3U8PA

Cytochrome b562 integral fusion with egfp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
337
structure length
336
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATFGGSADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYRGGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for efficient chromophore communication and energy transfer in a constructed didomain protein scaffold.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, electron transport
molecule keywords Cytochrome b562 integral fusion with enhanced green fluoresc
total genus 111
structure length 336
sequence length 337
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3u8pA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3u8pA01
1YJFA 3O78A 4DXMA 4W6CA 3SVCA 1GQAA 1QYOA 5HBDA 2BC5A 3ZTFA 4JFGA 3DQAA 4WGYA 3QW1A 3DQ5A 2ZMUA 3LA1A 2WISA 3HNKA 3DQCA 4PPJA 3I19A 1XQMA 3CFFA 5HZTA 2XLOA 1JC0A 2ICRA 4TZAA 3NMJA 4ZF4A 3DQ6A 3CFAA 2HJOA 5JP7A 3S05A 2AWKA 3DQ2A 2IOVA 4W6UA 4IK1A 4W6SA 1JBZA 5JUAA 4I2YA 4W74A 3VRCA 4EN1A 3CB9A 2Z6ZA 2YLDA 2VAEA 3M15A 4IZNA 2RH7A 2XLDA 4JE9A 2EMDA 4B30A 3EK7A 4W75A 2Z6XA 4JEBA 5FHVA 3ZUFA 4ER9A 1ZGQA 3O77A 4JC2A 3PJ7A 4IARA 4ZBLA 1W7UA 2YE1A 1RMMA 5DRFA 3ZTZA 3C63A 2OTBA 2FZUA 3U8AA 1YHGA 3LVCA 2XLEA 1E85A 3GL4A 4EMQA 1QY3A 1S05A 3DQUA 4RTCA 3K1KA 4W77A 4ZFSA 3AKOA 1CPQA 3SS0A 5J2OA 3HNLA 3SVRA 2Q57A 3DQMA 4RYSA 4ANJA 3SSVA 3G9AA 2YFPA 2C9IA 3SG7A 4W7DA 1EMBA 4D4XA 3ST0A 4Z4KA 4DKMA 4ZIOA 4W7XA 3CD9A 3U8PA 4N3DA 2FL1A 3GJ2A 2XLHA 3DQ8A 1H6RA 3ED8A 3TMTA 3SVOA 1KYSA 5KTGA 3V3DA 5EXUA 2QLAA 3C62A 2G3DB 1E83A 1EMKA 1F0BA 4B30B 3SSTA 1YHIA 1XA9A 1MYWA 1Z1QA 1OXEA 2WHSA 2A52B 256BA 2ARLA 1RMPA 5HGEA 4ZINA 2YL0A 4ZF3A 4HQCA 1A7VA 1GGXA 3OSRA 1EMFA 1CGOA 4W7CA 3PJ5A 1GL4A 2EMNA 4PFEA 1ZUXA 2H5PA 2CCYA 1OXDA 2B3PA 3M4CA 1EKYA 2H6VA 4W69A 4NC3A 2HQKA 2G5ZB 2DUFA 3ZULA 4ZB1A 2H5QA 3FOOA 1MOUA 3CGLA 4PPKA 4W7AA 4N6HA 2VVHA 2IE2A 1Q4CA 4IK9A 5EB7A 2YE0A 3DE8A 2BTJA 4W7FA 1RCPA 1E84A 4WGZA 3GJ1A 2QZ0A 3P8UA 5LTPA 3SVUA 1RRXA 3SVNA 3TOLA 2QLHA 2WSNA 1M6TA 5DPJA 3IP2A 5BT0A 3SRYA 3A8SA 3SG4A 2A53B 1MQVA 3DQ4A 4HE4A 5T3IA 2YL1A 3NT3A 3W1CA 4U9DA 3IQ6A 2YL3A 2IB5A 4KW4A 3ST2A 2VZXA 2A56B 1LM3B 1JAFA 2VADA 4W6PA 4JF9A 1E86A 4KAGA 1JBYA 4EULA 5DQBA 4OQWA 1EMGA 3EKJA 2J8WA 1OXFA 4W6GA 3VICA 4J89A 3SG3A 1C4FA 2H5OA 2WSOA 4KF5C 4KPIA 3VK1A 3WCKA 4BDUA 1HUYA 4P1QA 2C9JA 3SSYA 3GB3A 3BXBA 3NT9A 2YLGA 2QLEA 2OJKA 4U9EA 4L6RA 3OSQA 3EVPA 5DU0A 4R6BA 1YZAA 2XL8A 1BBHA 4DXOA 3E5VA 1YHHA 3DE9A 3LVAA 2AHAA 2V4EB 3OGOA 5LK4A 3DQ7A 1QYQA 1Q4DA 3M4BA 4HVFA 2OTEA 4W6FA 3SG6A 4XVPA 4ZF5A 1W7TA 4LW5A 3ZUJA 4W73A 3SVSA 5EJUA 4TZGA 3W1DA 2HPWA 3DQJA 2J9BA 5DPHA 4JRBA 1W7SA 4XOVA 5EXCI 1EMMA 2XM0A 1Z1PA 3SV5A 2A46A 4JGEA 4Q7TA 2VVIA 3QVZA 2G6XA 2DDDA 4W6LA 2HRSA 4W6DA 4CJGA 3DQIA 4JEOA 3AI5A 3DQFA 3PIBA 2GW4B 1G7KA 4IK3A 5EHUA 4W6AA 4W7RA 1ZGPA 1F09A 4OGSA 3CBEA 2WHUA 2Z6YA 3DPXA 3DQDA 3SSLA 5JLIA 5BTTB 4XOWA 1UISA 4OHSA 1YYXA 2QU1A 3DQ1A 5AQBB 2DUEA 3KCTA 3NMKA 4LJCA 3LS3A 4RYWA 2DUGA 1APCA 3ZWIA 4CDYA 4J88A 3KCSA 2GX0A 3EK4A 3RWAA 3DPZA 3WLCA 3LF4B 4IB4A 5JSLA 2OKYA 2G6EA 4Q7RA 2ZO7A 2Q6PA 4UTSA 5EXBA 1YJ2A 2EMOA 1YFPA 1QXTA 2GX2A 4Q9WA 2DUIA 4W6MA 4W6KA 3EVVA 4LQTA 3BXAA 1KYRA 5AGFA 2ZMWA 2QLGB 4AS8A 3FOPA 1CPRA 3P28A 5BTTA 1QPUA 1BFPA 2QLGA 3CD1A 4D4NA 3U0LA 4LJDC 4L12A 4KW8A 4DXIA 4W6OA 3E5WA 3ZQYA 4AR7A 2DD9A 4H3NA 2DDCA 3U0KA 4CX9A 5EBJA 5DTYA 4L1IA 3TMRA 1Q4BA 3VHTA 1QYFA 3NEZA 5JVEA 5DTZA 4XGYA 5EB6A 3E5TA 3DQKA 4EDOA 2IB6A 3EVUA 2YKZA 3U0MA 3ST3A 5H89A 3BXCA 4N4WA 3SG5A 4KF4A 4W6HA 4XL5A 3NF0A 4LJDA 4DXPA 3L1MA 2FWQA 4EDSA 5HZUA 1XMZA 2H9WA 2WURA 1S6ZA 3H1RA 1EMAA 2QLIA 5HZSA 4GOBA 4KGEA 3DQLA 5JT4A 1NBBA 3RWTA 5FVGA 2Z1OA 1EMLA 2PXWA 5FVIA 3LF3A 3HNIA 3ZQVA 5F9GA 3SSKA 2ZO6A 4W72A 2P4MA 5BQLA 3MGFA 4GF6B 2PXSA 2H5RA 4KGFA 5DQMA 1GFLA 3SVEA 2HGYA 5LTQA 2YL7A 3EKHA 3LVDA 2OGRA 4PPLA 4NWSA 2B3QA 3DPWA 2XLVA 4LQUA 3SSHA 5H88A 3CFHA 1Q4EA 4J8AA 4W7EA 2G2SB 5DY6A 3ZTMA 4KF5A 2QT2A 3DQ3A 2O2BA 4HQ9A 3H1OA 2XLWA 4H48A 4IK4A 4R6DA 4CIPA 4L13A 2WIQA 4DKNA 2A47A 3QW0A 2VVJA 2O24A 3M79A 2JADA 3VHTB 2GW3A 4GESB 1YYJA 3TOMA 3HNJA 2A54B 1JC1A 3IR8A 2DD7A 2XM4A 3NMIA 5FVFA 1CV7A 3U0NA 2A50B 4P76A 4W6BA 1QQ3A 2HGDA 1CGNA 2AWLA 2AWJA 4IK8A 4KW9A 3ST4A 3UFZA 3QVYA 4DXQA 2AH8A 3ADFA 5HZOA 4Z4MA 2V4EA 2A48A 3UG0A 2O29A 2POXA 4Q9XA 5LTRA 3BX9A 4CDVA 1YZWA 4IAQA 1XAEA 2HCGA 4Q7UA 3EK8A 1RMOA 2OKWA 5DPIA 2G3OA 1Q73A 2HFCA 4W6RA 3SVBA 5HW9A 3M24A 4W6IA 2H8QA 3DQ9A 2V4EC 1EMCA 4W6NA 3IQ5A 4ULVA 4KA9A 4W6TA 5H87A 2XL6A 4OJ0A 3SG2A 4LJBA 1HCJA 1H4UA 3DQHA 3SSPA 2XLMA 1RM9A 4W76A 4HQ8A 3AI4A 2Y0GA 2YDZA 5DTXA 1B9CA 4W6JA 3GEXA 4CJOA 1Q4AA 3M22A 5DRGA 2HQZA 5JS5A 1KYPA 1MOVA 1EMEA 5JRAA 2QRFA 3DQNA 1YZCA 2G6YA 2DUHA 4B5YA 2YLIA 1XSSA 5DPGA 4JEAA 3DQOA 2G16B 4EIYA 1KP5A 3EVRA 5DTLA 5B3IA 4CDAA 4H3LA 3SVDA 4OY4A 4ORNA 4H47A 4U2VA 4IK5A 2AWMA 3WLDA 3DQEA 4KEXA 4JKVA 3PJBA 1ZGOA 3NEDA 3U8CA 3LSAA 2WHTA 4DXNA 4H3MA
chains in the Genus database with same CATH superfamily
1YJFA 2YHSA 4W6CA 4EHPA 1YA7O 3ZTFA 5A6AA 4WGYA 2ZMUA 2W45A 3DQCA 4U5BE 3CFAA 4KI2A 3TULA 3EHNA 4W6UA 1D0ZA 4IK1A 2J0WA 2CDQA 2UUIA 4W6SA 2A68F 5JUAA 4EN1A 2OEVA 2YLDA 4C7OA 1Z23A 2XLDA 4JURI 4X0RA 4EBBA 3ABLC 4OIQF 1H7IA 3C8GB 1ZHXA 2QY9A 4LACB 4BJ6A 2EIMC 2ASRA 1WN0A 4C3BA 3O77A 1HMDA 5AC4A 5EGYA 2YQYA 2YE1A 2OTBA 2FZUA 3LVCA 4GEHA 1E85A 3GL4A 4EMQA 3DQUA 4RTCA 3K1KA 3FVYA 3AKOA 1MMDA 3HNLA 3SVRA 3WODF 1DOVA 3W8IA 4RYSA 3TD7A 3SSVA 1G5ZA 3SG7A 4Z4KA 3NYMA 4J30B 1T5OA 4RBNA 2Y3HA 2FL1A 3GJ2A 1A41A 5K0IA 3GM2A 3CAXA 1E83A 5HSWA 2XSEA 4IAOA 1Z1QA 1OXEA 2M64A 4CBEA 1RMPA 3NRHA 4HQCA 1A7VA 4PJMA 2LFFA 4LDKA 1T6IA 4PFEA 1ZUXA 1JPNA 5T1DB 2D4UA 2HQKA 4QDLA 4CS8A 1VLSA 4J7TA 2LK4A 2VCAA 5DS6A 3CGLA 2FAPB 2D5RB 4W7FA 2RSEB 4WGZA 4G7ZF 5LTPA 3SVNA 3Q7LA 2QLHA 1YAUO 3UGPA 4G7OF 3IP2A 5BT0A 2LCHA 3SRYA 1M2OA 3DQ4A 3NT3A 2VZXA 4U9DA 3ST2A 2OKUA 2A56B 1MMGA 4W6PA 3K33A 3T6BA 4EULA 3SXKA 4C3EA 1EMGA 4W6GA 1I4YA 4MVRA 1NG1A 3SG3A 1OXKA 1PV3A 3EGXA 2IXMA 4KF5C 2PBEA 1HUYA 1ZHYA 3GODA 3SSYA 2R7SA 3EVPA 5DU0A 