3U97A

1.1 angstrom-resolution crystal structure of the brucella abortus ribonuclease toxin, brnt
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
TMKIIWDEPKRQTNIAKHGLDFADLHFEFFLSAKVFPTKADRLMAIGEFNGLIIIAVIFKPVGSEALSVISMRSASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease toxin BrnT
publication title Molecular Structure and Function of the Novel BrnT/BrnA Toxin-Antitoxin System of Brucella abortus.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Hydrolase
total genus 15
structure length 77
sequence length 77
ec nomenclature ec 3.1.27.1: Transferred entry: 4.6.1.19.
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04365 BrnT_toxin Ribonuclease toxin, BrnT, of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.530 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3u97A00
3U97A
chains in the Genus database with same CATH superfamily
2SBLA 5KP3A 1JB4A 2F5WA 5IF6A 3N9HA 3G16A 2F4YA 1YGWA 2CW9A 2CWUA 4HM8B 1TFKA 5KP1A 1I8VA 1N9JA 1LNHA 3KCHA 5AIFA 5G1KA 5FW5A 3PXMA 5M1AA 1NJI4 1N8QA 1DETA 2P0XA 3AMOB 2JQ5A 3NQZA 4N6MA 4R9LA 1KQS2 4GB5A 1JBRA 1Q9EA 1B2MA 1IV7A 1YNVX 2P09A 3S29A 3DGMA 3G0KA 1YGEA 2CFDA 5ELJA 2HMLB 2WO0A 3PGBA 1VQP3 1JZDA 1HZ1A 4IIAA 2YFIB 3NM7A 2XH9A 1Q814 4FCMA 4MMYB 4CJNA 7GSPA 1CQSA 3EB8A 4EW5A 3GZBA 1ZS7A 4O8SA 4OK0A 3NQYA 2XGLA 5DRVA 3WOFB 1PFPA 1LOXA 1Q42A 1TRQA 1UCLA 5IG5A 4HOHA 3JUNA 3B4PA 3FLJA 1BSBA 3H51A 4O02B 3ZFZA 1X1WA 3KN4A 3ALAA 2BT3A 3MHEA 5EEOA 3ZG0A 1GSPA 1OUNA 5M18A 1O7WB 3A76A 2Z6BA 3FKAA 1EQKA 4BTWA 5FGOA 2W03A 3IMAB 1PY3A 3DMCA 4H61A 3DH2A 3JUMA 2BMRB 1JRQA 1T2HA 4N6LA 3FH1A 3LMLA 2BU4A 1Z1SA 1FW7A 3LZAA 3SLUA 4H3UA 1QALA 3LTCA 3JUOA 5M19A 2GU1A 8CHOA 2D1WA 1RRHA 1IVXA 1FA3A 2F86B 2I9WA 1IK3A 3CCJ3 1OGXA 2ML5A 3Q1CA 2GBWB 1US1A 1BOXA 3NV0B 1ROVA 1M904 5IG3A 1JJ22 2B24B 1AV4A 3CNXA 2LYXA 2F99A 3CME3 1M1K4 1FYSA 1J2BA 1UUWB 2W56A 4LSOA 5LC6A 2AAEA 1RMSA 1UUGB 1FUTA 1LOYA 1EA2A 2XFTA 1PYLA 3KSED 3SXXA 3D9RA 2HMMB 2XEPA 3PCSA 3KFQC 1T5YA 1K28A 1S723 1BUJA 1SARA 4BIRA 3JUQA 3G713 1RGGA 4HZ9B 2W2CA 2XSOB 3OWYA 2CFLA 4LEHA 2OQEC 4KZ1A 3OX9A 3BLZA 3TDGA 1NB5I 1QAFA 1ISKA 1CYUA 2OWPA 1VQL3 2STDA 5D81A 3OWUA 4LYLB 4BL3A 4R80A 2PZVA 1B20A 5CK6A 1OF5B 1SIHA 2CFKA 1C54A 4RNYA 2FNQA 1CH0A 3OV4A 3CCV3 4X2OA 4R1KA 3BNEA 3CCE3 3G6E3 3KKGA 3FGYA 1I2FA 2R41A 2CC3A 1VQM3 1BNFA 1BSCA 1IVUA 1T3BA 3BNCA 4WP5A 5IEPA 1JBSA 4OVMA 1BSDA 1JKGB 4OUQA 5IG4A 2CG1A 1O7MB 2WGQA 2Y73A 2W9QA 3JUPA 4WHAA 5CF1A 5RNTA 2QGUA 1IVWA 1A90A 4JRFA 4O2HA 4J8TA 3QRDA 1HU9A 3WDGB 3NUVA 1JN5B 3F14A 2C11A 1F8NA 3NM2A 4U13A 3NX0A 1MNLA 2GU3A 3Q3FA 1Q864 1BRSA 2MF7A 1UW1A 4K61A 3CCS3 1RGKA 3DGYA 1LVNA 3D3LA 8RNTA 1BRKA 3F9SA 1JZOA 3HIGA 1MGWA 5GSPA 4AKZA 4ILFA 2CFWA 3J7Yd 3FF0A 4HJLB 2GEYA 4WYKA 3GSPA 1SJWA 2OQEA 1DVDA 1DMMA 1LRAA 3NBBA 2A15A 3UNLA 1B27A 3NBRA 2UUGC 1WMNA 3IJEB 1O7GB 3JVCA 4HM2B 1EEJA 4I5QA 3RGRA 1ASKA 1GY5A 2Z7AA 1EKMA 1AVLA 1GMPA 1ULJB 3FG4A 1CEWI 4XBYA 3X3ZA 4BU4A 4WFOA 5D83A 3PS8A 3FG1A 3SVAA 3PZWA 2SARA 1QVF2 1O7PB 3K5TA 1M9GA 2KF4A 4K1UA 1RRLA 3X41A 3EN8A 1IT8A 1MWRA 2ML6A 3X40A 4LZIA 1IQYA 1BNJA 2HOHA 1R4CA 3MG1A 3MG3A 3T0UA 7STDA 2OOVA 2CWTA 5LC7A 3SOAA 1FZUA 1OHSA 3EX9A 2KF3A 3G8ZA 3H3HA 1G02A 4N3VA 4BL2A 3OXAA 4TX4A 3K63A 1NB3I 2W04A 4HVNA 4N6UA 2ZDJA 3F7SA 1ULIB 2O3OA 1WQLB 1NO3A 1RTUA 2AADA 4HM3B 3CCQ3 5CXOA 2H0GA 4AEQA 3EE1A 3CCL3 2XSHB 4HM0B 1VQO3 1VQN3 3D79A 1Q40A 3T8UA 1KSIA 1D6ZA 5EQLA 1LXEA 1TTOA 4RZMA 1GS3A 3S27A 1KD14 2M7OA 3EHCA 1VQ83 1G0TA 3WMDA 3CPOA 1DMQA 2R4IA 4EV2A 2ZL8A 3KIIA 4NREA 1RKYA 1STFI 1OH0A 1K41A 1UGHI 2Q07A 2P05A 3BNDA 1FUSA 3DUKA 6RNTA 3HIIA 4MJDA 1JKGA 2BO9B 1X1XA 2F98A 