2V4E A;  2HJ3 A;  3H2U A;  5BQG A;  2R7V A;  1MQV A;  2ZD9 A;  2ETS A;  3PJ7 A;  5DPJ A;  4JKV A;  2G6X A;  4MVM A;  4ER9 A;  3N24 A;  3VRC A;  1JAF A;  1FMV A;  5LTQ A;  3EK4 A;  5HZO A;  1B68 A;  3KMI A;  4DXO A;  5F5F A;  5L0C A;  3U0N A;  1Q0K A;  3B9Q A;  2H5P A;  3EG9 A;  2XLO A;  5DS4 A;  4Z9I A;  1NFN A;  1JC0 A;  3FDQ A;  2XL6 A;  1H9T A;  2OJK A;  3BXA A;  4ZF4 A;  2C9J A;  1OCZ C;  1EML A;  1YYJ A;  2XLM A;  2PX3 A;  3W8H A;  1OW6 A;  3PHF 2;  2A6H F;  4RD9 A;  1GFL A;  4J32 B;  4YT2 A;  1TWC A;  2WUR A;  1MOV A;  2AWL A;  2FZU A;  4JJG A;  1TWH A;  1LIH A;  1ZHZ A;  4JGE A;  5JSL A;  2G3O A;  2HV6 A;  4MW8 A;  1VTM P;  4CSA A;  3U0C A;  4OGS A;  2HS5 A;  2XRH A;  3EK8 A;  1E85 A;  1G4W R;  3JSZ A;  5E2Q A;  4AX2 A;  3A11 A;  2H7O A;  1ZVZ A;  3LF4 B;  3C7J A;  4OIN F;  1JRA A;  3KPH A;  2EMD A;  5H88 A;  4XVP A;  2EPN A;  2ARL A;  1D1B A;  1OQC A;  3U9M A;  5BQI A;  4OIR F;  4NTB A;  3ZQY A;  2V3C C;  4LDQ A;  5E33 A;  3I5Q A;  3ZWI A;  5JUA A;  4LJB A;  4U5E E;  5D91 A;  2Z15 A;  2O9X A;  5EGY A;  1QYF A;  3SNH A;  4ZIO A;  3MGF A;  4BDU A;  3HLZ A;  4PJM A;  5DS6 A;  4E17 A;  4DXW A;  2MYS A;  5EBJ A;  4W75 A;  2QLI A;  2OEV A;  2J46 A;  1S7Z A;  1QVX A;  4MVS A;  1YZA A;  4EUK B;  3HNI A;  2PX0 A;  1YYX A;  2AWK A;  2A48 A;  1M57 C;  4L13 A;  4U9D A;  3DQK A;  3MX3 A;  3GEE A;  4H47 A;  4W76 A;  5DQT A;  2YHS A;  4I3M A;  2A68 F;  3TD7 A;  1KNY A;  1EMC A;  3S28 A;  1ORS C;  1LE4 A;  1R5I D;  2XS8 A;  3SXM A;  3VK1 A;  2H8A A;  4YN0 B;  2V4E C;  4IAO A;  1H6R A;  4BJ1 A;  1Z1Q A;  1WWP A;  5TJ5 E;  4HQ9 A;  3OEO A;  2LD6 A;  3ZDL A;  4H3M A;  5JVE A;  1QYO A;  3RQG A;  3X1O A;  2A52 B;  3DQ2 A;  5E3A A;  4GOB A;  4PFE A;  4JZA A;  1Z6A A;  4L6R A;  1TWG A;  1QZX A;  4CX9 A;  2FGY A;  1O5H A;  1Z7Q c;  3T9O A;  3K1H A;  4ONS A;  4JEB A;  4BJ6 C;  5KYX B;  2YLG A;  1JMW A;  2AWY A;  4U5F E;  3EVR A;  2OKW A;  5L0H A;  2XLH A;  4BPM A;  2A6E F;  4BJT A;  1D0Z A;  4U5H A;  3ASO C;  3JCU Q;  2Z1O A;  2Y0G A;  3M1C B;  4KF5 C;  4W6T A;  5HZT A;  1D0Y A;  5BTT B;  4W6M