1BBHA 2CNWD 1YHHA 3VAYA 3T4RA 5LK4A 4JC7A 2AVKA 1QYQA 4HVFA 3SG6A 3DMDA 2VH3A 5EK0A 3W2VA 4PACA 4LW5A 2H7OA 3UNGC 2Y3GA 2HPWA 3FDQA 3SV5A 2ZXPA 2A46A 4JGEA 1G4US 2DDDA 2CW0F 4W6LA 4W6DA 3DQIA 4CS8C 3GM1A 1ZHTA 3DXJF 1VTMP 3S29A 2Z6YA 2WHUA 3SSLA 4QI0A 1OW6A 2MHRA 3ABKC 1YLMA 4XEVA 2IOQA 3MX3A 2DUGA 3O6XA 1AVOB 3MYIA 3EK4A 3DPZA 3WLCA 4DRJB 2HV6A 2XRHA 2ZO7A 2Q6PA 1SZIA 1YJ2A 1YFPA 4Q9WA 3BXAA 3EGXB 1WOLA 1KYRA 2ZMWA 1Z63A 5BTTA 1BFPA 3U0LA 2H7BA 3UMKA 4D4NA 4L12A 3KYIA 4U5DE 4AR7A 1W2WA 3PHF2 5DTYA 3TMRA 1NFNA 2Y69C 4WJ0A 2JD3A 2AU5A 5EB6A 4IGGA 2IB6A 2DYRC 3U0MA 3ST3A 1Z7Qc 3SG5A 4KF4A 4W6HA 4DXPA 5KYYA 1XMZA 3L0IA 1S6ZA 1T6QA 3R2PA 2M4EA 1MNEA 4ONSA 4UDVA 3RWTA 2PXWA 3V7OA 4N06A 4W72A 3JSEO 2XS1A 3JRTA 3QMKA 4ZLCA 4KGFA 2PXSA 4YWQA 5DQMA 3OA1A 2YWAA 1Z3IX 1B68A 4K1OA 3U3FA 4JVSA 3DPWA 2XLVA 3SSHA 5CIVA 3F47A 1U6HA 4W7EA 1OCCC 5DY6A 3JZ0A 2O2BA 1C03A 4DXWA 3VYWA 1NFOA 5L0FA 4CIPA 4DKNA 3QW0A 5A69A 3ZDLA 4GESB 4JTCB 2GA0A 2R7OA 3NMIA 1BR2A 4W6BA 1CGNA 3U5SA 5DVWA 5KYYB 2PP4A 4O6MA 4DVYP 3ADFA 1ZZPA 1QZXA 1HE9A 1I5NA 2PFDA 3BX9A 4HE8D 4JJGA 3RH3A 1YZWA 1O5HA 3I4UA 3AG2C 3HTKC 2PF4E 4XWJA 2KGOA 4PK4A 2LQGA 3PMRA 4W6RA 5DLJA 3IHUA 3GWNA 3HKKA 3M24A 2H8QA 1YJGA 1SYQA 2MWQA 5L0JA 2R7VA 4KA9A 4W6TA 3SG2A 4LJBA 2Q4FA 2Y3BA 4M63A 2HV7A 2R7XA 4DBRA 4E0IA 1D1AA 1OKKA 4W76A 3NKEA 2Y0GA 2YDZA 1B9CA 3C8GD 1Q4AA 5DRGA 3KPHA 3N2ZB 4U5FE 2R9RB 2NG1A 1KYPA 1EMEA 1MOVA 5JRAA 3DQNA 1YZCA 2C03A 3AOUA 3ASOC 2PNOA 5DPGA 5A6BA 2HJMA 3O39A 4EIYA 3EVRA 1A7EA 1Q0FA 4CDAA 3SVDA 2AWMA 2QE9A 3WLDA 4KEXA 1NU7D 1ZW2A 4JKVA 3PJBA 3SXMA 4MTGA 4H3MA 3DWWA 3O78A 2R05A 5DS4A 4DXMA 2P1AA 3SVCA 1LE2A 2BC5A 3DQAA 3GEEA 5DQTA 3LA1A 3HNKA 3I19A 3TQOA 1XQMA 3CFFA 4TZAA 3NMJA 2R25A 3DQ6A 3VF0A 2HJOA 5JP7A 1VMAA 3S05A 2L6GA 2AWKA 3DQ2A 1RJ9A 2JPUA 2IOVA 1VYKA 2YVKA 3U9MA 1JBZA 1ORYA 2VAEA 2Z15A 5EHHA 3M15A 1JMWA 4XLNF 2EMDA 1HW1A 3EK7A 4W75A 1MMAA 4JEBA 1ZU5A 2AWYA 3QZCA 4XLPF 4MTOA 1ZGQA 1F1MA 2ETSA 2HZ8A 2OEXA 4ZBLA 3C63A 3U8AA 4MVUA 1BZ4A 4YN0B 1QY3A 2DB4A 4XPXA 4ZFSA 5E2QA 5J2OA 3RKOF 4Z9HA 2GAQA 1M2VA 3LLIA 2WB7A 4D4XA 3ST0A 4PJNA 2X51A 4YL1A 4OIRF 4H4KC 2OJED 3U8PA 3LNMB 3DQ8A 3AGTA 3OEOA 5E3CA 2WZLA 2J9VA 3V3DA 1WTYA 3PDMP 3C62A 2G3DB 3SP1A 4B30B 2ZXWC 1F0BA 4AE4B 1XA9A 1ORSC 1EI7A 3Q6NA 4BPMA 2YL0A 1GGXA 1EMFA 1CGOA 4W7CA 3H65A 3JYHA 2WZFA 5HV9A 2LIGA 2W4MA 4CSAA 2VC9A 2H5PA 3BRJA 2CCYA 3K7DA 4JTDB 4W69A 4NC3A 1AEPA 3ZULA 2H5QA 4N6HA 2VVHA 1Q4CA 2YE0A 3DE8A 4R32A 3DD7A 3LEVA 2WVOA 2QZ0A 3SVUA 2WSNA 1TKNA 2KYHA 1TFKB 5DPJA 3RQGA 3SG4A 2A53B 1V4AA 1LM3B 2EILC 4NTBA 4N6CA 3EKJA 3EH2A 3A11A 1M57C 2IXPA 4P9FA 4ULWA 1GM5A 3WCKA 3G4ZA 1MNDA 3NT9A 2YLGA 4A2NB 4L6RA 3OSQA 3L8JA 2YRFA 3E5VA 2HS5A 3DE9A 3LVAA 2V4EB 1RKEA 4CSAC 3CZ6A 1Q4DA 3ZG1A 2OTEA 4XVPA 1W7TA 3T6JA 3S28A 1OW8A 1ZU4A 1SMYF 3DQJA 1D0XA 2PX0A 5DPHA 3N0TA 1EMMA 2CGEA 4NQFA 4FAPB 4NCQA 3DJNB 3QVZA 1K40A 2VCCA 1T9KA 4CS7A 2HRSA 3RQEA 2A6HF 4JEOA 3AI5A 3DQFA 1ZVZA 1ZGPA 3DJUB 4DRIB 5JLIA 2QU1A 2G62A 4MVQA 5AQBB 2DUEA 3KCTA 1T01A 4LJCA 1BDJB 3RWAA 4IB4A 2R7WA 1L3PA 2G3VA 4UTSA 5B1BC 3LEOA 3S84A 4PJLA 4W6KA 4O6YA 5TJ5E 4GYTA 5AGFA 3POVA 2QLGB 3O55A 1CPRA 2R7RA 1K04A 4W6OA 2LD6A 1VK5A 5D92A 4H3NA 2Q9CA 1RKEB 5DTZA 1NLXA 3C18A 2HKVA 4HFFB 3DQKA 4W8KA 4EDOA 1QKRA 1LPEA 3CEXA 5H89A 5KYXB 2DYSC 3L1MA 4MVZA 1NSGB 3EPVA 2WURA 5HZSA 2EPOA 4LLCA 1JPJA 3C8ZA 1YA9A 2VB6A 1FTSA 3ITFA 2F22A 4IJJA 3ZIBA 3CSKA 1OR3A 4O6NA 1IZMA 1GFLA 2HGYA 5LTQA 3LVDA 4KBLA 2OGRA 4I3MA 4PPLA 3GANA 5H88A 4I1OB 2KC3A 1ZW3A 2NSFA 4J7YA 3MLGA 1YDIA 4IK4A 3W8HA 4L13A 2WIQA 3QTHA 2A47A 2VVJA 3M79A 2IXOA 3VHTB 2GW3A 2A54B 1JC1A 3IR8A 4O79A 5FVFA 1CV7A 3U9JA 3U0NA 4P76A 2HGDA 3SXZA 1IW7F 1J8MF 4IK8A 4KW9A 3RQFA 5A6KA 2AH8A 3UG0A 4Q5SF 3EH1A 4CS9C 4CDVA 2NUTB 1V55C 1YVIA 3LJBA 2ICWG 1XWJA 2OKWA 2EINC 3RF3A 4NTAA 4A4AA 2G3OA 2AWCA 4CS9A 2J9UA 4W6IA 4E7SA 3LS1A 3DQ9A 3R7CA 1AUEA 3EFOA 3B0VC 2XL6A 4OJ0A 5DQZA 4BJ5C 1HCJA 3NG1A 3DQHA 1J8YF 1FMWA 1L7CA 2HMZA 5DTXA 2R7UA 4W6JA 4CJOA 1Z5ZA 3M22A 2I8BA 2J7PD 1EA8A 2DUHA 1BR1A 3AQBA 3HJCA 4MVOA 4Z9IA 5F5HA 2L9JA 1XSSA 2OJQA 1Z6AA 4YT8A 4GQHA 5COMA 1KP5A 4PR9A 5DTLA 2YZSA 2GWWA 3UGOA 3NYJA 4H3LA 1TR2A 4U2VA 4MVSA 3DQEA 4YL0A 4G0HA 4E18A 4C7OB 4JCHA 3IQCA 2R03A 1GQAA 1QYOA 4JFGA 3QW1A 5HZTA 2XLOA 1JC0A 2ICRA 4ZF4A 2OCCC 3K1HA 1T6UA 3I5PA 1JOGA 1DOWA 4KNVA 4I2YA 3VRCA 1SF8A 3EQLF 3DZAA 3CB9A 2Z6ZA 2RH7A 4JE9A 4B30A 2KNHA 3L8IA 2A1DD 2Z6XA 4U5GA 3AG3C 1Q0GA 3GM3A 3U2LA 1LI5A 1HE1A 4BEJA 4JC2A 3PJ7A 2KQ9A 4IARA 1RMMA 5DRFA 3KMIA 2OQMA 1YHGA 1FAPB 4BJ6C 3SS0A 1CGME 4XQ1A 4ANJA 3EGDA 3JTLO 4OD4A 4DKMA 3FAPB 2OOCA 4N3DA 3GWLA 5F5FA 3EFOB 2XLHA 5BUOA 1H6RA 3TMTA 3SVOA 4FX5A 1KYSA 5EXUA 2QLAA 3NYLA 1EMKA 1YHIA 1MYWA 2WHSA 2A52B 256BA 2ARLA 5L3VA 5HGEA 4ZINA 4XEKA 4ZF3A 3OSRA 3S9OA 1VB5A 1GL4A 2BL2A 2Q9BA 1FR0A 5CI9A 2HFIA 1A0BA 1EKYA 2H6VA 2R7QA 2G5ZB 4KNWA 2O9XA 4O7GA 2E87A 2J9WA 5L3QA 2B0JA 1O3UA 3C8GA 4IK9A 2BTJA 4EWCA 1E84A 2XS8A 2VASA 3P8UA 4DBQA 1RRXA 1A7DA 1TQGA 3TOLA 4I44A 3ATPA 3T9OA 3K1IA 4HFKB 3GORA 3CQZA 1MQVA 5AC5A 5T3IA 1PD0A 4WABA 5E3AA 2YL3A 2C04A 3L34A 1JAFA 4JF9A 4KAGA 3MBGA 1JBYA 5DQBA 4OQWA 3ABMC 3WHNA 4E17A 4BJTA 2J8WA 4U5HA 5L0HA 1C4FA 4E0HA 3C7JA 3EGDB 2H5OA 2WSOA 4EBKA 4KPIA 4BDUA 4ZLDA 3GB3A 5L0IA 3RVYA 4U9EA 5T3TA 3GEIA 4AK9A 4R6BA 1M56C 1YZAA 2EPKX 3LNRA 5KYWB 2AHAA 3W2WA 3OGOA 3W4YA 3DQ7A 1EQ1A 1WGWA 4ZF5A 3ZUJA 4W73A 3EG9B 5EJUA 4TZGA 4PFPA 2J9BA 4JRBA 5EXCI 2GFHA 2R02A 1NU9C 2G6XA 1D0YA 4CJGA 3IQTA 3ASNC 1V54C 3PIBA 1G7KA 4IK3A 4W6AA 2IBFA 4W7RA 4OGSA 3J06A 3DM9B 5F28E 3DQDA 5KYXA 5BTTB 1PCXA 1C17M 2KSFA 1YYXA 3TJ5A 2NUPB 4JIOA 4H54A 3LS3A 1APCA 3ZWIA 1LI7A 3KCSA 2GX0A 3F46A 2OKYA 3PCVA 1HY5A 2G6EA 4Q7RA 2OG2A 4Q4ZF 4PJJA 2GX2A 4W6MA 2DUIA 4JW1A 3EVVA 4LQTA 3OWTA 1V74B 4AL0A 1C02A 3P28A 2Q7RA 1QPUA 4LJDC 4KW8A 3E5WA 3KYJA 4EUKB 2DD9A 5EBJA 3EHMA 4L1IA 1Q4BA 1QYFA 1ZHZA 2NUPA 3O10A 1UG7A 2Y3DA 3NF0A 4LJDA 5HZUA 2H9WA 3Q7GA 2EIKC 4HEAJ 4DOZA 1EMAA 2QLIA 2HSQA 2V26A 5KYWA 3JYYA 3DQLA 3B71A 5JT4A 1NBBA 1Q0DA 5FVGA 4LDRA 5FVIA 1LKXA 3HNIA 3SSKA 2ZO6A 2GDCA 2QUPA 2P4MA 5BQLA 4GF6B 