3D5GA 3MG2A 1Q824 1Y4KA 1UUVB 2XFSA 3X3XA 1V74A 2HMNB 1W6GA 3CXC2 3M8CA 3F8XA 1B2XA 4FMCA 4N6TA 1S5AA 1WMOA 1B2ZA 2K54A 4R9KA 1GYBA 3LT9A 4STDA 3WHOA 4FMAA 4HM7B 4BTXA 4L7KA 4RNTA 1GOVA 1RHLA 4GHOA 2KF5A 3VGNA 5G2GA 3DXOA 1MOLA 4HM5B 2MC8A 4EBGA 3MSOA 4BTYA 5AIGA 2CKFB 1Q7HA 1BRNL 1PU4A 1VQ93 3HOHA 2OTJ3 2P38A 3OW22 5CLKA 3UL5A 3VF1A 5JPPA 1KC84 2XRXB 2YFLB 2CIUA 1A2PA 1TUHA 1IV9A 1I3FA 3LTBA 3ER7A 2KAAA 3RDEA 3G4S3 3AHSA 1RN1A 3HZPA 2B1XB 2P0MA 1UCJA 3U97A 3X3YA 2E2TA 1OACA 4GL6A 3CC23 2H0IA 3EF8A 1BVIA 1BSAA 3WOEB 1A2KA 4LMIA 3UB1A 4HYZA 1I3IA 2UX0A 2WGOA 1RGLA 1W01A 1FGQA 2GSPA 3BB9A 1V57A 4EC6A 1UDII 4HKVB 4J9AA 3I563 3LTDA 1RN7A 3DM8A 2IUJA 3EJVA 2F56A 1WTHA 3LOYA 1B3SA 3B7CA 3RGAA 4L8OA 3E99A 1TU5A 5AEWB 1AQZA 2KF6A 2QA43 1W5ZA 2CX1A 1VQK3 1L5GB 3CC43 2UGIA 3AMOA 2IA7A 1IDPA 1HKXA 3U1WA 2L1SA 5BXQA 1RGFA 2BHMA 1GY6A 2OOVC 1NNVA 3URPA 3CPW2 1GMQA 1LOVA 2PNCA 4FCZA 1YJW3 2HMJB 1G96A 3MPHA 3F40A 1RDSA 1ZGXA 1ZX2A 4JF8A 4MEIA 3N8BA 3EC9A 1LOWA 3CCM3 3F7XA 1I2EA 4WWUC 1RNBA 2C10A 3SYUA 1IVVA 3DGNA 1O7HB 5AYRB 1BNIA 3K0ZA 2RGQA 3EN1B 3HI7A 1OGZA 1D6UA 3K9MC 1I0XA 4NHFA 1VQ43 1CYVA 1SQWA 3D5IA 5STDA 1W2ZA 3GZRA 1FUWA 3OWSA 4EXRA 1GOYA 1SPUA 1GD3A 2BIRA 1YIT3 1HYFA 1RGEA 2YFJB 5IG0A 5IERA 4G1MB 3V92A 1BNEA 1ROAA 3ROBA 4EYCA 3FZWA 5EVHA 1UI7A 2GEXA 3VSYA 2KXGA 3ZG5A 3QK9A 3AHWA 1AR0A 1WNHA 2W56B 5G1LA 1LNIA 1BNRA 1RNTA 3T8NA 2Z77A 3S5CA 3ECFA 4GSPA 2LQVA 1MWSA 1W02A 2QIYA 2FGTA 1NU3A 3N54B 3NV0A 4FCJA 4IT7A 3X42A 4MMZB 2XR8B 3PCRA 3WR2A 1N5PA 2O9UX 3EBYA 3DGOA 1BGSA 1OCVA 1RN4A 3LTAA 4QWTA 1BNSA 3L0RA 4CCVA 2D42A 2J8XB 4XDVA 3S67A 5KP4A 3EBTA 2HMOB 3LT8A 2BNGA 1LQGC 2INXA 1D6YA 2WOFA 1QJGA 4FMDA 2CH9A 4N6V0 1E3RA 4X2HA 3FCSB 1BUQA 4KFDA 3CNMA 4HM1B 1JBTA 3O8YA 3B8LA 5HGRA 3UL6A 1N5HA 1OF5A 4DKIA 1W6YA 3SX1A 3KZTA 3HX8A 1BRJA 1W7CA 4ORLA 4N6NB 3CD63 2Y74A 4KFEA 2CG0A 1FGRA 4KT3B 6GSPA 3GRDA 1QAKA 1NWWA 2BMQB 2CK3H 2HMKB 1UI8A 2IYJA 2RCDA 3AGNA 1WMPA 3DGLA 4XM4A 1IT7A 3NHXA 1JB2A 1NDOB 3S28A 4HAAA 4CPKA 2OCTA 1JN5A 4EV5A 1E3VA 2E2VA 4N6OB 4Q53A 1GOUA 4WYKB 1TIJA 1N9EA 4XBTA 1K9M4 1VQ63 3GZYB 2IY2A 1R4YA 3BNBA 1DYUA 1OHPA 2JDIH 3WA3A 1KWIA 1RJOA 1T2IA 3B4OA 1VZZA 4HZBB 1N8R4 3LH4A 4J5KA 1X1YA 1RLSA 3V98A 4L8PA 1B21A 1MGRA 2YX9A 1K8A4 1U8CB 1AY7A 1YJN3 1TRPA 1UCKA 2V1LA 1QMAA 2ZA4A 1B2SA 3KE7A 4XDWA 2KCDA 1DVCA 1ZO2A 2CFGA 3LXUX 5AIHA 3FSDA 4AKYA 2OTL3 1YI23 4IPBA 1DE3A 3BU4A 1STDA 3FG3A 4FMBA 1IYYA 1FGTA 1FGOA 3I553 4RNZA 3FF2A 4K90B 1AVKA 5AYSC 3CCR3 1A67A 4K1VA 1MWUA 3GAXA 1EG9B 2W9PA 1YVSA 1VQ53 1UCIA 1GD4A 4O3VA 2K3DA 4I4KA 3IPTA 3AGOA 2GBXB 4KVHA 5ELUA 1BRGA 1W2B2 4HBRA 4MMXB 5IEOA 1A2VA 3SOYA 5JBSA 1GMRA 1FGMA 4XBXA 3CU3A 3I0YA 4PEJA 1I0VA 3K7CA 1Q40B 2CWVA 4CDLA 1IU7A 1QVG2 1U5OA 2C4BA 4FR9A 5BVBA 1TP6A 1TJDA 1BAOA 2ZHXB 3F8HA 4ZM8A 5TGNA 4R4KA 5HOHA 1B2UA 1BNGA 6STDA 3HK4A 2K0MA 2RNTA 1OHOA 3D4AA 1M1XB 2RBIA 1DMNA 5D82A 2W0QA 5AI1A 2CX0A 3UJMA 5I97A 1YVBI 2H0HA 1I2GA 1RGHA 1BSEA 2F5MA 3BIRA 4XB5A 1BRIA 1V58A 2WOHA 2GXFA 3Q2PA 5CF2A 2QEX3 5JPUA 1K734 2FXTA 1JB5A 3GZXB 3PYJA 5BIRA 4KFFA 2Z76A 2XGNA 5DREA 3RNTA 3CCU3 3MKIA 2RFRA 5AIIA 1O7NB 4HM6B 1RCKA 5AEUB 5IW9A 3DY5A 3DZLA 1UGIA 3LYGA 1BRHA 1YIJ3 4NPBA 1IQXA 3WA2X 1E97A 1RCLA 2CHCA 3GWRA 3NBJA 1MWTA 1YHQ3 1I70A 1OPYA 4LGQA 1RSNA 1TFOA 1IQ8A 4HM4B 3CC73 1Q7Y4 7RNTA 1JNQA 2RSXA 2IUKA 1GY7A 3KSPA 5A0OB 2L4VA 2IMJA 3STDA 1LQMB 1W6CA 2E2UA 3NXJA 5IENA 1EUIC 3MYTA 1RGCA 2W6JH 5BU4A 3Q90A 3SEDA 1C7HA 1X1UA 1BU4A 1BIRA 3WODG 9RNTA 1VQ73 1JV2B 3CMA3 3EQQB 3MWZA 1YJ93 2KRTA 2BMOB 2XF3A 3V99A 1BANA 1RGAA 1VQQA 3A5EA 1W00A 1SIIA 4RBNA 4J5GA 1W4NA
chains in the Genus database with same CATH topology