A;  3L8I A;  1HCJ A;  3I5P A;  2R7O A;  3SEO A;  2OGR A;  4EHP A;  4CSA C;  5FVI A;  3HNJ A;  3DQI A;  4HFF B;  4MS2 A;  4PK4 A;  4CJO A;  4DOZ A;  4L12 A;  5FCL A;  2WHT A;  1YFP A;  3ST0 A;  2OG2 A;  2QE9 A;  3LVC A;  3LAY A;  1Z1P A;  3UMK A;  5AC4 A;  1YJF A;  3KYI A;  1GS9 A;  2WL8 A;  1YZC A;  2ZXR A;  2GAQ A;  4W6I A;  3LLI A;  3RYL A;  3G9A A;  4XOW A;  1H6G A;  3O10 A;  1N1C A;  4KI2 A;  1ZHY A;  1BZ4 A;  4LDK A;  2YE1 A;  4W6L A;  4JC2 A;  1MYW A;  2AVK A;  5DPH A;  2Q00 A;  3SRY A;  4J88 A;  2IBF A;  2V4E B;  1KTM A;  4GF6 B;  1JPJ A;  2IM8 A;  2DB4 A;  1LS4 A;  3ABK C;  3DQ1 A;  4MW3 A;  3SVB A;  4KEX A;  4EDO A;  2KSF A;  4JE9 A;  2OTB A;  2YRF A;  2R7X A;  3DD7 A;  3DQ5 A;  2EPL X;  1ZHX A;  4W7D A;  4C3E A;  2CGE A;  2YQY A;  4ZBL A;  2H7V C;  3RVZ A;  3S05 A;  5DPG A;  4Z9J A;  2ZO7 A;  3EGX B;  3SG6 A;  2YLD A;  4DVZ A;  4YK5 A;  4DXI A;  2JX0 A;  1AVO B;  1K40 A;  1PCX A;  3JRT A;  1FMW A;  1KP5 A;  3Q7L A;  5DPI A;  3K33 A;  1YHG A;  3T4R A;  1PD0 A;  3SVO A;  3A8S A;  4KBL A;  4YL3 A;  3NF0 A;  2HSQ A;  3O77 A;  3CD1 A;  3RF3 A;  2XL8 A;  2J8W A;  3AJM A;  4XEV A;  1CGM E;  3CFF A;  4XPX A;  2WHU A;  1C17 M;  1HMO A;  2R25 A;  4W7F A;  3DQA A;  2PP4 A;  3U2L A;  2L6F A;  1K05 A;  1LI5 A;  4OIP F;  5EB6 A;  1OXE A;  1I4Y A;  5A6B D;  5LTP A;  3DQ4 A;  4E7Z A;  3IQ6 A;  3ZTM A;  3SVS A;  4B30 A;  2GX2 A;  1Q0F A;  1TWA A;  4DKN A;  1RMM A;  4DJ9 A;  1YHH A;  2NUT B;  3IP2 A;  3HKK A;  1BR4 A;  3K1K A;  4IK3 A;  3DQE A;  3B29 A;  4U5B E;  2L6G A;  3QTH A;  1VOM A;  2HQZ A;  3KH2 A;  1XAE A;  1LKX A;  3H1R A;  3LVD A;  3EQL F;  5DRF A;  5KYU A;  1OXF A;  4CDV A;  4FWV A;  3CEX A;  2R03 A;  4GQH A;  3TMR A;  1UFB A;  4W73 A;  4W72 A;  1LPE A;  1A7D A;  1IW7 F;  5JP7 A;  1JBZ A;  4E7S A;  1PD1 A;  3JYH A;  3AGT A;  1JPN A;  1LVK A;  3LVA A;  3LS0 A;  5FZT A;  1GM5 A;  3U8C A;  2DUG A;  2PF4 E;  5J2O A;  4KGE A;  3IHU A;  3NKE A;  1LM3 B;  4IK1 A;  1SF8 A;  2EIL C;  3SP1 A;  4MTO A;  5EK0 A;  4EIY A;  3L0I A;  4WGY A;  1YAR O;  3FOP A;  3EKH A;  3NDB B;  1XZP