1E2XA 4XPWA 2YL7A 2J45A 5B1AC 3S90A 3AG1C 4AL1A 4NWSA 1Q0MA 4JRZA 2WVQA 1Q4EA 1QVXA 2G2SB 3ZTMA 4KF5A 2QT2A 3U2MA 3H1OA 2XLWA 2HJ3A 1WATA 1LIHA 1LE4A 2XXAA 1H6GA 3JT1A 1YYJA 3FAJA 3TOMA 3US6A 1FFTC 3UMHA 5CI8A 1H9TA 3SZRA 1QQ3A 2AWJA 2A0UA 3ST4A 3UFZA 3QVYA 4DXQA 1TWGA 4Z4MA 2V4EA 2A48A 2O29A 2POXA 3RVZA 4DVZA 2HCGA 4Q7UA 4BJ5A 3EK8A 1R5ID 3MYFA 1RMOA 2Q9AA 1Q73A 1R4TA 4C3DA 3SVBA 3E70C 2P0NA 4LERA 1QLEC 1OCZC 5FZTA 2V3CC 1EMCA 1OQCA 3BEHA 4ULVA 5B3SC 2KJGA 4MW3A 4XTKA 4OIPF 1VLTA 1H4UA 1Y6DA 3SSPA 2XLMA 1RM9A 1FNTc 1OKKD 3A9CA 5L0DA 3AI4A 4Z9JA 3GEXA 1I4ZA 1RJ9B 1H9GA 4JEAA 2G16B 3SEOA 3AQCA 2ZXRA 5B3IA 2VCBA 4YL3A 3WG7C 4ORNA 4H47A 4IK5A 3U0CA 3LSAA 2WHTA 4DXNA 4MW8A 4MVMA 3RFYA 2YEVA 1TWHA 5BQHA 3I5QA 5HBDA 3FHDA 2FFHA 4AE4A 2ZPAA 2Q00A 3DQ5A 2WISA 1OCRC 4PPJA 4XEFA 4BG0A 1OW7A 1N1CA 3X2QC 4K7BA 4W74A 4IZNA 2HUJA 2NSGA 2WZGA 5FHVA 4YT2A 1GS9A 5COGA 3ZUFA 4ER9A 2IM8A 3ZSUA 3SXYA 4EBJA 2Y39A 3DAGA 1W7UA 3ZTZA 2P6VA 3TK0A 4K0DA 3LUTB 4Q7CA 2XLEA 3AGUA 1S05A 3V5ZA 4W77A 1M2VB 1CPQA 2IXNA 4U5EE 4YJWA 2Q57A 3DQMA 1XZPA 5L0CA 2IYLD 3G9AA 2YFPA 4OIOF 2C9IA 4W7DA 1EMBA 2PX3A 1VYIA 4ZIOA 1BR4A 3EG9A 4W7XA 3CD9A 4E7ZA 4PFOA 1UFBA 4NTFA 1OR2A 3ED8A 5KYNA 2B0HA 5KTGA 4JJFA 1LS1A 3SSTA 5A6JA 4YK5A 4IWBA 3PJ5A 2EMNA 4EKWA 3AG4C 5IY5C 3G50A 4FWVA 1OXDA 2ZXOA 2B3PA 3M4CA 3NKDA 5DS5A 2W9YA 4CIHA 1QSPA 2DUFA 3DAFA 4ZB1A 5KYUA 1XZQA 3FOOA 1MOUA 4PPKA 3S0XA 2DI3A 3MFNA 3ZC4A 4W7AA 5BQGA 3G4XA 2IE2A 5EB7A 1RCPA 1U0BB 3KL4A 2EPMX 3GJ1A 2OU6A 4G78A 5T3WA 1M6TA 1NZEA 3A8SA 1RKCA 4HE4A 2YL1A 4XPYA 3W1CA 3IQ6A 2IB5A 4KW4A 2J0XA 4B6IA 2VADA 3T6GB 1E86A 1GGQA 1OXFA 3VICA 4J89A 2P7VA 3DM5A 4MQ9F 3KKBA 2FGYA 3VK1A 3LESA 2C9JA 4I1MA 3BXBA 1JR8A 3NDBB 2QLEA 2MYSA 2OJKA 3K66A 1VOMA 2XL8A 4DXOA 5E33A 2QNLA 5D91A 3M4BA 4W6FA 2A6EF 5A6BD 3SVSA 5L0GA 1SR2A 4G7HF 3W1DA 3IEEA 1W7SA 3UMIA 4XOVA 2XM0A 1Z1PA 3DKAA 4YT5A 4Q7TA 2VVIA 3RYLA 2NUTA 1MMNA 4P9TA 5KYUB 1OCOC 3UR3C 2GW4B 3WAQA 5EHUA 2KW3C 3GEHA 1F09A 3CBEA 1TFOB 2L81A 1G8XA 1RXQA 3DPXA 1ST6A 4LDQA 3JRMO 4XOWA 1UISA 4OHSA 1TWAA 2X0CA 1KNYA 1YARO 3DQ1A 3NMKA 3V5YA 4RYWA 2A0BA 4J88A 4CDYA 3SYNA 3LF4B 5JSLA 2NPUA 3LS0A 4OINF 4YT4A 2TMVP 1WWPA 1O87A 1U89A 5EXBA 2H7VC 2EMOA 1OXBA 3S27A 1QXTA 3IPMO 2WVNA 3KH2A 2HMQA 1FMVA 2H8AA 3AJMA 3FMSA 4AS8A 3FOPA 2Q3TA 3E9VA 2QLGA 3CD1A 3EZHA 4DXIA 4IRUA 4F4BA 3ZQYA 2JX0A 3U0KA 2DDCA 4CX9A 3VHTA 2CNWA 4RD9A 5JVEA 3NEZA 4XGYA 2CYDA 1G4WR 3E5TA 3EVUA 1ZHWA 2YKZA 3BXCA 3V5XA 4N4WA 4XL5A 4EDSA 4DJ9A 2FWQA 3RIPA 1PD1A 3EJNA 3X1OA 4RDAA 3H1RA 4FESA 4AX2A 1D1CA 4GOBA 4KGEA 1D1BA 2Z1OA 1EMLA 3LF3A 4DRHB 3ZQVA 5F9GA 2R7TA 4MS2A 3JSZA 5FCLA 4OD5A 3MGFA 4BJ1A 2H5RA 2W4BA 2EPLX 3SVEA 3RW0A 4BEMJ 3EKHA 3SNHA 1K05A 3ECSA 4NY3A 2B3QA 4LQUA 4MNDA 3B9QA 3CFHA 4J8AA 1KTMA 3DQ3A 4P6IC 4HQ9A 4H48A 4R6DA 2HSBA 2EPNA 2L6FA 2I15A 2O24A 2JADA 1HW2A 2L6HA 3HNJA 4QI2A 2DD7A 4LLEA 2XM4A 3U8VA 3EZIA 4U5CE 2A69F 2A50B 3B0UX 3HLZA 1Y4CA 1HMOA 4JZAA 4W8PA 2AWLA 1LS4A 2DGJA 1LVKA 5HZOA 1RMVA 4JTAB 2XXAB 4Q9XA 2WL8A 5LTRA 2KK1A 3K6BA 3LLKA 3N24A 2G3KA 5BQIA 2UUHA 4IAQA 1XAEA 3B0PA 1KU2A 2RD9A 2AP3A 3Q6MA 3LAYA 1FFHA 5DPIA 2LP4A 2HFCA 3JCUQ 5HW9A 3M1CB 4KC9A 2V4EC 3FXHA 2ZD9A 4W6NA 3H2UA 2BE5F 3IQ5A 2P61A 5H87A 2QTVA 2EIJC 2LSEA 4JCZA 4HQ8A 2XL4A 3K1IC 2L7AA 2LFDA 2HQZA 1ORJA 1ZYRF 5JS5A 3DI5A 3TJ6A 5COFA 2QRFA 1S7ZA 4MTFA 2G6YA 4B5YA 2YLIA 5GPGB 3VM6A 3DQOA 3U3BA 1JRAA 2J7PA 3ZVRA 1TWCA 4OY4A 2J46A 1Q0KA 3H2VA 1ZGOA 3NEDA 3U8CA 4J32B 3B29A 1WASA 4P1QA
chains in the Genus database with same CATH topology
1YJFA 3O78A 4DXMA 4W6CA 3SVCA 1GQAA 1QYOA 5HBDA 2BC5A 3ZTFA 4JFGA 3DQAA 4WGYA 3QW1A 3DQ5A 2ZMUA 3LA1A 2WISA 3HNKA 3DQCA 4PPJA 3I19A 1XQMA 3CFFA 5HZTA 2XLOA 1JC0A 2ICRA 4TZAA 3NMJA 4ZF4A 3DQ6A 3CFAA 2HJOA 5JP7A 3S05A 2AWKA 3DQ2A 2IOVA 4W6UA 4IK1A 4W6SA 1JBZA 5JUAA 4I2YA 4W74A 3VRCA 4EN1A 3CB9A 2Z6ZA 2YLDA 2VAEA 3M15A 4IZNA 2RH7A 2XLDA 4JE9A 2EMDA 4B30A 3EK7A 4W75A 2Z6XA 4JEBA 5FHVA 3ZUFA 4ER9A 1ZGQA 3O77A 4JC2A 3PJ7A 4IARA 4ZBLA 1W7UA 2YE1A 1RMMA 5DRFA 3ZTZA 3C63A 2OTBA 2FZUA 3U8AA 1YHGA 3LVCA 2XLEA 1E85A 3GL4A 4EMQA 1QY3A 1S05A 3DQUA 4RTCA 3K1KA 4W77A 4ZFSA 3AKOA 1CPQA 3SS0A 5J2OA 3HNLA 3SVRA 2Q57A 3DQMA 4RYSA 4ANJA 3SSVA 3G9AA 2YFPA 2C9IA 3SG7A 4W7DA 1EMBA 4D4XA 3ST0A 4Z4KA 4DKMA 4ZIOA 4W7XA 3CD9A 3U8PA 4N3DA 2FL1A 3GJ2A 2XLHA 3DQ8A 1H6RA 3ED8A 3TMTA 3SVOA 1KYSA 5KTGA 3V3DA 5EXUA 2QLAA 3C62A 2G3DB 1E83A 1EMKA 1F0BA 4B30B 3SSTA 1YHIA 1XA9A 1MYWA 1Z1QA 1OXEA 2WHSA 2A52B 256BA 2ARLA 1RMPA 5HGEA 4ZINA 2YL0A 4ZF3A 4HQCA 1A7VA 1GGXA 3OSRA 1EMFA 1CGOA 4W7CA 3PJ5A 1GL4A 2EMNA 4PFEA 1ZUXA 2H5PA 2CCYA 1OXDA 2B3PA 3M4CA 1EKYA 2H6VA 4W69A 4NC3A 2HQKA 2G5ZB 2DUFA 3ZULA 4ZB1A 2H5QA 3FOOA 1MOUA 3CGLA 4PPKA 4W7AA 4N6HA 2VVHA 2IE2A 1Q4CA 4IK9A 5EB7A 2YE0A 3DE8A 2BTJA 4W7FA 1RCPA 1E84A 4WGZA 3GJ1A 2QZ0A 3P8UA 5LTPA 3SVUA 1RRXA 3SVNA 3TOLA 2QLHA 2WSNA 1M6TA 5DPJA 3IP2A 5BT0A 3SRYA 3A8SA 3SG4A 2A53B 1MQVA 3DQ4A 4HE4A 5T3IA 2YL1A 3NT3A 3W1CA 4U9DA 3IQ6A 2YL3A 2IB5A 4KW4A 3ST2A 2VZXA 2A56B 1LM3B 1JAFA 2VADA 4W6PA 4JF9A 1E86A 4KAGA 1JBYA 4EULA 5DQBA 4OQWA 1EMGA 3EKJA 2J8WA 1OXFA 4W6GA 3VICA 4J89A 3SG3A 1C4FA 2H5OA 2WSOA 4KF5C 4KPIA 3VK1A 3WCKA 4BDUA 1HUYA 4P1QA 2C9JA 3SSYA 3GB3A 3BXBA 3NT9A 2YLGA 2QLEA 2OJKA 4U9EA 4L6RA 3OSQA 3EVPA 5DU0A 4R6BA 1YZAA 2XL8A 1BBHA 4DXOA 3E5VA 1YHHA 3DE9A 3LVAA 2AHAA 2V4EB 3OGOA 5LK4A 3DQ7A 1QYQA 1Q4DA 3M4BA 4HVFA 2OTEA 4W6FA 3SG6A 4XVPA 4ZF5A 1W7TA 4LW5A 3ZUJA 4W73A 3SVSA 5EJUA 4TZGA 3W1DA 2HPWA 3DQJA 2J9BA 5DPHA 4JRBA 1W7SA 4XOVA 5EXCI 1EMMA 2XM0A 1Z1PA 3SV5A 2A46A 4JGEA 4Q7TA 2VVIA 3QVZA 2G6XA 2DDDA 4W6LA 2HRSA 4W6DA 4CJGA 3DQIA 4JEOA 3AI5A 3DQFA 3PIBA 2GW4B 1G7KA 4IK3A 5EHUA 4W6AA 4W7RA 1ZGPA 1F09A 4OGSA 3CBEA 2WHUA 2Z6YA 3DPXA 3DQDA 3SSLA 5JLIA 5BTTB 4XOWA 1UISA 4OHSA 1YYXA 2QU1A 3DQ1A 5AQBB 2DUEA 3KCTA 3NMKA 4LJCA 3LS3A 4RYWA 2DUGA 1APCA 3ZWIA 4CDYA 4J88A 3KCSA 2GX0A 3EK4A 3RWAA 3DPZA 3WLCA 3LF4B 4IB4A 5JSLA 2OKYA 2G6EA 4Q7RA 2ZO7A 2Q6PA 4UTSA 5EXBA 1YJ2A 2EMOA 1YFPA 1QXTA 2GX2A 4Q9WA 2DUIA 4W6MA 4W6KA 3EVVA 4LQTA 3BXAA 1KYRA 5AGFA 2ZMWA 2QLGB 4AS8A 3FOPA 1CPRA 3P28A 5BTTA 1QPUA 1BFPA 