3U97A

1.1 angstrom-resolution crystal structure of the brucella abortus ribonuclease toxin, brnt
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
TMKIIWDEPKRQTNIAKHGLDFADLHFEFFLSAKVFPTKADRLMAIGEFNGLIIIAVIFKPVGSEALSVISMRSASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Structure and Function of the Novel BrnT/BrnA Toxin-Antitoxin System of Brucella abortus.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Hydrolase
molecule keywords Ribonuclease toxin BrnT
total genus 15
structure length 77
sequence length 77
ec nomenclature ec 3.1.27.1: Transferred entry: 4.6.1.19.
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04365 BrnT_toxin Ribonuclease toxin, BrnT, of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.530 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3u97A00
3U97A
chains in the Genus database with same CATH superfamily
2P05A 1W01A 5D81A 1MNLA 2W9PA 4R9KA 1MWRA 3GZBA 1V74A 2UX0A 3LZAA 3WOEB 1MGRA 1A2KA 3JVCA 3KCHA 4ILFA 4J8TA 1YIJ3 3CD63 1TRQA 1UCIA 3B4OA 3G0KA 3K63A 4L8PA 3EHCA 2AAEA 5G2GA 3L0RA 1QVF2 4RZMA 1BIRA 3Q3FA 1Q7HA 5FW5A 1AR0A 3BIRA 1C54A 3LTAA 2HMOB 3ECFA 1TIJA 1OF5B 1CYVA 2PNCA 2P0MA 2C11A 3FG1A 1LOYA 4BIRA 4BTXA 1B3SA 1RN4A 2LQVA 3D3LA 1SIHA 4HM7B 4HVNA 2Z77A 3I0YA 4MMYB 1D6UA 1I3IA 1YGWA 2HOHA 1NO3A 1RCKA 2OQEC 1BNIA 2C10A 3X42A 3UB1A 2Z76A 3AMOB 1YVBI 1UCKA 2GU1A 2RBIA 2OOVA 4G1MB 1AVLA 1WMOA 2L1SA 2W04A 4R9LA 1YVSA 4WFOA 5CF2A 1JZOA 1CEWI 1DVDA 3AHSA 1ROAA 2RFRA 1RCLA 5CXOA 5KP3A 3X3XA 1MGWA 1OHSA 2RCDA 1MWUA 1IK3A 2P0XA 1Q40B 3NHXA 4I4KA 3MHEA 1BSAA 1RN1A 3AGNA 3S29A 1VQK3 5IERA 3V98A 2GSPA 1I8VA 1YNVX 2OWPA 2Z7AA 3MSOA 4MMXB 3NM2A 1TJDA 1RN7A 1JKGB 5M19A 3UJMA 5M18A 3QRDA 1VQ73 3FF0A 3BNDA 3M8CA 3Q2PA 3JUMA 4OVMA 2FGTA 2CFDA 1RMSA 3NV0B 1SARA 4QWTA 4WYKB 3NBJA 3WODG 1QMAA 1IYYA 1GY7A 1N9JA 2YX9A 3S67A 3F7SA 4J9AA 1BRKA 2C4BA 2XFSA 2KF4A 1N5HA 2YFIB 4NREA 2F5WA 4LGQA 3EE1A 3KKGA 2IUJA 1HU9A 3LOYA 8RNTA 1VQP3 7RNTA 4H61A 1S5AA 1VQL3 1W5ZA 1UGIA 4CCVA 5IG4A 2QA43 1IV7A 1EG9B 4MEIA 1BNGA 1UUGB 3LXUX 4RNZA 3CCE3 1TU5A 3CCL3 1VQ63 2CX1A 1STFI 1U8CB 1ROVA 3HK4A 1ASKA 2F86B 3MPHA 1JZDA 1OGZA 2HMJB 1TP6A 4BL3A 2CFWA 1NB5I 1OHOA 4N6MA 1X1WA 4XBTA 2KXGA 2IA7A 5DREA 1W7CA 1D6YA 1EKMA 2ZDJA 5IG5A 3NUVA 4LMIA 1B27A 1W6YA 6RNTA 1T5YA 3B7CA 1GOVA 5BU4A 1RGAA 2KF6A 1STDA 1UCJA 3BB9A 4JRFA 3SLUA 5D82A 2CG1A 1B2MA 2CWTA 1RHLA 4J5KA 3JUOA 3T8UA 5JPPA 5ELUA 1T3BA 2CWUA 2BMOB 1WMPA 3CCM3 4HBRA 4HOHA 4ORLA 1TFOA 5BXQA 1K8A4 1AVKA 2BHMA 3FCSB 4FR9A 1I0XA 2K0MA 3PZWA 1BSCA 3CC23 3LT8A 2YFLB 3OXAA 1FUWA 4I5QA 1US1A 1E3RA 1OCVA 1SQWA 2QIYA 3ZFZA 3OWUA 1BRNL 1CQSA 1E97A 2D42A 3HI7A 3SEDA 3URPA 1PYLA 3S27A 3HX8A 1QVG2 3MYTA 1I70A 1O7GB 1UDII 1LRAA 2P38A 5I97A 3VF1A 2H0IA 3JUQA 2W0QA 1R4CA 1TFKA 1VZZA 3ZG0A 1LVNA 1V58A 3NBBA 4IT7A 2CFKA 4HM1B 1NDOB 1VQN3 2JDIH 4FMAA 4IPBA 1Z1SA 1QALA 1YGEA 3B4PA 3D5GA 3F40A 4X2HA 3UL5A 3GWRA 3DM8A 2ML6A 1JB2A 3DGMA 2GXFA 2SARA 4HM6B 5GSPA 1GS3A 1M1K4 3X3ZA 5IEPA 1G0TA 2H0HA 3NQZA 5HGRA 2XF3A 3IMAB 1A67A 2KRTA 3EN1B 2JQ5A 1FGRA 4O2HA 1A2PA 1GD4A 2WOFA 4WYKA 1M1XB 1U5OA 1YIT3 1NJI4 4HM4B 4JF8A 5IW9A 1BNJA 5IG3A 1TRPA 1T2IA 3PXMA 1RNBA 3NBRA 3EN8A 4HJLB 1N9EA 2WOHA 2Z6BA 4N6V0 3H51A 4O8SA 3VSYA 4PEJA 1MOLA 4AKZA 4LYLB 2RNTA 2E2TA 2Y73A 4STDA 4LSOA 1UUWB 4OK0A 2KAAA 4XDWA 2F99A 3HIIA 3WA3A 2M7OA 3BNBA 3N9HA 3V92A 3G6E3 1IQYA 1EUIC 1RTUA 4HM3B 1WQLB 1M9GA 1CYUA 2W56B 1OGXA 3EBTA 1FUTA 2F56A 3DY5A 2J8XB 2XGLA 5EQLA 1W00A 1Q814 3U1WA 3MG3A 1SPUA 1JB4A 1UUVB 2UGIA 2WGQA 2PZVA 1JN5A 3X41A 2IY2A 1AQZA 1QAKA 2K54A 3F9SA 3NX0A 2OTJ3 1TUHA 3JUPA 1BVIA 1YJ93 2R41A 3BU4A 4XDVA 1KSIA 4HM2B 