A;  4BEJ A;  1VYI A;  3SVN A;  2Z6Y A;  1A41 A;  3AI5 A;  2Q57 A;  3UR3 C;  3O55 A;  2ICW G;  1JC1 A;  1QXT A;  1A7E A;  4UDV A;  5F28 E;  4U9E A;  2OEX A;  1Y4C A;  1BR1 A;  4W7E A;  1Q0G A;  2DGJ A;  4OD5 A;  3TJ5 A;  2H5Q A;  3SG4 A;  3R2P A;  1A0B A;  3M79 A;  4LLE A;  4KW8 A;  4ULV A;  1YA9 A;  2PFD A;  2Q7R A;  5GPG B;  2G16 B;  2J7P D;  4D4X A;  2J45 A;  2NUP A;  1XQM A;  2HQK A;  4W8P A;  3U9J A;  4AE4 A;  2PBE A;  3VHT B;  4DVY P;  1YJ2 A;  1RXQ A;  3QVZ A;  1TKN A;  1T6U A;  3GEI A;  2P61 A;  2OKY A;  4TZG A;  1FFH A;  2J0X A;  1S05 A;  3JTL O;  4XTK A;  3ADF A;  1UG7 A;  3N2Z B;  4FES A;  3DI5 A;  3SSY A;  1VLT A;  4W7X A;  1Q4B A;  4CIH A;  3CB9 A;  2J9B A;  3EHN A;  1Q0D A;  1MMN A;  1WAS A;  4EN1 A;  3GEX A;  4Q9X A;  5HZS A;  1RJ9 A;  5DU0 A;  3AQB A;  5L3V A;  1Q4D A;  4L1I A;  5DY6 A;  3IQC A;  3S0X A;  2QU1 A;  2P4M A;  3MYF A;  4JRB A;  1YDI A;  1Q0M A;  3LSA A;  1LE2 A;  2PXW A;  3EGD A;  3OWT A;  3NKD A;  3NYJ A;  3LNR A;  3DQ3 A;  2GFH A;  2HJO A;  2V26 A;  3EVU A;  4X0R A;  4H3L A;  1MMD A;  2BL2 A;  2EIM C;  5COM A;  5IY5 C;  5KYY B;  1YHI A;  4NTA A;  1EMA A;  4M63 A;  2AWM A;  1QKR A;  2OQM A;  4RYS A;  2KGO A;  2KW3 C;  3EVP A;  2HPW A;  1EQ1 A;  3RQF A;  2G5Z B;  2VCC A;  2VH3 A;  4EDS A;  1ORJ A;  2R7R A;  3LA1 A;  3BEH A;  3SVU A;  1H7I A;  5E3C A;  3KCS A;  1OW8 A;  4W77 A;  1ST6 A;  2VVJ A;  1Z5Z A;  3E5W A;  2FWQ A;  1RM9 A;  2YKZ A;  3GEH A;  2HKV A;  2FFH A;  4ZFS A;  2WSN A;  3M22 A;  2G3V A;  3B0V C;  2A50 B;  1V54 C;  2WIQ A;  2RSE B;  1HE9 A;  1CGN A;  4R6B A;  2EPK X;  2WB7 A;  3ASN C;  3UGO A;  3TMT A;  3PCV A;  2R9R B;  4XPW A;  1CPQ A;  4QI2 A;  3SSL A;  4DRH B;  3DQO A;  2YL0 A;  2YFP A;  4LLC A;  2QTV A;  1HMD A;  3GM2 A;  1R4T A;  4Q7C A;  5B1B C;  1EKY A;  1ZZP A;  4CS8 A;  1H4U A;  5AGF A;  3DQN A;  2L6H A;  1FNT c;  1W7T A;  3EZH A;  4E18 A;  5HW9 A;  2GDC A;  3DQM A;  3AKO A;  3ZTF A;  1G5Z A;  4NCQ A;  4RBN A;  2GA0 A;  2WZF A;  3ZC4 A;  4LDR A;  1C4F A;  2XLE A;  4IK9 A;  3MYI A;  1ZUX A;  5HV9 A;  2AH8 A;  4W6F A;  1HW2 A;  