2QLGA 3CD1A 4D4NA 3U0LA 4LJDC 4L12A 4KW8A 4DXIA 4W6OA 3E5WA 3ZQYA 4AR7A 2DD9A 4H3NA 2DDCA 3U0KA 4CX9A 5EBJA 5DTYA 4L1IA 3TMRA 1Q4BA 3VHTA 1QYFA 3NEZA 5JVEA 5DTZA 4XGYA 5EB6A 3E5TA 3DQKA 4EDOA 2IB6A 3EVUA 2YKZA 3U0MA 3ST3A 5H89A 3BXCA 4N4WA 3SG5A 4KF4A 4W6HA 4XL5A 3NF0A 4LJDA 4DXPA 3L1MA 2FWQA 4EDSA 5HZUA 1XMZA 2H9WA 2WURA 1S6ZA 3H1RA 1EMAA 2QLIA 5HZSA 4GOBA 4KGEA 3DQLA 5JT4A 1NBBA 3RWTA 5FVGA 2Z1OA 1EMLA 2PXWA 5FVIA 3LF3A 3HNIA 3ZQVA 5F9GA 3SSKA 2ZO6A 4W72A 2P4MA 5BQLA 3MGFA 4GF6B 2PXSA 2H5RA 4KGFA 5DQMA 1GFLA 3SVEA 2HGYA 5LTQA 2YL7A 3EKHA 3LVDA 2OGRA 4PPLA 4NWSA 2B3QA 3DPWA 2XLVA 4LQUA 3SSHA 5H88A 3CFHA 1Q4EA 4J8AA 4W7EA 2G2SB 5DY6A 3ZTMA 4KF5A 2QT2A 3DQ3A 2O2BA 4HQ9A 3H1OA 2XLWA 4H48A 4IK4A 4R6DA 4CIPA 4L13A 2WIQA 4DKNA 2A47A 3QW0A 2VVJA 2O24A 3M79A 2JADA 3VHTB 2GW3A 4GESB 1YYJA 3TOMA 3HNJA 2A54B 1JC1A 3IR8A 2DD7A 2XM4A 3NMIA 5FVFA 1CV7A 3U0NA 2A50B 4P76A 4W6BA 1QQ3A 2HGDA 1CGNA 2AWLA 2AWJA 4IK8A 4KW9A 3ST4A 3UFZA 3QVYA 4DXQA 2AH8A 3ADFA 5HZOA 4Z4MA 2V4EA 2A48A 3UG0A 2O29A 2POXA 4Q9XA 5LTRA 3BX9A 4CDVA 1YZWA 4IAQA 1XAEA 2HCGA 4Q7UA 3EK8A 1RMOA 2OKWA 5DPIA 2G3OA 1Q73A 2HFCA 4W6RA 3SVBA 5HW9A 3M24A 4W6IA 2H8QA 3DQ9A 2V4EC 1EMCA 4W6NA 3IQ5A 4ULVA 4KA9A 4W6TA 5H87A 2XL6A 4OJ0A 3SG2A 4LJBA 1HCJA 1H4UA 3DQHA 3SSPA 2XLMA 1RM9A 4W76A 4HQ8A 3AI4A 2Y0GA 2YDZA 5DTXA 1B9CA 4W6JA 3GEXA 4CJOA 1Q4AA 3M22A 5DRGA 2HQZA 5JS5A 1KYPA 1MOVA 1EMEA 5JRAA 2QRFA 3DQNA 1YZCA 2G6YA 2DUHA 4B5YA 2YLIA 1XSSA 5DPGA 4JEAA 3DQOA 2G16B 4EIYA 1KP5A 3EVRA 5DTLA 5B3IA 4CDAA 4H3LA 3SVDA 4OY4A 4ORNA 4H47A 4U2VA 4IK5A 2AWMA 3WLDA 3DQEA 4KEXA 4JKVA 3PJBA 1ZGOA 3NEDA 3U8CA 3LSAA 2WHTA 4DXNA 4H3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJF A;  3O78 A;  4DXM A;  4W6C A;  3SVC A;  1GQA A;  1QYO A;  5HBD A;  2BC5 A;  3ZTF A;  4JFG A;  3DQA A;  4WGY A;  3QW1 A;  3DQ5 A;  2ZMU A;  3LA1 A;  2WIS A;  3HNK A;  3DQC A;  4PPJ A;  3I19 A;  1XQM A;  3CFF A;  5HZT A;  2XLO A;  1JC0 A;  2ICR A;  4TZA A;  3NMJ A;  4ZF4 A;  3DQ6 A;  3CFA A;  2HJO A;  5JP7 A;  3S05 A;  2AWK A;  3DQ2 A;  2IOV A;  4W6U A;  4IK1 A;  4W6S A;  1JBZ A;  5JUA A;  4I2Y A;  4W74 A;  3VRC A;  4EN1 A;  3CB9 A;  2Z6Z A;  2YLD A;  2VAE A;  3M15 A;  4IZN A;  2RH7 A;  2XLD A;  4JE9 A;  2EMD A;  4B30 A;  3EK7 A;  4W75 A;  2Z6X A;  4JEB A;  5FHV A;  3ZUF A;  4ER9 A;  1ZGQ A;  3O77 A;  4JC2 A;  3PJ7 A;  4IAR A;  4ZBL A;  1W7U A;  2YE1 A;  1RMM A;  5DRF A;  3ZTZ A;  3C63 A;  2OTB A;  2FZU A;  3U8A A;  1YHG A;  3LVC A;  2XLE A;  1E85 A;  3GL4 A;  4EMQ A;  1QY3 A;  1S05 A;  3DQU A;  4RTC A;  3K1K A;  4W77 A;  4ZFS A;  3AKO A;  1CPQ A;  3SS0 A;  5J2O A;  3HNL A;  3SVR A;  2Q57 A;  3DQM A;  4RYS A;  4ANJ A;  3SSV A;  3G9A A;  2YFP A;  2C9I A;  3SG7 A;  4W7D A;  1EMB A;  4D4X A;  3ST0 A;  4Z4K A;  4DKM A;  4ZIO A;  4W7X A;  3CD9 A;  3U8P A;  4N3D A;  2FL1 A;  3GJ2 A;  2XLH A;  3DQ8 A;  1H6R A;  3ED8 A;  3TMT A;  3SVO A;  1KYS A;  5KTG A;  3V3D A;  5EXU A;  2QLA A;  3C62 A;  2G3D B;  1E83 A;  1EMK A;  1F0B A;  4B30 B;  3SST A;  1YHI A;  1XA9 A;  1MYW A;  1Z1Q A;  1OXE A;  2WHS A;  2A52 B;  256B A;  2ARL A;  1RMP A;  5HGE A;  4ZIN A;  2YL0 A;  4ZF3 A;  4HQC A;  1A7V A;  1GGX A;  3OSR A;  1EMF A;  1CGO A;  4W7C A;  3PJ5 A;  1GL4 A;  2EMN A;  4PFE A;  1ZUX A;  2H5P A;  2CCY A;  1OXD A;  2B3P A;  3M4C A;  1EKY A;  2H6V A;  4W69 A;  4NC3 A;  2HQK A;  2G5Z B;  2DUF A;  3ZUL A;  4ZB1 A;  2H5Q A;  3FOO A;  1MOU A;  3CGL A;  4PPK A;  4W7A A;  4N6H A;  2VVH A;  2IE2 A;  1Q4C A;  4IK9 A;  5EB7 A;  2YE0 A;  3DE8 A;  2BTJ A;  4W7F A;  1RCP A;  1E84 A;  4WGZ A;  3GJ1 A;  2QZ0 A;  3P8U A;  5LTP A;  3SVU A;  1RRX A;  3SVN A;  3TOL A;  2QLH A;  2WSN A;  1M6T A;  5DPJ A;  3IP2 A;  5BT0 A;  3SRY A;  3A8S A;  3SG4 A;  2A53 B;  1MQV A;  3DQ4 A;  4HE4 A;  5T3I A;  2YL1 A;  3NT3 A;  3W1C A;  4U9D A;  3IQ6 A;  2YL3 A;  2IB5 A;  4KW4 A;  3ST2 A;  2VZX A;  2A56 B;  1LM3 B;  1JAF A;  2VAD A;  4W6P A;  4JF9 A;  1E86 A;  4KAG A;  1JBY A;  4EUL A;  5DQB A;  4OQW A;  1EMG A;  3EKJ A;  2J8W A;  1OXF A;  4W6G A;  3VIC A;  4J89 A;  3SG3 A;  1C4F A;  2H5O A;  2WSO A;  4KF5 C;  4KPI A;  3VK1 A;  3WCK A;  4BDU A;  1HUY A;  4P1Q A;  2C9J A;  3SSY A;  3GB3 A;  3BXB A;  3NT9 A;  2YLG A;  2QLE A;  2OJK A;  4U9E A;  4L6R A;  3OSQ A;  3EVP A;  5DU0 A;  4R6B A;  1YZA A;  2XL8 A;  1BBH A;  4DXO A;  3E5V A;  1YHH A;  3DE9 A;  3LVA A;  2AHA A;  2V4E B;  3OGO A;  5LK4 A;  3DQ7 A;  1QYQ A;  1Q4D A;  3M4B A;  4HVF A;  2OTE A;  4W6F A;  3SG6 A;  4XVP A;  4ZF5 A;  1W7T A;  4LW5 A;  3ZUJ A;  4W73 A;  3SVS A;  5EJU A;  4TZG A;  3W1D A;  2HPW A;  3DQJ A;  2J9B A;  5DPH A;  4JRB A;  1W7S A;  4XOV A;  5EXC I;  1EMM A;  2XM0 A;  1Z1P A;  3SV5 A;  2A46 A;  4JGE A;  4Q7T A;  2VVI A;  3QVZ A;  2G6X A;  2DDD A;  4W6L A;  2HRS A;  4W6D A;  4CJG A;  3DQI A;  4JEO A;  3AI5 A;  3DQF A;  3PIB A;  2GW4 B;  1G7K A;  4IK3 A;  5EHU A;  4W6A A;  4W7R A;  1ZGP A;  1F09 A;  4OGS A;  3CBE A;  2WHU A;  2Z6Y A;  3DPX A;  3DQD A;  3SSL A;  5JLI A;  5BTT B;  4XOW A;  1UIS A;  4OHS A;  1YYX A;  2QU1 A;  3DQ1 A;  5AQB B;  2DUE A;  3KCT A;  3NMK A;  4LJC A;  3LS3 A;  4RYW A;  2DUG A;  1APC A;  3ZWI A;  4CDY A;  4J88 A;  3KCS A;  2GX0 A;  3EK4 A;  3RWA A;  3DPZ A;  3WLC A;  3LF4 B;  4IB4 A;  5JSL A;  2OKY A;  2G6E A;  4Q7R A;  2ZO7 A;  2Q6P A;  4UTS A;  5EXB A;  1YJ2 A;  2EMO A;  1YFP A;  1QXT A;  2GX2 A;  4Q9W A;  2DUI A;  4W6M A;  4W6K A;  3EVV A;  4LQT A;  3BXA A;  1KYR A;  5AGF A;  2ZMW A;  2QLG B;  4AS8 A;  3FOP A;  1CPR A;  3P28 A;  5BTT A;  1QPU A;  1BFP A;  2QLG A;  3CD1 A;  4D4N A;  3U0L A;  4LJD C;  4L12 A;  4KW8 A;  4DXI A;  4W6O A;  3E5W A;  3ZQY A;  4AR7 A;  2DD9 A;  4H3N A;  2DDC A;  3U0K A;  4CX9 A;  5EBJ A;  5DTY A;  4L1I A;  3TMR A;  1Q4B A;  3VHT A;  1QYF A;  3NEZ A;  5JVE A;  5DTZ A;  4XGY A;  5EB6 A;  3E5T A;  3DQK A;  4EDO A;  2IB6 A;  3EVU A;  2YKZ A;  3U0M A;  3ST3 A;  5H89 A;  3BXC A;  4N4W A;  3SG5 A;  4KF4 A;  4W6H A;  4XL5 A;  3NF0 A;  4LJD A;  4DXP A;  3L1M A;  2FWQ A;  4EDS A;  5HZU A;  1XMZ A;  2H9W A;  2WUR A;  1S6Z A;  3H1R A;  1EMA A;  2QLI A;  5HZS