3U9LA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
295
structure length
286
Chain Sequence
KKIILITGASSGFGRLTAEALAGAGHRVYASMRDIVGRNASNVEAIAGFARDNDVDLRTLELDVQSQVSVDRAIDQIIGEDGRIDVLIHNAGHMVFGPAEAFTPEQFAELYDINVLSTQRVNRAALPHMRRQKHGLLIWISSSSSAGGTPPYLAPYFAAKAAMDAIAVQYARELSRWGIETSIIVPGAFSGVPDDHARQAEYEAGPNAGLGEEIKKAFAAIVPPDADVSLVADAIVRVVGTASGKRPFRVHVDPAEDGADVGFSVLDRLRAEMLHRVGLSDLLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 101
structure length 286
sequence length 295
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u9lA00
4Q9NA 3B6ZA 2X0IA 1DAPA 1ADBA 4UUPA 1U2GA 4FBGA 5KOIA 4IZHA 2WM3A 1UXKA 4ZQGA 1B8VA 3I52A 4Z6KA 3EY4A 1FDUA 1Q0HA 4GLOA 3TZHA 1ZEMA 1E77A 1TT5A 3C85A 4IQ0A 3M2PA 2D1YA 3ETGA 1NPTO 4CL3A 5CHEA 5BQFA 2C2YA 2BF7A 2Y99A 3WNVA 5C3MA 2B0JA 5JCXA 5JY6A 1VJ1A 5IDXA 2A35A 3S2GA 2WYVA 4BGEA 3IJRA 2YQ5A 4B7CA 1DOHA 1U5AA 4NQZA 4J49A 1O0SA 4L4RA 4JGBA 1KY4A 1YWGO 4EDFA 1NFRA 3ONDA 2B35A 1YBMA 1JTVA 5DCYA 3D4NA 3HE3A 4CM4B 3LT2A 2B5VA 4LRSB 3JYPA 4JROA 3ZZNA 3OF2A 1Y9EA 1D7OA 2P4QA 5KVCA 2VNAA 1XWFA 2AQIA 4Y6PA 3OMLA 3PWZA 2PH3A 3DBLB 4ND5A 4W7HA 3ZHYA 3GK3A 3DOOA 3IQDB 3DZJA 3HWRA 1ADCA 4NG5A 2GZ3A 5A3VA 5THKA 5KKCA 3ANMA 2FHSA 4Q3BA 1IE3A 3GR6A 4AJHA 1Y5RA 3ZI0A 2Y67A 1U3TA 1BXKA 4URFA 1A7AA 2CUKA 3JD1A 4DGSA 3HDQA 2YUTA 1XELA 1E92A 1VKOA 1XHLA 3D7LA 3K2EA 4KWHA 4XA8A 3IUPA 3NRCA 5A4DA 1HKUA 3RI3A 5TS3A 3ZWMA 1QORA 5U9CA 2E37A 3E8XA 3PZRA 2YW9A 4J2HA 5A03A 5JMPA 4ZQHA 2J3KA 2VWHA 1HWYA 4M55A 6LDHA 1DJNA 1E7YA 3CIFA 3MJCA 3RUHA 1HZJA 3I1JA 4BL5A 5TLSA 2ZYGA 2P68A 2HO5A 1M66A 3LF1A 1UP6A 1ZNQO 3WJAA 1MXHA 2AG8A 3L4SO 3N7UA 5KNLA 3W6UA 4FPXA 4FFNA 3KVOA 1EVZA 1DSSG 4KWIA 3GVCA 4GX1A 4ID9A 3TZKA 2H5LA 3GGGA 3DBHB 4F6CA 3A14A 1T2AA 3F6YA 3R1IA 2YV3A 3IAHA 3ZNQA 1MG0A 3GZ4A 4BNHA 1P31A 1W73A 4W7IA 3WSWA 3CUKA 4Q3DA 4XQEA 4YAJA 1IY8A 5T8KC 5JMWA 4R51A 3PTZA 5TF4A 4L73A 1P77A 1CYDA 4R4JA 3RFXA 1H2HA 3G0OA 1DO8A 1KVTA 5CEEA 5KVSA 1DBVO 5HTOA 3K92A 4E2YA 4AJOA 1FDVA 1BDBA 1NPYA 2X5JO 3UW3A 4QO7A 5IZ4A 1SB8A 2IYPA 3EAGA 2GO1A 2CD9A 2H63A 3OA0A 2VHVA 4GLLA 1OI7A 1ULUA 2IODA 1ZK1A 2GGSA 3G3EA 1S6YA 2FY8A 3OJFA 3HJAA 4RO0A 1LQTA 4AJ1A 5G4LA 2JHFA 1E1NA 2VYVD 4E13A 1R12A 4J2OA 4P38A 1WNTA 1GFSA 1N1GA 2QRLA 2PD3A 5L40A 1DIBA 5EESA 1J4AA 1FJHA 1NASA 2NACA 1CWUA 3JQFA 3QQPA 1GR0A 1H94A 2E49A 3E5MA 4CMBA 1R0SA 1SO8A 4CMKA 3JQAD 4UVDA 3GHYA 1UDAA 3I9KA 2E82A 3BMNA 3JQEA 3QY9A 4N5LA 1E3WB 1OZAA 1UH5A 4HUJA 2VCYA 3UVEA 2I3GA 2I99A 4IPTA 1P1IA 2NU8A 3MZ0A 1DRWA 1HZZA 1EVJA 2J5RA 1T4BA 3W4KA 1UAGA 4E5YA 3D3WA 4GH5A 3LC7O 1VC2A 4A10A 1YXMA 2PNFA 2HUNA 4BNYA 1MB4A 2O50A 4MKXA 3KSZO 3H3JA 4NNJA 3S2FA 1YQXA 3DAFA 2CF5A 2C2XA 4EITA 3GRKA 3LDHA 3LT0A 4MO2A 1EVYA 1ENPA 1EFKA 4GMFA 1DC5A 1LXCA 4J1QA 4DC0A 4PFJA 3ROMA 1QG6A 1F8FA 3QSGA 