1Y6D A;  3ABL C;  2A47 A;  3DQ7 A;  3RVY A;  3T6B A;  3GOD A;  2G3D B;  2D5R B;  2HFC A;  3O78 A;  2MHR A;  3ZG1 A;  3G50 A;  3IQT A;  4G7Z F;  1GGX A;  3KKB A;  3U0L A;  1OXB A;  3U8V A;  5COG A;  4EBK A;  2G6E A;  2ZXO A;  5DS5 A;  1AUE A;  1EMB A;  1U89 A;  3DQD A;  1FFT C;  3SG3 A;  3DWW A;  4PPK A;  4PPJ A;  3Q7G A;  4H48 A;  3GOR A;  3QMK A;  1NFO A;  3DQ9 A;  3ZUF A;  3EFO B;  4HQ8 A;  4LQU A;  1DOV A;  2EPO A;  5DLJ A;  1MMG A;  3DKA A;  4B6I A;  5BT0 A;  2JPU A;  2OTE A;  2QLG B;  2DUH A;  2HFI A;  2RD9 A;  5KYN A;  3L34 A;  1ZHT A;  1XWJ A;  3SSK A;  4KAG A;  1VLS A;  3AI4 A;  3L1M A;  5HGE A;  2YL1 A;  2VC9 A;  3DJU B;  3W2V A;  2X0C A;  4C7O B;  3C8G A;  1VYK A;  3ITF A;  2IXP A;  4P9F A;  1H9G A;  1E83 A;  3UG0 A;  2EMN A;  3JSE O;  5L0I A;  1W7S A;  4KA9 A;  4XQ1 A;  5JS5 A;  4W6S A;  3EH2 A;  3MBG A;  2NUP B;  2C03 A;  4Q9W A;  4EWC A;  1RMP A;  4LW5 A;  3SG7 A;  1QY3 A;  4U5C E;  2BC5 A;  3ZSU A;  3ZVR A;  3AG3 C;  2UUH A;  4PJJ A;  3LNM B;  4QDL A;  4IK8 A;  3DM9 B;  3DE9 A;  3LJB A;  1NU7 D;  1RKE A;  4DXP A;  5T1D B;  2ASR A;  1RCP A;  2P0N A;  2G6Y A;  4J89 A;  1HW1 A;  2R7Q A;  4Z4K A;  5F9G A;  3RH3 A;  4F4B A;  3W1C A;  2H9W A;  4BJ5 A;  2IOQ A;  1EI7 A;  2Z6Z A;  4OQW A;  3SG5 A;  3GWN A;  1NZE A;  2KK1 A;  2VCB A;  1RJ9 B;  2ZPA A;  3SXZ A;  3TOL A;  1NSG B;  5H89 A;  1NLX A;  4EBJ A;  2HCG A;  1G7K A;  2YWA A;  4Q7T A;  1MMA A;  4CS8 C;  3DAF A;  4W6U A;  2KC3 A;  3EGD B;  3IR8 A;  1V74 B;  4B5Y A;  1M2V A;  5DQZ A;  5EJU A;  5EXC I;  3V3D A;  3OA1 A;  3S27 A;  4AS8 A;  4N6C A;  4DBR A;  2YDZ A;  4JUR I;  5F5H A;  5AC5 A;  2LSE A;  5A6K A;  1OKK A;  3B0P A;  4OHS A;  5DTX A;  4XPY A;  2WHS A;  2O24 A;  3B71 A;  2O2B A;  3C8G D;  2VVI A;  2AHA A;  2MWQ A;  4XLN F;  5JRA A;  5EXU A;  2RH7 A;  5T3W A;  3I19 A;  4NWS A;  4K7B A;  1KYR A;  3EG9 B;  4LJC A;  2IXO A;  4BG0 A;  2XLW A;  4IK5 A;  2A1D D;  4IWB A;  1G8X A;  1GQA A;  2WVQ A;  5KYW A; 
#chains in the Genus database with same CATH homology
