3U9HA

Complex structure of human tankyrase 2 with nicotinamide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of selective inhibition of human tankyrases.
pubmed doi rcsb
molecule keywords Tankyrase-2
molecule tags Transferase
source organism Homo sapiens
total genus 69
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 3u9hA00
4HHYA 2RD6A 4PNRA 5ETYA 4UVOA 5C5QA 4ZZYA 3SMIA 3KR7A 4L70A 4HKNA 4BU7A 4L0TA 4L7UA 4UVTA 5C5PA 3KCZA 4KZQA 4UW1A 5AL3A 4UVLA 4BJBA 4UVWA 4J3MA 4L2FA 4UUHA 4IUEA 4UX4A 5ADQA 4TVJA 4MSKA 4J22A 5AL2A 4BUEA 4UFUA 4HKIA 4LI8A 4UI4A 4XHUA 4K4EA 4HLKA 4TJYA 4L6SA 4BU6A 4BJCA 1UK0A 3W51A 4BUYA 2RCWA 4L7NA 5DCZA 3UA9A 4DQYC 4KRSA 4BU8A 4UVVA 4GV0A 5ADTA 4KZLA 4RV6A 4BU5A 3UDDA 4BUAA 3L3MA 4UHGA 3KR8A 4J1ZA 3U9YA 4AVWA 4LI7A 4TKFA 4TK5A 2X5YA 4J3LA 4UXBA 5AL5A 4L33A 4GV7A 3C4HA 4UI6A 3U9HA 4L2KA 3HKVA 3C49A 4ZZXA 4UVYA 4BUIA 4UI3A 5AKUA 4UI5A 1WOKA 4BUXA 4HMHA 4L7PA 4M7BA 4TJUA 4TJWA 4N3RA 4BUVA 3GJWA 3GN7A 5ECEA 4OQAC 4BUWA 4L0VA 4UVZA 3SMJA 4BS4A 4TKGA 4PNSA 4LI6A 4HYFA 3KJDA 1UK1A 3MHKA 3P0NA 4I9IA 4GV2A 4L10A 4UVUA 4W6EA 4U6AA 4HLMA 4UVSA 4OPXC 3UH2A 4W5IA 4HLFA 4PMLA 4UVNA 4L7OA 4BU9A 4L7LA 4UI8A 2PAWA 4L2GA 4PAXA 4TORA 4N4TA 4PY4A 4PNMA 4R6EA 5FPFA 5LX6A 5LYHA 3UH4A 4HHZA 1EFYA 5AEHA 5LXPA 5FPGA 4OQBC 3FHBA 4K4FA 4HKKA 4AVUA 4MT9A 4UNDA 4TKIA 4GV4A 3BLJA 4TK0A 4L32A 4BUFA 2RF5A 3P0PA 1A26A 4L09A 4HLGA 4L6ZA 4TOSA 4L0IA 4UVPA 4PJVA 4BUUA 4HLHA 5AKWA 4HL5A 4F1QA 5AL4A 4W5SA 5A00A 1PAXA 4N4VA 4UVXA 4ZZZA 4PNTA 3GEYA 4L0BA 4F1LA 4BUDA 4L0SA 4PNNA 4F0EA 4J21A 3PAXA 4PNQA 2PAXA 4R5WA 4BUTA 3CE0A 3MHJA 5ADSA 4X52A 4MSGA 1GS0A 5AL1A 3SE2A 4BJ9A 4L7RA 4KZUA 4OA7A 4PNLA 5ADRA 4BFPA 4BU3A 4DVIA 5EBTA 4BUSA 3P0QA 4L34A 4PJTA 3L3LA 3GOYA 4UFYA 4UI7A 5C5RA 2PQFA 4L31A
chains in the Genus database with same CATH superfamily