1GMQA 2BNGA 1EA2A 5M1AA 1QAFA 3ZG5A 2WGOA 5AEUB 3N8BA 1LOVA 3FGYA 2XFTA 3ROBA 1JBSA 1JN5B 3CPW2 1GY5A 1RDSA 1RNTA 1L5GB 1I3FA 1BNRA 5G1LA 3CMA3 1ULIB 4HM8B 3I563 2W2CA 1FGMA 2F4YA 1WTHA 4HAAA 1A90A 3F14A 4N6NB 5JBSA 1OPYA 2MF7A 1G02A 3AHWA 1LNIA 5IENA 1LOWA 1JBTA 5DRVA 2OQEA 3GRDA 3Q1CA 4CPKA 1OACA 1LOXA 3CNXA 3G713 1G96A 1RGLA 3EBYA 5CF1A 1BNEA 3F7XA 1GSPA 5ELJA 6GSPA 1YJN3 5TGNA 1N5PA 4WP5A 4N6TA 3NM7A 1IVXA 3K0ZA 4GHOA 4N6UA 6STDA 1QJGA 1W4NA 4DKIA 3T8NA 4O02B 1ZO2A 2CFLA 3D79A 3X3YA 3E99A 1B20A 1RLSA 1W6CA 1Q42A 1DETA 1RGKA 4EBGA 2W9QA 1JRQA 3SX1A 3CU3A 1WMNA 3EX9A 2H0GA 1V57A 3KN4A 2CG0A 4BU4A 2QEX3 4H3UA 3D4AA 1HYFA 3PCRA 1NB3I 2HMLB 1E3VA 2XH9A 1JV2B 1I2FA 3U97A 3AMOA 3FH1A 2I9WA 4HKVB 2L4VA 1BRJA 3MWZA 4XM4A 1JKGA 3CPOA 1ZS7A 3FG3A 3LMLA 1RKYA 8CHOA 2GBXB 3K5TA 3DH2A 3GAXA 5FGOA 3DMCA 3ALAA 1NU3A 1WNHA 1IU7A 3V99A 5AYRB 2CH9A 4K1VA 1BRHA 1B21A 2GEXA 2BMRB 2STDA 2W03A 3KZTA 3RGRA 5KP1A 1JNQA 4CJNA 1VQQA 4EYCA 1K28A 3Q90A 3DXOA 1OHPA 3PGBA 2XGNA 3EC9A 1O7HB 3LYGA 2O3OA 5EVHA 3G8ZA 3GZYB 3PCSA 5IEOA 1J2BA 5LC6A 3CNMA 1BUJA 3N54B 2W6JH 2CX0A 1FGTA 2RSXA 1S723 1FW7A 1DVCA 1FGQA 4GB5A 3J7Yd 1BOXA 1W2ZA 2HMKB 3KSED 1Q7Y4 2O9UX 1I2EA 3SXXA 2BU4A 3STDA 3KSPA 4U13A 2LYXA 1ZX2A 3MG1A 3S5CA 1LQGC 2ZHXB 5AIIA 4BTYA 2CKFB 2KCDA 3TDGA 1X1YA 5RNTA 1T2HA 1PFPA 1W2B2 3EQQB 1MWTA 1Q40A 4KZ1A 1HKXA 1UI7A 5HOHA 2YFJB 1UW1A 4J5GA 1GYBA 3FF2A 3SOAA 3WHOA 1B2SA 7STDA 3VGNA 3GZXB 4XBXA 2IUKA 4EXRA 1KD14 1M904 1RRLA 1X1XA 1YJW3 4KFDA 2OTL3 1O7NB 2GEYA 3WMDA 3KE7A 1AY7A 3HZPA 2BT3A 4L7KA 4WWUC 3FLJA 5AYSC 3NXJA 5KP4A 3NV0A 2XR8B 2R4IA 1BRSA 3G4S3 3D5IA 1KQS2 1PY3A 2BIRA 1BRIA 1K41A 1RGCA 5IF6A 2HMMB 1Q824 1KWIA 4BL2A 3CC73 3AGOA 3IJEB 1Q9EA 3JUNA 1BNSA 2ML5A 2B1XB 3PS8A 3RGAA 1ISKA 4R1KA 1VQ83 1D6ZA 2W56A 1JJ22 3EJVA 1FZUA 4HZ9B 3BLZA 1DE3A 3LH4A 3RDEA 1BSEA 3DGOA 3QK9A 2SBLA 3A76A 2BMQB 3MG2A 4Q53A 3X40A 3K9MC 1IQ8A 3DGLA 1VQM3 1RSNA 1LQMB 2P09A 1UGHI 3DUKA 1N8QA 1JB5A 3KIIA 2MC8A 1SIIA 4EV2A 1N8R4 1UCLA 4L8OA 4HZBB 3WOFB 5AIFA 4AKYA 4MMZB 1BSDA 1O7WB 4FMCA 3CCQ3 3FKAA 3A5EA 4N6OB 1BAOA 3CCU3 1Y4KA 3OX9A 1EEJA 1A2VA 3LTBA 3NQYA 2XRXB 3DZLA 4EV5A 3CME3 3F8HA 3LTCA 1W02A 3CCV3 1OF5A 4LZIA 2CIUA 1PU4A 1ULJB 4BTWA 1K734 4TX4A 2E2VA 3WDGB 3B8LA 3FSDA 1LNHA 1EQKA 3MKIA 2AADA 1GOYA 1GY6A 5BIRA 1BGSA 1I2GA 2WO0A 5G1KA 4K61A 3RNTA 7GSPA 3DGNA 1IT8A 4R4KA 2GBWB 3FZWA 1CH0A 1O7MB 4HM0B 1FUSA 2FNQA 2CHCA 3OV4A 2BO9B 5CLKA 5BVBA 2KF5A 4XB5A 2CC3A 3O8YA 1DMQA 3OWSA 1IVUA 2IYJA 4GL6A 1MWSA 5CK6A 1TTOA 1B2UA 2FXTA 4FMBA 1R4YA 1LXEA 2CK3H 2E2UA 5JPUA 3LT9A 1C7HA 2RGQA 1RGEA 1BUQA 2F98A 2A15A 1RGHA 4K90B 1FYSA 5D83A 1O7PB 1RRHA 2XSHB 1NWWA 3ER7A 3OW22 3HOHA 4MJDA 2CWVA 4ZM8A 2HMNB 2UUGC 2V1LA 1IQXA 1VQ43 4FCJA 1W6GA 1RJOA 1UI8A 4RBNA 3I553 1B2XA 1YI23 1IVVA 1DYUA 4K1UA 1IVWA 9RNTA 2K3DA 1VQ93 1B2ZA 3HIGA 4IIAA 4NHFA 3FG4A 1F8NA 1AV4A 4N6LA 1RGFA 1ZGXA 3GZRA 1IDPA 5LC7A 2ZL8A 4O3VA 4EW5A 1GOUA 2QGUA 4FCMA 1YHQ3 1OUNA 3CXC2 3UNLA 4KT3B 4HM5B 3SVAA 4R80A 2B24B 4RNYA 1RGGA 2F5MA 5STDA 2CFGA 4OUQA 2OCTA 3DGYA 1GMRA 2Y74A 1FA3A 1OH0A 1GMPA 4EC6A 3KFQC 1VQ53 4WHAA 4AEQA 3BNCA 1BRGA 1IT7A 1SJWA 2GU3A 5AI1A 1K9M4 4N3VA 5IG0A 3EF8A 3F8XA 1X1UA 3H3HA 3SOYA 3LTDA 2INXA 4FMDA 2OOVC 5A0OB 4HYZA 1FGOA 3SYUA 1HZ1A 1DMMA 3WA2X 2D1WA 1GD3A 1Q864 3OWYA 1I0VA 4CDLA 1BSBA 4GSPA 4FCZA 1BANA 3CCS3 4KFFA 4XBYA 5AEWB 1JBRA 3K7CA 3CC43 4NPBA 2CW9A 3BNEA 4X2OA 3EB8A 4KFEA 2Q07A 3PYJA 5AIGA 5AIHA 4KVHA 3CCJ3 3D9RA 1BU4A 4RNTA 3G16A 1DMNA 3S28A 2ZA4A 3CCR3 4LEHA 1NNVA 2KF3A 3WR2A 3IPTA 2XSOB 2XEPA 3UL6A 1BNFA 5EEOA 3T0UA 1KC84 1VQO3 3GSPA 1IV9A 2IMJA
chains in the Genus database with same CATH topology