 3QVY A;  3U0N A;  3SVN A;  2H5P A;  2Z6Y A;  2XLO A;  256B A;  3GL4 A;  3AI5 A;  2Q57 A;  1JC0 A;  2XL6 A;  3IQ5 A;  1F0B A;  4DKM A;  1JC1 A;  2OJK A;  3BXA A;  1QXT A;  4ZF4 A;  5B3I A;  1QYQ A;  2C9J A;  1EML A;  4JEA A;  1YYJ A;  2XLM A;  4U9E A;  2QZ0 A;  1GL4 A;  2Z6X A;  4W7E A;  3SST A;  1ZGQ A;  3NMJ A;  1GFL A;  3U0K A;  5DQB A;  1CV7 A;  1JBY A;  2WUR A;  1MOV A;  2H5Q A;  3SG4 A;  5FVF A;  3WCK A;  2AWL A;  1EMM A;  2FZU A;  4KW9 A;  3OGO A;  1CPR A;  3M4B A;  3M79 A;  4KW8 A;  4ULV A;  5EXB A;  1Q4A A;  5H87 A;  2YLI A;  4JGE A;  5DTL A;  5JSL A;  5DTY A;  2G3O A;  2G16 B;  2GW3 A;  4OGS A;  2GW4 B;  4JEO A;  4D4X A;  3C63 A;  3EK8 A;  5EB7 A;  4N4W A;  1XQM A;  2HQK A;  1Q4C A;  1E85 A;  3VHT B;  3BX9 A;  3PJB A;  3LF4 B;  1YJ2 A;  3QVZ A;  3W1D A;  2EMD A;  5H88 A;  5LK4 A;  4IZN A;  4XVP A;  2ARL A;  2PXS A;  2ZMU A;  3SSP A;  2OKY A;  1B9C A;  3DE8 A;  4TZG A;  3CGL A;  3M24 A;  1S05 A;  4W6D A;  3VHT A;  3CFH A;  3ADF A;  2XLV A;  4KGF A;  3SSY A;  4W7X A;  1Q4B A;  3ST3 A;  3CB9 A;  2J9B A;  3ZQY A;  1Q73 A;  3DQU A;  1NBB A;  2DDC A;  3ZWI A;  5JUA A;  4LJB A;  4EN1 A;  3CD9 A;  3GEX A;  4Q9X A;  5HZS A;  3DQF A;  5FHV A;  1YZW A;  4Q7R A;  4W6B A;  5DU0 A;  1QYF A;  3H1O A;  4ZIO A;  3PJ5 A;  1Q4D A;  3MGF A;  4L1I A;  3ST4 A;  5DY6 A;  4BDU A;  3FOO A;  4W7R A;  2QU1 A;  2CCY A;  2P4M A;  1RMO A;  4P1Q A;  5HBD A;  1UIS A;  4JRB A;  4W6J A;  2A53 B;  2XLD A;  5EBJ A;  4W6N A;  3LSA A;  2PXW A;  3SSH A;  4W75 A;  2QLI A;  1KYP A;  1ZGO A;  1YZA A;  4IAQ A;  3HNI A;  3DQ3 A;  2HJO A;  3EVU A;  3VIC A;  4CDA A;  3GJ1 A;  4H3L A;  1HUY A;  1YYX A;  1BBH A;  2Q6P A;  2AWK A;  2DD9 A;  1YHI A;  2A54 B;  1M6T A;  2A48 A;  4DXN A;  1EMA A;  3ZTZ A;  4L13 A;  4U9D A;  3DQK A;  2G2S B;  2AWM A;  3GJ2 A;  2WIS A;  4RYS A;  4H47 A;  4W76 A;  1XA9 A;  3EVP A;  1W7U A;  4HE4 A;  2HPW A;  2G5Z B;  1EMC A;  4LJD A;  4EDS A;  3VK1 A;  3SS0 A;  3SVC A;  3LA1 A;  2V4E C;  4ORN A;  4WGZ A;  4HQC A;  5BQL A;  3SVU A;  4HVF A;  1H6R A;  2QT2 A;  3KCS A;  3U8P A;  1Z1Q A;  4W77 A;  4HQ9 A;  2VVJ A;  3NT9 A;  4H3M A;  4Z4M A;  3E5W A;  