3U8PA

Cytochrome b562 integral fusion with egfp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
337
structure length
336
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATFGGSADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYRGGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b562 integral fusion with enhanced green fluoresc
publication title Structural basis for efficient chromophore communication and energy transfer in a constructed didomain protein scaffold.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, electron transport
total genus 111
structure length 336
sequence length 337
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3u8pA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3u8pA01
1ZGPA 3GJ2A 4Q9XA 5DQMA 3SV5A 3UG0A 3W1CA 3KCSA 5HZSA 4EDSA 2WIQA 3TOLA 4AR7A 5LK4A 4ZFSA 4RYSA 4XGYA 3SVCA 2ICRA 4Q7UA 4P1QA 2HJOA 3DQMA 2H6VA 2A48A 2QT2A 3UFZA 3DE8A 3ST0A 4EULA 2POXA 4W6OA 2YDZA 3DQUA 1YYXA 3SVOA 4XL5A 3ST3A 4DXQA 1H6RA 4W75A 4DXOA 4U9EA 3QVYA 4EIYA 3A8SA 2Z6YA 1QYOA 3WCKA 4IZNA 5EJUA 1E85A 3FOOA 3HNLA 4LQTA 3SG4A 1KYSA 3P28A 1Q4AA 3E5WA 3ZULA 1EMAA 1YHIA 1Q4DA 4KW9A 1Q4EA 4LJCA 4LW5A 3DQ1A 4PPKA 5AQBB 3SS0A 3SSPA 2HRSA 1A7VA 2AWJA 4I2YA 4CDYA 3SG5A 2G3OA 2V4EB 2FZUA 3IQ6A 3CBEA 1E86A 3LSAA 4GESB 2VVIA 4ZIOA 5DPHA 2IE2A 1Q4BA 3SSKA 1E83A 5JP7A 4IAQA 3H1OA 2YL3A 4IARA 3U0KA 4JF9A 5HGEA 4W76A 3SSVA 2YL7A 2AWLA 1QXTA 4OJ0A 3NMIA 4HE4A 4IB4A 1CV7A 5EB7A 5EXBA 3EVPA 3SG7A 3DQIA 2XM0A 3NF0A 1QY3A 3ZUJA 4JC2A 3M15A 2WISA 5BQLA 3M4BA 4XOVA 2J8WA 1RMOA 4JEBA 2BTJA 3EVUA 1CPQA 3M24A 2VAEA 4LQUA 2DD9A 3GB3A 3SVEA 3M22A 5JVEA 1RMMA 1KP5A 2YLIA 2WHSA 4L6RA 1Z1QA 2Z6ZA 4W6AA 4OGSA 4KF4A 3BX9A 4HVFA 3DQ9A 1CPRA 3NT9A 5DPIA 4W6KA 1M6TA 3VRCA 4W6LA 4KA9A 3ZTFA 2OJKA 4IK4A 2XLEA 2AHAA 2IB6A 4NWSA 3DQ4A 3SSYA 4WGZA 2DUFA 2QZ0A 1ZGQA 4OHSA 1GQAA 3DQAA 2XM4A 4N6HA 1HCJA 3PJBA 4J89A 3SVBA 2QLEA 4AS8A 1ZGOA 3ADFA 3LS3A 3DE9A 3QW1A 4W6FA 5F9GA 2VADA 1JBZA 2YLDA 3NEDA 4CJGA 4W6GA 2YE0A 1YZWA 4B30A 3U8PA 2DDDA 1EMEA 3BXBA 2ZO7A 3VHTA 5LTPA 4JE9A 4WGYA 3ED8A 4HQCA 3CFFA 2H8QA 2ZMWA 3LA1A 3CGLA 1EMFA 3ST2A 3LVCA 5BTTB 1MOVA 5H87A 3NMJA 1YYJA 3DQ2A 4CDVA 2Q6PA 3IQ5A 4H3MA 1F09A 2A50B 2YFPA 2HQZA 1RCPA 4P76A 2ARLA 5DQBA 2H5QA 1YHGA 1OXEA 3ZTZA 4W6SA 1HUYA 1YJFA 4H48A 3WLDA 2B3QA 3K1KA 4KGFA 2G5ZB 4IK1A 3L1MA 4JKVA 4RYWA 5EXCI 4W7AA 2VZXA 5T3IA 2FL1A 3PIBA 2DUHA 4IK5A 5HZOA 4EDOA 2A46A 4B5YA 2VVJA 3U8AA 3SRYA 3WLCA 2O29A 2OGRA 3SVRA 4W6IA 5FVGA 3HNJA 1S05A 5FVIA 2XLVA 4UTSA 2XL6A 3PJ5A 3AI4A 3DQ5A 1XQMA 2RH7A 2O24A 1XA9A 1XMZA 1H4UA 4OQWA 2EMNA 4Z4KA 3ST4A 2G6YA 5EB6A 4ZF5A 1NBBA 1GFLA 1W7SA 2G6EA 2YLGA 4XOWA 4IK8A 3GL4A 1MOUA 2EMDA 1OXFA 1GL4A 3C62A 2A52B 2BC5A 5JLIA 3U8CA 5EXUA 5H89A 3W1DA 1EMKA 2XLDA 3DPXA 3O78A 5DTZA 1CGNA 1MQVA 4H47A 5JS5A 3O77A 3NMKA 1UISA 2PXSA 2QLAA 3DQLA 3EK8A 4ULVA 2G2SB 2YE1A 3U0LA 4Q9WA 1LM3B 4KAGA 4H3LA 4JEAA 2ZMUA 2QLHA 3DQ6A 4W6JA 2IB5A 5AGFA 4GOBA 1QPUA 1QQ3A 3GEXA 4Q7TA 4W6CA 4W6PA 3SG6A 5DY6A 3ZUFA 3M4CA 4KW4A 4L1IA 4W7XA 3DQDA 2J9BA 4U9DA 4W6NA 1XSSA 4R6DA 3H1RA 3HNKA 2OTBA 3DQEA 2HQKA 4JFGA 3SSHA 3EVVA 2GW3A 5JT4A 4DXIA 2XLWA 2QLGB 1RRXA 2CCYA 2OTEA 5BT0A 4ZF3A 4OY4A 4W6UA 3LVDA 3RWAA 4HQ9A 1YHHA 2G3DB 2P4MA 3DQ3A 4LJDA 4CJOA 1YZAA 3EKJA 2H5OA 2WSOA 3E5TA 4H3NA 3SVNA 3ZQVA 4D4NA 2XLHA 1KYPA 4ZBLA 3SSTA 5EHUA 2DUIA 3BXAA 4DXPA 5JRAA 1RM9A 4KF5A 1S6ZA 4W7FA 1EKYA 4N3DA 3SG2A 2B3PA 2ZO6A 2HPWA 2HGDA 4W73A 4BDUA 2C9IA 1BBHA 3TMRA 5DU0A 3GJ1A 4J88A 3VICA 4W6HA 4LJBA 1Z1PA 3TMTA 3OSQA 5DPGA 2HGYA 4JGEA 2DUEA 3PJ7A 5BTTA 3M79A 3CFHA 1F0BA 3NEZA 1YJ2A 3P8UA 4GF6B 4W77A 3VHTB 5LTRA 2Z1OA 3NT3A 1OXDA 1RMPA 3FOPA 2YL0A 4Q7RA 5EBJA 1APCA 4EN1A 4IK9A 5DTXA 3RWTA 5HZTA 3CD1A 4R6BA 4W7CA 2HCGA 4W6RA 4ORNA 4W69A 4KW8A 3DQJA 1JC0A 3C63A 3V3DA 2WHTA 4ZINA 4RTCA 4TZGA 1BFPA 2H5PA 2G16B 5KTGA 4LJDC 3BXCA 4CIPA 3I19A 3SVUA 2AWKA 1YZCA 5JUAA 4ZB1A 1XAEA 4DXNA 5DRGA 3QVZA 1JC1A 4DXMA 4W6BA 2C9JA 2DDCA 2JADA 1EMLA 2DUGA 3IR8A 2HFCA 5HW9A 4KPIA 4KF5C 4CDAA 2GX2A 3IP2A 5B3IA 4KGEA 3VK1A 2V4EA 4J8AA 4HQ8A 2A56B 3DQ7A 4W6DA 5DTLA 3ZWIA 2Y0GA 2OKWA 2OKYA 3SVDA 5HZUA 2AWMA 3DQ8A 1ZUXA 3S05A 2YKZA 3EKHA 2WURA 1B9CA 4W6MA 3DPZA 3G9AA 3EK7A 4W6TA 2WSNA 4W7EA 2XLOA 2Z6XA 2O2BA 2Q57A 3OSRA 1C4FA 2A54B 2GX0A 3CD9A 3ZTMA 1YFPA 4NC3A 3E5VA 3DQKA 3OGOA 4U2VA 4ANJA 4N4WA 2WHUA 4IK3A 3HNIA 4W7RA 4L13A 1CGOA 4JEOA 2XL8A 3CB9A 3DQCA 2H9WA 3EVRA 256BA 2XLMA 3ZQYA 1Q73A 4KEXA 4DKNA 3KCTA 4PFEA 1Q4CA 5LTQA 3DQHA 3LF3A 4ZF4A 5DTYA 2VVHA 1JBYA 2H5RA 2V4EC 4W7DA 2FWQA 1E84A 4L12A 4CX9A 1MYWA 4EMQA 4W74A 1W7TA 2YL1A 3AI5A 3TOMA 1EMCA 5FVFA 2QLGA 3MGFA 1EMGA 1GGXA 3LVAA 5J2OA 1JAFA 1QYQA 2IOVA 5DPJA 4DKMA 1EMBA 2PXWA 5HBDA 4ER9A 3U0NA 3DQOA 3DQNA 4JRBA 2G6XA 3DPWA 3U0MA 5H88A 1W7UA 2QLIA 3LF4B 4D4XA 4PPJA 2EMOA 1G7KA 5FHVA 5JSLA 2QRFA 2DD7A 3QW0A 3SSLA 4XVPA 4W72A 3DQFA 3EK4A 1EMMA 1KYRA 2GW4B 2A53B 2QU1A 4B30B 3CFAA 4Z4MA 2AH8A 4TZAA 3SG3A 2A47A 3SVSA 3AKOA 1QYFA 5DRFA 4PPLA
chains in the Genus database with same CATH superfamily
3S90A 2L6GA 4RD9A 5DQMA 2LSEA 3KCSA 5LK4A 3DMDA 4ZFSA 3AG1C 2ICRA 3L8IA 3DQMA 1VLSA 3U8VA 5EHHA 4BJ6C 3EQLF 5BQGA 2POXA 4W6OA 2BE5F 2XS1A 4XPWA 3SVOA 4O6MA 3M1CB 4RBNA 1R5ID 3WCKA 5EJUA 3E9VA 2PX0A 3N2ZB 3E5WA 4BEJA 3KL4A 3LUTB 4G7ZF 4AL1A 1FMVA 1H9GA 4LJCA 2YHSA 1A7VA 4K7BA 2G3OA 3IQ6A 4GQHA 4PFOA 1D1AA 3S28A 3K1HA 3LLIA 2IE2A 3IHUA 2YWAA 2ZD9A 3ECSA 5HGEA 4BG0A 3SSVA 4LERA 4K1OA 2D4UA 1QXTA 3UMIA 3CSKA 2C04A 5EXBA 3SG7A 1EQ1A 4KC9A 1QY3A 4YL1A 2WISA 5D92A 4XOVA 2Y3DA 1NSGB 2BTJA 3EVUA 1CPQA 1NG1A 3M24A 3GB3A 1RMMA 4PJLA 1QLEC 5CI9A 2WHSA 2NUTA 2PP4A 2PF4E 3NT9A 4W6KA 1M6TA 4W6LA 3ZTFA 2AHAA 4MW3A 4WGZA 2WVOA 2CNWD 1ZGOA 3ADFA 5CIVA 2KGOA 1UG7A 2VADA 1ZHTA 2GFHA 4W6GA 2YE0A 1K05A 1FNTc 4HFKB 2IXPA 4LDQA 3Q6MA 3BXBA 2ZO7A 3VHTA 2CGEA 3CFFA 2F22A 2ZMWA 3LA1A 3ST2A 3UR3C 3G4ZA 5H87A 3GM1A 3NDBB 2Q6PA 2PNOA 3ZDLA 1RCPA 4P76A 3OEOA 4PACA 5A69A 2ARLA 1YHGA 1MMGA 1BZ4A 4W6SA 1A7EA 2HMQA 3WLDA 2KYHA 4IK1A 3FDQA 4MTGA 2EIKC 3I5PA 5COMA 4IK5A 3TK0A 4JRZA 4B5YA 2VVJA 2CYDA 5AC4A 4YWQA 1R4TA 1OCOC 