2P05A 1W01A 5D81A 1MNLA 2W9PA 4R9KA 3GZBA 1V74A 2UX0A 3LZAA 3WOEB 1A2KA 3JVCA 4J8TA 1YIJ3 3CD63 3B4OA 3K63A 3G0KA 4L8PA 3EHCA 5G2GA 3L0RA 1QVF2 4RZMA 5FW5A 1AR0A 3LTAA 2HMOB 3ECFA 1TIJA 1OF5B 1CYVA 2PNCA 2P0MA 2C11A 3FG1A 4BTXA 2LQVA 3D3LA 1SIHA 4HM7B 4HVNA 2Z77A 3I0YA 4MMYB 1D6UA 1NO3A 2OQEC 2C10A 3X42A 3UB1A 2Z76A 3AMOB 1YVBI 2GU1A 2OOVA 4G1MB 1AVLA 1WMOA 2W04A 4R9LA 5CF2A 4WFOA 1CEWI 1DVDA 3X3XA 1ROAA 2RFRA 5KP3A 5CXOA 1OHSA 2RCDA 1IK3A 2P0XA 1Q40B 3NHXA 4I4KA 3MHEA 3S29A 1VQK3 5IERA 3V98A 2OWPA 2Z7AA 3MSOA 4MMXB 3NM2A 1RN7A 1JKGB 3UJMA 3QRDA 1VQ73 3FF0A 3BNDA 3M8CA 3Q2PA 3JUMA 4OVMA 2FGTA 2CFDA 3NV0B 4QWTA 4WYKB 3NBJA 3WODG 1QMAA 1GY7A 1N9JA 2YX9A 3S67A 3F7SA 4J9AA 2XFSA 1N5HA 2YFIB 4NREA 4LGQA 3EE1A 3KKGA 2IUJA 1HU9A 3LOYA 1VQP3 4H61A 1S5AA 1VQL3 1W5ZA 4CCVA 5IG4A 2QA43 1IV7A 1EG9B 4MEIA 4RNZA 3LXUX 3CCE3 1TU5A 3CCL3 1VQ63 1STFI 1U8CB 1ROVA 3HK4A 1ASKA 2F86B 3MPHA 1OGZA 2HMJB 1TP6A 2CFWA 1NB5I 1OHOA 4N6MA 4XBTA 2KXGA 2IA7A 5DREA 1W7CA 1D6YA 1EKMA 2ZDJA 5IG5A 3NUVA 4LMIA 1W6YA 1T5YA 3B7CA 3SLUA 1STDA 4JRFA 3BB9A 5D82A 2CG1A 2CWTA 3JUOA 3T8UA 5JPPA 5ELUA 2CWUA 2BMOB 1WMPA 3CCM3 4HBRA 4ORLA 1TFOA 5BXQA 1K8A4 1AVKA 2BHMA 3FCSB 4FR9A 2K0MA 3PZWA 3CC23 3LT8A 2YFLB 3OXAA 1FUWA 1US1A 1E3RA 1OCVA 1SQWA 2QIYA 3OWUA 1CQSA 1E97A 2D42A 3HI7A 3SEDA 3S27A 3HX8A 1QVG2 3MYTA 1O7GB 2P38A 5I97A 3VF1A 3JUQA 2W0QA 1R4CA 1TFKA 1VZZA 1LVNA 3NBBA 4IT7A 2CFKA 4HM1B 1NDOB 1VQN3 2JDIH 4FMAA 4IPBA 1Z1SA 1QALA 1YGEA 3B4PA 3F40A 4X2HA 3UL5A 3GWRA 3DM8A 2ML6A 1JB2A 3DGMA 2GXFA 4HM6B 1GS3A 1M1K4 3X3ZA 5IEPA 3NQZA 5HGRA 2XF3A 3IMAB 1A67A 2KRTA 3EN1B 2JQ5A 1FGRA 4O2HA 1YIT3 1GD4A 2WOFA 4WYKA 1M1XB 1U5OA 1NJI4 4HM4B 4JF8A 5IW9A 5IG3A 3PXMA 3NBRA 3EN8A 4HJLB 1N9EA 2WOHA 2Z6BA 4N6V0 3H51A 4O8SA 3VSYA 4PEJA 1MOLA 4AKZA 2E2TA 2Y73A 4STDA 4LSOA 1UUWB 4OK0A 4XDWA 3WA3A 2F99A 3HIIA 2M7OA 3BNBA 3N9HA 3V92A 3G6E3 1IQYA 4HM3B 1WQLB 1M9GA 1CYUA 2W56B 1OGXA 3EBTA 3DY5A 2XGLA 5EQLA 1W00A 1Q814 3U1WA 3MG3A 1SPUA 1JB4A 1UUVB 2WGQA 2PZVA 1JN5A 3X41A 2K54A 1QAKA 3F9SA 3NX0A 2OTJ3 1TUHA 3JUPA 1YJ93 4XDVA 1KSIA 4HM2B 2BNGA 1EA2A 1QAFA 2WGOA 5AEUB 3N8BA 3FGYA 2XFTA 3ROBA 1JN5B 3CPW2 1GY5A 1L5GB 3CMA3 1ULIB 4HM8B 3I563 2W2CA 1FGMA 1WTHA 1A90A 3F14A 4N6NB 5JBSA 1OPYA 2MF7A 5IENA 5DRVA 2OQEA 3GRDA 3Q1CA 1OACA 1LOXA 3CNXA 3G713 1G96A 3EBYA 5CF1A 3F7XA 5ELJA 1YJN3 5TGNA 1N5PA 4WP5A 4N6TA 3NM7A 1IVXA 3K0ZA 6STDA 4N6UA 1QJGA 1W4NA 3T8NA 4O02B 1ZO2A 2CFLA 3X3YA 3E99A 1W6CA 1Q42A 4EBGA 2W9QA 1JRQA 3SX1A 3CU3A 1WMNA 3EX9A 3KN4A 2CG0A 2QEX3 4H3UA 3PCRA 1NB3I 2HMLB 1E3VA 2XH9A 1JV2B 3U97A 3AMOA 3FH1A 2I9WA 4HKVB 2L4VA 3MWZA 4XM4A 1JKGA 3CPOA 3FG3A 3LMLA 1RKYA 8CHOA 2GBXB 3K5TA 3GAXA 5FGOA 3DMCA 3ALAA 1NU3A 1WNHA 1IU7A 3V99A 5AYRB 2CH9A 4K1VA 2GEXA 3KZTA 2BMRB 2STDA 2W03A 3RGRA 5KP1A 1JNQA 4EYCA 1K28A 3Q90A 3DXOA 1OHPA 3PGBA 2XGNA 3EC9A 1O7HB 3LYGA 2O3OA 5EVHA 3G8ZA 3GZYB 3PCSA 5IEOA 1J2BA 5LC6A 3CNMA 3N54B 2W6JH 1S723 1FGTA 2RSXA 1DVCA 1FGQA 4GB5A 3J7Yd 1W2ZA 2HMKB 3KSED 1Q7Y4 2O9UX 3SXXA 3STDA 3KSPA 4U13A 2LYXA 1ZX2A 3MG1A 3S5CA 5AIIA 4BTYA 2CKFB 2KCDA 3TDGA 1PFPA 1W2B2 3EQQB 1Q40A 4KZ1A 1HKXA 1UI7A 2YFJB 1UW1A 1GYBA 3FF2A 3SOAA 7STDA 3VGNA 3GZXB 4XBXA 2IUKA 4EXRA 1KD14 1M904 1RRLA 1YJW3 4KFDA 2OTL3 1O7NB 2GEYA 3WMDA 3KE7A 3HZPA 4L7KA 2BT3A 4WWUC 5KP4A 3FLJA 5AYSC 3NXJA 3NV0A 2XR8B 2R4IA 3G4S3 1KQS2 1K41A 5IF6A 2HMMB 1Q824 1KWIA 3CC73 3IJEB 3JUNA 2ML5A 2B1XB 3PS8A 3RGAA 1ISKA 4R1KA 1VQ83 1D6ZA 2W56A 1JJ22 3EJVA 4HZ9B 3BLZA 3LH4A 3RDEA 3DGOA 3QK9A 2SBLA 3A76A 2BMQB 3MG2A 4Q53A 3X40A 3K9MC 1IQ8A 3DGLA 1VQM3 2P09A 3KIIA 3DUKA 1N8QA 1JB5A 2MC8A 4EV2A 1SIIA 1N8R4 4L8OA 4HZBB 3WOFB 5AIFA 