5G2OA 3EGOA 3GDFA 2DTEA 4CLOA 4XYMA 3EVTA 1YRLA 2P4HX 2NNLD 3ETDA 4BO9A 2HMSA 4IDFA 3ANLA 2GN8A 5CDUA 4EUFA 3ON5A 4L0QA 1QLHA 5MDHA 4L4SA 2DBRA 1XKQA 4L75A 5C7IO 2NU6A 1HDZA 1VE9A 4R68A 5EERA 2AMFA 3B70A 1B3RA 4MIYA 4P22A 3GC6A 5DCUA 1MX3A 3DZHA 3U62A 4JBIA 3Q0EA 2QZZA 3QVWA 5I7FA 1ZUD1 1LDEA 3FD8A 3OSUA 4WCFC 4IJUA 1MC5A 3ZNPA 2X5KO 2VT2A 5JSFA 4DXHA 3D4OA 2BMAA 2YJZA 5THQA 1RPNA 1Q0LA 3AUSA 5EN4A 2J3IA 3PFFA 4IM7A 1R0LA 5ADHA 3QVSA 1U4OA 3VH4A 5KTKA 2ZTVA 4N18A 3CEAA 3AJRA 3WFIA 3AY3A 5JE8A 2EERA 1NQAO 3TRIA 3R6DA 1JN0A 3DZIA 4D42A 3LF2A 3RU9A 1LLUA 2ZQZA 3PJDA 3WTBA 4BNZA 1H6CA 4XQCA 4EI2A 1PL7A 4MJLA 4ZD6A 3UH1A 4E4YA 5BR7A 3KHUA 3HZZA 3LVFO 5JO9A 2AEJA 1SC6A 1IPFA 4RL6A 4XYBA 3RQSA 2O7QA 4XRGA 2P9EA 4D79A 1GDHA 3ASVA 4JJGA 3PFWO 5I8ZA 3E03A 2SCUA 4YT2A 1V9LA 2VYNA 3OFSA 4BMNA 1NWHA 2VHZA 1WWKA 2BRUA 2V6FA 1E1MA 2O3QA 4M87A 3P19A 2P9CA 3KBOA 1BDMA 4DC1A 4BO5A 5JNLA 1M2WA 5IFLA 5IDQA 2FRDA 1UP4A 4LMRA 3C7AA 3DWFA 1YE3A 4OHUA 1LC0A 2EJWA 2EKLA 1SMKA 2NU9A 2DT5A 3GG2A 4RPJA 5JW6A 4CPDA 3BTUA 2ZJ0A 1T25A 1B8PA 3ZHXA 4BKUA 2VUUA 3OJLA 3DAGA 3RAJA 4W6ZA 5GZ3A 1V35A 4LVCA 3V1UA 2WE8A 3LZ6A 3H8VA 4KMSA 3KUXA 3VVBA 1HDCA 3FBTA 2OXIA 3Q2KA 3O8QB 2YV2A 3H3FA 4WUVA 1D8AA 4UULA 3EC7A 4BGIA 1I8TA 1Y81A 4RVUA 1YJ8A 4PG8A 2FWMX 2GN6A 1GY8A 3KM0A 4YPOA 4O5OA 3KXDA 3GEGA 2H9IA 5K6AC 4J0EA 1ZKMA 3V2GA 4DLBA 3ABIA 4LVUA 5BT9A 1O6ZA 4TZKA 1UXJA 4BO1A 3K30A 3LLVA 1B7GO 1H93A 4R1NA 3RUAA 4PZEA 4YQZA 2PGLA 3TN7A 1F8GA 1Z82A 3BAZA 1F0YA 1U3WA 2BELA 4ONEA 1LEHA 3KEQA 4OSOA 1OC2A 4IIUA 5HWSA 5JDCA 2QIOA 3GVHA 3WX0A 4DIBA 1PJ3A 2I65A 3PQEA 4TZTA 5CFZA 1AHIA 4FB5A 1CJCA 1ID1A 3EDMA 3ZWXA 4YJHB 4GMGA 1ZXBA 1EBFA 2R00C 3GGOA 1N1EA 3WMWA 1E7WA 1K5HA 3SC4A 2CDCA 1G0OA 3PXXA 4ZRMA 4RZIA 2NVUB 2W98A 1DC3A 4UVEA 3BZUA 3WTCA 1Q2XA 1BMDA 2Y0EA 4J1SA 4L8VA 4L9RA 3Q11A 1NVMB 2HK9A 5K9ZA 1M6WA 3OH8A 1VM6A 4R1TA 4RZHA 1LUAA 3NAQA 1Z74A 3STHA 1YOVA 3BA1A 1LLDA 1DLJA 1R66A 3SBOA 5A5FA 4BNNA 3ADPA 3PYLA 2LDBA 3ZNNA 2V6GA 4PLPA 1U8FO 1GQQA 1PS9A 3TZCA 1I30A 1N9GA 3C7DB 2FOIA 3WNQA 2PTGA 2IZZA 1E3SA 3GG9A 4XQ9A 1XR3A 4PRLA 5CAEA 4CLEA 4TSKA 4YA6A 3TF5A 3AFMA 3ROPA 4RCVA 4BQPA 3F5SA 2YY7A 1OFGA 3NTQA 3FI9A 5DULA 4MPDA 2FPPA 3IP1A 1WW8A 4WK6A 3I6QA 1IHXA 1KC1A 2C5AA 1GQ2A 3WQQA 2D4AA 3H2SA 3V2HA 3VTFA 4DPMA 3KB6A 1Q1NA 1PJQA 3AW9A 1KVQA 3TL3A 4RDIA 1R37A 3LQFA 3QWAA 4FFMA 4TKMA 2Y68A 4EJ0A 1XIVA 2IE0A 3TDKA 3GGPA 3OM9A 4MVJG 3CSDA 4NJOA 3DFUA 3H9QA 2I66A 3GAZA 1T1SA 2C54A 1LA2A 4CMJA 3KYCB 3FHLA 2IXBA 1NAHA 2OUIA 1JDJA 4YT5A 4RPHA 3U09A 4TRMA 3EYWA 3AM3A 1ZMOA 1YB4A 3DEYX 1B0AA 3MJVA 3SX2A 1I5RA 3JD2A 4JCOA 4BO7A 2GF2A 5JFOA 2C7GA 4WLFA 3IUSA 3SVTA 1DLIA 2CDBA 4IZIA 3S8MA 2PWZA 3ZV5A 3D5TA 1YS4A 4MKZA 2VWGA 4MP3A 2EXXA 4PGFA 2X5OA 3A06A 4J7XA 1U7HA 1IZ0A 2VWPA 2QRKA 