2O29A 2J0WA 2OGRA 3SVRA 4K0DA 3EG9A 1ZYRF 5GPGB 5FVIA 2XLVA 5E3CA 3S84A 3PJ5A 1ZW2A 3KYJA 3PCVA 4OQWA 2CNWA 2YVKA 2G6YA 1Z6AA 2C03A 1GFLA 1W7SA 4O6YA 3GL4A 1GL4A 4WABA 4CS7A 5JLIA 3WAQA 4H47A 3J06A 1Z23A 3NMKA 2PXSA 1BDJB 1YLMA 2XXAB 4ULVA 3ABMC 4FWVA 2R05A 4JEAA 4OD5A 1U89A 4W6JA 1VB5A 2H7BA 4Q7TA 4YK5A 3ZUFA 3DQDA 4W6NA 4R6DA 4O7GA 2QLGB 2CCYA 2NUTB 4IWBA 1JPJA 3RWAA 4HQ9A 5DLJA 2G3DB 4E0IA 4LJDA 4YT5A 2H5OA 2WSOA 4C3EA 4JCHA 2L81A 4Q7CA 4BPMA 3SSTA 1T9KA 1HMDA 1RM9A 3O55A 4KF5A 3BRJA 5DQTA 3SG2A 2R7WA 3DD7A 4BDUA 1A41A 3RQGA 3AJMA 3GJ1A 3TULA 1T01A 4W6HA 4LJBA 4W8PA 2DUEA 3DXJF 3PJ7A 3P8UA 3VHTB 3NT3A 3QZCA 4HFFB 3FOPA 4Q7RA 3SXYA 4IK9A 4R6BA 4W7CA 1MMNA 4ORNA 4KW8A 3W4YA 3V3DA 4ZINA 5KYYB 5KYXB 3BXCA 3I19A 2AWKA 1YZCA 2AP3A 5JUAA 4DXNA 2Y69C 1F1MA 1OW6A 1WTYA 4DXMA 2C9JA 3IR8A 4CSAC 2HFCA 4KPIA 5B3IA 4KGEA 2KW3C 4J8AA 1A0BA 4OINF 1AUEA 2A1DD 3T6BA 4DVZA 1G4US 1O5HA 2A6HF 4EUKB 2R7RA 3EG9B 1ZUXA 1SYQA 3ITFA 2NPUA 4QDLA 3G9AA 4PR9A 1M2VB 1OW7A 3OSRA 1YA7O 3JYHA 2EPMX 3E5VA 3DQKA 2OOCA 1CGOA 1ZU5A 2OQMA 3AQBA 2H9WA 3EVRA 2EINC 5DS5A 4PFEA 1Q4CA 2EPKX 3W8IA 5LTQA 1ORJA 3ZIBA 1W2WA 5EK0A 4P6IC 2R7VA 3A11A 4W7DA 2FWQA 1E84A 2AWYA 4J30B 2R9RB 1M56C 4Z9IA 1W7TA 3ASNC 3NRHA 1NU9C 1OR3A 5FVFA 1WOLA 3V5YA 2Z15A 2Q7RA 3LAYA 3H2VA 3ZVRA 1EA8A 4DKMA 1M57C 1EMBA 3O39A 3QTHA 5HBDA 4ER9A 3DQOA 2W4MA 4JRBA 4XEFA 1TKNA 3LF4B 4D4XA 4PPJA 1C17M 1G7KA 5JSLA 2QRFA 4YJWA 3QW0A 2M4EA 4XVPA 3SSLA 2ZPAA 2GW4B 3B29A 4B30B 2UUIA 4Z9HA 1QYFA 1FFTC 4MTOA 3ZG1A 2DYSC 3UMKA 3GJ2A 3SV5A 2Y3BA 3WODF 5BQHA 3TOLA 2OKUA 4G0HA 3W2WA 1RKEA 4RYSA 4YN0B 3SXKA 2H6VA 2XL4A 4JTDB 2A48A 2QT2A 3AG3C 1ZU4A 3GM3A 1IW7F 2X51A 1YYXA 4XL5A 3ST3A 2FAPB 1H6RA 4W75A 5CI8A 5L0HA 3QVYA 5F5FA 4EIYA 5L0DA 3U3BA 3V5ZA 4LQTA 3SG4A 1V54C 2YQYA 1YHIA 4KW9A 2CDQA 1Q4EA 4MVZA 3DQ1A 4LW5A 5AQBB 3RVYA 4LACB 3R7CA 2X0CA 4CDYA 1J8YF 5HSWA 2FZUA 4DXWA 3Q7GA 3JZ0A 5T3WA 3JSEO 2VVIA 1TWHA 3SSKA 4IAQA 3H1OA 4IARA 4W76A 3U9MA 3Q6NA 2WZLA 3B0VC 3FHDA 4OJ0A 3NMIA 4IB4A 4I44A 1AEPA 1BR4A 3DQIA 2XM0A 3F47A 3X2QC 5BQLA 1S7ZA 4OIRF 4PJJA 5T3TA 5L3VA 4JEBA 2VAEA 4LQUA 2DD9A 2NSGA 3M22A 5JVEA 3PMRA 2R7UA 4L6RA 4MVOA 2AVKA 4G7OF 3BX9A 3AOUA 1CPRA 5DPIA 4KA9A 2VH3A 3C8ZA 3EGDA 4JJFA 3DQ4A 1Q0GA 2LCHA 1ZGQA 1GQAA 3VYWA 2HFIA 1FAPB 2ETSA 3EHMA 4J89A 4B6IA 3W8HA 2PBEA 4AS8A 3KH2A 1VTMP 4IJJA 2A69F 2YLDA 2YEVA 3U8PA 4PK4A 1VMAA 1OKKA 5LTPA 3ED8A 3GEEA 1T6QA 4LLCA 2QTVA 4ONSA 3LVCA 4YT8A 2HUJA 1Q0DA 3NMJA 4AE4A 2A50B 3C8GD 1TWAA 3JTLO 1M2OA 2QE9A 4CS9A 5DQBA 4AK9A 3ZTZA 1HUYA 4AX2A 3ZSUA 4LDKA 5DS6A 3K1KA 5EXCI 2IOQA 5A6JA 2VZXA 5IY5C 3PIBA 2NUPA 1NLXA 2DB4A 3EGXA 1MNDA 2DI3A 4DBRA 1S05A 1D1BA 2JPUA 4DVYP 4C7OA 1NFNA 2MWQA 2XL6A 3AI4A 5COFA 4CS8A 5FZTA 1XQMA 2RH7A 2O24A 1H4UA 4JW1A 4FX5A 3QMKA 3RYLA 4J7YA 3U0CA 3MYIA 4YT2A 2G6EA 4XOWA 2EMDA 2P6VA 3S0XA 2A52B 2BC5A 5H89A 3W1DA 2XLDA 3NG1A 3DPXA 3O78A 1CGNA 4A4AA 2J9WA 5JS5A 3O77A 5KYNA 1UISA 4G7HF 3SYNA 3GORA 2G2SB 3U0LA 1LM3B 4E17A 3DQ6A 1SF8A 4BJ5C 4GOBA 1QQ3A 1QPUA 3GEXA 1I5NA 5DY6A 3C8GA 1LI7A 3GWLA 2J9BA 2V26A 3PDMP 1XSSA 2R7SA 4JFGA 2GW3A 5JT4A 1MMDA 2XLWA 3SXMA 2UUHA 2H7OA 4ZF3A 4W6UA 3S29A 1WWPA 3LVDA 1YHHA 3DQ3A 3EKJA 1U6HA 3E5TA 4H3NA 3Q7LA 1XZQA 4ZBLA 2O9XA 2R7OA 4DXPA 4CIHA 3AQCA 2B3PA 1QVXA 3L34A 3TMRA 1YVIA 2GDCA 2G3VA 1TWCA 1HE1A 1Q0MA 1U0BB 1Z1PA 3OSQA 3TMTA 5BTTA 4JGEA 4N06A 3M79A 1VYKA 4GF6B 3KMIA 2YZSA 5LTRA 2VC9A 2Z1OA 1RMPA 3W2VA 3B9QA 3I5QA 4KNWA 3RF3A 1OXBA 4MW8A 3RWTA 2HCGA 4W6RA 4JTCB 3DQJA 1JC0A 2FFHA 5KYWA 2WHTA 4AE4B 1NZEA 4TZGA 3TJ6A 1BFPA 2G16B 4MVRA 4LJDC 2LQGA 1XAEA 1RJ9A 2E87A 1JC1A 2Q3TA 2DUGA 4KF5C 4CDAA 3VK1A 2V4EA 2NUPB 4X0RA 4CBEA 4U5GA 3DQ7A 4W6DA 3SXZA 1JMWA 4MVQA 2HJMA 3L8JA 4MVMA 2Y0GA 2OKWA 2OKYA 1WATA 3DQ8A 2YKZA 2WURA 3EK7A 3C18A 3KKBA 3B71A 2G62A 1KTMA 2Q57A 2A54B 2GX0A 3CD9A 2ZXRA 4O6NA 4XPXA 3RW0A 1YARO 4U2VA 2DYRC 4HEAJ 4W7RA 4L13A 1SR2A 4DJ9A 1VOMA 4U5EE 3U2MA 1DOVA 1H7IA 4GEHA 3U5SA 4KBLA 2XLMA 4KEXA 2B0HA 2KSFA 2R7XA 3GWNA 3RQEA 3DQHA 4ZF4A 5DTYA 4N6CA 1JBYA 2KQ9A 2H5RA 3GEHA 4L12A 1MYWA 1H6GA 1O3UA 4Q5SF 3AI5A 2L6HA 4PJMA 3MGFA 5B1BC 3C8GB 2YRFA 2PX3A 5DPJA 2OCCC 2W45A 2PXWA 3U0NA 2ZXWC 3U0MA 2G6XA 5H88A 2JX0A 2QLIA 1G4WR 4LLEA 3K66A 1YAUO 2HSQA 2QU1A 2AH8A 2WB7A 2Q00A 3DWWA 3W1CA 2ASRA 3C7JA 1WGWA 1GM5A 1OCZC 4AR7A 2DGJA 2WL8A 4Q7UA 4FESA 2HJOA 4U5BE 2IXOA 3DE8A 2YDZA 3DQUA 3RKOF 4BEMJ 2P7VA 4U9EA 1T5OA 5KYWB 1JRAA 1JR8A 4IZNA 4KI2A 1Z63A 4H4KC 1KYSA 3IEEA 3P28A 5L0GA 1ZHWA 1EMAA 1ORYA 3SS0A 3SSPA 3S9OA 2HRSA 3IQTA 3LS0A 2AWJA 3SG5A 1OCRC 2V4EB 3OA1A 3LSAA 5DPHA 1KU2A 3HJCA 3F46A 2EIJC 1Q4BA 5JP7A 1ST6A 3U0KA 2YL7A 3DAGA 3OWTA 4HE4A 2IM8A 1CV7A 4OIPF 4XLPF 3RQFA 3BEHA 3EVPA 4RDAA 3NF0A 1L3PA 4JC2A 3M15A 4P9TA 5E3AA 4XQ1A 2JD3A 4Z9JA 3SVEA 1NU7D 3K33A 2VCBA 2YLIA 1V55C 1Z1QA 3DQ9A 2NSFA 3VRCA 4XEKA 2OJKA 1LVKA 2XLEA 4NWSA 3SSYA 3DM9B 3VF0A 2H8AA 5KYUA 4OHSA 4N6HA 1HCJA 3PJBA 2EPLX 5AC5A 2QLEA 3EPVA 3LS3A 1T6UA 3QW1A 1MNEA 4W6FA 1JBZA 1OQCA 3NEDA 1FMWA 1YZWA 3UMHA 2DDDA 4DOZA 1EMEA 4JE9A 1TQGA 1BR1A 3CGLA 3TD7A 3R2PA 1MOVA 4CDVA 3IQ5A 2YFPA 4I3MA 3JRTA 1OXEA 3AG4C 1Z5ZA 2J0XA 2B3QA 4IGGA 3GANA 2G5ZB 3L1MA 4JKVA 4RYWA 3LEOA 1UFBA 2V3CC 2DUHA 5HZOA 1D1CA 3U8AA 2AWCA 4EBKA 3SRYA 3WLCA 3K1IA 1LPEA 3GEIA 4W6IA 2W9YA 3DKAA 3HTKC 3HNJA 1WN0A 1SZIA 1XMZA 3AG2C 1QKRA 2EMNA 4Z4KA 4IAOA 2Q9AA 5EB6A 1NBBA 2YLGA 3SP1A 2FGYA 2OJED 5A6KA 1OXFA 2G3KA 4CS9C 4Q4ZF 3U8CA 4NTBA 1OW8A 5EXUA 3HKKA 2D5RB 2QLAA 3DQLA 3EK8A 1EI7A 3POVA 1JPNA 2J7PD 2XSEA 1Y6DA 2IBFA 2Y39A 5L3QA 4W6CA 4L1IA 4W7XA 2XS8A 2M64A 3SEOA 3H1RA 3HNKA 4MTFA 2HQKA 4H54A 3EVVA 4CS8C 4OIOF 4I1MA 4KNVA 3FXHA 1PD1A 5E33A 4OY4A 3LEVA 4CJOA 3KYIA 1YZAA 4YT4A 3SVNA 5HV9A 2XLHA 1E2XA 5E2QA 3HLZA 5KYUB 5EHUA 4MVSA 4W7FA 4N3DA 2P61A 3H2UA 3RVZA 1D0YA 2HGDA 4NCQA 2C9IA 1BBHA 3NKEA 3B0UX 2P1AA 3B0PA 1HW1A 2HGYA 1F0BA 4E18A 4W77A 2XRHA 5L0CA 3EJNA 5BUOA 1OXDA 3T9OA 1APCA 1RKEB 1YJGA 2OEXA 5DTXA 5HZTA 5BQIA 5L0IA 3DJNB 4W69A 3O10A 2GAQA 2LD6A 3U2LA 2H5PA 5KTGA 4CIPA 3SVUA 2J7PA 2L6FA 5DRGA 3QVZA 2KK1A 4I1OB 4W6BA 3FVYA 2DDCA 2JADA 2A0UA 3IP2A 3K6BA 4EBBA 4JJGA 4UDVA 