4AKYA 4MMZB 1O7WB 4FMCA 3CCQ3 3FKAA 4N6OB 3CCU3 1Y4KA 3OX9A 1A2VA 3LTBA 3NQYA 2XRXB 3DZLA 4EV5A 3CME3 3F8HA 3LTCA 1W02A 3CCV3 1OF5A 4LZIA 2CIUA 1PU4A 1ULJB 4BTWA 1K734 4TX4A 2E2VA 3WDGB 3B8LA 3FSDA 1LNHA 1EQKA 3MKIA 1GY6A 2WO0A 4K61A 3DGNA 1IT8A 4R4KA 2GBWB 3FZWA 1O7MB 4HM0B 2FNQA 3OV4A 2CHCA 2BO9B 5CLKA 5BVBA 4XB5A 2CC3A 3O8YA 1DMQA 3OWSA 1IVUA 4GL6A 5CK6A 2FXTA 4FMBA 1LXEA 2CK3H 2E2UA 5JPUA 3LT9A 1C7HA 2RGQA 1BUQA 2F98A 2A15A 4K90B 5D83A 1O7PB 1RRHA 2XSHB 1NWWA 3ER7A 3OW22 4MJDA 2CWVA 4ZM8A 2HMNB 2V1LA 1VQ43 1IQXA 4FCJA 1W6GA 1RJOA 1UI8A 4RBNA 3I553 1YI23 1IVVA 1DYUA 4K1UA 1IVWA 1VQ93 3HIGA 4IIAA 4NHFA 3FG4A 1F8NA 1AV4A 4N6LA 3GZRA 1IDPA 5LC7A 2ZL8A 4O3VA 2QGUA 4FCMA 1YHQ3 1OUNA 3CXC2 3UNLA 4HM5B 3SVAA 4R80A 2B24B 4RNYA 5STDA 2CFGA 4OUQA 2OCTA 2Y74A 1FA3A 1OH0A 4EC6A 3KFQC 1VQ53 4WHAA 4AEQA 3BNCA 1IT7A 1SJWA 2GU3A 5AI1A 1K9M4 4N3VA 5IG0A 3EF8A 3F8XA 3SOYA 3H3HA 3LTDA 2INXA 4FMDA 2OOVC 5A0OB 4HYZA 1FGOA 1DMMA 3WA2X 1GD3A 2D1WA 1Q864 3OWYA 4CDLA 4FCZA 3CCS3 4KFFA 4XBYA 5AEWB 3K7CA 3CC43 2CW9A 3BNEA 4X2OA 3EB8A 4KFEA 2Q07A 3PYJA 5AIGA 5AIHA 4KVHA 3CCJ3 3D9RA 3G16A 1DMNA 3S28A 3CCR3 4LEHA 3IPTA 2XSOB 2XEPA 3UL6A 5EEOA 3T0UA 1KC84 1VQO3 1IV9A 2IMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U97 A; 
#chains in the Genus database with same CATH topology
 2P05 A;  1W01 A;  5D81 A;  1MNL A;  2W9P A;  4R9K A;  1MWR A;  3GZB A;  1V74 A;  2UX0 A;  3LZA A;  3WOE B;  1MGR A;  1A2K A;  3JVC A;  3KCH A;  4ILF A;  4J8T A;  1YIJ 3;  3CD6 3;  1TRQ A;  1UCI A;  3B4O A;  3G0K A;  3K63 A;  4L8P A;  3EHC A;  2AAE A;  5G2G A;  3L0R A;  1QVF 2;  4RZM A;  1BIR A;  3Q3F A;  1Q7H A;  5FW5 A;  1AR0 A;  3BIR A;  1C54 A;  3LTA A;  2HMO B;  3ECF A;  1TIJ A;  1OF5 B;  1CYV A;  2PNC A;  2P0M A;  2C11 A;  3FG1 A;  1LOY A;  4BIR A;  4BTX A;  1B3S A;  1RN4 A;  2LQV A;  3D3L A;  1SIH A;  4HM7 B;  4HVN A;  2Z77 A;  3I0Y A;  4MMY B;  1D6U A;  1I3I A;  1YGW A;  2HOH A;  1NO3 A;  1RCK A;  2OQE C;  1BNI A;  2C10 A;  3X42 A;  3UB1 A;  2Z76 A;  3AMO B;  1YVB I;  1UCK A;  2GU1 A;  2RBI A;  2OOV A;  4G1M B;  1AVL A;  1WMO A;  2L1S A;  2W04 A;  4R9L A;  1YVS A;  4WFO A;  5CF2 A;  1JZO A;  1CEW I;  1DVD A;  3AHS A;  1ROA A;  2RFR A;  1RCL A;  5CXO A;  5KP3 A;  3X3X A;  1MGW A;  1OHS A;  2RCD A;  1MWU A;  1IK3 A;  2P0X A;  1Q40 B;  3NHX A;  4I4K A;  3MHE A;  1BSA A;  1RN1 A;  3AGN A;  3S29 A;  1VQK 3;  5IER A;  3V98 A;  2GSP A;  1I8V A;  1YNV X;  2OWP A;  2Z7A A;  3MSO A;  4MMX B;  3NM2 A;  1TJD A;  1RN7 A;  1JKG B;  5M19 A;  3UJM A;  5M18 A;  3QRD A;  1VQ7 3;  3FF0 A;  3BND A;  3M8C A;  3Q2P A;  3JUM A;  4OVM A;  2FGT A;  2CFD A;  1RMS A;  3NV0 B;  1SAR A;  4QWT A;  4WYK B;  3NBJ A;  3WOD G;  1QMA A;  1IYY A;  1GY7 A;  1N9J A;  2YX9 A;  3S67 A;  3F7S A;  4J9A A;  1BRK A;  2C4B A;  2XFS A;  2KF4 A;  1N5H A;  2YFI B;  4NRE A;  2F5W A;  4LGQ A;  3EE1 A;  3KKG A;  2IUJ A;  1HU9 A;  3LOY A;  8RNT A;  1VQP 3;  7RNT A;  4H61 A;  1S5A A;  1VQL 3;  1W5Z A;  1UGI A;  4CCV A;  5IG4 A;  2QA4 3;  1IV7 A;  1EG9 B;  4MEI A;  1BNG A;  1UUG B;  3LXU X;  4RNZ A;  3CCE 3;  1TU5 A;  3CCL 3;  1VQ6 3;  2CX1 A;  1STF I;  1U8C B;  1ROV A;  3HK4 A;  1ASK A;  2F86 B;  3MPH A;  1JZD A;  1OGZ A;  2HMJ B;  1TP6 A;  4BL3 A;  2CFW A;  1NB5 I;  1OHO A;  4N6M A;  1X1W A;  4XBT A;  2KXG A;  2IA7 A;  5DRE A;  1W7C A;  1D6Y A;  1EKM A;  2ZDJ A;  5IG5 A;  3NUV A;  4LMI A;  1B27 A;  1W6Y A;  6RNT A;  1T5Y A;  3B7C A;  1GOV A;  5BU4 A;  1RGA A;  2KF6 A;  1STD A;  1UCJ A;  3BB9 A;  4JRF A;  3SLU A;  5D82 A;  2CG1 A;  1B2M A;  2CWT A;  1RHL A;  4J5K A;  3JUO A;  3T8U A;  5JPP A;  5ELU A;  1T3B A;  2CWU A;  2BMO