1EUZA 1XG5A 3RFVA 4BNFA 4WKGA 1LSUA 2VOEA 2BD0A 4CUJA 2Q1TA 4Q3EA 4OYRA 1QP8A 4XDYA 3CE6A 5JDIC 3UCFA 2DFVA 3MJ4A 3M1LA 4O59O 3W8DA 4AJ2A 4DPLA 1E3EA 1ENOA 2XXBA 4BQRA 4Y67A 4WPGA 4U6SA 1ISIA 2BGMA 4D3FA 3CH6A 4GQAA 3VKUA 4H16A 3PIDA 3WJ7A 1K89A 1I3LA 3JQFC 1OBFO 3UHAA 4EEZA 4GX5A 4YJFB 3R0IA 2JAPA 3Q1LA 4CM3A 5EJ2A 1LX6A 3VOSA 4M8SA 3FWNA 3I9OA 5T5QA 4C7JA 5G0UA 4BNVA 3QP9A 4DMLA 4ZN6A 3P2OA 4BIIA 4Q3CA 3L4BC 4FOOA 5ITWA 1AGNA 2CY0A 5FFFA 3AI2A 3ZCXA 4CQMA 4K9DA 4CMHA 5FEUA 2V65A 2NADA 2QX7A 1NYTA 1ZJZA 4IIVA 4IMRA 4HBGA 1K6IA 2UV8A 5B4UA 1O9BA 2VRCD 3GH3A 3H5RA 1LDMA 2WSBA 1P1RA 3W4IA 1NHWA 3Q6IA 2GSDA 3FF4A 5KJFA 1EMDA 3PEFA 3ZW8A 4BGUA 1UUFA 1PJ4A 1YB1A 3CZRA 3V5NA 4LK3A 4YTEA 5T6BA 3PQFA 2NU7A 3RC1A 4ALIA 3WS7A 1PS0A 2EG9A 1EE9A 4OL9A 1X7HA 3I83A 1AXGA 1QYCA 2AEMA 3RBZA 3HG7A 1YOVB 3AK4A 2FPGA 3K9QO 3SJUA 4WLNA 4PG6A 3MWDB 4WNCA 2UDPA 4KP7A 3QLJA 4OIMA 5GMOA 1E6EA 4UEJA 2QG4A 4CM1A 1WMBA 4GI2A 1CEQA 1L7EA 3O38A 3DZKA 3UGKA 4CL8A 1ML3A 3JCZA 2C5EA 2VUSA 3OIDA 3DMTA 1U1IA 3OJOA 3WYEA 1DDOA 4YJHA 3JQ6A 3RSHA 2BFMA 4CLDA 4CV0A 4OXNA 4CM8B 3BXXA 3PRJA 4RQTA 5A1TA 4XD2A 2G1UA 4F3YA 4E30A 3NT5A 5DBIA 3DFZA 1KEWA 3WYCA 3OIGA 4E21A 4E5PA 1MLDA 3ZDFA 1LLQA 5AXAA 3TOZA 1UP7A 1R0KA 3UAGA 4BNWA 2IYOA 1NQTA 1NWCA 5AXCA 1EEHA 3K2BA 4YQYA 1ZVMA 5DOZA 4TRRA 4W9NC 4A73A 2WTBA 2X0NA 2G76A 2WE7A 1YL7A 3QHAA 2Q2VA 4PLZA 1ISJA 4B4WA 3PHGA 2O48X 3BMOA 2ET6A 3W8FA 4ALKA 4XGNA 5U4QA 3O8QA 1H0KA 4DIFA 1W6UA 2HMTA 3RASA 2C20A 4PCVA 5CDSA 4GPD1 4MVJF 4CM9A 1XDWA 2OBNA 4BO6A 3TZ6A 3X2EA 3KYDB 2ZB3A 4NU5A 3U3XA 3NTRA 4CLRA 5CEJA 3WBBA 1DC4A 1CERA 4BNUA 1CQJA 1GU7A 1O8CA 3JQ8B 2D5CA 1ZK3A 3JQ9A 3HDYA 4IDBA 1WDLA 4AG3A 5JY1A 5KCZA 6ADHA 1R16A 1ADFA 3RROA 1TLTA 5FYDA 5GY7A 4E2XA 3F4LA 2VHYA 4JNKA 3AM5A 1GCUA 4CMAA 5DP1A 5IDYA 1GCOA 4ZVVA 5L4LA 1Y9AA 4OM8A 1MXFA 3E6AA 3GY0A 4DRYA 1LQUA 3GAFA 3I9JA 2D59A 4FCCA 1LRJA 3SLGA 1W4ZA 2D3TA 5FF9A 5C7LO 4P4LA 3WGHA 3ZV3A 5L7WA 3ZWNA 1PGOA 4CLHA 1DB3A 1FDWA 4E0BA 3A9WA 3ZU3A 2BFOA 4RF5A 5K0ZA 1R4MA 2JHGA 4E32A 3A1NA 3ZV4A 2PZMA 1A71A 2XXJA 3UN1A 2ZYDA 4EJ6A 1BXZA 4N5MA 5A05A 4BMSA 1SB9A 1YB5A 3ONFA 1AXEA 2YZ7A 3QJ5A 1P1JA 2GNAA 1HEUA 5C37A 2QRJA 1UZMA 2O3RA 1HYGA 1ZIDA 1OMOA 3DAPA 4ZJUA 2BI8A 2FZWA 1IZ9A 3GNQA 3IP3A 5HBRA 2VHWA 1CRWG 5BSHA 4BKOA 3GVPA 4PLGA 5IDWA 1PR9A 4L4XA 3RC7A 2H1SA 1BTOA 1U4SA 3OIFA 2O4CA 2X58A 1HDXA 1T1RA 3NEPX 5TT0A 5KJ6A 2B5WA 3G1UA 2HCTA 3E1KA 4B4VA 7ADHA 4UREA 3NDIA 8LDHA 5EL0A 4O1MA 4B3JA 3WIDA 2NWQA 3K96A 3WQRA 1H2BA 4LCEA 3U9LA 3PP8A 4HNHA 1U3VA 1I01A 1CETA 3C1AA 3RJ5A 4NPCA 3VAZA 4RLSA 2RAFA 3L6EA 4YWJA 2VRCA 4O63O 5I7VA 1IHYA 3OP4A 4N54A 4QT0A 4XGIA 2EKPA 2Y1CA 4PLYA 5JDIA 4Q39A 4WNIA 1HTBA 4K6CA 5TX7A 3T4EA 2O2YA 2EWMA 4RF2A 4AJKA 1GADO 4ND3A 3FSRA 4WOKA 3UCEA 3PPIA 3DXFA 2C82A 