4HHYA 2RD6A 4PNRA 5ETYA 4UVOA 5C5QA 4ZZYA 3SMIA 3KR7A 4L70A 4HKNA 4BU7A 3DT4A 4L0TA 4L7UA 4UVTA 5C5PA 3KCZA 1K3DA 4KZQA 4UW1A 5AL3A 4UVLA 4BJBA 4UVWA 4J3MA 4L2FA 4UUHA 4IUEA 4UX4A 5ADQA 4TVJA 4MSKA 4J22A 5AL2A 4BUEA 4UFUA 4HKIA 4LI8A 4UI4A 4XHUA 2RKDA 4K4EA 4HLKA 4TJYA 4L6SA 4BU6A 4BJCA 1UK0A 2PY7X 3MOFA 4WIEA 2RCWA 4L7NA 5DCZA 3UA9A 4YWDA 3W51A 4BUYA 5FH3A 4DQYC 4R43A 4KRSA 4BU8A 1YVYA 3DT7A 4UVVA 2QF2A 4GV0A 1II2A 4RCGA 5ADTA 4KZLA 2QZYA 4RV6A 3UDDA 4BU5A 4GNOA 4BUAA 3L3MA 4UHGA 3KR8A 4J1ZA 1AYLA 3U9YA 4AVWA 4LI7A 5LX6A 2FAHA 4TKFA 4TK5A 1NHXA 2X5YA 4GNLA 4J3LA 4UXBA 5AL5A 4L33A 1KHFA 3C4HA 1KHGA 4GNQA 4GV7A 4UI6A 4GNMA 3U9HA 4L2KA 3HKVA 3C49A 4ZZXA 4UVYA 4GMUA 1KHEA 4BUIA 4UI3A 5AKUA 1K3CA 4OX2A 4UI5A 5FH4A 1WOKA 4BUXA 4HMHA 4L7PA 4M7BA 1XKVA 4WPUA 4TJUA 4TJWA 4N3RA 2PC9A 3GJWA 4BUVA 3GN7A 5ECEA 1AQ2A 4OQAC 4BUWA 4L0VA 4UVZA 3SMJA 4BS4A 4TKGA 3MOEA 4PNSA 2RK7A 4LI6A 4YW9A 4HYFA 1OS1A 3KJDA 1UK1A 3MHKA 3P0NA 4I9IA 4GV2A 4YW8A 4L10A 4UVUA 4W6EA 1KHBA 4GMZA 4U6AA 4HLMA 4UVSA 4OPXC 3UH2A 4W5IA 3DT2A 4HLFA 2OLQA 4PMLA 4UVNA 5FH1A 4L7OA 2GMVA 4BU9A 4L7LA 4UI8A 2PAWA 2QF1A 4L2GA 4PAXA 4TORA 4N4TA 3MOHA 4PNMA 2OLRA 4PY4A 4R6EA 4WL8A 5FPFA 1YGGA 5FH0A 5LYHA 3UH4A 4HHZA 1EFYA 3DTBA 5AEHA 5LXPA 5FPGA 4OQBC 2RKAA 2RK8A 1J3BA 4GMMA 3FHBA 4K4FA 4UI7A 5FH5A 4HKKA 4AVUA 4MT9A 4UNDA 4TKIA 4GV4A 3BLJA 4TK0A 1OENA 2PXZX 4L32A 4BUFA 4GNPA 2RF5A 3P0PA 4WOUA 1A26A 4L09A 4HLGA 4GMWA 4L6ZA 4TOSA 4L0IA 4UVPA 4PJVA 4BUUA 2QEYA 4HLHA 5AKWA 4HL5A 4F1QA 5I67A 5AL4A 4W5SA 5A00A 1PAXA 4N4VA 1M51A 4UVXA 4PNTA 3GEYA 4L0BA 4F1LA 4BUDA 4ZZZA 4L0SA 4PNNA 4WPVA 4F0EA 4J21A 3PAXA 4PNQA 2PAXA 4R5WA 4BUTA 5C5RA 4WIUA 3CE0A 3MHJA 5ADSA 4X52A 4MSGA 1GS0A 5AL1A 3SE2A 4BJ9A 4L7RA 2QEWA 4KZUA 4OA7A 4PNLA 5ADRA 4WPTA 4BFPA 4BU3A 4DVIA 5FH2A 2RKEA 5EBTA 4BUSA 3P0QA 4L34A 2FAFA 2ZCIA 4PJTA 3L3LA 3GOYA 4UFYA 1YLHA 1YTMA 4YWBA 2PQFA 4L31A
chains in the Genus database with same CATH topology