4NQFA 4HQ8A 4XLNF 5DTLA 2MYSA 1HY5A 1CGME 5HZUA 4JZAA 2AWMA 1LIHA 3S05A 4W6TA 1B9CA 3DPZA 2WSNA 2HV7A 4W7EA 2XLOA 1J8MF 1SMYF 4JURI 2O2BA 4DRHB 4LDRA 3ZTMA 3OGOA 2I8BA 4N4WA 4J7TA 2TMVP 3HNIA 1KNYA 2KC3A 1ZHXA 4FAPB 3CB9A 4BJTA 3CZ6A 2XXAA 4JTAB 3DQCA 1D0XA 1LS1A 1Q73A 4DKNA 1HMOA 1T6IA 3GM2A 2VVHA 1ZW3A 1OCCC 5F5HA 2V4EC 4CX9A 4EMQA 4W74A 2P0NA 1V4AA 4YL0A 3ABKC 3TOMA 1EMCA 2AU5A 3T6GB 2EPOA 2GA0A 3VM6A 2QLGA 1BR2A 3RIPA 2Y3GA 4EKWA 2I15A 3CQZA 4BJ6A 4WJ0A 3EGDB 3LVAA 5J2OA 2IOVA 1PD0A 1V74B 1ZHZA 4YL3A 3TJ5A 3DPWA 3U9JA 1W7UA 4MNDA 3VAYA 2R7QA 3DZAA 1Q0KA 1KYRA 2MHRA 2VCCA 4Z4MA 4TZAA 3SG3A 4DBQA 1I4ZA 3AKOA 5DRFA 1JOGA 1IZMA 1ZGPA 3UG0A 1TFKB 4Q9XA 5HZSA 4XTKA 1C02A 2J9UA 4EDSA 2WIQA 3ATPA 1K04A 3G50A 2HV6A 2W4BA 1Z3IX 4XGYA 3SVCA 4P1QA 3IPMO 3V5XA 3MLGA 1ZVZA 2EILC 4MVUA 1Z7Qc 3UFZA 5F28E 5KYXA 5KYYA 4OIQF 3ST0A 4EULA 2J45A 3N0TA 4F4BA 4DXQA 4M63A 4DXOA 5A6BD 3A8SA 4O79A 2R02A 1K40A 2Q9CA 1QYOA 2Z6YA 1GS9A 4NTFA 1E85A 3FOOA 3AGUA 3HNLA 2VB6A 3KPHA 1Q4AA 3ZULA 3EGXB 1I4YA 1Q4DA 5B3SC 4PPKA 4EHPA 4BJ5A 4I2YA 3CEXA 4C7OB 4G78A 2L9JA 2R25A 3CBEA 5K0IA 1E86A 3EFOA 1M2VA 4GESB 4ULWA 4ZIOA 2H7VC 1D0ZA 1E83A 2WVQA 1FTSA 2OU6A 2YL3A 2LIGA 1RMVA 4JF9A 3U3FA 2AWLA 2VASA 3E70C 1HW2A 1PV3A 5EB7A 4ZLDA 1Y4CA 1FR0A 4PFPA 1HE9A 3ZUJA 2L7AA 3M4BA 1QZXA 2J8WA 1RMOA 2QUPA 3CAXA 3EHNA 5FCLA 1KP5A 3O6XA 3UNGC 2Z6ZA 4W6AA 4XPYA 4KF4A 4OGSA 4HVFA 1OR2A 3L0IA 2LFFA 4IK4A 4PPLA 2IB6A 2QY9A 5A6BA 4HE8D 1TWGA 2DUFA 2QZ0A 1LS4A 2CW0F 3DQAA 2XM4A 3MBGA 3EH1A 3SVBA 2HJ3A 3LJBA 3DE9A 2HKVA 5A6AA 5F9GA 4CJGA 4P9FA 1G5ZA 2LFDA 1G8XA 1YDIA 3EH2A 4B30A 4GYTA 4WGYA 4HQCA 2H8QA 1VYIA 4NY3A 1EMFA 2A68F 1TR2A 5BTTB 1YYJA 3DQ2A 3K7DA 4H3MA 1ORSC 1F09A 2HSBA 3I4UA 2HQZA 1RXQA 3DM5A 2H5QA 3SNHA 1YJFA 4H48A 4U5HA 4U5FE 2ZXOA 2R7TA 4KGFA 2BL2A 1B68A 4W7AA 4BJ1A 5T3IA 2FL1A 4IRUA 1L7CA 1RJ9B 4EDOA 2A46A 3NKDA 1LKXA 3GODA 4MQ9F 1FFHA 3RH3A 2IXNA 2KNHA 5FVGA 3LNMB 3MX3A 4E7SA 3TQOA 5TJ5E 4UTSA 1TFOB 2IYLD 3DQ5A 1XA9A 3FAPB 3ST4A 4ZF5A 2OJQA 4IK8A 3X1OA 1MOUA 2A0BA 3A9CA 4QI0A 3C62A 3EFOB 2QNLA 1DOWA 1VLTA 1EMKA 5DTZA 1MQVA 2IXMA 4JVSA 3H65A 1O87A 2YE1A 1N1CA 4Q9WA 3LLKA 4KAGA 3SZRA 4H3LA 2ZMUA 2QLHA 3K1IC 2Y3HA 3DJUB 4XWJA 1LE4A 2IB5A 5AGFA 1XZPA 3RFYA 1NFOA 4W6PA 3SG6A 3M4CA 4KW4A 4U9DA 3NYJA 4W8KA 2Q4FA 1H9TA 2OTBA 3DQEA 3SSHA 1C03A 1Q0FA 3LESA 4DXIA 2WZFA 1RRXA 2OTEA 5BT0A 3N24A 2P4MA 3LS1A 3EZIA 3ZQVA 4D4NA 2PFDA 1KYPA 2EPNA 2HZ8A 2DUIA 2HMZA 5COGA 3BXAA 5JRAA 4C3BA 4CSAA 1MMAA 5B1AC 1S6ZA 1EKYA 2ZO6A 3UGOA 2HPWA 4W73A 1QSPA 3JSZA 3DAFA 3FMSA 5DU0A 4XEVA 4J88A 3VICA 5T1DB 4JC7A 1YA9A 4PJNA 5DPGA 4ZLCA 3CFHA 3NEZA 3EZHA 1YJ2A 3DI5A 4QI2A 2GWWA 2YL0A 4R32A 5EBJA 3LNRA 4EN1A 4MS2A 2ZXPA 4U5DE 3CD1A 3MYFA 3C63A 4OD4A 3S27A 4RTCA 4JCZA 2B0JA 3T6JA 1VK5A 4EWCA 2RD9A 4ZB1A 2LK4A 2A6EF 2J9VA 5L0JA 1EMLA 2NG1A 1LE2A 2RSEB 5HW9A 3PHF2 3ZC4A 2GX2A 4U5CE 5EGYA 2A56B 2WZGA 2WVNA 3JCUQ 4J32B 3MFNA 3NYMA 3ZWIA 3WHNA 3T4RA 4E0HA 3SVDA 2LP4A 3US6A 5DS4A 3EKHA 4W6MA 2ICWG 1OKKD 4EBJA 2Z6XA 3ABLC 3G4XA 4C3DA 1C4FA 1YFPA 4NC3A 1LI5A 1OXKA 4ANJA 1A7DA 4E7ZA 3JYYA 2WHUA 1ZZPA 4IK3A 2EIMC 4JEOA 2XL8A 5D91A 3ASOC 3NYLA 2KJGA 1PCXA 1ZHYA 256BA 3ZQYA 3KCTA 2VCAA 3LF3A 5L0FA 2OEVA 2R03A 3FAJA 3IQCA 4DRJB 1GGQA 2YL1A 1RKCA 2OG2A 3JRMO 1EMGA 1GGXA 4JIOA 1JAFA 1QYQA 1AVOB 4AL0A 3AGTA 3UGPA 2HS5A 3DQNA 3V7OA 3JT1A 4NTAA 2Q9BA 2EMOA 2J46A 5FHVA 2DD7A 4W72A 4DRIB 3WG7C 3DQFA 3EK4A 1EMMA 4A2NB 2A53B 3CFAA 5DQZA 5DVWA 2A47A 3SVSA 1WASA 1XWJA
chains in the Genus database with same CATH topology
1ZGPA 3GJ2A 4Q9XA 5DQMA 3SV5A 3UG0A 3W1CA 3KCSA 5HZSA 4EDSA 2WIQA 3TOLA 4AR7A 5LK4A 4ZFSA 4RYSA 4XGYA 3SVCA 2ICRA 4Q7UA 4P1QA 2HJOA 3DQMA 2H6VA 2A48A 2QT2A 3UFZA 3DE8A 3ST0A 4EULA 2POXA 4W6OA 2YDZA 3DQUA 1YYXA 3SVOA 4XL5A 3ST3A 4DXQA 1H6RA 4W75A 4DXOA 4U9EA 3QVYA 4EIYA 3A8SA 2Z6YA 1QYOA 3WCKA 4IZNA 5EJUA 1E85A 3FOOA 3HNLA 4LQTA 3SG4A 1KYSA 3P28A 1Q4AA 3E5WA 3ZULA 1EMAA 1YHIA 1Q4DA 4KW9A 1Q4EA 4LJCA 4LW5A 3DQ1A 4PPKA 5AQBB 3SS0A 3SSPA 2HRSA 1A7VA 2AWJA 4I2YA 4CDYA 3SG5A 2G3OA 2V4EB 2FZUA 3IQ6A 3CBEA 1E86A 3LSAA 4GESB 2VVIA 4ZIOA 5DPHA 2IE2A 1Q4BA 3SSKA 1E83A 5JP7A 4IAQA 3H1OA 2YL3A 4IARA 3U0KA 4JF9A 5HGEA 4W76A 3SSVA 2YL7A 2AWLA 1QXTA 4OJ0A 3NMIA 4HE4A 4IB4A 1CV7A 5EB7A 5EXBA 3EVPA 3SG7A 3DQIA 2XM0A 3NF0A 1QY3A 3ZUJA 4JC2A 3M15A 2WISA 5BQLA 3M4BA 4XOVA 2J8WA 1RMOA 4JEBA 2BTJA 3EVUA 1CPQA 3M24A 2VAEA 4LQUA 2DD9A 3GB3A 3SVEA 3M22A 5JVEA 1RMMA 1KP5A 2YLIA 2WHSA 4L6RA 1Z1QA 2Z6ZA 4W6AA 4OGSA 4KF4A 3BX9A 4HVFA 3DQ9A 1CPRA 3NT9A 5DPIA 4W6KA 1M6TA 3VRCA 4W6LA 4KA9A 3ZTFA 2OJKA 4IK4A 2XLEA 2AHAA 2IB6A 4NWSA 3DQ4A 3SSYA 4WGZA 2DUFA 2QZ0A 1ZGQA 4OHSA 1GQAA 3DQAA 2XM4A 4N6HA 1HCJA 3PJBA 4J89A 3SVBA 2QLEA 4AS8A 1ZGOA 3ADFA 3LS3A 3DE9A 3QW1A 4W6FA 5F9GA 2VADA 1JBZA 2YLDA 3NEDA 4CJGA 4W6GA 2YE0A 1YZWA 4B30A 3U8PA 2DDDA 1EMEA 3BXBA 2ZO7A 3VHTA 5LTPA 4JE9A 4WGYA 3ED8A 4HQCA 3CFFA 2H8QA 2ZMWA 3LA1A 3CGLA 1EMFA 3ST2A 3LVCA 5BTTB 1MOVA 5H87A 3NMJA 1YYJA 3DQ2A 4CDVA 2Q6PA 3IQ5A 4H3MA 1F09A 2A50B 2YFPA 2HQZA 1RCPA 4P76A 2ARLA 5DQBA 2H5QA 1YHGA 1OXEA 3ZTZA 4W6SA 1HUYA 1YJFA 4H48A 3WLDA 2B3QA 3K1KA 4KGFA 2G5ZB 4IK1A 3L1MA 4JKVA 4RYWA 5EXCI 4W7AA 2VZXA 5T3IA 2FL1A 3PIBA 2DUHA 4IK5A 5HZOA 4EDOA 2A46A 4B5YA 2VVJA 3U8AA 3SRYA 3WLCA 2O29A 2OGRA 3SVRA 4W6IA 5FVGA 3HNJA 1S05A 5FVIA 2XLVA 4UTSA 2XL6A 3PJ5A 3AI4A 3DQ5A 1XQMA 2RH7A 2O24A 1XA9A 1XMZA 1H4UA 4OQWA 2EMNA 4Z4KA 3ST4A 2G6YA 5EB6A 4ZF5A 1NBBA 1GFLA 1W7SA 2G6EA 2YLGA 4XOWA 4IK8A 3GL4A 1MOUA 2EMDA 1OXFA 1GL4A 3C62A 2A52B 2BC5A 5JLIA 3U8CA 5EXUA 5H89A 3W1DA 1EMKA 2XLDA 3DPXA 3O78A 5DTZA 1CGNA 1MQVA 4H47A 5JS5A 3O77A 3NMKA 1UISA 2PXSA 2QLAA 3DQLA 3EK8A 4ULVA 2G2SB 2YE1A 3U0LA 4Q9WA 1LM3B 4KAGA 4H3LA 4JEAA 2ZMUA 2QLHA 3DQ6A 4W6JA 2IB5A 5AGFA 4GOBA 1QPUA 1QQ3A 3GEXA 4Q7TA 4W6CA 4W6PA 3SG6A 5DY6A 3ZUFA 3M4CA 4KW4A 4L1IA 4W7XA 3DQDA 2J9BA 4U9DA 4W6NA 1XSSA 4R6DA 3H1RA 3HNKA 2OTBA 3DQEA 2HQKA 4JFGA 3SSHA 3EVVA 2GW3A 5JT4A 4DXIA 2XLWA 2QLGB 1RRXA 2CCYA 2OTEA 5BT0A 4ZF3A 4OY4A 4W6UA 3LVDA 3RWAA 4HQ9A 1YHHA 2G3DB 2P4MA 3DQ3A 4LJDA 4CJOA 1YZAA 3EKJA 2H5OA 2WSOA 3E5TA 4H3NA 3SVNA 