B;  1WMP A;  3CCM 3;  4HBR A;  4HOH A;  4ORL A;  1TFO A;  5BXQ A;  1K8A 4;  1AVK A;  2BHM A;  3FCS B;  4FR9 A;  1I0X A;  2K0M A;  3PZW A;  1BSC A;  3CC2 3;  3LT8 A;  2YFL B;  3OXA A;  1FUW A;  4I5Q A;  1US1 A;  1E3R A;  1OCV A;  1SQW A;  2QIY A;  3ZFZ A;  3OWU A;  1BRN L;  1CQS A;  1E97 A;  2D42 A;  3HI7 A;  3SED A;  3URP A;  1PYL A;  3S27 A;  3HX8 A;  1QVG 2;  3MYT A;  1I70 A;  1O7G B;  1UDI I;  1LRA A;  2P38 A;  5I97 A;  3VF1 A;  2H0I A;  3JUQ A;  2W0Q A;  1R4C A;  1TFK A;  1VZZ A;  3ZG0 A;  1LVN A;  1V58 A;  3NBB A;  4IT7 A;  2CFK A;  4HM1 B;  1NDO B;  1VQN 3;  2JDI H;  4FMA A;  4IPB A;  1Z1S A;  1QAL A;  1YGE A;  3B4P A;  3D5G A;  3F40 A;  4X2H A;  3UL5 A;  3GWR A;  3DM8 A;  2ML6 A;  1JB2 A;  3DGM A;  2GXF A;  2SAR A;  4HM6 B;  5GSP A;  1GS3 A;  1M1K 4;  3X3Z A;  5IEP A;  1G0T A;  2H0H A;  3NQZ A;  5HGR A;  2XF3 A;  3IMA B;  1A67 A;  2KRT A;  3EN1 B;  2JQ5 A;  1FGR A;  4O2H A;  1A2P A;  1GD4 A;  2WOF A;  4WYK A;  1M1X B;  1U5O A;  1YIT 3;  1NJI 4;  4HM4 B;  4JF8 A;  5IW9 A;  1BNJ A;  5IG3 A;  1TRP A;  1T2I A;  3PXM A;  1RNB A;  3NBR A;  3EN8 A;  4HJL B;  1N9E A;  2WOH A;  2Z6B A;  4N6V 0;  3H51 A;  4O8S A;  3VSY A;  4PEJ A;  1MOL A;  4AKZ A;  4LYL B;  2RNT A;  2E2T A;  2Y73 A;  4STD A;  4LSO A;  1UUW B;  4OK0 A;  2KAA A;  4XDW A;  2F99 A;  3HII A;  3WA3 A;  2M7O A;  3BNB A;  3N9H A;  3V92 A;  3G6E 3;  1IQY A;  1EUI C;  1RTU A;  4HM3 B;  1WQL B;  1M9G A;  1CYU A;  2W56 B;  1OGX A;  3EBT A;  1FUT A;  2F56 A;  3DY5 A;  2J8X B;  2XGL A;  5EQL A;  1W00 A;  1Q81 4;  3U1W A;  3MG3 A;  1SPU A;  1JB4 A;  1UUV B;  2UGI A;  2WGQ A;  2PZV A;  1JN5 A;  3X41 A;  2IY2 A;  1AQZ A;  1QAK A;  2K54 A;  3F9S A;  3NX0 A;  2OTJ 3;  1TUH A;  3JUP A;  1BVI A;  1YJ9 3;  2R41 A;  3BU4 A;  4XDV A;  1KSI A;  4HM2 B;  1GMQ A;  2BNG A;  1EA2 A;  5M1A A;  1QAF A;  3ZG5 A;  2WGO A;  5AEU B;  3N8B A;  1LOV A;  3FGY A;  2XFT A;  3ROB A;  1JBS A;  1JN5 B;  3CPW 2;  1GY5 A;  1RDS A;  1RNT A;  1L5G B;  1I3F A;  1BNR A;  5G1L A;  3CMA 3;  1ULI B;  4HM8 B;  3I56 3;  2W2C A;  1FGM A;  2F4Y A;  1WTH A;  4HAA A;  1A90 A;  3F14 A;  4N6N B;  5JBS A;  1OPY A;  2MF7 A;  1G02 A;  3AHW A;  1LNI A;  5IEN A;  1LOW A;  1JBT A;  5DRV A;  2OQE A;  3GRD A;  3Q1C A;  4CPK A;  1OAC A;  1LOX A;  3CNX A;  3G71 3;  1G96 A;  1RGL A;  3EBY A;  5CF1 A;  1BNE A;  3F7X A;  1GSP A;  5ELJ A;  6GSP A;  1YJN 3;  5TGN A;  1N5P A;  4WP5 A;  4N6T A;  3NM7 A;  1IVX A;  3K0Z A;  4GHO A;  4N6U A;  6STD A;  1QJG A;  1W4N A;  4DKI A;  3T8N A;  4O02 B;  1ZO2 A;  2CFL A;  3D79 A;  3X3Y A;  3E99 A;  1B20 A;  1RLS A;  1W6C A;  1Q42 A;  1DET A;  1RGK A;  4EBG A;  2W9Q A;  1JRQ A;  3SX1 A;  3CU3 A;  1WMN A;  3EX9 A;  2H0G A;  1V57 A;  3KN4 A;  2CG0 A;  4BU4 A;  2QEX 3;  4H3U A;  3D4A A;  1HYF A;  3PCR A;  1NB3 I;  2HML B;  1E3V A;  2XH9 A;  1JV2 B;  1I2F A;  3U97 A;  3AMO A;  3FH1 A;  2I9W A;  4HKV B;  2L4V A;  1BRJ A;  3MWZ A;  4XM4 A;  1JKG A;  3CPO A;  1ZS7 A;  3FG3 A;  3LML A;  1RKY A;  8CHO A;  2GBX B;  3K5T A;  3DH2 A;  3GAX A;  5FGO A;  3DMC A;  3ALA A;  1NU3 A;  1WNH A;  1IU7 A;  3V99 A;  5AYR B;  2CH9 A;  4K1V A;  1BRH A;  1B21 A;  2GEX A;  2BMR B;  2STD A;  2W03 A;  3KZT A;  3RGR A;  5KP1 A;  1JNQ A;  4CJN A;  1VQQ A;  4EYC A;  1K28 A;  3Q90 A;  3DXO A;  1OHP A;  3PGB A;  2XGN A;  3EC9 A;  1O7H B;  3LYG A;  2O3O A;  5EVH A;  3G8Z A;  3GZY B;  3PCS A;  5IEO A;  1J2B A;  5LC6 A;  3CNM A;  1BUJ A;  3N54 B;  2W6J H;  2CX0 A;  1FGT A;  2RSX A;  1S72 3;  1FW7 A;  1DVC A;  1FGQ A;  4GB5 A;  3J7Y d;  1BOX A;  1W2Z A;  2HMK B;  3KSE D;  1Q7Y 4;  2O9U X;  1I2E A;  3SXX A;  2BU4 A;  3STD A;  3KSP A;  4U13 A;  