1JLLA 3L0DA 1PS8A 2X0RA 1Y6JA 3X2FA 4EEXA 1GUFA 5KVVA 5EINA 2C0CA 3HSKA 3G49A 4UEOA 3FNGA 1H5QA 3DONA 3I9NA 5B1YA 3E9NA 2GN4A 5IJZA 1T2FA 3CZMA 2OL4A 1PZFA 1E7MA 2O2SA 2ZYAA 2J5QA 3B1JA 3L77A 1IUKA 4ZU3A 3ZU4A 1F12A 1Y8QA 3IS3A 2C7VA 4XCVA 2ZCUA 4LN1A 4DLAA 4ZICA 1CDOA 3NTOA 4J1NA 1ENYA 3GLQA 4A26A 1JVBA 3ITKA 4LW8A 3IMFA 4D44A 1BSVA 1UR5A 3PK0A 1JAXA 4UVHA 1F14A 2P5YA 2VTDA 4PLVA 4E2WA 5A5EA 3OICA 3PWSA 4F6LA 3SLKA 1ZFNA 4MVJA 4PVDA 5ILGA 1XSEA 1GTMA 5AXDA 5DF1A 5I8WA 2B4RO 2E48A 4UUOA 4BNMA 3OEWA 2ZK7A 1P44A 1QV7A 1PEDA 1GPJA 5ENVA 5F5NA 3JQBA 1YVEI 1PJSA 3KV3O 1E5LA 4OMUA 1HE4A 2B4QA 1A9YA 2IZ0A 3WMXA 1SOWA 4ALNA 1NNUA 3L9WA 1I32A 3GF4A 1BW9A 4PIVA 4QTZA 2CFCA 1Y7TA 1OAAA 2Q2WA 3G17A 2DUUA 2Y1DA 4R3WA 1SOVA 2Q45A 2WMDA 5U1PA 4N7RA 1QYVA 1M75A 2X9VA 3WR5A 1BVUA 2I5PO 9LDTA 3HDHA 2X1HA 2QW8A 1KIFA 3BMQA 1IULA 1PJBA 4ZQFA 3VC7A 4R1SA 4JJFA 1Z7BA 1HXHA 2JL1A 4ALJA 2NQ8A 3OETA 3EK2A 3RC9A 3WGGA 3RIHA 2GD1O 2CVOA 2JCVA 4CR6A 2RCYA 5B4TA 2X9NA 2PR2A 2HSDA 2EGHA 4CMEA 1E3JA 5F1KA 4AICA 1I3NA 4QSMA 4WE3A 4J1TA 2UUPA 3PLNA 3ZHBA 4DQUA 1YQGA 1XCBA 4O6VA 2X7HA 2YFHA 3N58A 2D8AA 5JO0A 2WYWA 2HMUA 3DDNA 4ALLA 4IXTA 1ENZA 4CR7A 3CINA 4BNXA 1MG5A 3FNHA 4XR9A 3EZYA 1NHGA 4HXYA 3AY6A 1PJCA 3H5AA 1X1TA 4NK5A 4HFJA 5B37A 1ONOA 4CMEC 1W0CA 1H6DA 3PHJA 5T8KA 4DPKA 2ZB8A 3WGQA 3GEDA 4IY1A 1RM5A 2RH8A 4GWKA 1KOLA 4AFNA 4O0LA 3KYCA 1GL3A 4FW8A 3Q9NA 4YEDA 5KJEA 3AUTA 3WLEA 4BV9A 3WFJA 3JQ7B 1P1HA 3QVXA 4BB6A 2Q3EA 4WOJA 3FN4A 3L4BA 5F21A 2X86A 2FZEA 2W2LA 3I23A 5L7YA 5T67A 3FPCA 5A9SA 3PHIA 2AQ8A 4WECA 4IJVA 5G0SA 2Y93A 2O23A 1BW9B 1I33A 3NV9A 4RVFA 3VZQA 3BMNB 3PYMA 2P91A 4NDNE 4BS9A 4RPLA 1N92A 3WGYA 3DBLA 3NJ8A 1J5PA 2EGGA 4E31A 1LTHR 1O5IA 1VL8A 5BNFA 4CM4A 4R9RA 1CIVA 1IPEA 2Z95A 3H9JA 3NDRA 1QKIA 2IEDA 4YAIA 2DPHA 4CUZA 5L9AA 4K1LA 1I2CA 1Q7BA 4U6QA 1NP3A 5H83A 5F5LA 4GL4A 5HRUA 3GDGA 5JC1A 5LDHA 5F1OA 3VH1A 2DTDA 5I9MA 2DFDA 2NSDA 3V8BA 3QVOA 2NM0A 2AHRA 1EDOA 1YL6A 2WDZA 2RIRA 1E3LA 3JQ9C 2OHXA 4P4NA 4Z3KA 1BXGA 2B4TO 1X15A 1PZGA 2X22A 2NVUA 5COAA 1PR3A 4DIOA 4D41A 1KS9A 4S3MA 1VPDA 3OA2A 2B36A 3JD0A 1MC4A 1TT7A 3TPCA 5TT1A 4FFPA 3GMDA 4LMPA 3S1LA 1LJ8A 5ER6A 3WG9A 2QHXA 5EIOA 4RVGA 2WYUA 5ES3A 3EZLA 4GVXA 1MV8A 4B79A 5T64A 1XQ6A 1HETA 3ZU2A 3QWFA 4EUHA 3DBRA 3FBGA 2W2LD 2YDYA 2Z5LA 3D3EA 2HJRA 2NTNA 2GPTA 4Y6SA 1PQPA 3OECA 5IAAA 2BH9A 3ROQA 4D0SA 4DL9A 4IMPA 2PKQP 3QVTA 4AJPA 1X7GA 4TWRA 3VH3A 1E5QA 3OHSX 1NX6A 4JP3A 1AUPA 1SCUA 2FN7A 4G81A 4W9NA 3DR3A 1FDTA 3I9LA 4QECA 4NBVA 4WASA 1U3UA 3JD4A 1XEAA 1YDWA 1ORRA 2F00A 1XU7A 4WJZA 5HS4A 2CF6A 4JX8A 3O26A 1NQ5A 3JTMA 4CJXA 1N7GA 1EQUA 3NGLA 2GZ1A 3AFNA 1NAIA 1B2LA 1B16A 4A27A 2B83A 1T2CA 2UVDA 1T26A 3WDSA 2GLXA 1KETA 5L4NA 3HFSA 2VQ3A 4QXMA 2DLDA 5COQA 3RC2A 3S55A 4GX0A 4AJEA 1BRMA 4RJTA 