3ZQVA 4D4NA 2XLHA 1KYPA 4ZBLA 3SSTA 5EHUA 2DUIA 3BXAA 4DXPA 5JRAA 1RM9A 4KF5A 1S6ZA 4W7FA 1EKYA 4N3DA 3SG2A 2B3PA 2ZO6A 2HPWA 2HGDA 4W73A 4BDUA 2C9IA 1BBHA 3TMRA 5DU0A 3GJ1A 4J88A 3VICA 4W6HA 4LJBA 1Z1PA 3TMTA 3OSQA 5DPGA 2HGYA 4JGEA 2DUEA 3PJ7A 5BTTA 3M79A 3CFHA 1F0BA 3NEZA 1YJ2A 3P8UA 4GF6B 4W77A 3VHTB 5LTRA 2Z1OA 3NT3A 1OXDA 1RMPA 3FOPA 2YL0A 4Q7RA 5EBJA 1APCA 4EN1A 4IK9A 5DTXA 3RWTA 5HZTA 3CD1A 4R6BA 4W7CA 2HCGA 4W6RA 4ORNA 4W69A 4KW8A 3DQJA 1JC0A 3C63A 3V3DA 2WHTA 4ZINA 4RTCA 4TZGA 1BFPA 2H5PA 2G16B 5KTGA 4LJDC 3BXCA 4CIPA 3I19A 3SVUA 2AWKA 1YZCA 5JUAA 4ZB1A 1XAEA 4DXNA 5DRGA 3QVZA 1JC1A 4DXMA 4W6BA 2C9JA 2DDCA 2JADA 1EMLA 2DUGA 3IR8A 2HFCA 5HW9A 4KPIA 4KF5C 4CDAA 2GX2A 3IP2A 5B3IA 4KGEA 3VK1A 2V4EA 4J8AA 4HQ8A 2A56B 3DQ7A 4W6DA 5DTLA 3ZWIA 2Y0GA 2OKWA 2OKYA 3SVDA 5HZUA 2AWMA 3DQ8A 1ZUXA 3S05A 2YKZA 3EKHA 2WURA 1B9CA 4W6MA 3DPZA 3G9AA 3EK7A 4W6TA 2WSNA 4W7EA 2XLOA 2Z6XA 2O2BA 2Q57A 3OSRA 1C4FA 2A54B 2GX0A 3CD9A 3ZTMA 1YFPA 4NC3A 3E5VA 3DQKA 3OGOA 4U2VA 4ANJA 4N4WA 2WHUA 4IK3A 3HNIA 4W7RA 4L13A 1CGOA 4JEOA 2XL8A 3CB9A 3DQCA 2H9WA 3EVRA 256BA 2XLMA 3ZQYA 1Q73A 4KEXA 4DKNA 3KCTA 4PFEA 1Q4CA 5LTQA 3DQHA 3LF3A 4ZF4A 5DTYA 2VVHA 1JBYA 2H5RA 2V4EC 4W7DA 2FWQA 1E84A 4L12A 4CX9A 1MYWA 4EMQA 4W74A 1W7TA 2YL1A 3AI5A 3TOMA 1EMCA 5FVFA 2QLGA 3MGFA 1EMGA 1GGXA 3LVAA 5J2OA 1JAFA 1QYQA 2IOVA 5DPJA 4DKMA 1EMBA 2PXWA 5HBDA 4ER9A 3U0NA 3DQOA 3DQNA 4JRBA 2G6XA 3DPWA 3U0MA 5H88A 1W7UA 2QLIA 3LF4B 4D4XA 4PPJA 2EMOA 1G7KA 5FHVA 5JSLA 2QRFA 2DD7A 3QW0A 3SSLA 4XVPA 4W72A 3DQFA 3EK4A 1EMMA 1KYRA 2GW4B 2A53B 2QU1A 4B30B 3CFAA 4Z4MA 2AH8A 4TZAA 3SG3A 2A47A 3SVSA 3AKOA 1QYFA 5DRFA 4PPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGP A;  3GJ2 A;  4Q9X A;  5DQM A;  3SV5 A;  3UG0 A;  3W1C A;  3KCS A;  5HZS A;  4EDS A;  2WIQ A;  3TOL A;  4AR7 A;  5LK4 A;  4ZFS A;  4RYS A;  4XGY A;  3SVC A;  2ICR A;  4Q7U A;  4P1Q A;  2HJO A;  3DQM A;  2H6V A;  2A48 A;  2QT2 A;  3UFZ A;  3DE8 A;  3ST0 A;  4EUL A;  2POX A;  4W6O A;  2YDZ A;  3DQU A;  1YYX A;  3SVO A;  4XL5 A;  3ST3 A;  4DXQ A;  1H6R A;  4W75 A;  4DXO A;  4U9E A;  3QVY A;  4EIY A;  3A8S A;  2Z6Y A;  1QYO A;  3WCK A;  4IZN A;  5EJU A;  1E85 A;  3FOO A;  3HNL A;  4LQT A;  3SG4 A;  1KYS A;  3P28 A;  1Q4A A;  3E5W A;  3ZUL A;  1EMA A;  1YHI A;  1Q4D A;  4KW9 A;  1Q4E A;  4LJC A;  4LW5 A;  3DQ1 A;  4PPK A;  5AQB B;  3SS0 A;  3SSP A;  2HRS A;  1A7V A;  2AWJ A;  4I2Y A;  4CDY A;  3SG5 A;  2G3O A;  2V4E B;  2FZU A;  3IQ6 A;  3CBE A;  1E86 A;  3LSA A;  4GES B;  2VVI A;  4ZIO A;  5DPH A;  2IE2 A;  1Q4B A;  3SSK A;  1E83 A;  5JP7 A;  4IAQ A;  3H1O A;  2YL3 A;  4IAR A;  3U0K A;  4JF9 A;  5HGE A;  4W76 A;  3SSV A;  2YL7 A;  2AWL A;  1QXT A;  4OJ0 A;  3NMI A;  4HE4 A;  4IB4 A;  1CV7 A;  5EB7 A;  5EXB A;  3EVP A;  3SG7 A;  3DQI A;  2XM0 A;  3NF0 A;  1QY3 A;  3ZUJ A;  4JC2 A;  3M15 A;  2WIS A;  5BQL A;  3M4B A;  4XOV A;  2J8W A;  1RMO A;  4JEB A;  2BTJ A;  3EVU A;  1CPQ A;  3M24 A;  2VAE A;  4LQU A;  2DD9 A;  3GB3 A;  3SVE A;  3M22 A;  5JVE A;  1RMM A;  1KP5 A;  2YLI A;  2WHS A;  4L6R A;  1Z1Q A;  2Z6Z A;  4W6A A;  4OGS A;  4KF4 A;  3BX9 A;  4HVF A;  3DQ9 A;  1CPR A;  3NT9 A;  5DPI A;  4W6K A;  1M6T A;  3VRC A;  4W6L A;  4KA9 A;  3ZTF A;  2OJK A;  4IK4 A;  2XLE A;  2AHA A;  2IB6 A;  4NWS A;  3DQ4 A;  3SSY A;  4WGZ A;  2DUF A;  2QZ0 A;  1ZGQ A;  4OHS A;  1GQA A;  3DQA A;  2XM4 A;  4N6H A;  1HCJ A;  3PJB A;  4J89 A;  3SVB A;  2QLE A;  4AS8 A;  1ZGO A;  3ADF A;  3LS3 A;  3DE9 A;  3QW1 A;  4W6F A;  5F9G A;  2VAD A;  1JBZ A;  2YLD A;  3NED A;  4CJG A;  4W6G A;  2YE0 A;  1YZW A;  4B30 A;  3U8P A;  2DDD A;  1EME A;  3BXB A;  2ZO7 A;  3VHT A;  5LTP A;  4JE9 A;  4WGY A;  3ED8 A;  4HQC A;  3CFF A;  2H8Q A;  2ZMW A;  3LA1 A;  3CGL A;  1EMF A;  3ST2 A;  3LVC A;  5BTT B;  1MOV A;  5H87 A;  3NMJ A;  1YYJ A;  3DQ2 A;  4CDV A;  2Q6P A;  3IQ5 A;  4H3M A;  1F09 A;  2A50 B;  2YFP A;  2HQZ A;  1RCP A;  4P76 A;  2ARL A;  5DQB A;  2H5Q A;  1YHG A;  1OXE A;  3ZTZ A;  4W6S A;  1HUY A;  1YJF A;  4H48 A;  3WLD A;  2B3Q A;  3K1K A;  4KGF A;  2G5Z B;  4IK1 A;  3L1M A;  4JKV A;  4RYW A;  5EXC I;  4W7A A;  2VZX A;  5T3I A;  2FL1 A;  3PIB A;  2DUH A;  4IK5 A;  5HZO A;  4EDO A;  2A46 A;  4B5Y A;  2VVJ A;  3U8A A;  3SRY A;  3WLC A;  2O29 A;  2OGR A;  3SVR A;  4W6I A;  5FVG A;  3HNJ A;  1S05 A;  5FVI A;  2XLV A;  4UTS A;  2XL6 A;  3PJ5 A;  3AI4 A;  3DQ5 A;  1XQM A;  2RH7 A;  2O24 A;  1XA9 A;  1XMZ A;  1H4U A;  4OQW A;  2EMN A;  4Z4K A;  3ST4 A;  2G6Y A;  5EB6 A;  4ZF5 A;  1NBB A;  1GFL A;  1W7S A;  2G6E A;  2YLG A;  4XOW A;  4IK8 A;  3GL4 A;  1MOU A;  2EMD A;  1OXF A;  1GL4 A;  3C62 A;  2A52 B;  2BC5 A;  5JLI A;  3U8C A;  5EXU A;  5H89 A;  3W1D A;  1EMK A;  2XLD A;  3DPX A;  3O78 A;  5DTZ A;  1CGN A;  1MQV A;  4H47 A;  5JS5 A;  3O77 A;  3NMK A;  1UIS A;  2PXS A;  2QLA A;  3DQL A;  3EK8 A;  4ULV A;  2G2S B;  2YE1 A;  3U0L A;  4Q9W A;  1LM3 B;  4KAG A;  4H3L A;  4JEA A;  2ZMU A;  2QLH A;  3DQ6 A;  4W6J A;  2IB5 A;  5AGF A;  4GOB A;  1QPU A;  1QQ3 A;  3GEX A;  4Q7T A;  4W6C A;  4W6P A;  3SG6 A;  5DY6 A;  3ZUF A;  3M4C A;  4KW4 A;  4L1I A;  4W7X A;  3DQD A;  2J9B A;  4U9D A;  4W6N A;  1XSS A;  4R6D A;  3H1R A;  3HNK A;  2OTB A;  3DQE A;  2HQK A;  4JFG A;  3SSH A;  3EVV A;  2GW3 A;  5JT4 A;  4DXI A;  2XLW A;  2QLG B;  1RRX A;  2CCY A;  2OTE A;  5BT0 A;  4ZF3 A;  4OY4 A;  4W6U A;  3LVD A;  3RWA A;  4HQ9 A;  1YHH A;  2G3D B;  2P4M A;  3DQ3 A;  4LJD A;  4CJO A;  1YZA A;  3EKJ A;  2H5O A;  2WSO A;  3E5T A;  4H3N A;  3SVN A;  3ZQV A;  4D4N A;  2XLH A;  1KYP A;  4ZBL A;  3SST A;  5EHU A;  2DUI A;  3BXA A;  4DXP A;  5JRA A;  1RM9 A;  4KF5 A;  1S6Z A;  4W7F A;  1EKY A;  4N3D A;  3SG2 A;  2B3P A;  2ZO6 A;  2HPW A;  2HGD A;  4W73 A;  4BDU A;  2C9I A;  1BBH A;  3TMR A;  5DU0 A;  3GJ1 A;  4J88 A;  3VIC A;  4W6H A;  4LJB A;  1Z1P A;  3TMT A;  3OSQ A;  5DPG A;  2HGY A;  4JGE A;  2DUE A;  3PJ7 A;  5BTT A;  3M79 A;  3CFH A;  1F0B A;  3NEZ A;  1YJ2 A;  3P8U A;  4GF6 B;  4W77 A;  3VHT B;  5LTR A;  2Z1O A;  3NT3 A;  1OXD A;  1RMP A;  3FOP A;  2YL0 A;  4Q7R A;  