2LYX A;  1ZX2 A;  3MG1 A;  3S5C A;  1LQG C;  2ZHX B;  5AII A;  4BTY A;  2CKF B;  2KCD A;  3TDG A;  1X1Y A;  5RNT A;  1T2H A;  1PFP A;  1W2B 2;  3EQQ B;  1MWT A;  1Q40 A;  4KZ1 A;  1HKX A;  1UI7 A;  5HOH A;  2YFJ B;  1UW1 A;  4J5G A;  1GYB A;  3FF2 A;  3SOA A;  3WHO A;  1B2S A;  7STD A;  3VGN A;  3GZX B;  4XBX A;  2IUK A;  4EXR A;  1KD1 4;  1M90 4;  1RRL A;  1X1X A;  1YJW 3;  4KFD A;  2OTL 3;  1O7N B;  2GEY A;  3WMD A;  3KE7 A;  1AY7 A;  3HZP A;  2BT3 A;  4L7K A;  4WWU C;  3FLJ A;  5AYS C;  3NXJ A;  5KP4 A;  3NV0 A;  2XR8 B;  2R4I A;  1BRS A;  3G4S 3;  3D5I A;  1KQS 2;  1PY3 A;  2BIR A;  1BRI A;  1K41 A;  1RGC A;  5IF6 A;  2HMM B;  1Q82 4;  1KWI A;  4BL2 A;  3CC7 3;  3AGO A;  3IJE B;  1Q9E A;  3JUN A;  1BNS A;  2ML5 A;  2B1X B;  3PS8 A;  3RGA A;  1ISK A;  4R1K A;  1VQ8 3;  1D6Z A;  2W56 A;  1JJ2 2;  3EJV A;  1FZU A;  4HZ9 B;  3BLZ A;  1DE3 A;  3LH4 A;  3RDE A;  1BSE A;  3DGO A;  3QK9 A;  2SBL A;  3A76 A;  2BMQ B;  3MG2 A;  4Q53 A;  3X40 A;  3K9M C;  1IQ8 A;  3DGL A;  1VQM 3;  1RSN A;  1LQM B;  2P09 A;  1UGH I;  3DUK A;  1N8Q A;  1JB5 A;  3KII A;  2MC8 A;  1SII A;  4EV2 A;  1N8R 4;  1UCL A;  4L8O A;  4HZB B;  3WOF B;  5AIF A;  4AKY A;  4MMZ B;  1BSD A;  1O7W B;  4FMC A;  3CCQ 3;  3FKA A;  3A5E A;  4N6O B;  1BAO A;  3CCU 3;  1Y4K A;  3OX9 A;  1EEJ A;  1A2V A;  3LTB A;  3NQY A;  2XRX B;  3DZL A;  4EV5 A;  3CME 3;  3F8H A;  3LTC A;  1W02 A;  3CCV 3;  1OF5 A;  4LZI A;  2CIU A;  1PU4 A;  1ULJ B;  4BTW A;  1K73 4;  4TX4 A;  2E2V A;  3WDG B;  3B8L A;  3FSD A;  1LNH A;  1EQK A;  3MKI A;  2AAD A;  1GOY A;  1GY6 A;  5BIR A;  1BGS A;  1I2G A;  2WO0 A;  5G1K A;  4K61 A;  3RNT A;  7GSP A;  3DGN A;  1IT8 A;  4R4K A;  2GBW B;  3FZW A;  1CH0 A;  1O7M B;  4HM0 B;  1FUS A;  2FNQ A;  2CHC A;  3OV4 A;  2BO9 B;  5CLK A;  5BVB A;  2KF5 A;  4XB5 A;  2CC3 A;  3O8Y A;  1DMQ A;  3OWS A;  1IVU A;  2IYJ A;  4GL6 A;  1MWS A;  5CK6 A;  1TTO A;  1B2U A;  2FXT A;  4FMB A;  1R4Y A;  1LXE A;  2CK3 H;  2E2U A;  5JPU A;  3LT9 A;  1C7H A;  2RGQ A;  1RGE A;  1BUQ A;  2F98 A;  2A15 A;  1RGH A;  4K90 B;  1FYS A;  5D83 A;  1O7P B;  1RRH A;  2XSH B;  1NWW A;  3ER7 A;  3OW2 2;  3HOH A;  4MJD A;  2CWV A;  4ZM8 A;  2HMN B;  2UUG C;  2V1L A;  1IQX A;  1VQ4 3;  4FCJ A;  1W6G A;  1RJO A;  1UI8 A;  4RBN A;  3I55 3;  1B2X A;  1YI2 3;  1IVV A;  1DYU A;  4K1U A;  1IVW A;  9RNT A;  2K3D A;  1VQ9 3;  1B2Z A;  3HIG A;  4IIA A;  4NHF A;  3FG4 A;  1F8N A;  1AV4 A;  4N6L A;  1RGF A;  1ZGX A;  3GZR A;  1IDP A;  5LC7 A;  2ZL8 A;  4O3V A;  4EW5 A;  1GOU A;  2QGU A;  4FCM A;  1YHQ 3;  1OUN A;  3CXC 2;  3UNL A;  4KT3 B;  4HM5 B;  3SVA A;  4R80 A;  2B24 B;  4RNY A;  1RGG A;  2F5M A;  5STD A;  2CFG A;  4OUQ A;  2OCT A;  3DGY A;  1GMR A;  2Y74 A;  1FA3 A;  1OH0 A;  1GMP A;  4EC6 A;  3KFQ C;  1VQ5 3;  4WHA A;  4AEQ A;  3BNC A;  1BRG A;  1IT7 A;  1SJW A;  2GU3 A;  5AI1 A;  1K9M 4;  4N3V A;  5IG0 A;  3EF8 A;  3F8X A;  1X1U A;  3H3H A;  3SOY A;  3LTD A;  2INX A;  4FMD A;  2OOV C;  5A0O B;  4HYZ A;  1FGO A;  3SYU A;  1HZ1 A;  1DMM A;  3WA2 X;  2D1W A;  1GD3 A;  1Q86 4;  3OWY A;  1I0V A;  4CDL A;  1BSB A;  4GSP A;  4FCZ A;  1BAN A;  3CCS 3;  4KFF A;  4XBY A;  5AEW B;  1JBR A;  3K7C A;  3CC4 3;  4NPB A;  2CW9 A;  3BNE A;  4X2O A;  3EB8 A;  4KFE A;  2Q07 A;  3PYJ A;  5AIG A;  5AIH A;  4KVH A;  3CCJ 3;  3D9R A;  1BU4 A;  4RNT A;  3G16 A;  1DMN A;  3S28 A;  2ZA4 A;  3CCR 3;  4LEH A;  1NNV A;  2KF3 A;  3WR2 A;  3IPT A;  2XSO B;  2XEP A;  3UL6 A;  1BNF A;  5EEO A;  3T0U A;  1KC8 4;  1VQO 3;  3GSP A;  1IV9 A;  2IMJ A; 
#chains in the Genus database with same CATH homology