1NQOA 2ILTA 2X4GA 2R2GA 4A5OA 4EZBA 3JD3A 4JK3A 2VZ0A 1VI2A 2I67A 1P0CA 1J0XO 1T2DA 5AXBA 1IOLA 3JQAA 3JQBC 3Q9UA 1XGKA 4RF4A 1YH3A 3TSCA 3T7EA 3B1KA 3IIEA 1KERA 2E6UX 4I08A 5DBFA 1ARZA 3U4CA 1M6HA 1X7DA 4CR8A 2A92A 1WVGA 3D1LA 2CDAA 2EEZA 2PA3A 3JQGA 4YJGB 3HDJA 1DHRA 3K8ZA 4RV9A 1N7HA 1GZ3A 1DPGA 3U5TA 1KEPA 4FOSA 4ZRNA 3JQCA 3TWOA 2BFPA 4Y8VA 3F9IA 3PHLA 4BB5A 4AL4A 4PG5A 3R3SA 1H6AA 2NLOA 2X8LA 3HB4X 1RM3A 2Y0DA 4XRRA 2DBZA 3QWIA 2Y1EA 4J7CA 4FC7A 1E7QA 3LT1A 4RVHA 2Y0CA 1CQIA 1PGNA 1QV6A 4TROA 1TI7A 1VL6A 1V3TA 3DQPA 2O3SA 1UXIA 4N5NA 4YBZA 2YHUA 3AOEC 2HMVA 4UUMA 2G5CA 1VSUA 4YR9A 4W4TA 1JKIA 4IDAA 4NU6A 4BO0A 4BNIA 2I3AA 2CZCA 3JYQA 4UEKA 1HF3A 3F5QA 2BI7A 1ZBQA 2VZ9A 4M1QA 1LSJA 2JJYA 1DFIA 3FWZA 1HRDA 3LK7A 2V6BA 1X14A 2YYYA 4IS2A 5IXSA 1VJTA 2PK3A 3O03A 2FMUA 3ZWBA 3ROKA 3E18A 3GA0A 1FXSA 1TEHA 3KLMX 1E1KA 4CMCA 4B4UA 5JC8A 2DM6A 3KYBA 1NPDA 4YAEA 4ZQEA 1YGYA 5F3RA 2CVZA 1N5DA 2Q1WA 1YBVA 4PZDA 4L74A 3WB9A 2PV7A 2I76A 3MEQA 3UOGA 3RU7A 2BFAA 4D43A 3TOXA 2JFGA 2WD8A 5IZCC 1RYDA 2RHRA 4FGWA 7MDHA 4MKRA 3L9XA 4C7KA 2J5KA 3LT4A 1A7KA 4Z0HO 2IEBA 2W2KB 2X6TA 3PLRA 1MFPA 1W8DA 3OQBA 4WLVA 4E2ZA 1B3BA 4J90A 3GNSA 3S2IA 1EDZA 4YAKA 2HKIA 1HYHA 3ZWAA 3AY7A 4GWGA 4MP6A 3SEFA 3BTVA 4NBTA 5JLAA 3H7AA 4J3FA 2EKQA 4K6FA 4BKQA 4A03A 4BO2A 4CM9D 1FMCA 4PLTA 4F46A 2ZTMA 3RJ9A 4CLXA 2EIHA 5F1PA 1EE2A 3FTPA 3LC1O 1U2DA 4NIMA 3RBXA 4JBGA 2VYVA 1R4NB 3HB5X 3PJGA 1BXGB 5L7TA 1MA0A 1HDOA 2B69A 9LDBA 3U4IA 3I6IA 1DRVA 4JN6B 4MVJH 2VUTA 1DIRA 4DMMA 4OXKA 3DHNA 1QXSA 4OJNA 1WZEA 4XQGA 4KOAA 2Z1NA 1RJWA 3WWZA 5T57A 4BKRA 3GPDG 3HHPA 1LRLA 2HMWA 1R6DA 2BGKA 4NFYA 5GZ1A 3IKTA 4MVJM 2X9GA 2JCYA 3M2TA 2Y1OA 4XGKA 3GQVA 1Y8QB 2VZ8A 3W6ZA 4EGFA 3P5SA 1PSDA 1A4UA 1RWBA 1A4IA 4IDDA 1IL0A 3DZFA 4BO3A 4DQVA 3AU9A 1C1DB 2NVBA 5DN9A 3VDQA 3RBVA 3WBFA 3PGJA 4GSKA 2FPIA 4NJMB 1WLYA 3VVCA 4D3DA 3ZNOA 1KYQA 1ADGA 4F45A 2DU8A 2Q4BA 3BYZA 4J4BA 2O4UX 5J23A 2GASA 3H9UA 2F1KA 4R41A 4NI5A 2GUGA 4K28A 1F17A 2HK7A 1ULSA 2OFPA 5L53A 5FI5A 3RUEA 4B7XA 4NBRA 4KDEA 3BIOA 1P74A 2UUOA 4IS3A 1I3KA 3AI1A 1ZMTA 5AVOA 3WQSB 1GYQA 3ZWCA 5JYEA 4FFOA 3WGTA 2JCXA 4YAGA 2PH5A 4TRNA 2DVMA 5B4VA 4PLHA 4ALMA 5BSEA 2DBVO 1A72A 1HSOA 1D3AA 2NQTA 3PDUA 4FDAA 1GV1A 3GZNA 4WCDA 5AYVA 4CMIA 1JVSA 3KLPX 4M89A 2YDXA 3L6DA 5TC4A 4CV2A 4CQLB 2ZB7A 4FJ1A 1DAOA 2PD6A 4FJ0A 4M86A 1D1TA 2C07A 3EHEA 3CMCO 3EUWA 1P1FA 4J16A 4FQ8A 2B37A 1I36A 4R3NA 3AOGA 3DMYA 2Q2QA 4JLWA 1DHTA 2IXAA 1E7RA 1PL6A 2HQ1A 4EBFA 5IN4A 1GUYA 5DP2A 2ZTLA 1HDYA 3E9MA 2JFFA 4E5KA 2GYYA 4A0SA 4RPGA 4OQZA 1B8UA 4EYEA 3IL2A 3GEMA 1X1EA 4I1IA 4B3IA 1NXQA 3H65A 4PN3A 4BVAA 3H9EO 3ZW9A 2BGLA 4WCFB 1PWZA 3ENNA 2ZB4A 1LLCA 4MVJE 1E7SA 3C1OA 4CV3A 3M6IA 1DFGA 4GSLA 4XEHA 5JAIA 3NKLA 2GERA 4DLLA 4U0KA 4U7WA 5JYDA 5JCJD 5CDGA 4DTIA 