A;  4GOB A;  4KGE A;  3DQL A;  5JT4 A;  1NBB A;  3RWT A;  5FVG A;  2Z1O A;  1EML A;  2PXW A;  5FVI A;  3LF3 A;  3HNI A;  3ZQV A;  5F9G A;  3SSK A;  2ZO6 A;  4W72 A;  2P4M A;  5BQL A;  3MGF A;  4GF6 B;  2PXS A;  2H5R A;  4KGF A;  5DQM A;  1GFL A;  3SVE A;  2HGY A;  5LTQ A;  2YL7 A;  3EKH A;  3LVD A;  2OGR A;  4PPL A;  4NWS A;  2B3Q A;  3DPW A;  2XLV A;  4LQU A;  3SSH A;  5H88 A;  3CFH A;  1Q4E A;  4J8A A;  4W7E A;  2G2S B;  5DY6 A;  3ZTM A;  4KF5 A;  2QT2 A;  3DQ3 A;  2O2B A;  4HQ9 A;  3H1O A;  2XLW A;  4H48 A;  4IK4 A;  4R6D A;  4CIP A;  4L13 A;  2WIQ A;  4DKN A;  2A47 A;  3QW0 A;  2VVJ A;  2O24 A;  3M79 A;  2JAD A;  3VHT B;  2GW3 A;  4GES B;  1YYJ A;  3TOM A;  3HNJ A;  2A54 B;  1JC1 A;  3IR8 A;  2DD7 A;  2XM4 A;  3NMI A;  5FVF A;  1CV7 A;  3U0N A;  2A50 B;  4P76 A;  4W6B A;  1QQ3 A;  2HGD A;  1CGN A;  2AWL A;  2AWJ A;  4IK8 A;  4KW9 A;  3ST4 A;  3UFZ A;  3QVY A;  4DXQ A;  2AH8 A;  3ADF A;  5HZO A;  4Z4M A;  2V4E A;  2A48 A;  3UG0 A;  2O29 A;  2POX A;  4Q9X A;  5LTR A;  3BX9 A;  4CDV A;  1YZW A;  4IAQ A;  1XAE A;  2HCG A;  4Q7U A;  3EK8 A;  1RMO A;  2OKW A;  5DPI A;  2G3O A;  1Q73 A;  2HFC A;  4W6R A;  3SVB A;  5HW9 A;  3M24 A;  4W6I A;  2H8Q A;  3DQ9 A;  2V4E C;  1EMC A;  4W6N A;  3IQ5 A;  4ULV A;  4KA9 A;  4W6T A;  5H87 A;  2XL6 A;  4OJ0 A;  3SG2 A;  4LJB A;  1HCJ A;  1H4U A;  3DQH A;  3SSP A;  2XLM A;  1RM9 A;  4W76 A;  4HQ8 A;  3AI4 A;  2Y0G A;  2YDZ A;  5DTX A;  1B9C A;  4W6J A;  3GEX A;  4CJO A;  1Q4A A;  3M22 A;  5DRG A;  2HQZ A;  5JS5 A;  1KYP A;  1MOV A;  1EME A;  5JRA A;  2QRF A;  3DQN A;  1YZC A;  2G6Y A;  2DUH A;  4B5Y A;  2YLI A;  1XSS A;  5DPG A;  4JEA A;  3DQO A;  2G16 B;  4EIY A;  1KP5 A;  3EVR A;  5DTL A;  5B3I A;  4CDA A;  4H3L A;  3SVD A;  4OY4 A;  4ORN A;  4H47 A;  4U2V A;  4IK5 A;  2AWM A;  3WLD A;  3DQE A;  4KEX A;  4JKV A;  3PJB A;  1ZGO A;  3NED A;  3U8C A;  3LSA A;  2WHT A;  4DXN A;  4H3M A; 
#chains in the Genus database with same CATH topology
 1YJF A;  2YHS A;  4W6C A;  4EHP A;  1YA7 O;  3ZTF A;  5A6A A;  4WGY A;  2ZMU A;  2W45 A;  3DQC A;  4U5B E;  3CFA A;  4KI2 A;  3TUL A;  3EHN A;  4W6U A;  1D0Z A;  4IK1 A;  2J0W A;  2CDQ A;  2UUI A;  4W6S A;  2A68 F;  5JUA A;  4EN1 A;  2OEV A;  2YLD A;  4C7O A;  1Z23 A;  2XLD A;  4JUR I;  4X0R A;  4EBB A;  3ABL C;  4OIQ F;  1H7I A;  3C8G B;  1ZHX A;  2QY9 A;  4LAC B;  4BJ6 A;  2EIM C;  2ASR A;  1WN0 A;  4C3B A;  3O77 A;  1HMD A;  5AC4 A;  5EGY A;  2YQY A;  2YE1 A;  2OTB A;  2FZU A;  3LVC A;  4GEH A;  1E85 A;  3GL4 A;  4EMQ A;  3DQU A;  4RTC A;  3K1K A;  3FVY A;  3AKO A;  1MMD A;  3HNL A;  3SVR A;  3WOD F;  1DOV A;  3W8I A;  4RYS A;  3TD7 A;  3SSV A;  1G5Z A;  3SG7 A;  4Z4K A;  3NYM A;  4J30 B;  1T5O A;  4RBN A;  2Y3H A;  2FL1 A;  3GJ2 A;  1A41 A;  5K0I A;  3GM2 A;  3CAX A;  1E83 A;  5HSW A;  2XSE A;  4IAO A;  1Z1Q A;  1OXE A;  2M64 A;  4CBE A;  1RMP A;  3NRH A;  4HQC A;  1A7V A;  4PJM A;  2LFF A;  4LDK A;  1T6I A;  4PFE A;  1ZUX A;  1JPN A;  5T1D B;  2D4U A;  2HQK A;  4QDL A;  4CS8 A;  1VLS A;  4J7T A;  2LK4 A;  2VCA A;  5DS6 A;  3CGL A;  2FAP B;  2D5R B;  4W7F A;  2RSE B;  4WGZ A;  4G7Z F;  5LTP A;  3SVN A;  3Q7L A;  2QLH A;  1YAU O;  3UGP A;  4G7O F;  3IP2 A;  5BT0 A;  2LCH A;  3SRY A;  1M2O A;  3DQ4 A;  3NT3 A;  2VZX A;  4U9D A;  3ST2 A;  2OKU A;  2A56 B;  1MMG A;  4W6P A;  3K33 A;  3T6B A;  4EUL A;  3SXK A;  4C3E A;  1EMG A;  4W6G A;  1I4Y A;  4MVR A;  1NG1 A;  3SG3 A;  1OXK A;  1PV3 A;  3EGX A;  2IXM A;  4KF5 C;  2PBE A;  1HUY A;  1ZHY A;  3GOD A;  3SSY A;  2R7S A;  3EVP A;  5DU0 A;  1BBH A;  2CNW D;  1YHH A;  3VAY A;  3T4R A;  5LK4 A;  4JC7 A;  2AVK A;  1QYQ A;  4HVF A;  3SG6 A;  3DMD A;  2VH3 A;  5EK0 A;  3W2V A;  4PAC A;  4LW5 A;  2H7O A;  3UNG C;  2Y3G A;  2HPW A;  3FDQ A;  3SV5 A;  2ZXP A;  2A46 A;  4JGE A;  1G4U S;  2DDD A;  2CW0 F;  4W6L A;  4W6D A;  3DQI A;  4CS8 C;  3GM1 A;  1ZHT A;  3DXJ F;  1VTM P;  3S29 A;  2Z6Y A;  2WHU A;  3SSL A;  4QI0 A;  1OW6 A;  2MHR A;  3ABK C;  1YLM A;  4XEV A;  2IOQ A;  3MX3 A;  2DUG A;  3O6X A;  1AVO B;  3MYI A;  3EK4 A;  3DPZ A;  3WLC A;  4DRJ B;  2HV6 A;  2XRH A;  2ZO7 A;  2Q6P A;  1SZI A;  1YJ2 A;  1YFP A;  4Q9W A;  3BXA A;  3EGX B;  1WOL A;  1KYR A;  2ZMW A;  1Z63 A;  5BTT A;  1BFP A;  3U0L A;  2H7B A;  3UMK A;  4D4N A;  4L12 A;  3KYI A;  4U5D E;  4AR7 A;  1W2W A;  3PHF 2;  5DTY A;  3TMR A;  1NFN A;  2Y69 C;  4WJ0 A;  2JD3 A;  2AU5 A;  5EB6 A;  4IGG A;  2IB6 A;  2DYR C;  3U0M A;  3ST3 A;  1Z7Q c;  3SG5 A;  4KF4 A;  4W6H A;  4DXP A;  5KYY A;  1XMZ A;  3L0I A;  1S6Z A;  1T6Q A;  3R2P A;  2M4E A;  1MNE A;  4ONS A;  4UDV A;  3RWT A;  2PXW A;  3V7O A;  4N06 A;  4W72 A;  3JSE O;  2XS1 A;  3JRT A;  3QMK A;  4ZLC A;  4KGF A;  2PXS A;  4YWQ A;  5DQM A;  3OA1 A;  2YWA A;  1Z3I X;  1B68 A;  4K1O A;  3U3F A;  4JVS A;  3DPW A;  2XLV A;  3SSH A;  5CIV A;  3F47 A;  1U6H A;  4W7E A;  1OCC C;  5DY6 A;  3JZ0 A;  2O2B A;  1C03 A;  4DXW A;  3VYW A;  1NFO A;  5L0F A;  4CIP A;  4DKN A;  3QW0 A;  5A69 A;  3ZDL A;  4GES B;  4JTC B;  2GA0 A;  2R7O A;  3NMI A;  1BR2 A;  4W6B A;  1CGN A;  3U5S A;  5DVW A;  5KYY B;  2PP4 A;  4O6M A;  4DVY P;  3ADF A;  1ZZP A;  1QZX A;  1HE9 A;  1I5N A;  2PFD A;  3BX9 A;  4HE8 D;  4JJG A;  3RH3 A;  1YZW A;  1O5H A;  3I4U A;  3AG2 C;  3HTK C;  2PF4 E;  4XWJ A;  2KGO A;  4PK4 A;  2LQG A;  3PMR A;  4W6R A;  5DLJ A;  3IHU A;  3GWN A;  3HKK A;  3M24 A;  2H8Q A;  1YJG A;  1SYQ A;  2MWQ A;  5L0J A;  2R7V A;  4KA9 A;  4W6T A;  3SG2 A;  4LJB A;  2Q4F A;  2Y3B A;  4M63 A;  2HV7 A;  2R7X A;  4DBR A;  4E0I A;  1D1A A;  1OKK A;  4W76 A;  3NKE A;  2Y0G A;  2YDZ A;  1B9C A;  3C8G D;  1Q4A A;  5DRG A;  3KPH A;  3N2Z B;  4U5F E;  2R9R B;  2NG1 A;  1KYP A;  1EME A;  1MOV A;  5JRA A;  3DQN A;  1YZC A;  2C03 A;  3AOU A;  3ASO C;  2PNO A;  5DPG A;  5A6B A;  2HJM A;  3O39 A;  4EIY A;  3EVR A;  1A7E A;  1Q0F A;  4CDA A;  3SVD A;  2AWM A;  2QE9 A;  3WLD A;  4KEX A;  1NU7 D;  1ZW2 A;  4JKV A;  3PJB A;  3SXM A;  4MTG A;  4H3M A;  3DWW A;  3O78 A;  2R05 A;  5DS4 A;  4DXM A;  2P1A A;  3SVC A;  1LE2 A;  2BC5 A;  3DQA A;  