 2P05 A;  1W01 A;  5D81 A;  1MNL A;  2W9P A;  4R9K A;  3GZB A;  1V74 A;  2UX0 A;  3LZA A;  3WOE B;  1A2K A;  3JVC A;  4J8T A;  1YIJ 3;  3CD6 3;  3B4O A;  3K63 A;  3G0K A;  4L8P A;  3EHC A;  5G2G A;  3L0R A;  1QVF 2;  4RZM A;  5FW5 A;  1AR0 A;  3LTA A;  2HMO B;  3ECF A;  1TIJ A;  1OF5 B;  1CYV A;  2PNC A;  2P0M A;  2C11 A;  3FG1 A;  4BTX A;  2LQV A;  3D3L A;  1SIH A;  4HM7 B;  4HVN A;  2Z77 A;  3I0Y A;  4MMY B;  1D6U A;  1NO3 A;  2OQE C;  2C10 A;  3X42 A;  3UB1 A;  2Z76 A;  3AMO B;  1YVB I;  2GU1 A;  2OOV A;  4G1M B;  1AVL A;  1WMO A;  2W04 A;  4R9L A;  5CF2 A;  4WFO A;  1CEW I;  1DVD A;  3X3X A;  1ROA A;  2RFR A;  5KP3 A;  5CXO A;  1OHS A;  2RCD A;  1IK3 A;  2P0X A;  1Q40 B;  3NHX A;  4I4K A;  3MHE A;  3S29 A;  1VQK 3;  5IER A;  3V98 A;  2OWP A;  2Z7A A;  3MSO A;  4MMX B;  3NM2 A;  1RN7 A;  1JKG B;  3UJM A;  3QRD A;  1VQ7 3;  3FF0 A;  3BND A;  3M8C A;  3Q2P A;  3JUM A;  4OVM A;  2FGT A;  2CFD A;  3NV0 B;  4QWT A;  4WYK B;  3NBJ A;  3WOD G;  1QMA A;  1GY7 A;  1N9J A;  2YX9 A;  3S67 A;  3F7S A;  4J9A A;  2XFS A;  1N5H A;  2YFI B;  4NRE A;  4LGQ A;  3EE1 A;  3KKG A;  2IUJ A;  1HU9 A;  3LOY A;  1VQP 3;  4H61 A;  1S5A A;  1VQL 3;  1W5Z A;  4CCV A;  5IG4 A;  2QA4 3;  1IV7 A;  1EG9 B;  4MEI A;  4RNZ A;  3LXU X;  3CCE 3;  1TU5 A;  3CCL 3;  1VQ6 3;  1STF I;  1U8C B;  1ROV A;  3HK4 A;  1ASK A;  2F86 B;  3MPH A;  1OGZ A;  2HMJ B;  1TP6 A;  2CFW A;  1NB5 I;  1OHO A;  4N6M A;  4XBT A;  2KXG A;  2IA7 A;  5DRE A;  1W7C A;  1D6Y A;  1EKM A;  2ZDJ A;  5IG5 A;  3NUV A;  4LMI A;  1W6Y A;  1T5Y A;  3B7C A;  3SLU A;  1STD A;  4JRF A;  3BB9 A;  5D82 A;  2CG1 A;  2CWT A;  3JUO A;  3T8U A;  5JPP A;  5ELU A;  2CWU A;  2BMO B;  1WMP A;  3CCM 3;  4HBR A;  4ORL A;  1TFO A;  5BXQ A;  1K8A 4;  1AVK A;  2BHM A;  3FCS B;  4FR9 A;  2K0M A;  3PZW A;  3CC2 3;  3LT8 A;  2YFL B;  3OXA A;  1FUW A;  1US1 A;  1E3R A;  1OCV A;  1SQW A;  2QIY A;  3OWU A;  1CQS A;  1E97 A;  2D42 A;  3HI7 A;  3SED A;  3S27 A;  3HX8 A;  1QVG 2;  3MYT A;  1O7G B;  2P38 A;  5I97 A;  3VF1 A;  3JUQ A;  2W0Q A;  1R4C A;  1TFK A;  1VZZ A;  1LVN A;  3NBB A;  4IT7 A;  2CFK A;  4HM1 B;  1NDO B;  1VQN 3;  2JDI H;  4FMA A;  4IPB A;  1Z1S A;  1QAL A;  1YGE A;  3B4P A;  3F40 A;  4X2H A;  3UL5 A;  3GWR A;  3DM8 A;  2ML6 A;  1JB2 A;  3DGM A;  2GXF A;  4HM6 B;  1GS3 A;  1M1K 4;  3X3Z A;  5IEP A;  3NQZ A;  5HGR A;  2XF3 A;  3IMA B;  1A67 A;  2KRT A;  3EN1 B;  2JQ5 A;  1FGR A;  4O2H A;  1YIT 3;  1GD4 A;  2WOF A;  4WYK A;  1M1X B;  1U5O A;  1NJI 4;  4HM4 B;  4JF8 A;  5IW9 A;  5IG3 A;  3PXM A;  3NBR A;  3EN8 A;  4HJL B;  1N9E A;  2WOH A;  2Z6B A;  4N6V 0;  3H51 A;  4O8S A;  3VSY A;  4PEJ A;  1MOL A;  4AKZ A;  2E2T A;  2Y73 A;  4STD A;  4LSO A;  1UUW B;  4OK0 A;  4XDW A;  3WA3 A;  2F99 A;  3HII A;  2M7O A;  3BNB A;  3N9H A;  3V92 A;  3G6E 3;  1IQY A;  4HM3 B;  1WQL B;  1M9G A;  1CYU A;  2W56 B;  1OGX A;  3EBT A;  3DY5 A;  2XGL A;  5EQL A;  1W00 A;  1Q81 4;  3U1W A;  3MG3 A;  1SPU A;  1JB4 A;  1UUV B;  2WGQ A;  2PZV A;  1JN5 A;  3X41 A;  2K54 A;  1QAK A;  3F9S A;  3NX0 A;  2OTJ 3;  1TUH A;  3JUP A;  1YJ9 3;  4XDV A;  1KSI A;  4HM2 B;  2BNG A;  1EA2 A;  1QAF A;  2WGO A;  5AEU B;  3N8B A;  3FGY A;  2XFT A;  3ROB A;  1JN5 B;  3CPW 2;  1GY5 A;  1L5G B;  3CMA 3;  1ULI B;  4HM8 B;  3I56 3;  2W2C A;  1FGM A;  1WTH A;  1A90 A;  3F14 A;  4N6N B;  5JBS A;  1OPY A;  2MF7 A;  5IEN A;  5DRV A;  2OQE A;  3GRD A;  3Q1C A;  1OAC A;  1LOX A;  3CNX A;  3G71 3;  1G96 A;  3EBY A;  5CF1 A;  3F7X A;  5ELJ A;  1YJN 3;  5TGN A;  1N5P A;  4WP5 A;  4N6T A;  3NM7 A;  1IVX A;  3K0Z A;  6STD A;  4N6U A;  1QJG A;  1W4N A;  3T8N A;  4O02 B;  1ZO2 A;  2CFL A;  3X3Y A;  3E99 A;  