5EBJ A;  1APC A;  4EN1 A;  4IK9 A;  5DTX A;  3RWT A;  5HZT A;  3CD1 A;  4R6B A;  4W7C A;  2HCG A;  4W6R A;  4ORN A;  4W69 A;  4KW8 A;  3DQJ A;  1JC0 A;  3C63 A;  3V3D A;  2WHT A;  4ZIN A;  4RTC A;  4TZG A;  1BFP A;  2H5P A;  2G16 B;  5KTG A;  4LJD C;  3BXC A;  4CIP A;  3I19 A;  3SVU A;  2AWK A;  1YZC A;  5JUA A;  4ZB1 A;  1XAE A;  4DXN A;  5DRG A;  3QVZ A;  1JC1 A;  4DXM A;  4W6B A;  2C9J A;  2DDC A;  2JAD A;  1EML A;  2DUG A;  3IR8 A;  2HFC A;  5HW9 A;  4KPI A;  4KF5 C;  4CDA A;  2GX2 A;  3IP2 A;  5B3I A;  4KGE A;  3VK1 A;  2V4E A;  4J8A A;  4HQ8 A;  2A56 B;  3DQ7 A;  4W6D A;  5DTL A;  3ZWI A;  2Y0G A;  2OKW A;  2OKY A;  3SVD A;  5HZU A;  2AWM A;  3DQ8 A;  1ZUX A;  3S05 A;  2YKZ A;  3EKH A;  2WUR A;  1B9C A;  4W6M A;  3DPZ A;  3G9A A;  3EK7 A;  4W6T A;  2WSN A;  4W7E A;  2XLO A;  2Z6X A;  2O2B A;  2Q57 A;  3OSR A;  1C4F A;  2A54 B;  2GX0 A;  3CD9 A;  3ZTM A;  1YFP A;  4NC3 A;  3E5V A;  3DQK A;  3OGO A;  4U2V A;  4ANJ A;  4N4W A;  2WHU A;  4IK3 A;  3HNI A;  4W7R A;  4L13 A;  1CGO A;  4JEO A;  2XL8 A;  3CB9 A;  3DQC A;  2H9W A;  3EVR A;  256B A;  2XLM A;  3ZQY A;  1Q73 A;  4KEX A;  4DKN A;  3KCT A;  4PFE A;  1Q4C A;  5LTQ A;  3DQH A;  3LF3 A;  4ZF4 A;  5DTY A;  2VVH A;  1JBY A;  2H5R A;  2V4E C;  4W7D A;  2FWQ A;  1E84 A;  4L12 A;  4CX9 A;  1MYW A;  4EMQ A;  4W74 A;  1W7T A;  2YL1 A;  3AI5 A;  3TOM A;  1EMC A;  5FVF A;  2QLG A;  3MGF A;  1EMG A;  1GGX A;  3LVA A;  5J2O A;  1JAF A;  1QYQ A;  2IOV A;  5DPJ A;  4DKM A;  1EMB A;  2PXW A;  5HBD A;  4ER9 A;  3U0N A;  3DQO A;  3DQN A;  4JRB A;  2G6X A;  3DPW A;  3U0M A;  5H88 A;  1W7U A;  2QLI A;  3LF4 B;  4D4X A;  4PPJ A;  2EMO A;  1G7K A;  5FHV A;  5JSL A;  2QRF A;  2DD7 A;  3QW0 A;  3SSL A;  4XVP A;  4W72 A;  3DQF A;  3EK4 A;  1EMM A;  1KYR A;  2GW4 B;  2A53 B;  2QU1 A;  4B30 B;  3CFA A;  4Z4M A;  2AH8 A;  4TZA A;  3SG3 A;  2A47 A;  3SVS A;  3AKO A;  1QYF A;  5DRF A;  4PPL A; 
#chains in the Genus database with same CATH topology
 3S90 A;  2L6G A;  4RD9 A;  5DQM A;  2LSE A;  3KCS A;  5LK4 A;  3DMD A;  4ZFS A;  3AG1 C;  2ICR A;  3L8I A;  3DQM A;  1VLS A;  3U8V A;  5EHH A;  4BJ6 C;  3EQL F;  5BQG A;  2POX A;  4W6O A;  2BE5 F;  2XS1 A;  4XPW A;  3SVO A;  4O6M A;  3M1C B;  4RBN A;  1R5I D;  3WCK A;  5EJU A;  3E9V A;  2PX0 A;  3N2Z B;  3E5W A;  4BEJ A;  3KL4 A;  3LUT B;  4G7Z F;  4AL1 A;  1FMV A;  1H9G A;  4LJC A;  2YHS A;  1A7V A;  4K7B A;  2G3O A;  3IQ6 A;  4GQH A;  4PFO A;  1D1A A;  3S28 A;  3K1H A;  3LLI A;  2IE2 A;  3IHU A;  2YWA A;  2ZD9 A;  3ECS A;  5HGE A;  4BG0 A;  3SSV A;  4LER A;  4K1O A;  2D4U A;  1QXT A;  3UMI A;  3CSK A;  2C04 A;  5EXB A;  3SG7 A;  1EQ1 A;  4KC9 A;  1QY3 A;  4YL1 A;  2WIS A;  5D92 A;  4XOV A;  2Y3D A;  1NSG B;  2BTJ A;  3EVU A;  1CPQ A;  1NG1 A;  3M24 A;  3GB3 A;  1RMM A;  4PJL A;  1QLE C;  5CI9 A;  2WHS A;  2NUT A;  2PP4 A;  2PF4 E;  3NT9 A;  4W6K A;  1M6T A;  4W6L A;  3ZTF A;  2AHA A;  4MW3 A;  4WGZ A;  2WVO A;  2CNW D;  1ZGO A;  3ADF A;  5CIV A;  2KGO A;  1UG7 A;  2VAD A;  1ZHT A;  2GFH A;  4W6G A;  2YE0 A;  1K05 A;  1FNT c;  4HFK B;  2IXP A;  4LDQ A;  3Q6M A;  3BXB A;  2ZO7 A;  3VHT A;  2CGE A;  3CFF A;  2F22 A;  2ZMW A;  3LA1 A;  3ST2 A;  3UR3 C;  3G4Z A;  5H87 A;  3GM1 A;  3NDB B;  2Q6P A;  2PNO A;  3ZDL A;  1RCP A;  4P76 A;  3OEO A;  4PAC A;  5A69 A;  2ARL A;  1YHG A;  1MMG A;  1BZ4 A;  4W6S A;  1A7E A;  2HMQ A;  3WLD A;  2KYH A;  4IK1 A;  3FDQ A;  4MTG A;  2EIK C;  3I5P A;  5COM A;  4IK5 A;  3TK0 A;  4JRZ A;  4B5Y A;  2VVJ A;  2CYD A;  5AC4 A;  4YWQ A;  1R4T A;  1OCO C;  2O29 A;  2J0W A;  2OGR A;  3SVR A;  4K0D A;  3EG9 A;  1ZYR F;  5GPG B;  5FVI A;  2XLV A;  5E3C A;  3S84 A;  3PJ5 A;  1ZW2 A;  3KYJ A;  3PCV A;  4OQW A;  2CNW A;  2YVK A;  2G6Y A;  1Z6A A;  2C03 A;  1GFL A;  1W7S A;  4O6Y A;  3GL4 A;  1GL4 A;  4WAB A;  4CS7 A;  5JLI A;  3WAQ A;  4H47 A;  3J06 A;  1Z23 A;  3NMK A;  2PXS A;  1BDJ B;  1YLM A;  2XXA B;  4ULV A;  3ABM C;  4FWV A;  2R05 A;  4JEA A;  4OD5 A;  1U89 A;  4W6J A;  1VB5 A;  2H7B A;  4Q7T A;  4YK5 A;  3ZUF A;  3DQD A;  4W6N A;  4R6D A;  4O7G A;  2QLG B;  2CCY A;  2NUT B;  4IWB A;  1JPJ A;  3RWA A;  4HQ9 A;  5DLJ A;  2G3D B;  4E0I A;  4LJD A;  4YT5 A;  2H5O A;  2WSO A;  4C3E A;  4JCH A;  2L81 A;  4Q7C A;  4BPM A;  3SST A;  1T9K A;  1HMD A;  1RM9 A;  3O55 A;  4KF5 A;  3BRJ A;  5DQT A;  3SG2 A;  2R7W A;  3DD7 A;  4BDU A;  1A41 A;  3RQG A;  3AJM A;  3GJ1 A;  3TUL A;  1T01 A;  4W6H A;  4LJB A;  4W8P A;  2DUE A;  3DXJ F;  3PJ7 A;  3P8U A;  3VHT B;  3NT3 A;  3QZC A;  4HFF B;  3FOP A;  4Q7R A;  3SXY A;  4IK9 A;  4R6B A;  4W7C A;  1MMN A;  4ORN A;  4KW8 A;  3W4Y A;  3V3D A;  4ZIN A;  5KYY B;  5KYX B;  3BXC A;  3I19 A;  2AWK A;  1YZC A;  2AP3 A;  5JUA A;  4DXN A;  2Y69 C;  1F1M A;  1OW6 A;  1WTY A;  4DXM A;  2C9J A;  3IR8 A;  4CSA C;  2HFC A;  4KPI A;  5B3I A;  4KGE A;  2KW3 C;  4J8A A;  1A0B A;  4OIN F;  1AUE A;  2A1D D;  3T6B A;  4DVZ A;  1G4U S;  1O5H A;  2A6H F;  4EUK B;  2R7R A;  3EG9 B;  1ZUX A;  1SYQ A;  3ITF A;  2NPU A;  4QDL A;  3G9A A;  4PR9 A;  1M2V B;  1OW7 A;  3OSR A;  1YA7 O;  3JYH A;  2EPM X;  3E5V A;  3DQK A;  2OOC A;  1CGO A;  1ZU5 A;  2OQM A;  3AQB A;  2H9W A;  3EVR A;  2EIN C;  5DS5 A;  4PFE A;  1Q4C A;  2EPK X;  3W8I A;  5LTQ A;  1ORJ A;  3ZIB A;  1W2W A;  5EK0 A;  4P6I C;  2R7V A;  3A11 A;  4W7D A;  2FWQ A;  1E84 A;  2AWY A;  4J30 B;  2R9R B;  1M56 C;  4Z9I A;  1W7T A;  3ASN C;  3NRH A;  1NU9 C;  1OR3 A;  5FVF A;  1WOL A;  3V5Y A;  2Z15 A;  2Q7R A;  3LAY A;  3H2V A;  3ZVR A;  1EA8 A;  4DKM A;  1M57 C;  1EMB A;  3O39 A;  3QTH A;  5HBD A;  4ER9 A;  3DQO A;  2W4M A;  4JRB A;  4XEF A;  1TKN A;  3LF4 B;  4D4X A;  4PPJ A;  1C17 M;  1G7K A;  5JSL A;  2QRF A;  4YJW A;  3QW0 A;  2M4E A;  4XVP A;  3SSL A;  2ZPA A;  2GW4 B;  3B29 A;  4B30 B;  2UUI A;  4Z9H A;  1QYF A;  1FFT C;  4MTO A;  3ZG1 A;  2DYS C;  3UMK A;  3GJ2 A;  3SV5 A;  2Y3B A;  3WOD F;  5BQH A;  3TOL A;  2OKU A;  4G0H A;  3W2W A;  1RKE A;  4RYS A;  4YN0 B;  3SXK A;  2H6V A;  2XL4 A;  4JTD B;  2A48 A;  2QT2 A;  3AG3 C;  1ZU4 A;  3GM3 A;  1IW7 F;  2X51 A;  