4HHYA 2RD6A 4PNRA 5ETYA 4UVOA 5C5QA 4ZZYA 3SMIA 3KR7A 4L70A 4HKNA 4BU7A 3DT4A 4L0TA 4L7UA 4UVTA 5C5PA 3KCZA 1K3DA 4KZQA 4UW1A 5AL3A 4UVLA 4BJBA 4UVWA 4J3MA 4L2FA 4UUHA 4IUEA 4UX4A 5ADQA 4TVJA 4MSKA 4J22A 5AL2A 4BUEA 4UFUA 4HKIA 4LI8A 4UI4A 4XHUA 2RKDA 4K4EA 4HLKA 4TJYA 4L6SA 4BU6A 4BJCA 1UK0A 2PY7X 3MOFA 4WIEA 2RCWA 4L7NA 5DCZA 3UA9A 4YWDA 3W51A 4BUYA 5FH3A 4DQYC 4R43A 4KRSA 4BU8A 1YVYA 3DT7A 4UVVA 2QF2A 4GV0A 1II2A 4RCGA 5ADTA 4KZLA 2QZYA 4RV6A 3UDDA 4BU5A 4GNOA 4BUAA 3L3MA 4UHGA 3KR8A 4J1ZA 1AYLA 3U9YA 4AVWA 4LI7A 5LX6A 2FAHA 4TKFA 4TK5A 1NHXA 2X5YA 4GNLA 4J3LA 4UXBA 5AL5A 4L33A 1KHFA 3C4HA 1KHGA 4GNQA 4GV7A 4UI6A 4GNMA 3U9HA 4L2KA 3HKVA 3C49A 4ZZXA 4UVYA 4GMUA 1KHEA 4BUIA 4UI3A 5AKUA 1K3CA 4OX2A 4UI5A 5FH4A 1WOKA 4BUXA 4HMHA 4L7PA 4M7BA 1XKVA 4WPUA 4TJUA 4TJWA 4N3RA 2PC9A 3GJWA 4BUVA 3GN7A 5ECEA 1AQ2A 4OQAC 4BUWA 4L0VA 4UVZA 3SMJA 4BS4A 4TKGA 3MOEA 4PNSA 2RK7A 4LI6A 4YW9A 4HYFA 1OS1A 3KJDA 1UK1A 3MHKA 3P0NA 4I9IA 4GV2A 4YW8A 4L10A 4UVUA 4W6EA 1KHBA 4GMZA 4U6AA 4HLMA 4UVSA 4OPXC 3UH2A 4W5IA 3DT2A 4HLFA 2OLQA 4PMLA 4UVNA 5FH1A 4L7OA 2GMVA 4BU9A 4L7LA 4UI8A 2PAWA 2QF1A 4L2GA 4PAXA 4TORA 4N4TA 3MOHA 4PNMA 2OLRA 4PY4A 4R6EA 4WL8A 5FPFA 1YGGA 5FH0A 5LYHA 3UH4A 4HHZA 1EFYA 3DTBA 5AEHA 5LXPA 5FPGA 4OQBC 2RKAA 2RK8A 1J3BA 4GMMA 3FHBA 4K4FA 4UI7A 5FH5A 4HKKA 4AVUA 4MT9A 4UNDA 4TKIA 4GV4A 3BLJA 4TK0A 1OENA 2PXZX 4L32A 4BUFA 4GNPA 2RF5A 3P0PA 4WOUA 1A26A 4L09A 4HLGA 4GMWA 4L6ZA 4TOSA 4L0IA 4UVPA 4PJVA 4BUUA 2QEYA 4HLHA 5AKWA 4HL5A 4F1QA 5I67A 5AL4A 4W5SA 5A00A 1PAXA 4N4VA 1M51A 4UVXA 4PNTA 3GEYA 4L0BA 4F1LA 4BUDA 4ZZZA 4L0SA 4PNNA 4WPVA 4F0EA 4J21A 3PAXA 4PNQA 2PAXA 4R5WA 4BUTA 5C5RA 4WIUA 3CE0A 3MHJA 5ADSA 4X52A 4MSGA 1GS0A 5AL1A 3SE2A 4BJ9A 4L7RA 2QEWA 4KZUA 4OA7A 4PNLA 5ADRA 4WPTA 4BFPA 4BU3A 4DVIA 5FH2A 2RKEA 5EBTA 4BUSA 3P0QA 4L34A 2FAFA 2ZCIA 4PJTA 3L3LA 3GOYA 4UFYA 1YLHA 1YTMA 4YWBA 2PQFA 4L31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHY A;  2RD6 A;  4PNR A;  5ETY A;  4UVO A;  5C5Q A;  4ZZY A;  3SMI A;  3KR7 A;  4L70 A;  4HKN A;  4BU7 A;  4L0T A;  4L7U A;  4UVT A;  5C5P A;  