3GEE A;  5DQT A;  3LA1 A;  3HNK A;  3I19 A;  3TQO A;  1XQM A;  3CFF A;  4TZA A;  3NMJ A;  2R25 A;  3DQ6 A;  3VF0 A;  2HJO A;  5JP7 A;  1VMA A;  3S05 A;  2L6G A;  2AWK A;  3DQ2 A;  1RJ9 A;  2JPU A;  2IOV A;  1VYK A;  2YVK A;  3U9M A;  1JBZ A;  1ORY A;  2VAE A;  2Z15 A;  5EHH A;  3M15 A;  1JMW A;  4XLN F;  2EMD A;  1HW1 A;  3EK7 A;  4W75 A;  1MMA A;  4JEB A;  1ZU5 A;  2AWY A;  3QZC A;  4XLP F;  4MTO A;  1ZGQ A;  1F1M A;  2ETS A;  2HZ8 A;  2OEX A;  4ZBL A;  3C63 A;  3U8A A;  4MVU A;  1BZ4 A;  4YN0 B;  1QY3 A;  2DB4 A;  4XPX A;  4ZFS A;  5E2Q A;  5J2O A;  3RKO F;  4Z9H A;  2GAQ A;  1M2V A;  3LLI A;  2WB7 A;  4D4X A;  3ST0 A;  4PJN A;  2X51 A;  4YL1 A;  4OIR F;  4H4K C;  2OJE D;  3U8P A;  3LNM B;  3DQ8 A;  3AGT A;  3OEO A;  5E3C A;  2WZL A;  2J9V A;  3V3D A;  1WTY A;  3PDM P;  3C62 A;  2G3D B;  3SP1 A;  4B30 B;  2ZXW C;  1F0B A;  4AE4 B;  1XA9 A;  1ORS C;  1EI7 A;  3Q6N A;  4BPM A;  2YL0 A;  1GGX A;  1EMF A;  1CGO A;  4W7C A;  3H65 A;  3JYH A;  2WZF A;  5HV9 A;  2LIG A;  2W4M A;  4CSA A;  2VC9 A;  2H5P A;  3BRJ A;  2CCY A;  3K7D A;  4JTD B;  4W69 A;  4NC3 A;  1AEP A;  3ZUL A;  2H5Q A;  4N6H A;  2VVH A;  1Q4C A;  2YE0 A;  3DE8 A;  4R32 A;  3DD7 A;  3LEV A;  2WVO A;  2QZ0 A;  3SVU A;  2WSN A;  1TKN A;  2KYH A;  1TFK B;  5DPJ A;  3RQG A;  3SG4 A;  2A53 B;  1V4A A;  1LM3 B;  2EIL C;  4NTB A;  4N6C A;  3EKJ A;  3EH2 A;  3A11 A;  1M57 C;  2IXP A;  4P9F A;  4ULW A;  1GM5 A;  3WCK A;  3G4Z A;  1MND A;  3NT9 A;  2YLG A;  4A2N B;  4L6R A;  3OSQ A;  3L8J A;  2YRF A;  3E5V A;  2HS5 A;  3DE9 A;  3LVA A;  2V4E B;  1RKE A;  4CSA C;  3CZ6 A;  1Q4D A;  3ZG1 A;  2OTE A;  4XVP A;  1W7T A;  3T6J A;  3S28 A;  1OW8 A;  1ZU4 A;  1SMY F;  3DQJ A;  1D0X A;  2PX0 A;  5DPH A;  3N0T A;  1EMM A;  2CGE A;  4NQF A;  4FAP B;  4NCQ A;  3DJN B;  3QVZ A;  1K40 A;  2VCC A;  1T9K A;  4CS7 A;  2HRS A;  3RQE A;  2A6H F;  4JEO A;  3AI5 A;  3DQF A;  1ZVZ A;  1ZGP A;  3DJU B;  4DRI B;  5JLI A;  2QU1 A;  2G62 A;  4MVQ A;  5AQB B;  2DUE A;  3KCT A;  1T01 A;  4LJC A;  1BDJ B;  3RWA A;  4IB4 A;  2R7W A;  1L3P A;  2G3V A;  4UTS A;  5B1B C;  3LEO A;  3S84 A;  4PJL A;  4W6K A;  4O6Y A;  5TJ5 E;  4GYT A;  5AGF A;  3POV A;  2QLG B;  3O55 A;  1CPR A;  2R7R A;  1K04 A;  4W6O A;  2LD6 A;  1VK5 A;  5D92 A;  4H3N A;  2Q9C A;  1RKE B;  5DTZ A;  1NLX A;  3C18 A;  2HKV A;  4HFF B;  3DQK A;  4W8K A;  4EDO A;  1QKR A;  1LPE A;  3CEX A;  5H89 A;  5KYX B;  2DYS C;  3L1M A;  4MVZ A;  1NSG B;  3EPV A;  2WUR A;  5HZS A;  2EPO A;  4LLC A;  1JPJ A;  3C8Z A;  1YA9 A;  2VB6 A;  1FTS A;  3ITF A;  2F22 A;  4IJJ A;  3ZIB A;  3CSK A;  1OR3 A;  4O6N A;  1IZM A;  1GFL A;  2HGY A;  5LTQ A;  3LVD A;  4KBL A;  2OGR A;  4I3M A;  4PPL A;  3GAN A;  5H88 A;  4I1O B;  2KC3 A;  1ZW3 A;  2NSF A;  4J7Y A;  3MLG A;  1YDI A;  4IK4 A;  3W8H A;  4L13 A;  2WIQ A;  3QTH A;  2A47 A;  2VVJ A;  3M79 A;  2IXO A;  3VHT B;  2GW3 A;  2A54 B;  1JC1 A;  3IR8 A;  4O79 A;  5FVF A;  1CV7 A;  3U9J A;  3U0N A;  4P76 A;  2HGD A;  3SXZ A;  1IW7 F;  1J8M F;  4IK8 A;  4KW9 A;  3RQF A;  5A6K A;  2AH8 A;  3UG0 A;  4Q5S F;  3EH1 A;  4CS9 C;  4CDV A;  2NUT B;  1V55 C;  1YVI A;  3LJB A;  2ICW G;  1XWJ A;  2OKW A;  2EIN C;  3RF3 A;  4NTA A;  4A4A A;  2G3O A;  2AWC A;  4CS9 A;  2J9U A;  4W6I A;  4E7S A;  3LS1 A;  3DQ9 A;  3R7C A;  1AUE A;  3EFO A;  3B0V C;  2XL6 A;  4OJ0 A;  5DQZ A;  4BJ5 C;  1HCJ A;  3NG1 A;  3DQH A;  1J8Y F;  1FMW A;  1L7C A;  2HMZ A;  5DTX A;  2R7U A;  4W6J A;  4CJO A;  1Z5Z A;  3M22 A;  2I8B A;  2J7P D;  1EA8 A;  2DUH A;  1BR1 A;  3AQB A;  3HJC A;  4MVO A;  4Z9I A;  5F5H A;  2L9J A;  1XSS A;  2OJQ A;  1Z6A A;  4YT8 A;  4GQH A;  5COM A;  1KP5 A;  4PR9 A;  5DTL A;  2YZS A;  2GWW A;  3UGO A;  3NYJ A;  4H3L A;  1TR2 A;  4U2V A;  4MVS A;  3DQE A;  4YL0 A;  4G0H A;  4E18 A;  4C7O B;  4JCH A;  3IQC A;  2R03 A;  1GQA A;  1QYO A;  4JFG A;  3QW1 A;  5HZT A;  2XLO A;  1JC0 A;  2ICR A;  4ZF4 A;  2OCC C;  3K1H A;  1T6U A;  3I5P A;  1JOG A;  1DOW A;  4KNV A;  4I2Y A;  3VRC A;  1SF8 A;  3EQL F;  3DZA A;  3CB9 A;  2Z6Z A;  2RH7 A;  4JE9 A;  4B30 A;  2KNH A;  3L8I A;  2A1D D;  2Z6X A;  4U5G A;  3AG3 C;  1Q0G A;  3GM3 A;  3U2L A;  1LI5 A;  1HE1 A;  4BEJ A;  4JC2 A;  3PJ7 A;  2KQ9 A;  4IAR A;  1RMM A;  5DRF A;  3KMI A;  2OQM A;  1YHG A;  1FAP B;  4BJ6 C;  3SS0 A;  1CGM E;  4XQ1 A;  4ANJ A;  3EGD A;  3JTL O;  4OD4 A;  4DKM A;  3FAP B;  2OOC A;  4N3D A;  3GWL A;  5F5F A;  3EFO B;  2XLH A;  5BUO A;  1H6R A;  3TMT A;  3SVO A;  4FX5 A;  1KYS A;  5EXU A;  2QLA A;  3NYL A;  1EMK A;  1YHI A;  1MYW A;  2WHS A;  2A52 B;  256B A;  2ARL A;  5L3V A;  5HGE A;  4ZIN A;  4XEK A;  4ZF3 A;  3OSR A;  3S9O A;  1VB5 A;  1GL4 A;  2BL2 A;  2Q9B A;  1FR0 A;  5CI9 A;  2HFI A;  1A0B A;  1EKY A;  2H6V A;  2R7Q A;  2G5Z B;  4KNW A;  2O9X A;  4O7G A;  2E87 A;  2J9W A;  5L3Q A;  2B0J A;  1O3U A;  3C8G A;  4IK9 A;  2BTJ A;  4EWC A;  1E84 A;  2XS8 A;  2VAS A;  3P8U A;  4DBQ A;  1RRX A;  1A7D A;  1TQG A;  3TOL A;  4I44 A;  3ATP A;  3T9O A;  3K1I A;  4HFK B;  3GOR A;  3CQZ A;  1MQV A;  5AC5 A;  5T3I A;  1PD0 A;  4WAB A;  5E3A A;  2YL3 A;  2C04 A;  3L34 A;  1JAF A;  4JF9 A;  4KAG A;  3MBG A;  1JBY A;  5DQB A;  4OQW A;  3ABM C;  3WHN A;  4E17 A;  4BJT A;  2J8W A;  4U5H A;  5L0H A;  1C4F A;  4E0H A;  3C7J A;  3EGD B;  2H5O A;  2WSO A;  4EBK A;  4KPI A;  4BDU A;  4ZLD A;  3GB3 A;  5L0I A;  3RVY A;  4U9E A;  5T3T A;  3GEI A;  4AK9 A;  4R6B A;  1M56 C;  1YZA A;  2EPK X;  3LNR A;  5KYW B;  2AHA A;  3W2W A;  3OGO A;  3W4Y A;  3DQ7 A;  1EQ1 A;  1WGW A;  4ZF5 A;  3ZUJ A;  4W73 A;  3EG9 B;  5EJU A;  4TZG A;  4PFP A;  2J9B A;  4JRB A;  5EXC I;  2GFH A;  2R02 A;  1NU9 C;  2G6X A;  1D0Y A;  4CJG A;  3IQT A;  3ASN C;  1V54 C;  3PIB A;  1G7K A;  4IK3 A;  4W6A A;  2IBF A;  4W7R A;  4OGS A;  3J06 A;  3DM9 B;  5F28 E;  3DQD A;  5KYX A;  5BTT B;  1PCX A;  1C17 M;  2KSF A;  1YYX A;  3TJ5 A;  2NUP B;  4JIO A;  4H54 A;  3LS3 A;  1APC A;  3ZWI A;  1LI7 A;  3KCS A;  2GX0 A;  3F46 A;  2OKY A;  3PCV A;  1HY5 A;  2G6E A;  4Q7R A;  2OG2 A;  4Q4Z F;  4PJJ A;  2GX2 A;  4W6M A;  2DUI A;  4JW1 A;  