4WEQA 1N8KA 3QW2A 3CXRA 3E82A 1PIWA 4W82A 5CEFA 3DMTC 2I9PA 2BLLA 1XLTA 1LDYA 2OO5A 4YYZA 1H6BA 3P7MA 3VDRA 5COBA 1F06A 1LRKA 1O94A 3HADA 3TFOA 5TJHA 1U9JA 2GN9A 1T4DA 1WAMA 4INAA 4WGGA 2H6EA 3PI7A 3PDJA 1TXGA 2DC1A 3WGZA 1WMAA 5DDIP 1GV0A 3CMMA 1SZJG 3ZWYA 5BSGA 2CVQA 3JQ8A 3GT0A 1U7TA 1UDCA 2XOXA 3D0OA 1RM0A 5ENDA 1HYEA 2X0JA 3DL2A 4HFRA 1E6WA 4CLRB 3MOIA 1C0LA 2D2IA 3E9QA 4UVIA 5CPFA 2YHIB 2VTEA 1PZHA 4CM6A 4CMGA 2AE1A 3BMOB 4Q3AA 4HX5A 3KEOA 1ZK2A 1FF9A 4YJDA 3SC6A 3GNTA 3RUFA 3GN1A 1VSVA 4LRTB 4XIJA 3TL2A 1KVSA 4H3VA 1X0VA 4TKLA 5DT9A 3UFXA 4DBVO 5G0WA 5HS6A 3M1AA 3GFGA 4FIZA 4FJ2A 4P4GA 1LNQA 1YQDA 4NK4A 4RLHA 1GYPA 1JWBB 1G0NA 1BGVA 2A9FA 5LC1A 4XIYA 4X54A 4YVFA 5ER9A 4JP2A 1KEUA 2ZTUA 3LC2O 3MTJA 5I9LA 5DCWA 4DWVA 3U4HA 4D0RA 8ADHA 3WICA 3K5PA 5JAMA 1LC3A 2O3JA 1AHHA 1Q0QA 1JWAB 1P1KA 2FSVA 2QYSA 1EBUA 3DBRB 4XJSA 4A2CA 4QFCA 1QR6A 3PJEA 1HE2A 1HDGO 4NBUA 4NZ9A 4UAGA 4DYDA 1NVGA 2CNBA 4XB1A 1HE3A 4I9UA 1OC4A 1GQYA 1VRWA 4OGWA 3D4PA 5CDYA 5TQVA 4FC6A 1LDNA 3ZWOA 2QQ5A 3VZPA 2FSSA 1JW9B 1L1FA 1P45A 1AN9A 3IOYA 4BNTA 5ILOA 1O95A 1ZEJA 3DC2A 4NR0A 3MWEB 3T7CA 5FI3A 3FPLA 4YT4A 4R5MA 3RUDA 3GDOA 4IQGA 3ULKA 1OOEA 4HADA 2A94A 2DKNA 3FNEA 4IDCA 5IXYA 3HNPA 1LDGA 1T2EA 5ITVA 3UICA 3GN2A 3ITDA 1LSSA 1GEEA 1NFQA 1HLDA 1A9ZA 1E6UA 4XWYA 4JIGA 5KKAA 3DZBA 1ONPA 5G4KB 4IXWA 1E3IA 3JSAA 2PFGA 2AW5A 4OXYA 1P33A 1XQ1A 2AG5A 2P9GA 1V0JA 2Q1UA 4R69A 2LDXA 1UAYA 2HU2A 3JQDA 4R01A 5JBIA 3RUCA 4HWKA 1ZZEA 1L7DA 1B15A 4ND2A 4W99A 3KRTA 4A7PA 1BVRA 2PKQO 1MFZA 1QLJA 3H4VA 1PJ2A 5A9SB 1R15A 2R00A 4U0JA 1UXGA 3GVIA 4MP8A 4MVJP 3ZWPA 3C1TA 3JQ7A 2GZ2A 3DOCA 4OOEA 4D3SA 2HLPA 4J4TA 4RVSA 3F3SA 3H9GA 4Z0PA 5TGDA 4H7PA 3ZWWA 2Q46A 4ILKA 3KYDA 4OO3A 3HUDA 3WYBA 1EZ4A 3C3XA 1JAYA 2W4QA 3KTDA 4YRAA 1PU2A 4B3HA 4Z9YA 2OORA 3F1LA 3GZNB 4CQLA 1ONNA 4YT8A 5A9TA 1ZH8A 1Q7CA 3H5NA 5EQFA 3V1TC 1U8XX 4IDEA 4KZPA 4QO8A 1QYWA 1RYEA 4EUEA 1Z73A 5ICSA 2VYND 1G6KA 3AOEA 4R16A 3F4BA 4CMIB 4U8GA 1HT0A 1E0DA 1I0ZA 3RKRA 3ZN2A 1GZ6A 4CQMD 4KDFA 2IDZA 4GBJA 1NM5A 1VKNA 2HAEA 2VT3A 1WDMA 5I9NA 4KTVE 1JKJA 1ZW1A 3L6OO 3VPGA 1YBAA 2VHXA 2A4KA 1Z7EA 2HRBA 3G1TA 4QX6A 4PLCA 3KSUA 4ZA2A 3GMSA 4BMVA 1X0XA 1PQWA 1V6AA 1SAYA 4PRKA 4AJIA 4NJMA 1I24A 3QRWA 1QYDA 4CM8A 1SPXA 1T24A 2YV1A 4XYGA 3Q2IA 3MOGA 4HV4A 1UDBA 4Y98A 4ND1A 5TRTA 2O3TA 5L45A 3GUYA 3AM4A 5KVQA 3OQ6A 4XZ3A 1EQ2A 4K26A 3I5MA 1LDBA 3E5RA 4XX0A 3JYLA 2Y1GA 1M67A 1HDRA 5H82A 3FR8A 1MP0A 3UUWA 1VLLA 3IJPA 1WP4A 2UYYA 3F47A 4R9SA 2Z1MA 2OZPA 4OAQA 4H15A 2G0TA 3WGOA 3LLSA 1LI4A 4HNGA 4QUKA 3K31A 3IDSA 1ZCJA 4BO8A 5LDGA 2TMDA 1ZO8A 2AXQA 4XJTA 5LCXA 5CG1A 3HN2A 1SEVA 4J4HA 4XKJA 3BTOA 1WPQA 2JD0A 3ORFA 3VZRA 2TMGA 3UKOA 3QV1A 1EUDA 3GOHA 4ZHSA 2J3HA 3OQ1A 1PTJA 5DZSA 2GR9A 3ANNA 5K6AA 1EUCA 2J3JA 3NYWA 1R4NA 1DIAA 