2SBLA 5KP3A 1JB4A 5IF6A 3N9HA 3G16A 2CW9A 2CWUA 4HM8B 1TFKA 5KP1A 1N9JA 1LNHA 5AIFA 5FW5A 3PXMA 1NJI4 1N8QA 2P0XA 3AMOB 2JQ5A 3NQZA 4N6MA 4R9LA 1KQS2 4GB5A 1IV7A 2P09A 3S29A 3DGMA 3G0KA 1YGEA 2CFDA 5ELJA 2HMLB 2WO0A 3PGBA 1VQP3 4IIAA 2YFIB 3NM7A 2XH9A 1Q814 4FCMA 4MMYB 1CQSA 3EB8A 3GZBA 4O8SA 4OK0A 5DRVA 3NQYA 2XGLA 3WOFB 1PFPA 1LOXA 1Q42A 5IG5A 3JUNA 3B4PA 3FLJA 3H51A 4O02B 5EEOA 3KN4A 3ALAA 2BT3A 3MHEA 1OUNA 1O7WB 3A76A 2Z6BA 3FKAA 1EQKA 4BTWA 5FGOA 2W03A 3IMAB 3DMCA 4H61A 4N6LA 3JUMA 2BMRB 1JRQA 3FH1A 3LMLA 1Z1SA 3LZAA 3SLUA 4H3UA 1QALA 3LTCA 3JUOA 2GU1A 8CHOA 2D1WA 1RRHA 1IVXA 1FA3A 2F86B 2I9WA 1IK3A 3CCJ3 1OGXA 2ML5A 3Q1CA 2GBWB 1US1A 3NV0B 1ROVA 1M904 5IG3A 1JJ22 2B24B 1AV4A 3CNXA 2LYXA 2F99A 3CME3 1M1K4 1J2BA 1UUWB 2W56A 4LSOA 5LC6A 2XFTA 1EA2A 3KSED 3SXXA 3D9RA 2HMMB 2XEPA 3PCSA 3KFQC 1T5YA 1K28A 1S723 3JUQA 3G713 4HZ9B 2W2CA 2XSOB 3OWYA 2CFLA 4LEHA 2OQEC 4KZ1A 3OX9A 3BLZA 3TDGA 1NB5I 1QAFA 1ISKA 1CYUA 2OWPA 1VQL3 2STDA 5D81A 3OWUA 4R80A 2PZVA 5CK6A 1OF5B 1SIHA 2CFKA 4RNYA 2FNQA 3OV4A 3CCV3 4X2OA 4R1KA 3BNEA 3CCE3 3G6E3 3KKGA 3FGYA 2CC3A 1VQM3 1IVUA 3BNCA 4WP5A 5IEPA 4OVMA 1JKGB 4OUQA 5IG4A 2CG1A 1O7MB 2WGQA 2Y73A 2W9QA 3JUPA 4WHAA 5CF1A 2QGUA 1IVWA 1A90A 4JRFA 4J8TA 3QRDA 1HU9A 3WDGB 3NUVA 1JN5B 3F14A 2C11A 1F8NA 3NM2A 4U13A 3NX0A 1MNLA 2GU3A 1Q864 2MF7A 1UW1A 4K61A 3CCS3 1LVNA 3D3LA 3F9SA 4AKZA 3HIGA 2CFWA 3J7Yd 3FF0A 4HJLB 2GEYA 4WYKA 2OQEA 1SJWA 1DVDA 1DMMA 3NBBA 3UNLA 2A15A 3NBRA 1WMNA 3IJEB 1O7GB 3JVCA 4HM2B 3RGRA 1ASKA 1GY5A 2Z7AA 1EKMA 1AVLA 1ULJB 3FG4A 1CEWI 4XBYA 3X3ZA 4WFOA 5D83A 3PS8A 3FG1A 3SVAA 3PZWA 1QVF2 1O7PB 3K5TA 1M9GA 4K1UA 1RRLA 3X41A 3EN8A 1IT8A 2ML6A 3X40A 4LZIA 1IQYA 1R4CA 3MG1A 3MG3A 3T0UA 7STDA 2OOVA 2CWTA 5LC7A 3SOAA 1OHSA 3EX9A 3G8ZA 3H3HA 4N3VA 3OXAA 4TX4A 3K63A 1NB3I 2W04A 4HVNA 4N6UA 2ZDJA 3F7SA 1ULIB 2O3OA 1WQLB 1NO3A 3CCQ3 4HM3B 5CXOA 4AEQA 3EE1A 3CCL3 2XSHB 4HM0B 1VQO3 1VQN3 1Q40A 3T8UA 1KSIA 1D6ZA 5EQLA 1LXEA 4RZMA 1GS3A 3S27A 1KD14 2M7OA 3EHCA 1VQ83 3WMDA 3CPOA 1DMQA 2R4IA 4EV2A 2ZL8A 3KIIA 4NREA 1RKYA 1STFI 1OH0A 1K41A 2Q07A 2P05A 3BNDA 3DUKA 3HIIA 4MJDA 1JKGA 2BO9B 2F98A 3MG2A 1Q824 1Y4KA 1UUVB 2XFSA 3X3XA 1V74A 2HMNB 1W6GA 3CXC2 3M8CA 3F8XA 4FMCA 4N6TA 1S5AA 1WMOA 2K54A 4R9KA 4BTXA 1GYBA 3LT9A 4STDA 4FMAA 4HM7B 4L7KA 3VGNA 5G2GA 3DXOA 1MOLA 4HM5B 2MC8A 4EBGA 3MSOA 4BTYA 5AIGA 2CKFB 1PU4A 1VQ93 2OTJ3 2P38A 3OW22 5CLKA 3UL5A 3VF1A 5JPPA 1KC84 2XRXB 2YFLB 2CIUA 3LTBA 1TUHA 1IV9A 3ER7A 3G4S3 3RDEA 3HZPA 2P0MA 2B1XB 3U97A 3X3YA 2E2TA 1OACA 4GL6A 3CC23 3EF8A 3WOEB 1A2KA 4LMIA 3UB1A 4HYZA 2UX0A 2WGOA 1W01A 3BB9A 1FGQA 4EC6A 4HKVB 4J9AA 3I563 3LTDA 1RN7A 3DM8A 2IUJA 3EJVA 1WTHA 3LOYA 3B7CA 3RGAA 4L8OA 3E99A 1TU5A 5AEWB 2QA43 1W5ZA 1VQK3 3CC43 1L5GB 3AMOA 2IA7A 1IDPA 1HKXA 3U1WA 5BXQA 2BHMA 1GY6A 2OOVC 3CPW2 2PNCA 4FCZA 1YJW3 2HMJB 1G96A 3MPHA 3F40A 1ZX2A 4JF8A 4MEIA 3N8BA 3EC9A 3CCM3 3F7XA 4WWUC 2C10A 1IVVA 3DGNA 1O7HB 5AYRB 3K0ZA 4O2HA 2RGQA 3EN1B 3HI7A 1OGZA 1D6UA 3K9MC 4NHFA 1VQ43 1CYVA 1SQWA 5STDA 1W2ZA 3GZRA 1FUWA 3OWSA 4EXRA 1SPUA 1GD3A 1YIT3 2YFJB 5IG0A 5IERA 4G1MB 3V92A 1ROAA 3ROBA 4EYCA 3FZWA 5EVHA 1UI7A 2GEXA 3VSYA 2KXGA 3QK9A 1AR0A 1WNHA 2W56B 3T8NA 2Z77A 3S5CA 3ECFA 2LQVA 1W02A 2QIYA 3NV0A 2FGTA 1NU3A 3N54B 4FCJA 4IT7A 3X42A 4MMZB 2XR8B 3PCRA 1N5PA 2O9UX 3EBYA 3DGOA 1OCVA 3LTAA 4QWTA 3L0RA 4CCVA 2D42A 4XDVA 3S67A 5KP4A 3EBTA 2HMOB 3LT8A 2BNGA 2INXA 1D6YA 2WOFA 1QJGA 4FMDA 2CH9A 4N6V0 1E3RA 4X2HA 3FCSB 1BUQA 4KFDA 3CNMA 4HM1B 3O8YA 3B8LA 5HGRA 3UL6A 1N5HA 1OF5A 1W6YA 3SX1A 3KZTA 3HX8A 1W7CA 4ORLA 4N6NB 3CD63 2Y74A 4KFEA 2CG0A 1FGRA 3GRDA 1QAKA 1NWWA 2BMQB 2CK3H 2HMKB 1UI8A 