1W6C A;  1Q42 A;  4EBG A;  2W9Q A;  1JRQ A;  3SX1 A;  3CU3 A;  1WMN A;  3EX9 A;  3KN4 A;  2CG0 A;  2QEX 3;  4H3U A;  3PCR A;  1NB3 I;  2HML B;  1E3V A;  2XH9 A;  1JV2 B;  3U97 A;  3AMO A;  3FH1 A;  2I9W A;  4HKV B;  2L4V A;  3MWZ A;  4XM4 A;  1JKG A;  3CPO A;  3FG3 A;  3LML A;  1RKY A;  8CHO A;  2GBX B;  3K5T A;  3GAX A;  5FGO A;  3DMC A;  3ALA A;  1NU3 A;  1WNH A;  1IU7 A;  3V99 A;  5AYR B;  2CH9 A;  4K1V A;  2GEX A;  3KZT A;  2BMR B;  2STD A;  2W03 A;  3RGR A;  5KP1 A;  1JNQ A;  4EYC A;  1K28 A;  3Q90 A;  3DXO A;  1OHP A;  3PGB A;  2XGN A;  3EC9 A;  1O7H B;  3LYG A;  2O3O A;  5EVH A;  3G8Z A;  3GZY B;  3PCS A;  5IEO A;  1J2B A;  5LC6 A;  3CNM A;  3N54 B;  2W6J H;  1S72 3;  1FGT A;  2RSX A;  1DVC A;  1FGQ A;  4GB5 A;  3J7Y d;  1W2Z A;  2HMK B;  3KSE D;  1Q7Y 4;  2O9U X;  3SXX A;  3STD A;  3KSP A;  4U13 A;  2LYX A;  1ZX2 A;  3MG1 A;  3S5C A;  5AII A;  4BTY A;  2CKF B;  2KCD A;  3TDG A;  1PFP A;  1W2B 2;  3EQQ B;  1Q40 A;  4KZ1 A;  1HKX A;  1UI7 A;  2YFJ B;  1UW1 A;  1GYB A;  3FF2 A;  3SOA A;  7STD A;  3VGN A;  3GZX B;  4XBX A;  2IUK A;  4EXR A;  1KD1 4;  1M90 4;  1RRL A;  1YJW 3;  4KFD A;  2OTL 3;  1O7N B;  2GEY A;  3WMD A;  3KE7 A;  3HZP A;  4L7K A;  2BT3 A;  4WWU C;  5KP4 A;  3FLJ A;  5AYS C;  3NXJ A;  3NV0 A;  2XR8 B;  2R4I A;  3G4S 3;  1KQS 2;  1K41 A;  5IF6 A;  2HMM B;  1Q82 4;  1KWI A;  3CC7 3;  3IJE B;  3JUN A;  2ML5 A;  2B1X B;  3PS8 A;  3RGA A;  1ISK A;  4R1K A;  1VQ8 3;  1D6Z A;  2W56 A;  1JJ2 2;  3EJV A;  4HZ9 B;  3BLZ A;  3LH4 A;  3RDE A;  3DGO A;  3QK9 A;  2SBL A;  3A76 A;  2BMQ B;  3MG2 A;  4Q53 A;  3X40 A;  3K9M C;  1IQ8 A;  3DGL A;  1VQM 3;  2P09 A;  3KII A;  3DUK A;  1N8Q A;  1JB5 A;  2MC8 A;  4EV2 A;  1SII A;  1N8R 4;  4L8O A;  4HZB B;  3WOF B;  5AIF A;  4AKY A;  4MMZ B;  1O7W B;  4FMC A;  3CCQ 3;  3FKA A;  4N6O B;  3CCU 3;  1Y4K A;  3OX9 A;  1A2V A;  3LTB A;  3NQY A;  2XRX B;  3DZL A;  4EV5 A;  3CME 3;  3F8H A;  3LTC A;  1W02 A;  3CCV 3;  1OF5 A;  4LZI A;  2CIU A;  1PU4 A;  1ULJ B;  4BTW A;  1K73 4;  4TX4 A;  2E2V A;  3WDG B;  3B8L A;  3FSD A;  1LNH A;  1EQK A;  3MKI A;  1GY6 A;  2WO0 A;  4K61 A;  3DGN A;  1IT8 A;  4R4K A;  2GBW B;  3FZW A;  1O7M B;  4HM0 B;  2FNQ A;  3OV4 A;  2CHC A;  2BO9 B;  5CLK A;  5BVB A;  4XB5 A;  2CC3 A;  3O8Y A;  1DMQ A;  3OWS A;  1IVU A;  4GL6 A;  5CK6 A;  2FXT A;  4FMB A;  1LXE A;  2CK3 H;  2E2U A;  5JPU A;  3LT9 A;  1C7H A;  2RGQ A;  1BUQ A;  2F98 A;  2A15 A;  4K90 B;  5D83 A;  1O7P B;  1RRH A;  2XSH B;  1NWW A;  3ER7 A;  3OW2 2;  4MJD A;  2CWV A;  4ZM8 A;  2HMN B;  2V1L A;  1VQ4 3;  1IQX A;  4FCJ A;  1W6G A;  1RJO A;  1UI8 A;  4RBN A;  3I55 3;  1YI2 3;  1IVV A;  1DYU A;  4K1U A;  1IVW A;  1VQ9 3;  3HIG A;  4IIA A;  4NHF A;  3FG4 A;  1F8N A;  1AV4 A;  4N6L A;  3GZR A;  1IDP A;  5LC7 A;  2ZL8 A;  4O3V A;  2QGU A;  4FCM A;  1YHQ 3;  1OUN A;  3CXC 2;  3UNL A;  4HM5 B;  3SVA A;  4R80 A;  2B24 B;  4RNY A;  5STD A;  2CFG A;  4OUQ A;  2OCT A;  2Y74 A;  1FA3 A;  1OH0 A;  4EC6 A;  3KFQ C;  1VQ5 3;  4WHA A;  4AEQ A;  3BNC A;  1IT7 A;  1SJW A;  2GU3 A;  5AI1 A;  1K9M 4;  4N3V A;  5IG0 A;  3EF8 A;  3F8X A;  3SOY A;  3H3H A;  3LTD A;  2INX A;  4FMD A;  2OOV C;  5A0O B;  4HYZ A;  1FGO A;  1DMM A;  3WA2 X;  1GD3 A;  2D1W A;  1Q86 4;  3OWY A;  4CDL A;  4FCZ A;  3CCS 3;  4KFF A;  4XBY A;  5AEW B;  3K7C A;  3CC4 3;  2CW9 A;  3BNE A;  4X2O A;  3EB8 A;  4KFE A;  2Q07 A;  3PYJ A;  5AIG A;  5AIH A;  4KVH A;  3CCJ 3;  3D9R A;  3G16 A;  1DMN A;  3S28 A;  3CCR 3;  4LEH A;  3IPT A;  2XSO B;  2XEP A;  3UL6 A;  5EEO A;  3T0U A;  1KC8 4;  1VQO 3;  1IV9 A;  2IMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...