2FWQ A;  5JVE A;  1QYO A;  5HZU A;  3NMI A;  2B3Q A;  1RM9 A;  2FL1 A;  2YKZ A;  2A52 B;  3DQ2 A;  3DPZ A;  4GOB A;  4PFE A;  4ZFS A;  2WSN A;  4J8A A;  1CGO A;  3M22 A;  4GES B;  4L6R A;  2A50 B;  2WIQ A;  3WLD A;  4JFG A;  4CX9 A;  3ED8 A;  1CGN A;  4R6B A;  4ANJ A;  3TMT A;  4DXM A;  1CPQ A;  1ZGP A;  3SSL A;  3DQO A;  4JEB A;  4ZF3 A;  2YL0 A;  2YFP A;  2QRF A;  2A46 A;  2YLG A;  3GB3 A;  3KCT A;  4R6D A;  4W6H A;  2DD7 A;  2YL3 A;  3EVR A;  1EKY A;  4NC3 A;  1XSS A;  2OKW A;  2C9I A;  2EMO A;  2XLH A;  2DUE A;  1H4U A;  3PIB A;  5AGF A;  2Z1O A;  1EMK A;  2POX A;  2Y0G A;  3DQN A;  2DUI A;  4KF5 C;  1E86 A;  2QLE A;  4W6T A;  1W7T A;  5HZT A;  5BTT B;  4W6M A;  5HW9 A;  1HCJ A;  1QQ3 A;  3ST2 A;  2VAE A;  3DQM A;  4AR7 A;  2OGR A;  3AKO A;  3ZTF A;  4KPI A;  4XGY A;  5FVI A;  3HNJ A;  3DQI A;  4CJO A;  4L12 A;  3U8A A;  4D4N A;  3WLC A;  4ZF5 A;  3RWT A;  2WHT A;  1YFP A;  2IB5 A;  4W6K A;  1E84 A;  3ST0 A;  3LVC A;  1Z1P A;  1C4F A;  3SVD A;  1YJF A;  3SSV A;  1YZC A;  4W6I A;  4OY4 A;  2XM4 A;  2QLH A;  3EKJ A;  3G9A A;  4XOW A;  3LF3 A;  2XLE A;  4IK9 A;  2ZO6 A;  1ZUX A;  2AH8 A;  4W6F A;  3U0M A;  1EMG A;  4ZIN A;  3SVE A;  2YE1 A;  4W6L A;  2DUF A;  2A47 A;  3DQ7 A;  4JC2 A;  2G3D B;  4TZA A;  1MYW A;  5DPH A;  3SRY A;  4J88 A;  2V4E B;  4GF6 B;  3DQ8 A;  1OXD A;  2HFC A;  3O78 A;  3CFA A;  3SVR A;  5T3I A;  1GGX A;  4Q7U A;  2WSO A;  3SV5 A;  3U0L A;  5JT4 A;  3DQ1 A;  3P28 A;  2G6E A;  3DQL A;  2DDD A;  4XL5 A;  4KEX A;  3SVB A;  4EDO A;  1EMB A;  3DQD A;  4JE9 A;  4IB4 A;  2OTB A;  3DQ6 A;  3SG3 A;  4PPL A;  4PPK A;  4PPJ A;  2B3P A;  3DQ5 A;  4H48 A;  3DQJ A;  2A56 B;  4W7D A;  4W6P A;  3SG2 A;  3DQ9 A;  1Q4E A;  4ZBL A;  3ZUF A;  2HGD A;  3S05 A;  4HQ8 A;  4LQU A;  5DPG A;  3ZUJ A;  5EHU A;  5DRG A;  2ZO7 A;  3P8U A;  2IOV A;  3BXB A;  4IAR A;  3SG6 A;  2BTJ A;  3HNL A;  2YLD A;  4KW4 A;  4DXI A;  4U2V A;  4W6A A;  2VVH A;  2VZX A;  5DTZ A;  5BT0 A;  1KP5 A;  2OTE A;  2QLG B;  5DPI A;  1F09 A;  4W7C A;  5FVG A;  4W69 A;  2DUH A;  3E5V A;  1YHG A;  3C62 A;  