2RCDA 3DGLA 4XM4A 1WMPA 1IT7A 3NHXA 1JB2A 1NDOB 3S28A 2OCTA 1JN5A 4EV5A 1E3VA 2E2VA 4N6OB 4Q53A 4WYKB 4XBTA 1TIJA 1N9EA 1K9M4 1VQ63 3GZYB 3BNBA 1DYUA 1OHPA 2JDIH 3WA3A 1KWIA 1RJOA 3B4OA 1VZZA 4HZBB 1N8R4 3LH4A 3V98A 4L8PA 2YX9A 1K8A4 1U8CB 1YJN3 3KE7A 2V1LA 1QMAA 4XDWA 2KCDA 1DVCA 1ZO2A 2CFGA 3LXUX 5AIHA 3FSDA 4AKYA 2OTL3 1YI23 4IPBA 1STDA 3FG3A 4FMBA 1FGTA 1FGOA 3I553 4RNZA 3FF2A 4K90B 1AVKA 5AYSC 3CCR3 1A67A 4K1VA 3GAXA 1EG9B 2W9PA 1VQ53 1GD4A 4O3VA 4I4KA 3IPTA 4KVHA 2GBXB 5ELUA 1W2B2 4HBRA 4MMXB 5IEOA 1A2VA 3SOYA 5JBSA 4XBXA 1FGMA 3CU3A 3I0YA 4PEJA 3K7CA 1Q40B 2CWVA 4CDLA 1IU7A 1QVG2 1U5OA 4FR9A 5BVBA 1TP6A 3F8HA 4ZM8A 5TGNA 4R4KA 6STDA 3HK4A 2K0MA 1OHOA 1M1XB 1DMNA 5D82A 2W0QA 5AI1A 3UJMA 5I97A 1YVBI 4XB5A 2QEX3 2WOHA 2GXFA 3Q2PA 5CF2A 1K734 5JPUA 2FXTA 1JB5A 3GZXB 3PYJA 4KFFA 2Z76A 2XGNA 5DREA 3CCU3 3MKIA 2RFRA 5AIIA 1O7NB 4HM6B 5AEUB 5IW9A 3DY5A 3DZLA 3LYGA 1YIJ3 1IQXA 3WA2X 1E97A 3NBJA 2CHCA 3GWRA 1YHQ3 1OPYA 4LGQA 4HM4B 1TFOA 1IQ8A 3CC73 1Q7Y4 1JNQA 2RSXA 2IUKA 1GY7A 3KSPA 5A0OB 2L4VA 2IMJA 3STDA 1W6CA 3NXJA 2E2UA 5IENA 3MYTA 2W6JH 3Q90A 3SEDA 1C7HA 3WODG 1VQ73 1JV2B 3CMA3 3EQQB 3MWZA 1YJ93 2KRTA 2BMOB 2XF3A 3V99A 1W00A 1SIIA 4RBNA 1W4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U97 A; 
#chains in the Genus database with same CATH topology
 2SBL A;  5KP3 A;  1JB4 A;  2F5W A;  5IF6 A;  3N9H A;  3G16 A;  2F4Y A;  1YGW A;  2CW9 A;  2CWU A;  4HM8 B;  1TFK A;  5KP1 A;  1I8V A;  1N9J A;  1LNH A;  3KCH A;  5AIF A;  5G1K A;  5FW5 A;  3PXM A;  5M1A A;  1NJI 4;  1N8Q A;  1DET A;  2P0X A;  3AMO B;  2JQ5 A;  3NQZ A;  4N6M A;  4R9L A;  1KQS 2;  4GB5 A;  1JBR A;  1Q9E A;  1B2M A;  1IV7 A;  1YNV X;  2P09 A;  3S29 A;  3DGM A;  3G0K A;  1YGE A;  2CFD A;  5ELJ A;  2HML B;  2WO0 A;  3PGB A;  1VQP 3;  1JZD A;  1HZ1 A;  4IIA A;  2YFI B;  3NM7 A;  2XH9 A;  1Q81 4;  4FCM A;  4MMY B;  4CJN A;  7GSP A;  1CQS A;  3EB8 A;  4EW5 A;  3GZB A;  1ZS7 A;  4O8S A;  4OK0 A;  3NQY A;  2XGL A;  5DRV A;  3WOF B;  1PFP A;  1LOX A;  1Q42 A;  1TRQ A;  1UCL A;  5IG5 A;  4HOH A;  3JUN A;  3B4P A;  3FLJ A;  1BSB A;  3H51 A;  4O02 B;  3ZFZ A;  1X1W A;  3KN4 A;  3ALA A;  2BT3 A;  3MHE A;  5EEO A;  3ZG0 A;  1GSP A;  1OUN A;  5M18 A;  1O7W B;  3A76 A;  2Z6B A;  3FKA A;  1EQK A;  4BTW A;  5FGO A;  2W03 A;  3IMA B;  1PY3 A;  3DMC A;  4H61 A;  3DH2 A;  3JUM A;  2BMR B;  1JRQ A;  1T2H A;  4N6L A;  3FH1 A;  3LML A;  2BU4 A;  1Z1S A;  1FW7 A;  3LZA A;  3SLU A;  4H3U A;  1QAL A;  3LTC A;  3JUO A;  5M19 A;  2GU1 A;  8CHO A;  2D1W A;  1RRH A;  1IVX A;  1FA3 A;  2F86 B;  2I9W A;  1IK3 A;  3CCJ 3;  1OGX A;  2ML5 A;  3Q1C A;  2GBW B;  1US1 A;  1BOX A;  3NV0 B;  1ROV A;  1M90 4;  5IG3 A;  1JJ2 2;  2B24 B;  1AV4 A;  3CNX A;  2LYX A;  2F99 A;  3CME 3;  1M1K 4;  1FYS A;  1J2B A;  1UUW B;  2W56 A;  4LSO A;  5LC6 A;  2AAE A;  1RMS A;  1UUG B;  1FUT A;  1LOY A;  1EA2 A;  2XFT A;  1PYL A;  3KSE D;  3SXX A;  3D9R A;  2HMM B;  2XEP A;  3PCS A;  3KFQ C;  1T5Y A;  1K28 A;  1S72 3;  1BUJ A;  1SAR A;  4BIR A;  3JUQ A;  3G71 3;  1RGG A;  4HZ9 B;  2W2C A;  2XSO B;  3OWY A;  2CFL A;  4LEH A;  2OQE C;  4KZ1 A;  3OX9 A;  3BLZ A;  3TDG A;  1NB5 I;  1QAF A;  1ISK A;  1CYU A;  2OWP A;  1VQL 3;  2STD A;  5D81 A;  3OWU A;  4LYL B;  4BL3 A;  4R80 A;  2PZV A;  1B20 A;  5CK6 A;  1OF5 B;  1SIH A;  2CFK A;  1C54 A;  4RNY A;  2FNQ A;  1CH0 A;  3OV4 A;  3CCV 3;  4X2O A;  4R1K A;  3BNE A;  3CCE 3;  3G6E 3;  3KKG A;  3FGY A;  1I2F A;  2R41 A;  2CC3 A;  1VQM 3;  1BNF A;  1BSC A;  1IVU A;  1T3B A;  3BNC A;  4WP5 A;  5IEP A;  1JBS A;  4OVM A;  1BSD A;  1JKG B;  4OUQ A;  5IG4 A;  2CG1 A;  1O7M B;  2WGQ A;  2Y73 