1YYX A;  4XL5 A;  3ST3 A;  2FAP B;  1H6R A;  4W75 A;  5CI8 A;  5L0H A;  3QVY A;  5F5F A;  4EIY A;  5L0D A;  3U3B A;  3V5Z A;  4LQT A;  3SG4 A;  1V54 C;  2YQY A;  1YHI A;  4KW9 A;  2CDQ A;  1Q4E A;  4MVZ A;  3DQ1 A;  4LW5 A;  5AQB B;  3RVY A;  4LAC B;  3R7C A;  2X0C A;  4CDY A;  1J8Y F;  5HSW A;  2FZU A;  4DXW A;  3Q7G A;  3JZ0 A;  5T3W A;  3JSE O;  2VVI A;  1TWH A;  3SSK A;  4IAQ A;  3H1O A;  4IAR A;  4W76 A;  3U9M A;  3Q6N A;  2WZL A;  3B0V C;  3FHD A;  4OJ0 A;  3NMI A;  4IB4 A;  4I44 A;  1AEP A;  1BR4 A;  3DQI A;  2XM0 A;  3F47 A;  3X2Q C;  5BQL A;  1S7Z A;  4OIR F;  4PJJ A;  5T3T A;  5L3V A;  4JEB A;  2VAE A;  4LQU A;  2DD9 A;  2NSG A;  3M22 A;  5JVE A;  3PMR A;  2R7U A;  4L6R A;  4MVO A;  2AVK A;  4G7O F;  3BX9 A;  3AOU A;  1CPR A;  5DPI A;  4KA9 A;  2VH3 A;  3C8Z A;  3EGD A;  4JJF A;  3DQ4 A;  1Q0G A;  2LCH A;  1ZGQ A;  1GQA A;  3VYW A;  2HFI A;  1FAP B;  2ETS A;  3EHM A;  4J89 A;  4B6I A;  3W8H A;  2PBE A;  4AS8 A;  3KH2 A;  1VTM P;  4IJJ A;  2A69 F;  2YLD A;  2YEV A;  3U8P A;  4PK4 A;  1VMA A;  1OKK A;  5LTP A;  3ED8 A;  3GEE A;  1T6Q A;  4LLC A;  2QTV A;  4ONS A;  3LVC A;  4YT8 A;  2HUJ A;  1Q0D A;  3NMJ A;  4AE4 A;  2A50 B;  3C8G D;  1TWA A;  3JTL O;  1M2O A;  2QE9 A;  4CS9 A;  5DQB A;  4AK9 A;  3ZTZ A;  1HUY A;  4AX2 A;  3ZSU A;  4LDK A;  5DS6 A;  3K1K A;  5EXC I;  2IOQ A;  5A6J A;  2VZX A;  5IY5 C;  3PIB A;  2NUP A;  1NLX A;  2DB4 A;  3EGX A;  1MND A;  2DI3 A;  4DBR A;  1S05 A;  1D1B A;  2JPU A;  4DVY P;  4C7O A;  1NFN A;  2MWQ A;  2XL6 A;  3AI4 A;  5COF A;  4CS8 A;  5FZT A;  1XQM A;  2RH7 A;  2O24 A;  1H4U A;  4JW1 A;  4FX5 A;  3QMK A;  3RYL A;  4J7Y A;  3U0C A;  3MYI A;  4YT2 A;  2G6E A;  4XOW A;  2EMD A;  2P6V A;  3S0X A;  2A52 B;  2BC5 A;  5H89 A;  3W1D A;  2XLD A;  3NG1 A;  3DPX A;  3O78 A;  1CGN A;  4A4A A;  2J9W A;  5JS5 A;  3O77 A;  5KYN A;  1UIS A;  4G7H F;  3SYN A;  3GOR A;  2G2S B;  3U0L A;  1LM3 B;  4E17 A;  3DQ6 A;  1SF8 A;  4BJ5 C;  4GOB A;  1QQ3 A;  1QPU A;  3GEX A;  1I5N A;  5DY6 A;  3C8G A;  1LI7 A;  3GWL A;  2J9B A;  2V26 A;  3PDM P;  1XSS A;  2R7S A;  4JFG A;  2GW3 A;  5JT4 A;  1MMD A;  2XLW A;  3SXM A;  2UUH A;  2H7O A;  4ZF3 A;  4W6U A;  3S29 A;  1WWP A;  3LVD A;  1YHH A;  3DQ3 A;  3EKJ A;  1U6H A;  3E5T A;  4H3N A;  3Q7L A;  1XZQ A;  4ZBL A;  2O9X A;  2R7O A;  4DXP A;  4CIH A;  3AQC A;  2B3P A;  1QVX A;  3L34 A;  3TMR A;  1YVI A;  2GDC A;  2G3V A;  1TWC A;  1HE1 A;  1Q0M A;  1U0B B;  1Z1P A;  3OSQ A;  3TMT A;  5BTT A;  4JGE A;  4N06 A;  3M79 A;  1VYK A;  4GF6 B;  3KMI A;  2YZS A;  5LTR A;  2VC9 A;  2Z1O A;  1RMP A;  3W2V A;  3B9Q A;  3I5Q A;  4KNW A;  3RF3 A;  1OXB A;  4MW8 A;  3RWT A;  2HCG A;  4W6R A;  4JTC B;  3DQJ A;  1JC0 A;  2FFH A;  5KYW A;  2WHT A;  4AE4 B;  1NZE A;  4TZG A;  3TJ6 A;  1BFP A;  2G16 B;  4MVR A;  4LJD C;  2LQG A;  1XAE A;  1RJ9 A;  2E87 A;  1JC1 A;  2Q3T A;  2DUG A;  4KF5 C;  4CDA A;  3VK1 A;  2V4E A;  2NUP B;  4X0R A;  4CBE A;  4U5G A;  3DQ7 A;  4W6D A;  3SXZ A;  1JMW A;  4MVQ A;  2HJM A;  3L8J A;  4MVM A;  2Y0G A;  2OKW A;  2OKY A;  1WAT A;  3DQ8 A;  2YKZ A;  2WUR A;  3EK7 A;  3C18 A;  3KKB A;  3B71 A;  2G62 A;  1KTM A;  2Q57 A;  2A54 B;  2GX0 A;  3CD9 A;  2ZXR A;  4O6N A;  4XPX A;  3RW0 A;  1YAR O;  4U2V A;  2DYR C;  4HEA J;  4W7R A;  4L13 A;  1SR2 A;  4DJ9 A;  1VOM A;  4U5E E;  3U2M A;  1DOV A;  1H7I A;  4GEH A;  3U5S A;  4KBL A;  2XLM A;  4KEX A;  2B0H A;  2KSF A;  2R7X A;  3GWN A;  3RQE A;  3DQH A;  4ZF4 A;  5DTY A;  4N6C A;  1JBY A;  2KQ9 A;  2H5R A;  3GEH A;  4L12 A;  1MYW A;  1H6G A;  1O3U A;  4Q5S F;  3AI5 A;  2L6H A;  4PJM A;  3MGF A;  5B1B C;  3C8G B;  2YRF A;  2PX3 A;  5DPJ A;  2OCC C;  2W45 A;  2PXW A;  3U0N A;  2ZXW C;  3U0M A;  2G6X A;  5H88 A;  2JX0 A;  2QLI A;  1G4W R;  4LLE A;  3K66 A;  1YAU O;  2HSQ A;  2QU1 A;  2AH8 A;  2WB7 A;  2Q00 A;  3DWW A;  3W1C A;  2ASR A;  3C7J A;  1WGW A;  1GM5 A;  1OCZ C;  4AR7 A;  2DGJ A;  2WL8 A;  4Q7U A;  4FES A;  2HJO A;  4U5B E;  2IXO A;  3DE8 A;  2YDZ A;  3DQU A;  3RKO F;  4BEM J;  2P7V A;  4U9E A;  1T5O A;  5KYW B;  1JRA A;  1JR8 A;  4IZN A;  4KI2 A;  1Z63 A;  4H4K C;  1KYS A;  3IEE A;  3P28 A;  5L0G A;  1ZHW A;  1EMA A;  1ORY A;  3SS0 A;  3SSP A;  3S9O A;  2HRS A;  3IQT A;  3LS0 A;  2AWJ A;  3SG5 A;  1OCR C;  2V4E B;  3OA1 A;  3LSA A;  5DPH A;  1KU2 A;  3HJC A;  3F46 A;  2EIJ C;  1Q4B A;  5JP7 A;  1ST6 A;  3U0K A;  2YL7 A;  3DAG A;  3OWT A;  4HE4 A;  2IM8 A;  1CV7 A;  4OIP F;  4XLP F;  3RQF A;  3BEH A;  3EVP A;  4RDA A;  3NF0 A;  1L3P A;  4JC2 A;  3M15 A;  4P9T A;  5E3A A;  4XQ1 A;  2JD3 A;  4Z9J A;  3SVE A;  1NU7 D;  3K33 A;  2VCB A;  2YLI A;  1V55 C;  1Z1Q A;  3DQ9 A;  2NSF A;  3VRC A;  4XEK A;  2OJK A;  1LVK A;  2XLE A;  4NWS A;  3SSY A;  3DM9 B;  3VF0 A;  2H8A A;  5KYU A;  4OHS A;  4N6H A;  1HCJ A;  3PJB A;  2EPL X;  5AC5 A;  2QLE A;  3EPV A;  3LS3 A;  1T6U A;  3QW1 A;  1MNE A;  4W6F A;  1JBZ A;  1OQC A;  3NED A;  1FMW A;  1YZW A;  3UMH A;  2DDD A;  4DOZ A;  1EME A;  4JE9 A;  1TQG A;  1BR1 A;  3CGL A;  3TD7 A;  3R2P A;  1MOV A;  4CDV A;  3IQ5 A;  2YFP A;  4I3M A;  3JRT A;  1OXE A;  3AG4 C;  1Z5Z A;  2J0X A;  2B3Q A;  4IGG A;  3GAN A;  2G5Z B;  3L1M A;  4JKV A;  4RYW A;  3LEO A;  1UFB A;  2V3C C;  2DUH A;  5HZO A;  1D1C A;  3U8A A;  2AWC A;  4EBK A;  3SRY A;  3WLC A;  3K1I A;  1LPE A;  3GEI A;  4W6I A;  2W9Y A;  3DKA A;  3HTK C;  3HNJ A;  1WN0 A;  1SZI A;  1XMZ A;  3AG2 C;  1QKR A;  2EMN A;  4Z4K A;  4IAO A;  2Q9A A;  5EB6 A;  1NBB A;  2YLG A;  3SP1 A;  2FGY A;  2OJE D;  5A6K A;  1OXF A;  2G3K A;  4CS9 C;  4Q4Z F;  3U8C A;  4NTB A;  1OW8 A;  5EXU A;  3HKK A;  2D5R B;  2QLA A;  3DQL A;  3EK8 A;  1EI7 A;  3POV A;  1JPN A;  2J7P D;  2XSE A;  1Y6D A;  2IBF A;  2Y39 A;  5L3Q A;  4W6C A;  4L1I A;  4W7X A;  2XS8 A;  2M64 A;  3SEO A;  3H1R A;  3HNK A;  4MTF A;  2HQK A;  4H54 A;  3EVV A;  4CS8 C;  4OIO F;  4I1M A;  4KNV A;  3FXH A;  1PD1 A;  5E33 A;  4OY4 A;  3LEV A;  4CJO A;  3KYI A;  1YZA A;  4YT4 A;  3SVN A;  5HV9 A;  2XLH A;  1E2X A;  5E2Q A;  3HLZ A;  5KYU B;  5EHU A;  4MVS A;  4W7F A;  4N3D A;  2P61 A;  