4DBZA 5A3JA 1EFLA 2Y66A 5ICMA 4D7AA 3PJFA 1I10A 2FR1A 4HFMA 4FGSA 3DO5A 3WIEA 5B12A 1RM4A 5EMHA 1HLPA 4GAEA 1Z45A 1MGOA 4Z3DA 3RFTA 3O9ZA 4EW6A 4DREA 3I4FA 3GFBA 5L51A 1DXYA 1KVRA 1C0PA 2ZJ1A 3AWDA 4NMHA 3CTMA 3ZV6A 3NUGA 1GEGA 2W2KA 3NT4A 3O4RA 3INRA 4QFDA 1XA0A 2VN8A 2POQX 3OBBA 5CDTA 2P5UA 4G2NA 1KEVA 3T4XA 5I7EA 5KIAA 2VWQA 4MDHA 5A04A 1Z6ZA 2PY6A 4IJKA 3P2YA 4MIEA 4AJJA 3QWHA 4B8WA 1KVUA 4B8ZA 1N2SA 2JAHA 2GDZA 2V6MA 3BHJA 1WXDA 1DIHA 1EK6A 3QIVA 4KTTE 1VJ0A 3ONEA 2BKAA 4RDHA 2EW8A 4YCAA 3TQHA 3GHHA 3IC5A 2YHIA 3W4JA 2V7PA 2HRZA 4I5GA 1B14A 4RVDA 4Y6RA 1GZ4A 4D45A 4LGVA 1NBOA 1U5CA 4FR5A 4GGPA 4R5HA 3QA9A 2ZKLA 3W1VA 5IG2A 4II2A 4NBWA 3ASUA 3JYOA 1PJTA 3U0BA 1IYZA 4LSWA 3JV7A 2PD4A 1ZK0A 3H2ZA 1XU9A 1LU9A 3D64A 3INGA 4LSMA 5HA5A 4D46A 1GYRA 1YO6A 1YDEA 3BMCB 5HM8A 3C24A 2CSUA 3L07A 4ZQBA 4PVCA 1ZXLA 1DRUA 3NDJA 1GD1O 2OGUA 1Q7GA 2WJPA 1C14A 1I2ZA 4PLWA 3TNLA 1R4MB 4MINA 1K6JA 3EMKA 4TQGA 3PHHA 4BUCA 5G4KA 2YQ4A 2HDHA 1Z75A 4OQYA 2VRBA 4ROSA 4I5EA 3BHMA 1XYGA 4MVJD 3QWBA 4Z9FA 3NGXA 2EHDA 4HFNA 1BHSA 2Q50A 2FP4A 3PWKA 4DUPA 1LSOA 3KO8A 3WXBA 5IZCA 3BMCA 3U4DA 4DVJA 2VNSA 2AQKA 2XAAA 2NUAA 4RORA 3TZQA 3LYLA 1NVTA 5JXWA 4RGBA 1ZSVA 3GPIA 3B1FA 4IGFA 4BNLA 3KZVA 4AJ4A 4Z0TA 2PZJA 1V3VA 1HL3A 4WCFA 2YFQA 3GVXA 4ESOA 1GAEO 1O89A 3G79A 4YB8A 1K2WA 3JQAB 4BNKA 2W90A 2ZCVA 4FSHA 4PLFA 3B20A 4BNGA 3DOJA 1BG6A 3DBVO 3WGIA 1YL5A 2DAPA 4J9VA 4XB2A 2X23A 2EV9A 4GVLA 4OKNA 5A9RA 5TIIA 2PLAA 5AOVA 3OJ0A 4M54A 3TFQA 1SNYA 2Q49A 4M49A 4XR4A 2RHCA 4E12A 3E48A 1GUZA 2JFHA 3MJTA 1PZEA 3U49A 3VPSA 5DOVA 4CM5A 4E33A 3UCXA 4IQ8A 5TSDA 3ETEA 1PX0A 3IKVA 4KUHA 5JS6A 3W8EA 5L4SA 4E3ZA 4WLEA 1P9LA 1JKFA 1PQUA 2DUWA 1PJLA 2Y05A 1EK5A 4IDGA 1RKXA 2W8ZA 3RUIA 2CMDA 1KC3A 3FRJA 4CLOB 1U28A 4ND4A 5EQDA 3ZU5A 3VH2A 4G65A 1ZSYA 2Q1SA 4I9HA 3UXYA 4WEOA 3LU1A 2WD7B 4FN4A 4WLOA 1ZJYA 3RWBA 1HE5A 4ZGWA 2GRAA 5BNTA 5JAQA 4BO4A 4PZCA 1B26A 3AU8A 3ADOA 4HY3A 3DB2A 1C1DA 1Y1PA 4CV1A 4DQXA 2BHLA 1JU9A 1E1LA 1I2BA 2C59A 3BHIA 1Y5MA 2Y1FA 5CG2A 1WZIA 4IUYA 4NH4A 3HN7A 2OBYA 2J6IA 3D3WB 3DZGA 3PQDA 1DEHA 2I6TA 2QYTA 1YJQA 4CUKA 3FTNA 3RD5A 1G1AA 3I3OA 4B7UA 5TNXA 2IZ1A 3RCBA 4R54A 3ENKA 1SEPA 4HKTA 1BWSA 3INTA 3PVZA 1C1XA 2PGDA 1WDKA 4DA9A 1S7CA 2EP7A 3R3JA 3UF0A 2AA3A 1PWXA 5AQ1A 1ISFA 1P0FA 3GRPA 5I7SA 3H6KA 4C4OA 1H9BA 3A4VA 3C7CB 4I5DA 4PG7A 4KQXA 4BKPA 3NT2A 2UAGA 1X13A 4KQWA 4NHEA 3WSVA 4P8RA 1C1XB 1HSZA 2Q99A 2P2SA 3VZSA 5TJ9A 4U5QA 4FFLA 2E4AA 4BOYA 2FR8A 2OP1A 3MTGA 3ZHZA 4OH1A 3N74A 4BHTA 5FWNA 4YRDA 2PZKA 3EW7A 4CQMB 5A02A 5JAZA 4XYEA 3C8MA 1IB6A 1TVEA 4NFSA 2R6JA 5L3ZA 1ZSNA 1DFHA 4LISA 2PKRA 3ICCA 4XDZA 1UJMA 2G17A 4J0FA 5G0TA 3WWYA 1ISMA 1CF2O 3OEYA 2XF8A 3VKVA 2PZLA 4YJFA 3VPFA 1M76A 1TA4A 4BGVA 3RVDA 5JPIA 3F46A 4MVJI 4J7UA 2XPCA 3WLFA 1D1SA 1PGPA 1A27A 