A;  2W9Q A;  3JUP A;  4WHA A;  5CF1 A;  5RNT A;  2QGU A;  1IVW A;  1A90 A;  4JRF A;  4O2H A;  4J8T A;  3QRD A;  1HU9 A;  3WDG B;  3NUV A;  1JN5 B;  3F14 A;  2C11 A;  1F8N A;  3NM2 A;  4U13 A;  3NX0 A;  1MNL A;  2GU3 A;  3Q3F A;  1Q86 4;  1BRS A;  2MF7 A;  1UW1 A;  4K61 A;  3CCS 3;  1RGK A;  3DGY A;  1LVN A;  3D3L A;  8RNT A;  1BRK A;  3F9S A;  1JZO A;  3HIG A;  1MGW A;  5GSP A;  4AKZ A;  4ILF A;  2CFW A;  3J7Y d;  3FF0 A;  4HJL B;  2GEY A;  4WYK A;  3GSP A;  1SJW A;  2OQE A;  1DVD A;  1DMM A;  1LRA A;  3NBB A;  2A15 A;  3UNL A;  1B27 A;  3NBR A;  2UUG C;  1WMN A;  3IJE B;  1O7G B;  3JVC A;  4HM2 B;  1EEJ A;  4I5Q A;  3RGR A;  1ASK A;  1GY5 A;  2Z7A A;  1EKM A;  1AVL A;  1GMP A;  1ULJ B;  3FG4 A;  1CEW I;  4XBY A;  3X3Z A;  4BU4 A;  4WFO A;  5D83 A;  3PS8 A;  3FG1 A;  3SVA A;  3PZW A;  2SAR A;  1QVF 2;  1O7P B;  3K5T A;  1M9G A;  2KF4 A;  4K1U A;  1RRL A;  3X41 A;  3EN8 A;  1IT8 A;  1MWR A;  2ML6 A;  3X40 A;  4LZI A;  1IQY A;  1BNJ A;  2HOH A;  1R4C A;  3MG1 A;  3MG3 A;  3T0U A;  7STD A;  2OOV A;  2CWT A;  5LC7 A;  3SOA A;  1FZU A;  1OHS A;  3EX9 A;  2KF3 A;  3G8Z A;  3H3H A;  1G02 A;  4N3V A;  4BL2 A;  3OXA A;  4TX4 A;  3K63 A;  1NB3 I;  2W04 A;  4HVN A;  4N6U A;  2ZDJ A;  3F7S A;  1ULI B;  2O3O A;  1WQL B;  1NO3 A;  1RTU A;  2AAD A;  4HM3 B;  3CCQ 3;  5CXO A;  2H0G A;  4AEQ A;  3EE1 A;  3CCL 3;  2XSH B;  4HM0 B;  1VQO 3;  1VQN 3;  3D79 A;  1Q40 A;  3T8U A;  1KSI A;  1D6Z A;  5EQL A;  1LXE A;  1TTO A;  4RZM A;  1GS3 A;  3S27 A;  1KD1 4;  2M7O A;  3EHC A;  1VQ8 3;  1G0T A;  3WMD A;  3CPO A;  1DMQ A;  2R4I A;  4EV2 A;  2ZL8 A;  3KII A;  4NRE A;  1RKY A;  1STF I;  1OH0 A;  1K41 A;  1UGH I;  2Q07 A;  2P05 A;  3BND A;  1FUS A;  3DUK A;  6RNT A;  3HII A;  4MJD A;  1JKG A;  2BO9 B;  1X1X A;  2F98 A;  3D5G A;  3MG2 A;  1Q82 4;  1Y4K A;  1UUV B;  2XFS A;  3X3X A;  1V74 A;  2HMN B;  1W6G A;  3CXC 2;  3M8C A;  3F8X A;  1B2X A;  4FMC A;  4N6T A;  1S5A A;  1WMO A;  1B2Z A;  2K54 A;  4R9K A;  1GYB A;  3LT9 A;  4STD A;  3WHO A;  4FMA A;  4HM7 B;  4BTX A;  4L7K A;  4RNT A;  1GOV A;  1RHL A;  4GHO A;  2KF5 A;  3VGN A;  5G2G A;  3DXO A;  1MOL A;  4HM5 B;  2MC8 A;  4EBG A;  3MSO A;  4BTY A;  5AIG A;  2CKF B;  1Q7H A;  1BRN L;  1PU4 A;  1VQ9 3;  3HOH A;  2OTJ 3;  2P38 A;  3OW2 2;  5CLK A;  3UL5 A;  3VF1 A;  5JPP A;  1KC8 4;  2XRX B;  2YFL B;  2CIU A;  1A2P A;  1TUH A;  1IV9 A;  1I3F A;  3LTB A;  3ER7 A;  2KAA A;  3RDE A;  3G4S 3;  3AHS A;  1RN1 A;  3HZP A;  2B1X B;  2P0M A;  1UCJ A;  3U97 A;  3X3Y A;  2E2T A;  1OAC A;  4GL6 A;  3CC2 3;  2H0I A;  3EF8 A;  1BVI A;  1BSA A;  3WOE B;  1A2K A;  4LMI A;  3UB1 A;  4HYZ A;  1I3I A;  2UX0 A;  2WGO A;  1RGL A;  1W01 A;  1FGQ A;  2GSP A;  3BB9 A;  1V57 A;  4EC6 A;  1UDI I;  4HKV B;  4J9A A;  3I56 3;  3LTD A;  1RN7 A;  3DM8 A;  2IUJ A;  3EJV A;  2F56 A;  1WTH A;  3LOY A;  1B3S A;  3B7C A;  3RGA A;  4L8O A;  3E99 A;  1TU5 A;  5AEW B;  1AQZ A;  2KF6 A;  2QA4 3;  1W5Z A;  2CX1 A;  1VQK 3;  1L5G B;  3CC4 3;  2UGI A;  3AMO A;  2IA7 A;  1IDP A;  1HKX A;  3U1W A;  2L1S A;  5BXQ A;  1RGF A;  2BHM A;  1GY6 A;  2OOV C;  1NNV A;  3URP A;  3CPW 2;  1GMQ A;  1LOV A;  2PNC A;  4FCZ A;  1YJW 3;  2HMJ B;  1G96 A;  3MPH A;  3F40 A;  1RDS A;  1ZGX A;  1ZX2 A;  4JF8 A;  4MEI A;  3N8B A;  3EC9 A;  1LOW A;  3CCM 3;  3F7X A;  1I2E A;  4WWU C;  1RNB A;  2C10 A;  3SYU A;  1IVV A;  3DGN A;  1O7H B;  5AYR B;  1BNI A;  3K0Z A;  2RGQ A;  3EN1 B;  3HI7 A;  1OGZ A;  1D6U A;  3K9M C;  1I0X A;  4NHF A;  1VQ4 3;  1CYV A;  1SQW A;  3D5I A;  5STD A;  1W2Z A;  3GZR A;  1FUW A;  3OWS A;  4EXR A;  1GOY A;  1SPU A;  1GD3 A;  2BIR A;  1YIT 3;  1HYF