3EVV A;  4LQT A;  3OWT A;  1V74 B;  4AL0 A;  1C02 A;  3P28 A;  2Q7R A;  1QPU A;  4LJD C;  4KW8 A;  3E5W A;  3KYJ A;  4EUK B;  2DD9 A;  5EBJ A;  3EHM A;  4L1I A;  1Q4B A;  1QYF A;  1ZHZ A;  2NUP A;  3O10 A;  1UG7 A;  2Y3D A;  3NF0 A;  4LJD A;  5HZU A;  2H9W A;  3Q7G A;  2EIK C;  4HEA J;  4DOZ A;  1EMA A;  2QLI A;  2HSQ A;  2V26 A;  5KYW A;  3JYY A;  3DQL A;  3B71 A;  5JT4 A;  1NBB A;  1Q0D A;  5FVG A;  4LDR A;  5FVI A;  1LKX A;  3HNI A;  3SSK A;  2ZO6 A;  2GDC A;  2QUP A;  2P4M A;  5BQL A;  4GF6 B;  1E2X A;  4XPW A;  2YL7 A;  2J45 A;  5B1A C;  3S90 A;  3AG1 C;  4AL1 A;  4NWS A;  1Q0M A;  4JRZ A;  2WVQ A;  1Q4E A;  1QVX A;  2G2S B;  3ZTM A;  4KF5 A;  2QT2 A;  3U2M A;  3H1O A;  2XLW A;  2HJ3 A;  1WAT A;  1LIH A;  1LE4 A;  2XXA A;  1H6G A;  3JT1 A;  1YYJ A;  3FAJ A;  3TOM A;  3US6 A;  1FFT C;  3UMH A;  5CI8 A;  1H9T A;  3SZR A;  1QQ3 A;  2AWJ A;  2A0U A;  3ST4 A;  3UFZ A;  3QVY A;  4DXQ A;  1TWG A;  4Z4M A;  2V4E A;  2A48 A;  2O29 A;  2POX A;  3RVZ A;  4DVZ A;  2HCG A;  4Q7U A;  4BJ5 A;  3EK8 A;  1R5I D;  3MYF A;  1RMO A;  2Q9A A;  1Q73 A;  1R4T A;  4C3D A;  3SVB A;  3E70 C;  2P0N A;  4LER A;  1QLE C;  1OCZ C;  5FZT A;  2V3C C;  1EMC A;  1OQC A;  3BEH A;  4ULV A;  5B3S C;  2KJG A;  4MW3 A;  4XTK A;  4OIP F;  1VLT A;  1H4U A;  1Y6D A;  3SSP A;  2XLM A;  1RM9 A;  1FNT c;  1OKK D;  3A9C A;  5L0D A;  3AI4 A;  4Z9J A;  3GEX A;  1I4Z A;  1RJ9 B;  1H9G A;  4JEA A;  2G16 B;  3SEO A;  3AQC A;  2ZXR A;  5B3I A;  2VCB A;  4YL3 A;  3WG7 C;  4ORN A;  4H47 A;  4IK5 A;  3U0C A;  3LSA A;  2WHT A;  4DXN A;  4MW8 A;  4MVM A;  3RFY A;  2YEV A;  1TWH A;  5BQH A;  3I5Q A;  5HBD A;  3FHD A;  2FFH A;  4AE4 A;  2ZPA A;  2Q00 A;  3DQ5 A;  2WIS A;  1OCR C;  4PPJ A;  4XEF A;  4BG0 A;  1OW7 A;  1N1C A;  3X2Q C;  4K7B A;  4W74 A;  4IZN A;  2HUJ A;  2NSG A;  2WZG A;  5FHV A;  4YT2 A;  1GS9 A;  5COG A;  3ZUF A;  4ER9 A;  2IM8 A;  3ZSU A;  3SXY A;  4EBJ A;  2Y39 A;  3DAG A;  1W7U A;  3ZTZ A;  2P6V A;  3TK0 A;  4K0D A;  3LUT B;  4Q7C A;  2XLE A;  3AGU A;  1S05 A;  3V5Z A;  4W77 A;  1M2V B;  1CPQ A;  2IXN A;  4U5E E;  4YJW A;  2Q57 A;  3DQM A;  1XZP A;  5L0C A;  2IYL D;  3G9A A;  2YFP A;  4OIO F;  2C9I A;  4W7D A;  1EMB A;  2PX3 A;  1VYI A;  4ZIO A;  1BR4 A;  3EG9 A;  4W7X A;  3CD9 A;  4E7Z A;  4PFO A;  1UFB A;  4NTF A;  1OR2 A;  3ED8 A;  5KYN A;  2B0H A;  5KTG A;  4JJF A;  1LS1 A;  3SST A;  5A6J A;  4YK5 A;  4IWB A;  3PJ5 A;  2EMN A;  4EKW A;  3AG4 C;  5IY5 C;  3G50 A;  4FWV A;  1OXD A;  2ZXO A;  2B3P A;  3M4C A;  3NKD A;  5DS5 A;  2W9Y A;  4CIH A;  1QSP A;  2DUF A;  3DAF A;  4ZB1 A;  5KYU A;  1XZQ A;  3FOO A;  1MOU A;  4PPK A;  3S0X A;  2DI3 A;  3MFN A;  3ZC4 A;  4W7A A;  5BQG A;  3G4X A;  2IE2 A;  5EB7 A;  1RCP A;  1U0B B;  3KL4 A;  2EPM X;  3GJ1 A;  2OU6 A;  4G78 A;  5T3W A;  1M6T A;  1NZE A;  3A8S A;  1RKC A;  4HE4 A;  2YL1 A;  4XPY A;  3W1C A;  3IQ6 A;  2IB5 A;  4KW4 A;  2J0X A;  4B6I A;  2VAD A;  3T6G B;  1E86 A;  1GGQ A;  1OXF A;  3VIC A;  4J89 A;  2P7V A;  3DM5 A;  4MQ9 F;  3KKB A;  2FGY A;  3VK1 A;  3LES A;  2C9J A;  4I1M A;  3BXB A;  1JR8 A;  3NDB B;  2QLE A;  2MYS A;  2OJK A;  3K66 A;  1VOM A;  2XL8 A;  4DXO A;  5E33 A;  2QNL A;  5D91 A;  3M4B A;  4W6F A;  2A6E F;  5A6B D;  3SVS A;  5L0G A;  1SR2 A;  4G7H F;  3W1D A;  3IEE A;  1W7S A;  3UMI A;  4XOV A;  2XM0 A;  1Z1P A;  3DKA A;  4YT5 A;  4Q7T A;  2VVI A;  3RYL A;  2NUT A;  1MMN A;  4P9T A;  5KYU B;  1OCO C;  3UR3 C;  2GW4 B;  3WAQ A;  5EHU A;  2KW3 C;  3GEH A;  1F09 A;  3CBE A;  1TFO B;  2L81 A;  1G8X A;  1RXQ A;  3DPX A;  1ST6 A;  4LDQ A;  3JRM O;  4XOW A;  1UIS A;  4OHS A;  1TWA A;  2X0C A;  1KNY A;  1YAR O;  3DQ1 A;  3NMK A;  3V5Y A;  4RYW A;  2A0B A;  4J88 A;  4CDY A;  3SYN A;  3LF4 B;  5JSL A;  2NPU A;  3LS0 A;  4OIN F;  4YT4 A;  2TMV P;  1WWP A;  1O87 A;  1U89 A;  5EXB A;  2H7V C;  2EMO A;  1OXB A;  3S27 A;  1QXT A;  3IPM O;  2WVN A;  3KH2 A;  2HMQ A;  1FMV A;  2H8A A;  3AJM A;  3FMS A;  4AS8 A;  3FOP A;  2Q3T A;  3E9V A;  2QLG A;  3CD1 A;  3EZH A;  4DXI A;  4IRU A;  4F4B A;  3ZQY A;  2JX0 A;  3U0K A;  2DDC A;  4CX9 A;  3VHT A;  2CNW A;  4RD9 A;  5JVE A;  3NEZ A;  4XGY A;  2CYD A;  1G4W R;  3E5T A;  3EVU A;  1ZHW A;  2YKZ A;  3BXC A;  3V5X A;  4N4W A;  4XL5 A;  4EDS A;  4DJ9 A;  2FWQ A;  3RIP A;  1PD1 A;  3EJN A;  3X1O A;  4RDA A;  3H1R A;  4FES A;  4AX2 A;  1D1C A;  4GOB A;  4KGE A;  1D1B A;  2Z1O A;  1EML A;  3LF3 A;  4DRH B;  3ZQV A;  5F9G A;  2R7T A;  4MS2 A;  3JSZ A;  5FCL A;  4OD5 A;  3MGF A;  4BJ1 A;  2H5R A;  2W4B A;  2EPL X;  3SVE A;  3RW0 A;  4BEM J;  3EKH A;  3SNH A;  1K05 A;  3ECS A;  4NY3 A;  2B3Q A;  4LQU A;  4MND A;  3B9Q A;  3CFH A;  4J8A A;  1KTM A;  3DQ3 A;  4P6I C;  4HQ9 A;  4H48 A;  4R6D A;  2HSB A;  2EPN A;  2L6F A;  2I15 A;  2O24 A;  2JAD A;  1HW2 A;  2L6H A;  3HNJ A;  4QI2 A;  2DD7 A;  4LLE A;  2XM4 A;  3U8V A;  3EZI A;  4U5C E;  2A69 F;  2A50 B;  3B0U X;  3HLZ A;  1Y4C A;  1HMO A;  4JZA A;  4W8P A;  2AWL A;  1LS4 A;  2DGJ A;  1LVK A;  5HZO A;  1RMV A;  4JTA B;  2XXA B;  4Q9X A;  2WL8 A;  5LTR A;  2KK1 A;  3K6B A;  3LLK A;  3N24 A;  2G3K A;  5BQI A;  2UUH A;  4IAQ A;  1XAE A;  3B0P A;  1KU2 A;  2RD9 A;  2AP3 A;  3Q6M A;  3LAY A;  1FFH A;  5DPI A;  2LP4 A;  2HFC A;  3JCU Q;  5HW9 A;  3M1C B;  4KC9 A;  2V4E C;  3FXH A;  2ZD9 A;  4W6N A;  3H2U A;  2BE5 F;  3IQ5 A;  2P61 A;  5H87 A;  2QTV A;  2EIJ C;  2LSE A;  4JCZ A;  4HQ8 A;  2XL4 A;  3K1I C;  2L7A A;  2LFD A;  2HQZ A;  1ORJ A;  1ZYR F;  5JS5 A;  3DI5 A;  3TJ6 A;  5COF A;  2QRF A;  1S7Z A;  4MTF A;  2G6Y A;  4B5Y A;  2YLI A;  5GPG B;  3VM6 A;  3DQO A;  3U3B A;  1JRA A;  2J7P A;  3ZVR A;  1TWC A;  4OY4 A;  2J46 A;  1Q0K A;  3H2V A;  1ZGO A;  3NED A;  3U8C A;  4J32 B;  3B29 A;  1WAS A;  4P1Q A; 
#chains in the Genus database with same CATH homology