3OSQ A;  4OJ0 A;  3SVO A;  2IE2 A;  3A8S A;  5KTG A;  3SSK A;  4KAG A;  3AI4 A;  3L1M A;  3NF0 A;  2YL1 A;  5HGE A;  4EUL A;  3O77 A;  5LTR A;  3CD1 A;  2QLG A;  4LJD C;  2XL8 A;  2J8W A;  1MOU A;  3NT3 A;  1E83 A;  1QPU A;  3UG0 A;  3CFF A;  2EMN A;  1W7S A;  2HRS A;  4KA9 A;  5DQM A;  3RWA A;  2WHU A;  4KF5 A;  5JS5 A;  4W6S A;  4I2Y A;  3OSR A;  3M15 A;  4Q9W A;  3DQA A;  4W7F A;  4W6G A;  4B30 B;  3M4C A;  1RMP A;  4LW5 A;  3SG7 A;  1QY3 A;  5EB6 A;  1A7V A;  2BC5 A;  1OXE A;  3CBE A;  3DPW A;  4N3D A;  1EME A;  2H8Q A;  5LTP A;  3DQ4 A;  4CIP A;  4IK8 A;  4W6R A;  3IQ6 A;  3TOM A;  4DXQ A;  3DE9 A;  3ZTM A;  3SVS A;  2IB6 A;  3QW1 A;  1BFP A;  4B30 A;  2GX2 A;  4DXP A;  1RCP A;  2G6Y A;  2ICR A;  4J89 A;  2H5O A;  3NED A;  2H5R A;  4DKN A;  4Z4K A;  5F9G A;  3W1C A;  1APC A;  2H9W A;  1RMM A;  2Z6Z A;  4OQW A;  3NMK A;  1YHH A;  3SG5 A;  2VAD A;  3HNK A;  4UTS A;  3IP2 A;  1S6Z A;  2JAD A;  3K1K A;  4RTC A;  3EVV A;  4CDY A;  3BXC A;  3DQE A;  3TOL A;  4IK3 A;  5BTT A;  2H6V A;  3UFZ A;  1XMZ A;  3NEZ A;  4XOV A;  5H89 A;  4W7A A;  2HQZ A;  2ZMW A;  2HCG A;  1XAE A;  1G7K A;  3H1R A;  2QLA A;  4RYW A;  4Q7T A;  2XM0 A;  3LVD A;  5AQB B;  5DRF A;  1OXF A;  4CDV A;  3TMR A;  4W73 A;  3QW0 A;  4W6U A;  4W72 A;  5JLI A;  3IR8 A;  4P76 A;  4B5Y A;  2YL7 A;  4H3N A;  4LQT A;  5EJU A;  5EXC I;  4W6O A;  3EK7 A;  5JP7 A;  3V3D A;  3E5T A;  1JBZ A;  4AS8 A;  1RRX A;  2YDZ A;  4JF9 A;  3DPX A;  1EMF A;  2YE0 A;  2AWJ A;  4OHS A;  3DQH A;  5DTX A;  4ZB1 A;  3LVA A;  4EMQ A;  2WHS A;  4CJG A;  4W6C A;  2O24 A;  2V4E A;  4W74 A;  2O2B A;  2VVI A;  2AHA A;  1MQV A;  5JRA A;  3U8C A;  5EXU A;  2RH7 A;  2DUG A;  3DQC A;  3I19 A;  4NWS A;  5J2O A;  3PJ7 A;  5DPJ A;  4IK4 A;  1KYR A;  2O29 A;  4KGE A;  4JKV A;  3ZQV A;  2G6X A;  4LJC A;  1KYS A;  4ER9 A;  1LM3 B;  2GX0 A;  4N6H A;  3VRC A;  1JAF A;  2XLW A;  4IK5 A;  4IK1 A;  5LTQ A;  3EK4 A;  4KF4 A;  5HZO A;  4EIY A;  4WGY A;  3ZUL A;  3LS3 A;  1GQA A;  4DXO A;  3FOP A;  2HGY A;  3EKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...