A;  1RGE A;  2YFJ B;  5IG0 A;  5IER A;  4G1M B;  3V92 A;  1BNE A;  1ROA A;  3ROB A;  4EYC A;  3FZW A;  5EVH A;  1UI7 A;  2GEX A;  3VSY A;  2KXG A;  3ZG5 A;  3QK9 A;  3AHW A;  1AR0 A;  1WNH A;  2W56 B;  5G1L A;  1LNI A;  1BNR A;  1RNT A;  3T8N A;  2Z77 A;  3S5C A;  3ECF A;  4GSP A;  2LQV A;  1MWS A;  1W02 A;  2QIY A;  2FGT A;  1NU3 A;  3N54 B;  3NV0 A;  4FCJ A;  4IT7 A;  3X42 A;  4MMZ B;  2XR8 B;  3PCR A;  3WR2 A;  1N5P A;  2O9U X;  3EBY A;  3DGO A;  1BGS A;  1OCV A;  1RN4 A;  3LTA A;  4QWT A;  1BNS A;  3L0R A;  4CCV A;  2D42 A;  2J8X B;  4XDV A;  3S67 A;  5KP4 A;  3EBT A;  2HMO B;  3LT8 A;  2BNG A;  1LQG C;  2INX A;  1D6Y A;  2WOF A;  1QJG A;  4FMD A;  2CH9 A;  4N6V 0;  1E3R A;  4X2H A;  3FCS B;  1BUQ A;  4KFD A;  3CNM A;  4HM1 B;  1JBT A;  3O8Y A;  3B8L A;  5HGR A;  3UL6 A;  1N5H A;  1OF5 A;  4DKI A;  1W6Y A;  3SX1 A;  3KZT A;  3HX8 A;  1BRJ A;  1W7C A;  4ORL A;  4N6N B;  3CD6 3;  2Y74 A;  4KFE A;  2CG0 A;  1FGR A;  4KT3 B;  6GSP A;  3GRD A;  1QAK A;  1NWW A;  2BMQ B;  2CK3 H;  2HMK B;  1UI8 A;  2IYJ A;  2RCD A;  3AGN A;  1WMP A;  3DGL A;  4XM4 A;  1IT7 A;  3NHX A;  1JB2 A;  1NDO B;  3S28 A;  4HAA A;  4CPK A;  2OCT A;  1JN5 A;  4EV5 A;  1E3V A;  2E2V A;  4N6O B;  4Q53 A;  1GOU A;  4WYK B;  1TIJ A;  1N9E A;  4XBT A;  1K9M 4;  1VQ6 3;  3GZY B;  2IY2 A;  1R4Y A;  3BNB A;  1DYU A;  1OHP A;  2JDI H;  3WA3 A;  1KWI A;  1RJO A;  1T2I A;  3B4O A;  1VZZ A;  4HZB B;  1N8R 4;  3LH4 A;  4J5K A;  1X1Y A;  1RLS A;  3V98 A;  4L8P A;  1B21 A;  1MGR A;  2YX9 A;  1K8A 4;  1U8C B;  1AY7 A;  1YJN 3;  1TRP A;  1UCK A;  2V1L A;  1QMA A;  2ZA4 A;  1B2S A;  3KE7 A;  4XDW A;  2KCD A;  1DVC A;  1ZO2 A;  2CFG A;  3LXU X;  5AIH A;  3FSD A;  4AKY A;  2OTL 3;  1YI2 3;  4IPB A;  1DE3 A;  3BU4 A;  1STD A;  3FG3 A;  4FMB A;  1IYY A;  1FGT A;  1FGO A;  3I55 3;  4RNZ A;  3FF2 A;  4K90 B;  1AVK A;  5AYS C;  3CCR 3;  1A67 A;  4K1V A;  1MWU A;  3GAX A;  1EG9 B;  2W9P A;  1YVS A;  1VQ5 3;  1UCI A;  1GD4 A;  4O3V A;  2K3D A;  4I4K A;  3IPT A;  3AGO A;  2GBX B;  4KVH A;  5ELU A;  1BRG A;  1W2B 2;  4HBR A;  4MMX B;  5IEO A;  1A2V A;  3SOY A;  5JBS A;  1GMR A;  1FGM A;  4XBX A;  3CU3 A;  3I0Y A;  4PEJ A;  1I0V A;  3K7C A;  1Q40 B;  2CWV A;  4CDL A;  1IU7 A;  1QVG 2;  1U5O A;  2C4B A;  4FR9 A;  5BVB A;  1TP6 A;  1TJD A;  1BAO A;  2ZHX B;  3F8H A;  4ZM8 A;  5TGN A;  4R4K A;  5HOH A;  1B2U A;  1BNG A;  6STD A;  3HK4 A;  2K0M A;  2RNT A;  1OHO A;  3D4A A;  1M1X B;  2RBI A;  1DMN A;  5D82 A;  2W0Q A;  5AI1 A;  2CX0 A;  3UJM A;  5I97 A;  1YVB I;  2H0H A;  1I2G A;  1RGH A;  1BSE A;  2F5M A;  3BIR A;  4XB5 A;  1BRI A;  1V58 A;  2WOH A;  2GXF A;  3Q2P A;  5CF2 A;  2QEX 3;  5JPU A;  1K73 4;  2FXT A;  1JB5 A;  3GZX B;  3PYJ A;  5BIR A;  4KFF A;  2Z76 A;  2XGN A;  5DRE A;  3RNT A;  3CCU 3;  3MKI A;  2RFR A;  5AII A;  1O7N B;  4HM6 B;  1RCK A;  5AEU B;  5IW9 A;  3DY5 A;  3DZL A;  1UGI A;  3LYG A;  1BRH A;  1YIJ 3;  4NPB A;  1IQX A;  3WA2 X;  1E97 A;  1RCL A;  2CHC A;  3GWR A;  3NBJ A;  1MWT A;  1YHQ 3;  1I70 A;  1OPY A;  4LGQ A;  1RSN A;  1TFO A;  1IQ8 A;  4HM4 B;  3CC7 3;  1Q7Y 4;  7RNT A;  1JNQ A;  2RSX A;  2IUK A;  1GY7 A;  3KSP A;  5A0O B;  2L4V A;  2IMJ A;  3STD A;  1LQM B;  1W6C A;  2E2U A;  3NXJ A;  5IEN A;  1EUI C;  3MYT A;  1RGC A;  2W6J H;  5BU4 A;  3Q90 A;  3SED A;  1C7H A;  1X1U A;  1BU4 A;  1BIR A;  3WOD G;  9RNT A;  1VQ7 3;  1JV2 B;  3CMA 3;  3EQQ B;  3MWZ A;  1YJ9 3;  2KRT A;  2BMO B;  2XF3 A;  3V99 A;  1BAN A;  1RGA A;  1VQQ A;  3A5E A;  1W00 A;  1SII A;  4RBN A;  4J5G A;  1W4N A; 
#chains in the Genus database with same CATH homology