3KCZ A;  4KZQ A;  4UW1 A;  5AL3 A;  4UVL A;  4BJB A;  4UVW A;  4J3M A;  4L2F A;  4UUH A;  4IUE A;  4UX4 A;  5ADQ A;  4TVJ A;  4MSK A;  4J22 A;  5AL2 A;  4BUE A;  4UFU A;  4HKI A;  4LI8 A;  4UI4 A;  4XHU A;  4K4E A;  4HLK A;  4TJY A;  4L6S A;  4BU6 A;  4BJC A;  1UK0 A;  3W51 A;  4BUY A;  2RCW A;  4L7N A;  5DCZ A;  3UA9 A;  4DQY C;  4KRS A;  4BU8 A;  4UVV A;  4GV0 A;  5ADT A;  4KZL A;  4RV6 A;  4BU5 A;  3UDD A;  4BUA A;  3L3M A;  4UHG A;  3KR8 A;  4J1Z A;  3U9Y A;  4AVW A;  4LI7 A;  4TKF A;  4TK5 A;  2X5Y A;  4J3L A;  4UXB A;  5AL5 A;  4L33 A;  4GV7 A;  3C4H A;  4UI6 A;  3U9H A;  4L2K A;  3HKV A;  3C49 A;  4ZZX A;  4UVY A;  4BUI A;  4UI3 A;  5AKU A;  4UI5 A;  1WOK A;  4BUX A;  4HMH A;  4L7P A;  4M7B A;  4TJU A;  4TJW A;  4N3R A;  4BUV A;  3GJW A;  3GN7 A;  5ECE A;  4OQA C;  4BUW A;  4L0V A;  4UVZ A;  3SMJ A;  4BS4 A;  4TKG A;  4PNS A;  4LI6 A;  4HYF A;  3KJD A;  1UK1 A;  3MHK A;  3P0N A;  4I9I A;  4GV2 A;  4L10 A;  4UVU A;  4W6E A;  4U6A A;  4HLM A;  4UVS A;  4OPX C;  3UH2 A;  4W5I A;  4HLF A;  4PML A;  4UVN A;  4L7O A;  4BU9 A;  4L7L A;  4UI8 A;  2PAW A;  4L2G A;  4PAX A;  4TOR A;  4N4T A;  4PY4 A;  4PNM A;  4R6E A;  5FPF A;  5LX6 A;  5LYH A;  3UH4 A;  4HHZ A;  1EFY A;  5AEH A;  5LXP A;  5FPG A;  4OQB C;  3FHB A;  4K4F A;  4HKK A;  4AVU A;  4MT9 A;  4UND A;  4TKI A;  4GV4 A;  3BLJ A;  4TK0 A;  4L32 A;  4BUF A;  2RF5 A;  3P0P A;  1A26 A;  4L09 A;  4HLG A;  4L6Z A;  4TOS A;  4L0I A;  4UVP A;  4PJV A;  4BUU A;  4HLH A;  5AKW A;  4HL5 A;  4F1Q A;  5AL4 A;  4W5S A;  5A00 A;  1PAX A;  4N4V A;  4UVX A;  4ZZZ A;  4PNT A;  3GEY A;  4L0B A;  4F1L A;  4BUD A;  4L0S A;  4PNN A;  4F0E A;  4J21 A;  3PAX A;  4PNQ A;  2PAX A;  4R5W A;  4BUT A;  3CE0 A;  3MHJ A;  5ADS A;  4X52 A;  4MSG A;  1GS0 A;  5AL1 A;  3SE2 A;  4BJ9 A;  4L7R A;  4KZU A;  4OA7 A;  4PNL A;  5ADR A;  4BFP A;  4BU3 A;  4DVI A;  5EBT A;  4BUS A;  3P0Q A;  4L34 A;  4PJT A;  3L3L A;  3GOY A;  4UFY A;  4UI7 A;  5C5R A;  2PQF A;  4L31 A; 