3H2U A;  3RVZ A;  1D0Y A;  2HGD A;  4NCQ A;  2C9I A;  1BBH A;  3NKE A;  3B0U X;  2P1A A;  3B0P A;  1HW1 A;  2HGY A;  1F0B A;  4E18 A;  4W77 A;  2XRH A;  5L0C A;  3EJN A;  5BUO A;  1OXD A;  3T9O A;  1APC A;  1RKE B;  1YJG A;  2OEX A;  5DTX A;  5HZT A;  5BQI A;  5L0I A;  3DJN B;  4W69 A;  3O10 A;  2GAQ A;  2LD6 A;  3U2L A;  2H5P A;  5KTG A;  4CIP A;  3SVU A;  2J7P A;  2L6F A;  5DRG A;  3QVZ A;  2KK1 A;  4I1O B;  4W6B A;  3FVY A;  2DDC A;  2JAD A;  2A0U A;  3IP2 A;  3K6B A;  4EBB A;  4JJG A;  4UDV A;  4NQF A;  4HQ8 A;  4XLN F;  5DTL A;  2MYS A;  1HY5 A;  1CGM E;  5HZU A;  4JZA A;  2AWM A;  1LIH A;  3S05 A;  4W6T A;  1B9C A;  3DPZ A;  2WSN A;  2HV7 A;  4W7E A;  2XLO A;  1J8M F;  1SMY F;  4JUR I;  2O2B A;  4DRH B;  4LDR A;  3ZTM A;  3OGO A;  2I8B A;  4N4W A;  4J7T A;  2TMV P;  3HNI A;  1KNY A;  2KC3 A;  1ZHX A;  4FAP B;  3CB9 A;  4BJT A;  3CZ6 A;  2XXA A;  4JTA B;  3DQC A;  1D0X A;  1LS1 A;  1Q73 A;  4DKN A;  1HMO A;  1T6I A;  3GM2 A;  2VVH A;  1ZW3 A;  1OCC C;  5F5H A;  2V4E C;  4CX9 A;  4EMQ A;  4W74 A;  2P0N A;  1V4A A;  4YL0 A;  3ABK C;  3TOM A;  1EMC A;  2AU5 A;  3T6G B;  2EPO A;  2GA0 A;  3VM6 A;  2QLG A;  1BR2 A;  3RIP A;  2Y3G A;  4EKW A;  2I15 A;  3CQZ A;  4BJ6 A;  4WJ0 A;  3EGD B;  3LVA A;  5J2O A;  2IOV A;  1PD0 A;  1V74 B;  1ZHZ A;  4YL3 A;  3TJ5 A;  3DPW A;  3U9J A;  1W7U A;  4MND A;  3VAY A;  2R7Q A;  3DZA A;  1Q0K A;  1KYR A;  2MHR A;  2VCC A;  4Z4M A;  4TZA A;  3SG3 A;  4DBQ A;  1I4Z A;  3AKO A;  5DRF A;  1JOG A;  1IZM A;  1ZGP A;  3UG0 A;  1TFK B;  4Q9X A;  5HZS A;  4XTK A;  1C02 A;  2J9U A;  4EDS A;  2WIQ A;  3ATP A;  1K04 A;  3G50 A;  2HV6 A;  2W4B A;  1Z3I X;  4XGY A;  3SVC A;  4P1Q A;  3IPM O;  3V5X A;  3MLG A;  1ZVZ A;  2EIL C;  4MVU A;  1Z7Q c;  3UFZ A;  5F28 E;  5KYX A;  5KYY A;  4OIQ F;  3ST0 A;  4EUL A;  2J45 A;  3N0T A;  4F4B A;  4DXQ A;  4M63 A;  4DXO A;  5A6B D;  3A8S A;  4O79 A;  2R02 A;  1K40 A;  2Q9C A;  1QYO A;  2Z6Y A;  1GS9 A;  4NTF A;  1E85 A;  3FOO A;  3AGU A;  3HNL A;  2VB6 A;  3KPH A;  1Q4A A;  3ZUL A;  3EGX B;  1I4Y A;  1Q4D A;  5B3S C;  4PPK A;  4EHP A;  4BJ5 A;  4I2Y A;  3CEX A;  4C7O B;  4G78 A;  2L9J A;  2R25 A;  3CBE A;  5K0I A;  1E86 A;  3EFO A;  1M2V A;  4GES B;  4ULW A;  4ZIO A;  2H7V C;  1D0Z A;  1E83 A;  2WVQ A;  1FTS A;  2OU6 A;  2YL3 A;  2LIG A;  1RMV A;  4JF9 A;  3U3F A;  2AWL A;  2VAS A;  3E70 C;  1HW2 A;  1PV3 A;  5EB7 A;  4ZLD A;  1Y4C A;  1FR0 A;  4PFP A;  1HE9 A;  3ZUJ A;  2L7A A;  3M4B A;  1QZX A;  2J8W A;  1RMO A;  2QUP A;  3CAX A;  3EHN A;  5FCL A;  1KP5 A;  3O6X A;  3UNG C;  2Z6Z A;  4W6A A;  4XPY A;  4KF4 A;  4OGS A;  4HVF A;  1OR2 A;  3L0I A;  2LFF A;  4IK4 A;  4PPL A;  2IB6 A;  2QY9 A;  5A6B A;  4HE8 D;  1TWG A;  2DUF A;  2QZ0 A;  1LS4 A;  2CW0 F;  3DQA A;  2XM4 A;  3MBG A;  3EH1 A;  3SVB A;  2HJ3 A;  3LJB A;  3DE9 A;  2HKV A;  5A6A A;  5F9G A;  4CJG A;  4P9F A;  1G5Z A;  2LFD A;  1G8X A;  1YDI A;  3EH2 A;  4B30 A;  4GYT A;  4WGY A;  4HQC A;  2H8Q A;  1VYI A;  4NY3 A;  1EMF A;  2A68 F;  1TR2 A;  5BTT B;  1YYJ A;  3DQ2 A;  3K7D A;  4H3M A;  1ORS C;  1F09 A;  2HSB A;  3I4U A;  2HQZ A;  1RXQ A;  3DM5 A;  2H5Q A;  3SNH A;  1YJF A;  4H48 A;  4U5H A;  4U5F E;  2ZXO A;  2R7T A;  4KGF A;  2BL2 A;  1B68 A;  4W7A A;  4BJ1 A;  5T3I A;  2FL1 A;  4IRU A;  1L7C A;  1RJ9 B;  4EDO A;  2A46 A;  3NKD A;  1LKX A;  3GOD A;  4MQ9 F;  1FFH A;  3RH3 A;  2IXN A;  2KNH A;  5FVG A;  3LNM B;  3MX3 A;  4E7S A;  3TQO A;  5TJ5 E;  4UTS A;  1TFO B;  2IYL D;  3DQ5 A;  1XA9 A;  3FAP B;  3ST4 A;  4ZF5 A;  2OJQ A;  4IK8 A;  3X1O A;  1MOU A;  2A0B A;  3A9C A;  4QI0 A;  3C62 A;  3EFO B;  2QNL A;  1DOW A;  1VLT A;  1EMK A;  5DTZ A;  1MQV A;  2IXM A;  4JVS A;  3H65 A;  1O87 A;  2YE1 A;  1N1C A;  4Q9W A;  3LLK A;  4KAG A;  3SZR A;  4H3L A;  2ZMU A;  2QLH A;  3K1I C;  2Y3H A;  3DJU B;  4XWJ A;  1LE4 A;  2IB5 A;  5AGF A;  1XZP A;  3RFY A;  1NFO A;  4W6P A;  3SG6 A;  3M4C A;  4KW4 A;  4U9D A;  3NYJ A;  4W8K A;  2Q4F A;  1H9T A;  2OTB A;  3DQE A;  3SSH A;  1C03 A;  1Q0F A;  3LES A;  4DXI A;  2WZF A;  1RRX A;  2OTE A;  5BT0 A;  3N24 A;  2P4M A;  3LS1 A;  3EZI A;  3ZQV A;  4D4N A;  2PFD A;  1KYP A;  2EPN A;  2HZ8 A;  2DUI A;  2HMZ A;  5COG A;  3BXA A;  5JRA A;  4C3B A;  4CSA A;  1MMA A;  5B1A C;  1S6Z A;  1EKY A;  2ZO6 A;  3UGO A;  2HPW A;  4W73 A;  1QSP A;  3JSZ A;  3DAF A;  3FMS A;  5DU0 A;  4XEV A;  4J88 A;  3VIC A;  5T1D B;  4JC7 A;  1YA9 A;  4PJN A;  5DPG A;  4ZLC A;  3CFH A;  3NEZ A;  3EZH A;  1YJ2 A;  3DI5 A;  4QI2 A;  2GWW A;  2YL0 A;  4R32 A;  5EBJ A;  3LNR A;  4EN1 A;  4MS2 A;  2ZXP A;  4U5D E;  3CD1 A;  3MYF A;  3C63 A;  4OD4 A;  3S27 A;  4RTC A;  4JCZ A;  2B0J A;  3T6J A;  1VK5 A;  4EWC A;  2RD9 A;  4ZB1 A;  2LK4 A;  2A6E F;  2J9V A;  5L0J A;  1EML A;  2NG1 A;  1LE2 A;  2RSE B;  5HW9 A;  3PHF 2;  3ZC4 A;  2GX2 A;  4U5C E;  5EGY A;  2A56 B;  2WZG A;  2WVN A;  3JCU Q;  4J32 B;  3MFN A;  3NYM A;  3ZWI A;  3WHN A;  3T4R A;  4E0H A;  3SVD A;  2LP4 A;  3US6 A;  5DS4 A;  3EKH A;  4W6M A;  2ICW G;  1OKK D;  4EBJ A;  2Z6X A;  3ABL C;  3G4X A;  4C3D A;  1C4F A;  1YFP A;  4NC3 A;  1LI5 A;  1OXK A;  4ANJ A;  1A7D A;  4E7Z A;  3JYY A;  2WHU A;  1ZZP A;  4IK3 A;  2EIM C;  4JEO A;  2XL8 A;  5D91 A;  3ASO C;  3NYL A;  2KJG A;  1PCX A;  1ZHY A;  256B A;  3ZQY A;  3KCT A;  2VCA A;  3LF3 A;  5L0F A;  2OEV A;  2R03 A;  3FAJ A;  3IQC A;  4DRJ B;  1GGQ A;  2YL1 A;  1RKC A;  2OG2 A;  3JRM O;  1EMG A;  1GGX A;  4JIO A;  1JAF A;  1QYQ A;  1AVO B;  4AL0 A;  3AGT A;  3UGP A;  2HS5 A;  3DQN A;  3V7O A;  3JT1 A;  4NTA A;  2Q9B A;  2EMO A;  2J46 A;  5FHV A;  2DD7 A;  4W72 A;  4DRI B;  3WG7 C;  3DQF A;  3EK4 A;  1EMM A;  4A2N B;  2A53 B;  3CFA A;  5DQZ A;  5DVW A;  2A47 A;  3SVS A;  1WAS A;  1XWJ A; 
#chains in the Genus database with same CATH homology