 2SBL A;  5KP3 A;  1JB4 A;  5IF6 A;  3N9H A;  3G16 A;  2CW9 A;  2CWU A;  4HM8 B;  1TFK A;  5KP1 A;  1N9J A;  1LNH A;  5AIF A;  5FW5 A;  3PXM A;  1NJI 4;  1N8Q A;  2P0X A;  3AMO B;  2JQ5 A;  3NQZ A;  4N6M A;  4R9L A;  1KQS 2;  4GB5 A;  1IV7 A;  2P09 A;  3S29 A;  3DGM A;  3G0K A;  1YGE A;  2CFD A;  5ELJ A;  2HML B;  2WO0 A;  3PGB A;  1VQP 3;  4IIA A;  2YFI B;  3NM7 A;  2XH9 A;  1Q81 4;  4FCM A;  4MMY B;  1CQS A;  3EB8 A;  3GZB A;  4O8S A;  4OK0 A;  5DRV A;  3NQY A;  2XGL A;  3WOF B;  1PFP A;  1LOX A;  1Q42 A;  5IG5 A;  3JUN A;  3B4P A;  3FLJ A;  3H51 A;  4O02 B;  5EEO A;  3KN4 A;  3ALA A;  2BT3 A;  3MHE A;  1OUN A;  1O7W B;  3A76 A;  2Z6B A;  3FKA A;  1EQK A;  4BTW A;  5FGO A;  2W03 A;  3IMA B;  3DMC A;  4H61 A;  4N6L A;  3JUM A;  2BMR B;  1JRQ A;  3FH1 A;  3LML A;  1Z1S A;  3LZA A;  3SLU A;  4H3U A;  1QAL A;  3LTC A;  3JUO A;  2GU1 A;  8CHO A;  2D1W A;  1RRH A;  1IVX A;  1FA3 A;  2F86 B;  2I9W A;  1IK3 A;  3CCJ 3;  1OGX A;  2ML5 A;  3Q1C A;  2GBW B;  1US1 A;  3NV0 B;  1ROV A;  1M90 4;  5IG3 A;  1JJ2 2;  2B24 B;  1AV4 A;  3CNX A;  2LYX A;  2F99 A;  3CME 3;  1M1K 4;  1J2B A;  1UUW B;  2W56 A;  4LSO A;  5LC6 A;  2XFT A;  1EA2 A;  3KSE D;  3SXX A;  3D9R A;  2HMM B;  2XEP A;  3PCS A;  3KFQ C;  1T5Y A;  1K28 A;  1S72 3;  3JUQ A;  3G71 3;  4HZ9 B;  2W2C A;  2XSO B;  3OWY A;  2CFL A;  4LEH A;  2OQE C;  4KZ1 A;  3OX9 A;  3BLZ A;  3TDG A;  1NB5 I;  1QAF A;  1ISK A;  1CYU A;  2OWP A;  1VQL 3;  2STD A;  5D81 A;  3OWU A;  4R80 A;  2PZV A;  5CK6 A;  1OF5 B;  1SIH A;  2CFK A;  4RNY A;  2FNQ A;  3OV4 A;  3CCV 3;  4X2O A;  4R1K A;  3BNE A;  3CCE 3;  3G6E 3;  3KKG A;  3FGY A;  2CC3 A;  1VQM 3;  1IVU A;  3BNC A;  4WP5 A;  5IEP A;  4OVM A;  1JKG B;  4OUQ A;  5IG4 A;  2CG1 A;  1O7M B;  2WGQ A;  2Y73 A;  2W9Q A;  3JUP A;  4WHA A;  5CF1 A;  2QGU A;  1IVW A;  1A90 A;  4JRF A;  4J8T A;  3QRD A;  1HU9 A;  3WDG B;  3NUV A;  1JN5 B;  3F14 A;  2C11 A;  1F8N A;  3NM2 A;  4U13 A;  3NX0 A;  1MNL A;  2GU3 A;  1Q86 4;  2MF7 A;  1UW1 A;  4K61 A;  3CCS 3;  1LVN A;  3D3L A;  3F9S A;  4AKZ A;  3HIG A;  2CFW A;  3J7Y d;  3FF0 A;  4HJL B;  2GEY A;  4WYK A;  2OQE A;  1SJW A;  1DVD A;  1DMM A;  3NBB A;  3UNL A;  2A15 A;  3NBR A;  1WMN A;  3IJE B;  1O7G B;  3JVC A;  4HM2 B;  3RGR A;  1ASK A;  1GY5 A;  2Z7A A;  1EKM A;  1AVL A;  1ULJ B;  3FG4 A;  1CEW I;  4XBY A;  3X3Z A;  4WFO A;  5D83 A;  3PS8 A;  3FG1 A;  3SVA A;  3PZW A;  1QVF 2;  1O7P B;  3K5T A;  1M9G A;  4K1U A;  1RRL A;  3X41 A;  3EN8 A;  1IT8 A;  2ML6 A;  3X40 A;  4LZI A;  1IQY A;  1R4C A;  3MG1 A;  3MG3 A;  3T0U A;  7STD A;  2OOV A;  2CWT A;  5LC7 A;  3SOA A;  1OHS A;  3EX9 A;  3G8Z A;  3H3H A;  4N3V A;  3OXA A;  4TX4 A;  3K63 A;  1NB3 I;  2W04 A;  4HVN A;  4N6U A;  2ZDJ A;  3F7S A;  1ULI B;  2O3O A;  1WQL B;  1NO3 A;  3CCQ 3;  4HM3 B;  5CXO A;  4AEQ A;  3EE1 A;  3CCL 3;  2XSH B;  4HM0 B;  1VQO 3;  1VQN 3;  1Q40 A;  3T8U A;  1KSI A;  1D6Z A;  5EQL A;  1LXE A;  4RZM A;  1GS3 A;  3S27 A;  1KD1 4;  2M7O A;  3EHC A;  1VQ8 3;  3WMD A;  3CPO A;  1DMQ A;  2R4I A;  4EV2 A;  2ZL8 A;  3KII A;  4NRE A;  1RKY A;  1STF I;  1OH0 A;  1K41 A;  2Q07 A;  2P05 A;  3BND A;  3DUK A;  3HII A;  4MJD A;  1JKG A;  2BO9 B;  2F98 A;  3MG2 A;  1Q82 4;  1Y4K A;  1UUV B;  2XFS A;  3X3X A;  1V74 A;  2HMN B;  1W6G A;  3CXC 2;  3M8C A;  3F8X A;  4FMC A;  4N6T A;  1S5A A;  1WMO A;  2K54 A;  4R9K A;  4BTX A;  1GYB A;  3LT9 A;  4STD A;  4FMA A;  4HM7 B;  4L7K A;  3VGN A;  5G2G A;  3DXO A;  1MOL A;  4HM5 B;  2MC8 A;  4EBG A;  3MSO A;  4BTY A;  5AIG A;  2CKF B;  1PU4 A;  1VQ9 3;  2OTJ 3;  2P38 A;  3OW2 2;  5CLK A;  3UL5 A;  3VF1 A;  5JPP A;  1KC8 4;  2XRX B;  2YFL B;  2CIU A;  3LTB A;  