#chains in the Genus database with same CATH topology
 4HHY A;  2RD6 A;  4PNR A;  5ETY A;  4UVO A;  5C5Q A;  4ZZY A;  3SMI A;  3KR7 A;  4L70 A;  4HKN A;  4BU7 A;  3DT4 A;  4L0T A;  4L7U A;  4UVT A;  5C5P A;  3KCZ A;  1K3D A;  4KZQ A;  4UW1 A;  5AL3 A;  4UVL A;  4BJB A;  4UVW A;  4J3M A;  4L2F A;  4UUH A;  4IUE A;  4UX4 A;  5ADQ A;  4TVJ A;  4MSK A;  4J22 A;  5AL2 A;  4BUE A;  4UFU A;  4HKI A;  4LI8 A;  4UI4 A;  4XHU A;  2RKD A;  4K4E A;  4HLK A;  4TJY A;  4L6S A;  4BU6 A;  4BJC A;  1UK0 A;  2PY7 X;  3MOF A;  4WIE A;  2RCW A;  4L7N A;  5DCZ A;  3UA9 A;  4YWD A;  3W51 A;  4BUY A;  5FH3 A;  4DQY C;  4R43 A;  4KRS A;  4BU8 A;  1YVY A;  3DT7 A;  4UVV A;  2QF2 A;  4GV0 A;  1II2 A;  4RCG A;  5ADT A;  4KZL A;  2QZY A;  4RV6 A;  3UDD A;  4BU5 A;  4GNO A;  4BUA A;  3L3M A;  4UHG A;  3KR8 A;  4J1Z A;  1AYL A;  3U9Y A;  4AVW A;  4LI7 A;  5LX6 A;  2FAH A;  4TKF A;  4TK5 A;  1NHX A;  2X5Y A;  4GNL A;  4J3L A;  4UXB A;  5AL5 A;  4L33 A;  1KHF A;  3C4H A;  1KHG A;  4GNQ A;  4GV7 A;  4UI6 A;  4GNM A;  3U9H A;  4L2K A;  3HKV A;  3C49 A;  4ZZX A;  4UVY A;  4GMU A;  1KHE A;  4BUI A;  4UI3 A;  5AKU A;  1K3C A;  4OX2 A;  4UI5 A;  5FH4 A;  1WOK A;  4BUX A;  4HMH A;  4L7P A;  4M7B A;  1XKV A;  4WPU A;  4TJU A;  4TJW A;  4N3R A;  2PC9 A;  3GJW A;  4BUV A;  3GN7 A;  5ECE A;  1AQ2 A;  4OQA C;  4BUW A;  4L0V A;  4UVZ A;  3SMJ A;  4BS4 A;  4TKG A;  3MOE A;  4PNS A;  2RK7 A;  4LI6 A;  4YW9 A;  4HYF A;  1OS1 A;  3KJD A;  1UK1 A;  3MHK A;  3P0N A;  4I9I A;  4GV2 A;  4YW8 A;  4L10 A;  4UVU A;  4W6E A;  1KHB A;  4GMZ A;  4U6A A;  4HLM A;  4UVS A;  4OPX C;  3UH2 A;  4W5I A;  3DT2 A;  4HLF A;  2OLQ A;  4PML A;  4UVN A;  5FH1 A;  4L7O A;  2GMV A;  4BU9 A;  4L7L A;  4UI8 A;  2PAW A;  2QF1 A;  4L2G A;  4PAX A;  4TOR A;  4N4T A;  3MOH A;  4PNM A;  2OLR A;  4PY4 A;  4R6E A;  4WL8 A;  5FPF A;  1YGG A;  5FH0 A;  5LYH A;  3UH4 A;  4HHZ A;  1EFY A;  3DTB A;  5AEH A;  5LXP