 1ZGP A;  3GJ2 A;  4Q9X A;  5DQM A;  3SV5 A;  3UG0 A;  3W1C A;  3KCS A;  5HZS A;  4EDS A;  2WIQ A;  3TOL A;  4AR7 A;  5LK4 A;  4ZFS A;  4RYS A;  4XGY A;  3SVC A;  2ICR A;  4Q7U A;  4P1Q A;  2HJO A;  3DQM A;  2H6V A;  2A48 A;  2QT2 A;  3UFZ A;  3DE8 A;  3ST0 A;  4EUL A;  2POX A;  4W6O A;  2YDZ A;  3DQU A;  1YYX A;  3SVO A;  4XL5 A;  3ST3 A;  4DXQ A;  1H6R A;  4W75 A;  4DXO A;  4U9E A;  3QVY A;  4EIY A;  3A8S A;  2Z6Y A;  1QYO A;  3WCK A;  4IZN A;  5EJU A;  1E85 A;  3FOO A;  3HNL A;  4LQT A;  3SG4 A;  1KYS A;  3P28 A;  1Q4A A;  3E5W A;  3ZUL A;  1EMA A;  1YHI A;  1Q4D A;  4KW9 A;  1Q4E A;  4LJC A;  4LW5 A;  3DQ1 A;  4PPK A;  5AQB B;  3SS0 A;  3SSP A;  2HRS A;  1A7V A;  2AWJ A;  4I2Y A;  4CDY A;  3SG5 A;  2G3O A;  2V4E B;  2FZU A;  3IQ6 A;  3CBE A;  1E86 A;  3LSA A;  4GES B;  2VVI A;  4ZIO A;  5DPH A;  2IE2 A;  1Q4B A;  3SSK A;  1E83 A;  5JP7 A;  4IAQ A;  3H1O A;  2YL3 A;  4IAR A;  3U0K A;  4JF9 A;  5HGE A;  4W76 A;  3SSV A;  2YL7 A;  2AWL A;  1QXT A;  4OJ0 A;  3NMI A;  4HE4 A;  4IB4 A;  1CV7 A;  5EB7 A;  5EXB A;  3EVP A;  3SG7 A;  3DQI A;  2XM0 A;  3NF0 A;  1QY3 A;  3ZUJ A;  4JC2 A;  3M15 A;  2WIS A;  5BQL A;  3M4B A;  4XOV A;  2J8W A;  1RMO A;  4JEB A;  2BTJ A;  3EVU A;  1CPQ A;  3M24 A;  2VAE A;  4LQU A;  2DD9 A;  3GB3 A;  3SVE A;  3M22 A;  5JVE A;  1RMM A;  1KP5 A;  2YLI A;  2WHS A;  4L6R A;  1Z1Q A;  2Z6Z A;  4W6A A;  4OGS A;  4KF4 A;  3BX9 A;  4HVF A;  3DQ9 A;  1CPR A;  3NT9 A;  5DPI A;  4W6K A;  1M6T A;  3VRC A;  4W6L A;  4KA9 A;  3ZTF A;  2OJK A;  4IK4 A;  2XLE A;  2AHA A;  2IB6 A;  4NWS A;  3DQ4 A;  3SSY A;  4WGZ A;  2DUF A;  2QZ0 A;  1ZGQ A;  4OHS A;  1GQA A;  3DQA A;  2XM4 A;  4N6H A;  1HCJ A;  3PJB A;  4J89 A;  3SVB A;  2QLE A;  4AS8 A;  1ZGO A;  3ADF A;  3LS3 A;  3DE9 A;  3QW1 A;  4W6F A;  5F9G A;  2VAD A;  1JBZ A;  2YLD A;  3NED A;  4CJG A;  4W6G A;  2YE0 A;  1YZW A;  4B30 A;  3U8P A;  2DDD A;  1EME A;  3BXB A;  2ZO7 A;  3VHT A;  5LTP A;  4JE9 A;  4WGY A;  3ED8 A;  4HQC A;  3CFF A;  2H8Q A;  2ZMW A;  3LA1 A;  3CGL A;  1EMF A;  3ST2 A;  3LVC A;  5BTT B;  1MOV A;  5H87 A;  3NMJ A;  1YYJ A;  3DQ2 A;  4CDV A;  2Q6P A;  3IQ5 A;  4H3M A;  1F09 A;  2A50 B;  2YFP A;  2HQZ A;  1RCP A;  4P76 A;  2ARL A;  5DQB A;  2H5Q A;  1YHG A;  1OXE A;  3ZTZ A;  4W6S A;  1HUY A;  1YJF A;  4H48 A;  3WLD A;  2B3Q A;  3K1K A;  4KGF A;  2G5Z B;  4IK1 A;  3L1M A;  4JKV A;  4RYW A;  5EXC I;  4W7A A;  2VZX A;  5T3I A;  2FL1 A;  3PIB A;  2DUH A;  4IK5 A;  5HZO A;  4EDO A;  2A46 A;  4B5Y A;  2VVJ A;  3U8A A;  3SRY A;  3WLC A;  2O29 A;  2OGR A;  3SVR A;  4W6I A;  5FVG A;  3HNJ A;  1S05 A;  5FVI A;  2XLV A;  4UTS A;  2XL6 A;  3PJ5 A;  3AI4 A;  3DQ5 A;  1XQM A;  2RH7 A;  2O24 A;  1XA9 A;  1XMZ A;  1H4U A;  4OQW A;  2EMN A;  4Z4K A;  3ST4 A;  2G6Y A;  5EB6 A;  4ZF5 A;  1NBB A;  1GFL A;  1W7S A;  2G6E A;  2YLG A;  4XOW A;  4IK8 A;  3GL4 A;  1MOU A;  2EMD A;  1OXF A;  1GL4 A;  3C62 A;  2A52 B;  2BC5 A;  5JLI A;  3U8C A;  5EXU A;  5H89 A;  3W1D A;  1EMK A;  2XLD A;  3DPX A;  3O78 A;  5DTZ A;  1CGN A;  1MQV A;  4H47 A;  5JS5 A;  3O77 A;  3NMK A;  1UIS A;  2PXS A;  2QLA A;  3DQL A;  3EK8 A;  4ULV A;  2G2S B;  2YE1 A;  3U0L A;  4Q9W A;  1LM3 B;  4KAG A;  4H3L A;  4JEA A;  2ZMU A;  2QLH A;  3DQ6 A;  4W6J A;  2IB5 A;  5AGF A;  4GOB A;  1QPU A;  1QQ3 A;  3GEX A;  4Q7T A;  4W6C A;  4W6P A;  3SG6 A;  5DY6 A;  3ZUF A;  3M4C A;  4KW4 A;  4L1I A;  4W7X A;  3DQD A;  2J9B A;  4U9D A;  4W6N A;  1XSS A;  4R6D A;  3H1R A;  3HNK A;  2OTB A;  3DQE A;  2HQK A;  4JFG A;  3SSH A;  3EVV A;  2GW3 A;  5JT4 A;  4DXI A;  2XLW A;  2QLG B;  1RRX A;  2CCY A;  2OTE A;  5BT0 A;  4ZF3 A;  4OY4 A;  4W6U A;  3LVD A;  3RWA A;  4HQ9 A;  1YHH A;  2G3D B;  2P4M A;  3DQ3 A;  4LJD A;  4CJO A;  1YZA A;  3EKJ A;  2H5O A;  2WSO A;  3E5T A;  4H3N A;  3SVN A;  3ZQV A;  4D4N A;  2XLH A;  1KYP A;  4ZBL A;  3SST A;  5EHU A;  2DUI A;  3BXA A;  4DXP A;  5JRA A;  1RM9 A;  4KF5 A;  1S6Z A;  4W7F A;  1EKY A;  4N3D A;  3SG2 A;  2B3P A;  2ZO6 A;  2HPW A;  2HGD A;  4W73 A;  4BDU A;  2C9I A;  1BBH A;  3TMR A;  5DU0 A;  3GJ1 A;  4J88 A;  3VIC A;  4W6H A;  4LJB A;  1Z1P A;  3TMT A;  3OSQ A;  5DPG A;  2HGY A;  4JGE A;  2DUE A;  3PJ7 A;  5BTT A;  3M79 A;  3CFH A;  1F0B A;  3NEZ A;  1YJ2 A;  3P8U A;  4GF6 B;  4W77 A;  3VHT B;  5LTR A;  2Z1O A;  3NT3 A;  1OXD A;  1RMP A;  3FOP A;  2YL0 A;  4Q7R A;  5EBJ A;  1APC A;  4EN1 A;  4IK9 A;  5DTX A;  3RWT A;  5HZT A;  3CD1 A;  4R6B A;  4W7C A;  2HCG A;  4W6R A;  4ORN A;  4W69 A;  4KW8 A;  3DQJ A;  1JC0 A;  3C63 A;  3V3D A;  2WHT A;  4ZIN A;  4RTC A;  4TZG A;  1BFP A;  2H5P A;  2G16 B;  5KTG A;  4LJD C;  3BXC A;  4CIP A;  3I19 A;  3SVU A;  2AWK A;  1YZC A;  5JUA A;  4ZB1 A;  1XAE A;  4DXN A;  5DRG A;  3QVZ A;  1JC1 A;  4DXM A;  4W6B A;  2C9J A;  2DDC A;  2JAD A;  1EML A;  2DUG A;  3IR8 A;  2HFC A;  5HW9 A;  4KPI A;  4KF5 C;  4CDA A;  2GX2 A;  3IP2 A;  5B3I A;  4KGE A;  3VK1 A;  2V4E A;  4J8A A;  4HQ8 A;  2A56 B;  3DQ7 A;  4W6D A;  5DTL A;  3ZWI A;  2Y0G A;  2OKW A;  2OKY A;  3SVD A;  5HZU A;  2AWM A;  3DQ8 A;  1ZUX A;  3S05 A;  2YKZ A;  3EKH A;  2WUR A;  1B9C A;  4W6M A;  3DPZ A;  3G9A A;  3EK7 A;  4W6T A;  2WSN A;  4W7E A;  2XLO A;  2Z6X A;  2O2B A;  2Q57 A;  3OSR A;  1C4F A;  2A54 B;  2GX0 A;  3CD9 A;  3ZTM A;  1YFP A;  4NC3 A;  3E5V A;  3DQK A;  3OGO A;  4U2V A;  4ANJ A;  4N4W A;  2WHU A;  4IK3 A;  3HNI A;  4W7R A;  4L13 A;  1CGO A;  4JEO A;  2XL8 A;  3CB9 A;  3DQC A;  2H9W A;  3EVR A;  256B A;  2XLM A;  3ZQY A;  1Q73 A;  4KEX A;  4DKN A;  3KCT A;  4PFE A;  1Q4C A;  5LTQ A;  3DQH A;  3LF3 A;  4ZF4 A;  5DTY A;  2VVH A;  1JBY A;  2H5R A;  2V4E C;  4W7D A;  2FWQ A;  1E84 A;  4L12 A;  4CX9 A;  1MYW A;  4EMQ A;  4W74 A;  1W7T A;  2YL1 A;  3AI5 A;  3TOM A;  1EMC A;  5FVF A;  2QLG A;  3MGF A;  1EMG A;  1GGX A;  3LVA A;  5J2O A;  1JAF A;  1QYQ A;  2IOV A;  5DPJ A;  4DKM A;  1EMB A;  2PXW A;  5HBD A;  4ER9 A;  3U0N A;  3DQO A;  3DQN A;  4JRB A;  2G6X A;  3DPW A;  3U0M A;  5H88 A;  1W7U A;  2QLI A;  3LF4 B;  4D4X A;  4PPJ A;  2EMO A;  1G7K A;  5FHV A;  5JSL A;  2QRF A;  2DD7 A;  3QW0 A;  3SSL A;  4XVP A;  4W72 A;  3DQF A;  3EK4 A;  1EMM A;  1KYR A;  2GW4 B;  2A53 B;  2QU1 A;  4B30 B;  3CFA A;  4Z4M A;  2AH8 A;  4TZA A;  3SG3 A;  2A47 A;  3SVS A;  3AKO A;  1QYF A;  5DRF A;  4PPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...