1TUH A;  1IV9 A;  3ER7 A;  3G4S 3;  3RDE A;  3HZP A;  2P0M A;  2B1X B;  3U97 A;  3X3Y A;  2E2T A;  1OAC A;  4GL6 A;  3CC2 3;  3EF8 A;  3WOE B;  1A2K A;  4LMI A;  3UB1 A;  4HYZ A;  2UX0 A;  2WGO A;  1W01 A;  3BB9 A;  1FGQ A;  4EC6 A;  4HKV B;  4J9A A;  3I56 3;  3LTD A;  1RN7 A;  3DM8 A;  2IUJ A;  3EJV A;  1WTH A;  3LOY A;  3B7C A;  3RGA A;  4L8O A;  3E99 A;  1TU5 A;  5AEW B;  2QA4 3;  1W5Z A;  1VQK 3;  3CC4 3;  1L5G B;  3AMO A;  2IA7 A;  1IDP A;  1HKX A;  3U1W A;  5BXQ A;  2BHM A;  1GY6 A;  2OOV C;  3CPW 2;  2PNC A;  4FCZ A;  1YJW 3;  2HMJ B;  1G96 A;  3MPH A;  3F40 A;  1ZX2 A;  4JF8 A;  4MEI A;  3N8B A;  3EC9 A;  3CCM 3;  3F7X A;  4WWU C;  2C10 A;  1IVV A;  3DGN A;  1O7H B;  5AYR B;  3K0Z A;  4O2H A;  2RGQ A;  3EN1 B;  3HI7 A;  1OGZ A;  1D6U A;  3K9M C;  4NHF A;  1VQ4 3;  1CYV A;  1SQW A;  5STD A;  1W2Z A;  3GZR A;  1FUW A;  3OWS A;  4EXR A;  1SPU A;  1GD3 A;  1YIT 3;  2YFJ B;  5IG0 A;  5IER A;  4G1M B;  3V92 A;  1ROA A;  3ROB A;  4EYC A;  3FZW A;  5EVH A;  1UI7 A;  2GEX A;  3VSY A;  2KXG A;  3QK9 A;  1AR0 A;  1WNH A;  2W56 B;  3T8N A;  2Z77 A;  3S5C A;  3ECF A;  2LQV A;  1W02 A;  2QIY A;  3NV0 A;  2FGT A;  1NU3 A;  3N54 B;  4FCJ A;  4IT7 A;  3X42 A;  4MMZ B;  2XR8 B;  3PCR A;  1N5P A;  2O9U X;  3EBY A;  3DGO A;  1OCV A;  3LTA A;  4QWT A;  3L0R A;  4CCV A;  2D42 A;  4XDV A;  3S67 A;  5KP4 A;  3EBT A;  2HMO B;  3LT8 A;  2BNG A;  2INX A;  1D6Y A;  2WOF A;  1QJG A;  4FMD A;  2CH9 A;  4N6V 0;  1E3R A;  4X2H A;  3FCS B;  1BUQ A;  4KFD A;  3CNM A;  4HM1 B;  3O8Y A;  3B8L A;  5HGR A;  3UL6 A;  1N5H A;  1OF5 A;  1W6Y A;  3SX1 A;  3KZT A;  3HX8 A;  1W7C A;  4ORL A;  4N6N B;  3CD6 3;  2Y74 A;  4KFE A;  2CG0 A;  1FGR A;  3GRD A;  1QAK A;  1NWW A;  2BMQ B;  2CK3 H;  2HMK B;  1UI8 A;  2RCD A;  3DGL A;  4XM4 A;  1WMP A;  1IT7 A;  3NHX A;  1JB2 A;  1NDO B;  3S28 A;  2OCT A;  1JN5 A;  4EV5 A;  1E3V A;  2E2V A;  4N6O B;  4Q53 A;  4WYK B;  4XBT A;  1TIJ A;  1N9E A;  1K9M 4;  1VQ6 3;  3GZY B;  3BNB A;  1DYU A;  1OHP A;  2JDI H;  3WA3 A;  1KWI A;  1RJO A;  3B4O A;  1VZZ A;  4HZB B;  1N8R 4;  3LH4 A;  3V98 A;  4L8P A;  2YX9 A;  1K8A 4;  1U8C B;  1YJN 3;  3KE7 A;  2V1L A;  1QMA A;  4XDW A;  2KCD A;  1DVC A;  1ZO2 A;  2CFG A;  3LXU X;  5AIH A;  3FSD A;  4AKY A;  2OTL 3;  1YI2 3;  4IPB A;  1STD A;  3FG3 A;  4FMB A;  1FGT A;  1FGO A;  3I55 3;  4RNZ A;  3FF2 A;  4K90 B;  1AVK A;  5AYS C;  3CCR 3;  1A67 A;  4K1V A;  3GAX A;  1EG9 B;  2W9P A;  1VQ5 3;  1GD4 A;  4O3V A;  4I4K A;  3IPT A;  4KVH A;  2GBX B;  5ELU A;  1W2B 2;  4HBR A;  4MMX B;  5IEO A;  1A2V A;  3SOY A;  5JBS A;  4XBX A;  1FGM A;  3CU3 A;  3I0Y A;  4PEJ A;  3K7C A;  1Q40 B;  2CWV A;  4CDL A;  1IU7 A;  1QVG 2;  1U5O A;  4FR9 A;  5BVB A;  1TP6 A;  3F8H A;  4ZM8 A;  5TGN A;  4R4K A;  6STD A;  3HK4 A;  2K0M A;  1OHO A;  1M1X B;  1DMN A;  5D82 A;  2W0Q A;  5AI1 A;  3UJM A;  5I97 A;  1YVB I;  4XB5 A;  2QEX 3;  2WOH A;  2GXF A;  3Q2P A;  5CF2 A;  1K73 4;  5JPU A;  2FXT A;  1JB5 A;  3GZX B;  3PYJ A;  4KFF A;  2Z76 A;  2XGN A;  5DRE A;  3CCU 3;  3MKI A;  2RFR A;  5AII A;  1O7N B;  4HM6 B;  5AEU B;  5IW9 A;  3DY5 A;  3DZL A;  3LYG A;  1YIJ 3;  1IQX A;  3WA2 X;  1E97 A;  3NBJ A;  2CHC A;  3GWR A;  1YHQ 3;  1OPY A;  4LGQ A;  4HM4 B;  1TFO A;  1IQ8 A;  3CC7 3;  1Q7Y 4;  1JNQ A;  2RSX A;  2IUK A;  1GY7 A;  3KSP A;  5A0O B;  2L4V A;  2IMJ A;  3STD A;  1W6C A;  3NXJ A;  2E2U A;  5IEN A;  3MYT A;  2W6J H;  3Q90 A;  3SED A;  1C7H A;  3WOD G;  1VQ7 3;  1JV2 B;  3CMA 3;  3EQQ B;  3MWZ A;  1YJ9 3;  2KRT A;  2BMO B;  2XF3 A;  3V99 A;  1W00 A;  1SII A;  4RBN A;  1W4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...