A;  5FPG A;  4OQB C;  2RKA A;  2RK8 A;  1J3B A;  4GMM A;  3FHB A;  4K4F A;  4UI7 A;  5FH5 A;  4HKK A;  4AVU A;  4MT9 A;  4UND A;  4TKI A;  4GV4 A;  3BLJ A;  4TK0 A;  1OEN A;  2PXZ X;  4L32 A;  4BUF A;  4GNP A;  2RF5 A;  3P0P A;  4WOU A;  1A26 A;  4L09 A;  4HLG A;  4GMW A;  4L6Z A;  4TOS A;  4L0I A;  4UVP A;  4PJV A;  4BUU A;  2QEY A;  4HLH A;  5AKW A;  4HL5 A;  4F1Q A;  5I67 A;  5AL4 A;  4W5S A;  5A00 A;  1PAX A;  4N4V A;  1M51 A;  4UVX A;  4PNT A;  3GEY A;  4L0B A;  4F1L A;  4BUD A;  4ZZZ A;  4L0S A;  4PNN A;  4WPV A;  4F0E A;  4J21 A;  3PAX A;  4PNQ A;  2PAX A;  4R5W A;  4BUT A;  5C5R A;  4WIU A;  3CE0 A;  3MHJ A;  5ADS A;  4X52 A;  4MSG A;  1GS0 A;  5AL1 A;  3SE2 A;  4BJ9 A;  4L7R A;  2QEW A;  4KZU A;  4OA7 A;  4PNL A;  5ADR A;  4WPT A;  4BFP A;  4BU3 A;  4DVI A;  5FH2 A;  2RKE A;  5EBT A;  4BUS A;  3P0Q A;  4L34 A;  2FAF A;  2ZCI A;  4PJT A;  3L3L A;  3GOY A;  4UFY A;  1YLH A;  1YTM A;  4YWB A;  2PQF A;  4L31 A; 
#chains in the Genus database with same CATH homology
 4HHY A;  2RD6 A;  4PNR A;  5ETY A;  4UVO A;  5C5Q A;  4ZZY A;  3SMI A;  3KR7 A;  4L70 A;  4HKN A;  4BU7 A;  3DT4 A;  4L0T A;  4L7U A;  4UVT A;  5C5P A;  3KCZ A;  1K3D A;  4KZQ A;  4UW1 A;  5AL3 A;  4UVL A;  4BJB A;  4UVW A;  4J3M A;  4L2F A;  4UUH A;  4IUE A;  4UX4 A;  5ADQ A;  4TVJ A;  4MSK A;  4J22 A;  5AL2 A;  4BUE A;  4UFU A;  4HKI A;  4LI8 A;  4UI4 A;  4XHU A;  2RKD A;  4K4E A;  4HLK A;  4TJY A;  4L6S A;  4BU6 A;  4BJC A;  1UK0 A;  2PY7 X;  3MOF A;  4WIE A;  2RCW A;  4L7N A;  5DCZ A;  3UA9 A;  4YWD A;  3W51 A;  4BUY A;  5FH3 A;  4DQY C;  4R43 A;  4KRS A;  4BU8 A;  1YVY A;  3DT7 A;  4UVV A;  2QF2 A;  4GV0 A;  1II2 A;  4RCG A;  5ADT A;  4KZL A;  2QZY A;  4RV6 A;  3UDD A;  4BU5 A;  4GNO A;  4BUA A;  3L3M A;  4UHG A;  3KR8 A;  4J1Z A;  1AYL A;  3U9Y A;  4AVW A;  4LI7 A;  5LX6 A;  2FAH A;  4TKF A;  4TK5 A;  1NHX A;  2X5Y A;  4GNL A;  4J3L A;  4UXB A;  5AL5 A;  4L33 A;  1KHF A;  3C4H A;  