 1YJF A;  3O78 A;  4DXM A;  4W6C A;  3SVC A;  1GQA A;  1QYO A;  5HBD A;  2BC5 A;  3ZTF A;  4JFG A;  3DQA A;  4WGY A;  3QW1 A;  3DQ5 A;  2ZMU A;  3LA1 A;  2WIS A;  3HNK A;  3DQC A;  4PPJ A;  3I19 A;  1XQM A;  3CFF A;  5HZT A;  2XLO A;  1JC0 A;  2ICR A;  4TZA A;  3NMJ A;  4ZF4 A;  3DQ6 A;  3CFA A;  2HJO A;  5JP7 A;  3S05 A;  2AWK A;  3DQ2 A;  2IOV A;  4W6U A;  4IK1 A;  4W6S A;  1JBZ A;  5JUA A;  4I2Y A;  4W74 A;  3VRC A;  4EN1 A;  3CB9 A;  2Z6Z A;  2YLD A;  2VAE A;  3M15 A;  4IZN A;  2RH7 A;  2XLD A;  4JE9 A;  2EMD A;  4B30 A;  3EK7 A;  4W75 A;  2Z6X A;  4JEB A;  5FHV A;  3ZUF A;  4ER9 A;  1ZGQ A;  3O77 A;  4JC2 A;  3PJ7 A;  4IAR A;  4ZBL A;  1W7U A;  2YE1 A;  1RMM A;  5DRF A;  3ZTZ A;  3C63 A;  2OTB A;  2FZU A;  3U8A A;  1YHG A;  3LVC A;  2XLE A;  1E85 A;  3GL4 A;  4EMQ A;  1QY3 A;  1S05 A;  3DQU A;  4RTC A;  3K1K A;  4W77 A;  4ZFS A;  3AKO A;  1CPQ A;  3SS0 A;  5J2O A;  3HNL A;  3SVR A;  2Q57 A;  3DQM A;  4RYS A;  4ANJ A;  3SSV A;  3G9A A;  2YFP A;  2C9I A;  3SG7 A;  4W7D A;  1EMB A;  4D4X A;  3ST0 A;  4Z4K A;  4DKM A;  4ZIO A;  4W7X A;  3CD9 A;  3U8P A;  4N3D A;  2FL1 A;  3GJ2 A;  2XLH A;  3DQ8 A;  1H6R A;  3ED8 A;  3TMT A;  3SVO A;  1KYS A;  5KTG A;  3V3D A;  5EXU A;  2QLA A;  3C62 A;  2G3D B;  1E83 A;  1EMK A;  1F0B A;  4B30 B;  3SST A;  1YHI A;  1XA9 A;  1MYW A;  1Z1Q A;  1OXE A;  2WHS A;  2A52 B;  256B A;  2ARL A;  1RMP A;  5HGE A;  4ZIN A;  2YL0 A;  4ZF3 A;  4HQC A;  1A7V A;  1GGX A;  3OSR A;  1EMF A;  1CGO A;  4W7C A;  3PJ5 A;  1GL4 A;  2EMN A;  4PFE A;  1ZUX A;  2H5P A;  2CCY A;  1OXD A;  2B3P A;  3M4C A;  1EKY A;  2H6V A;  4W69 A;  4NC3 A;  2HQK A;  2G5Z B;  2DUF A;  3ZUL A;  4ZB1 A;  2H5Q A;  3FOO A;  1MOU A;  3CGL A;  4PPK A;  4W7A A;  4N6H A;  2VVH A;  2IE2 A;  1Q4C A;  4IK9 A;  5EB7 A;  2YE0 A;  3DE8 A;  2BTJ A;  4W7F A;  1RCP A;  1E84 A;  4WGZ A;  3GJ1 A;  2QZ0 A;  3P8U A;  5LTP A;  3SVU A;  1RRX A;  3SVN A;  3TOL A;  2QLH A;  2WSN A;  1M6T A;  5DPJ A;  3IP2 A;  5BT0 A;  3SRY A;  3A8S A;  3SG4 A;  2A53 B;  1MQV A;  3DQ4 A;  4HE4 A;  5T3I A;  2YL1 A;  3NT3 A;  3W1C A;  4U9D A;  3IQ6 A;  2YL3 A;  2IB5 A;  4KW4 A;  3ST2 A;  2VZX A;  2A56 B;  1LM3 B;  1JAF A;  2VAD A;  4W6P A;  4JF9 A;  1E86 A;  4KAG A;  1JBY A;  4EUL A;  5DQB A;  4OQW A;  1EMG A;  3EKJ A;  2J8W A;  1OXF A;  4W6G A;  3VIC A;  4J89 A;  3SG3 A;  1C4F A;  2H5O A;  2WSO A;  4KF5 C;  4KPI A;  3VK1 A;  3WCK A;  4BDU A;  1HUY A;  4P1Q A;  2C9J A;  3SSY A;  3GB3 A;  3BXB A;  3NT9 A;  2YLG A;  2QLE A;  2OJK A;  4U9E A;  4L6R A;  3OSQ A;  3EVP A;  5DU0 A;  4R6B A;  1YZA A;  2XL8 A;  1BBH A;  4DXO A;  3E5V A;  1YHH A;  3DE9 A;  3LVA A;  2AHA A;  2V4E B;  3OGO A;  5LK4 A;  3DQ7 A;  1QYQ A;  1Q4D A;  3M4B A;  4HVF A;  2OTE A;  4W6F A;  3SG6 A;  4XVP A;  4ZF5 A;  1W7T A;  4LW5 A;  3ZUJ A;  4W73 A;  3SVS A;  5EJU A;  4TZG A;  3W1D A;  2HPW A;  3DQJ A;  2J9B A;  5DPH A;  4JRB A;  1W7S A;  4XOV A;  5EXC I;  1EMM A;  2XM0 A;  1Z1P A;  3SV5 A;  2A46 A;  4JGE A;  4Q7T A;  2VVI A;  3QVZ A;  2G6X A;  2DDD A;  4W6L A;  2HRS A;  4W6D A;  4CJG A;  3DQI A;  4JEO A;  3AI5 A;  3DQF A;  3PIB A;  2GW4 B;  1G7K A;  4IK3 A;  5EHU A;  4W6A A;  4W7R A;  1ZGP A;  1F09 A;  4OGS A;  3CBE A;  2WHU A;  2Z6Y A;  3DPX A;  3DQD A;  3SSL A;  5JLI A;  5BTT B;  4XOW A;  1UIS A;  4OHS A;  1YYX A;  2QU1 A;  3DQ1 A;  5AQB B;  2DUE A;  3KCT A;  3NMK A;  4LJC A;  3LS3 A;  4RYW A;  2DUG A;  1APC A;  3ZWI A;  4CDY A;  4J88 A;  3KCS A;  2GX0 A;  3EK4 A;  3RWA A;  3DPZ A;  3WLC A;  3LF4 B;  4IB4 A;  5JSL A;  2OKY A;  2G6E A;  4Q7R A;  2ZO7 A;  2Q6P A;  4UTS A;  5EXB A;  1YJ2 A;  2EMO A;  1YFP A;  1QXT A;  2GX2 A;  4Q9W A;  2DUI A;  4W6M A;  4W6K A;  3EVV A;  4LQT A;  3BXA A;  1KYR A;  5AGF A;  2ZMW A;  2QLG B;  4AS8 A;  3FOP A;  1CPR A;  3P28 A;  5BTT A;  1QPU A;  1BFP A;  2QLG A;  3CD1 A;  4D4N A;  3U0L A;  4LJD C;  4L12 A;  4KW8 A;  4DXI A;  4W6O A;  3E5W A;  3ZQY A;  4AR7 A;  2DD9 A;  4H3N A;  2DDC A;  3U0K A;  4CX9 A;  5EBJ A;  5DTY A;  4L1I A;  3TMR A;  1Q4B A;  3VHT A;  1QYF A;  3NEZ A;  5JVE A;  5DTZ A;  4XGY A;  5EB6 A;  3E5T A;  3DQK A;  4EDO A;  2IB6 A;  3EVU A;  2YKZ A;  3U0M A;  3ST3 A;  5H89 A;  3BXC A;  4N4W A;  3SG5 A;  4KF4 A;  4W6H A;  4XL5 A;  3NF0 A;  4LJD A;  4DXP A;  3L1M A;  2FWQ A;  4EDS A;  5HZU A;  1XMZ A;  2H9W A;  2WUR A;  1S6Z A;  3H1R A;  1EMA A;  2QLI A;  5HZS A;  4GOB A;  4KGE A;  3DQL A;  5JT4 A;  1NBB A;  3RWT A;  5FVG A;  2Z1O A;  1EML A;  2PXW A;  5FVI A;  3LF3 A;  3HNI A;  3ZQV A;  5F9G A;  3SSK A;  2ZO6 A;  4W72 A;  2P4M A;  5BQL A;  3MGF A;  4GF6 B;  2PXS A;  2H5R A;  4KGF A;  5DQM A;  1GFL A;  3SVE A;  2HGY A;  5LTQ A;  2YL7 A;  3EKH A;  3LVD A;  2OGR A;  4PPL A;  4NWS A;  2B3Q A;  3DPW A;  2XLV A;  4LQU A;  3SSH A;  5H88 A;  3CFH A;  1Q4E A;  4J8A A;  4W7E A;  2G2S B;  5DY6 A;  3ZTM A;  4KF5 A;  2QT2 A;  3DQ3 A;  2O2B A;  4HQ9 A;  3H1O A;  2XLW A;  4H48 A;  4IK4 A;  4R6D A;  4CIP A;  4L13 A;  2WIQ A;  4DKN A;  2A47 A;  3QW0 A;  2VVJ A;  2O24 A;  3M79 A;  2JAD A;  3VHT B;  2GW3 A;  4GES B;  1YYJ A;  3TOM A;  3HNJ A;  2A54 B;  1JC1 A;  3IR8 A;  2DD7 A;  2XM4 A;  3NMI A;  5FVF A;  1CV7 A;  3U0N A;  2A50 B;  4P76 A;  4W6B A;  1QQ3 A;  2HGD A;  1CGN A;  2AWL A;  2AWJ A;  4IK8 A;  4KW9 A;  3ST4 A;  3UFZ A;  3QVY A;  4DXQ A;  2AH8 A;  3ADF A;  5HZO A;  4Z4M A;  2V4E A;  2A48 A;  3UG0 A;  2O29 A;  2POX A;  4Q9X A;  5LTR A;  3BX9 A;  4CDV A;  1YZW A;  4IAQ A;  1XAE A;  2HCG A;  4Q7U A;  3EK8 A;  1RMO A;  2OKW A;  5DPI A;  2G3O A;  1Q73 A;  2HFC A;  4W6R A;  3SVB A;  5HW9 A;  3M24 A;  4W6I A;  2H8Q A;  3DQ9 A;  2V4E C;  1EMC A;  4W6N A;  3IQ5 A;  4ULV A;  4KA9 A;  4W6T A;  5H87 A;  2XL6 A;  4OJ0 A;  3SG2 A;  4LJB A;  1HCJ A;  1H4U A;  3DQH A;  3SSP A;  2XLM A;  1RM9 A;  4W76 A;  4HQ8 A;  3AI4 A;  2Y0G A;  2YDZ A;  5DTX A;  1B9C A;  4W6J A;  3GEX A;  4CJO A;  1Q4A A;  3M22 A;  5DRG A;  2HQZ A;  5JS5 A;  1KYP A;  1MOV A;  1EME A;  5JRA A;  2QRF A;  3DQN A;  1YZC A;  2G6Y A;  2DUH A;  4B5Y A;  2YLI A;  1XSS A;  5DPG A;  4JEA A;  3DQO A;  2G16 B;  4EIY A;  1KP5 A;  3EVR A;  5DTL A;  5B3I A;  4CDA A;  4H3L A;  3SVD A;  4OY4 A;  4ORN A;  4H47 A;  4U2V A;  4IK5 A;  2AWM A;  3WLD A;  3DQE A;  4KEX A;  4JKV A;  3PJB A;  1ZGO A;  3NED A;  3U8C A;  3LSA A;  2WHT A;  4DXN A;  4H3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...