1KHG A;  4GNQ A;  4GV7 A;  4UI6 A;  4GNM A;  3U9H A;  4L2K A;  3HKV A;  3C49 A;  4ZZX A;  4UVY A;  4GMU A;  1KHE A;  4BUI A;  4UI3 A;  5AKU A;  1K3C A;  4OX2 A;  4UI5 A;  5FH4 A;  1WOK A;  4BUX A;  4HMH A;  4L7P A;  4M7B A;  1XKV A;  4WPU A;  4TJU A;  4TJW A;  4N3R A;  2PC9 A;  3GJW A;  4BUV A;  3GN7 A;  5ECE A;  1AQ2 A;  4OQA C;  4BUW A;  4L0V A;  4UVZ A;  3SMJ A;  4BS4 A;  4TKG A;  3MOE A;  4PNS A;  2RK7 A;  4LI6 A;  4YW9 A;  4HYF A;  1OS1 A;  3KJD A;  1UK1 A;  3MHK A;  3P0N A;  4I9I A;  4GV2 A;  4YW8 A;  4L10 A;  4UVU A;  4W6E A;  1KHB A;  4GMZ A;  4U6A A;  4HLM A;  4UVS A;  4OPX C;  3UH2 A;  4W5I A;  3DT2 A;  4HLF A;  2OLQ A;  4PML A;  4UVN A;  5FH1 A;  4L7O A;  2GMV A;  4BU9 A;  4L7L A;  4UI8 A;  2PAW A;  2QF1 A;  4L2G A;  4PAX A;  4TOR A;  4N4T A;  3MOH A;  4PNM A;  2OLR A;  4PY4 A;  4R6E A;  4WL8 A;  5FPF A;  1YGG A;  5FH0 A;  5LYH A;  3UH4 A;  4HHZ A;  1EFY A;  3DTB A;  5AEH A;  5LXP A;  5FPG A;  4OQB C;  2RKA A;  2RK8 A;  1J3B A;  4GMM A;  3FHB A;  4K4F A;  4UI7 A;  5FH5 A;  4HKK A;  4AVU A;  4MT9 A;  4UND A;  4TKI A;  4GV4 A;  3BLJ A;  4TK0 A;  1OEN A;  2PXZ X;  4L32 A;  4BUF A;  4GNP A;  2RF5 A;  3P0P A;  4WOU A;  1A26 A;  4L09 A;  4HLG A;  4GMW A;  4L6Z A;  4TOS A;  4L0I A;  4UVP A;  4PJV A;  4BUU A;  2QEY A;  4HLH A;  5AKW A;  4HL5 A;  4F1Q A;  5I67 A;  5AL4 A;  4W5S A;  5A00 A;  1PAX A;  4N4V A;  1M51 A;  4UVX A;  4PNT A;  3GEY A;  4L0B A;  4F1L A;  4BUD A;  4ZZZ A;  4L0S A;  4PNN A;  4WPV A;  4F0E A;  4J21 A;  3PAX A;  4PNQ A;  2PAX A;  4R5W A;  4BUT A;  5C5R A;  4WIU A;  3CE0 A;  3MHJ A;  5ADS A;  4X52 A;  4MSG A;  1GS0 A;  5AL1 A;  3SE2 A;  4BJ9 A;  4L7R A;  2QEW A;  4KZU A;  4OA7 A;  4PNL A;  5ADR A;  4WPT A;  4BFP A;  4BU3 A;  4DVI A;  5FH2 A;  2RKE A;  5EBT A;  4BUS A;  3P0Q A;  4L34 A;  2FAF A;  2ZCI A;  4PJT A;  3L3L A;  3GOY A;  4UFY A;  1YLH A;  1YTM A;  4YWB A;  2PQF A;  4L31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...