4IJWA 4FFRA 4R1UA 2JD1A 3D5QA 1J6UA 2AE2A 4B4OA 1A5ZA 1PL8A 1V3UA 1NFFA 4GKBA 4I9NA 4J43A 3SXPA 3K73O 5L95A 2D0IA 2J8ZA 3LSYA 4RF3A 1Y8RB 2NVWA 2ZQYA 3TJRA 5C5IA 1PGQA 2OP0A 4WLUA 5DNAA 1C0IA 3VTZA 4YDRA 5G0VA 1NR1A 2O3UA 1V8BA 1NR7A 5CPBA 1Y8RA 1K6XA 3I4CA 2O7SA 4BV8A 5KWEA 3PGXA 2DTXA 3HFGA 4FD3A 4II3A 4E5NA 3V1YA 4OSPA 4IINA 2AEFA 4PG4A 1UZLA 2PGJA 1KBZA 4TMFA 3CKYA 2EF1A 3ZGYA 1LBEA 4JQCA 4GGOA 1SBYA 5EPOA 5BSFA 2OOSA 4J6FA 2D5AA 3BMQB 3QE3A 3V2UA 3S2EA 5BNIA 3NJ4A 3AI3A 2WEKA 1FK8A 3AUAA 1DJQA 4I8XA 1UXHA 5CP8A 1GPDG 3VHRA 3AUUA 4MOWA 3K6JA 5IN5A 1E3WA 3WOHA 1ISGA 1YONA 4IGEA 2EJVA 3FNFA 2WWRA 4GKVA 4J9UE 4QQRA 2JD2A 2HJSA 4DYVA 5IF3A 2AQHA 4XYLA 1C3VA 2EP5A 4NFHA 4BNJA 1PGJA 3JYNA 4Y9DA 4Z9XA 4CM7A 2C29D 2RH4A 3MCVA 3VPXA 4G5HA 2DQ4A 5KJCA 4TVBA 3PYXA 3SJ7A 4J91A 4JXKA 1D4FA 3KSDO 3MJSA 4TVOA 4JBHA 1ZK4A 2RBEA 1N9GB 3JQGB 4UUNA 4YJGA 3FCOA 4IBOA 4AJNA 2QZ9A 5KJ1A 2VOJA 3GUCA 4L76A 3ZWVA 3DTTA 1K0UA 2G82A 1KY5A 4OKIA 3KETA 4LCJA 5MGBA 2JKVA 1J49A 3VPHA 1NTOA 4KUGA 4RPKA 3OJEA 1C0KA 2NTJA 4I5FA 2DPGA 1QMGA 3DHEA 4TRJA 4QEDA 2NV6A 3ICPA 3PIIA 1TT5B 3ST7A 4MIOA 4YXFA 4RQUA 3FR7A 1UZNA 2WD7A 5JDCC 1QRRA 3HQ4O 3BTSA 5A06A 3PZBA 1YKFA 4GX2A 2IRWA 1EVIA 4FS3A 1AE1A 1VL0A 5C7OO 2ZIZA 1QSGA 3COSA 3ZH2A 3KOUA 2HK8A 4EJMA 2EW2A 1JQBA 4CODB 1MUUA 2ZATA 3DBHA 3CPSA 1JA9A 4UVGA 3F1KA 1ISHA 3Q3CA 4JJIA 4E6PA 3A28A 4ITUA 3RKUA 5GZ6A 1I3MA 1QYXA 3DTYA 3I9MA 4S1VA 5DBGA 1FDSA 4OOFA 4HP8A 4AJLA 4E5MA 2FR0A 5JCJA 4AVYA 3NX4A 3EVNA 2Q4EA 4KUEA 2DBQA 1TB4A 2GCGA 1P3DA 3MJEA 4Q3NA 1DIGA 1H9AA 2NTVA 3DHYA 4YRBA 2OMEA 1K3TA 1DC6A 4YACA 5H81A
chains in the Genus database with same CATH superfamily
1U8EA 2JIMA 4Q9NA 4BP1A 1ADBA 1EAYA 1U2GA 3QH4A 1SXJE 5KOIA 1UMCB 1NU8A 2FW6A 1UXKA 2PCLA 3JALA 4PSKA 4Z6KA 4HGQA 2OO7A 1C9KA 2ZUCA 3GJ4A 5CIQA 5JATA 1TT5A 3IVMA 4TXLA 4LOAA 1U4NA 4WADA 1TYDE 3D31A 2D1YA 3UOWA 2VNHA 1OBHA 5F9MA 3IA7A 4CL3A 4QDZA 4KL8S 2BF7A 2Y99A 3GGJA 3WNVA 3H0CA 1IU9A 3AYZB 1VJ1A 5H1YA 1KY2A 1UFOA 3JR3A 3WK7A 1DQSA 3VSBA 4BGEA 2Q1XA 2PLFA 3IJRA 3WDMA 1L3IA 5BRAA 3R9IA 4HLQB 4QYIA 5KYYB 4I9FA 1DCKA 1U6KA 3ZE1B 4CVNA 1VGQA 2IWHA 4MWSA 1I6LA 1NBAA 1U2EA 4IH1A 4KVAA 1QQBA 2XCIA 1EPUA 1C9JA 1QGOA 3BREA 1IRXA 2PZAA 4R71A 5EQTA 1TRKA 2XYVA 3ZWMA 3DL7A 4AKGA 1JU4A 1DKNA 4FDVA 3SYLA 1DPFA 1B0PA 1YBMA 4H7IA 1VBMA 2C5LA 3HA2A 3Q7PA 3OBIA 4CFYA 1O57A 3GEEA 2G1PA 3D4NA 3HE3A 1IBKB 2CNLA 3ELWA 1HT1E 2M6LA 1S8FA 4Z5XA 3AHJA 4MCAA 3JYPA 3I3SR 4JROA 4KSYA 3SHQA 3KAQA 2I55A 3GLUA 1N36B 3H7IA 2CLKB 1RQ2A 1GSAA 1NUAA 2P4QA 2VNAA 2Z3ZA 3SXUA 2C9CA 2HSWA 1T5BA 6REQA 3PWZA 4I3HA 3RYFA 3ZHYA 2OQIA 1UKEA 3PNBA 3GK3A 4J0DA 4OBWA 1KP2A 1F38A 1RHMA 3STTA 2QNRA 4HK4A 1AQLA 3HWRA 5A3VA 1NBHA 1TF5A 5D7NA 2X19A 3KR0A 4CIDA 5A4FS 3CWQA 4EGCB 1DX9A 3ANMA 5AM5A 4ZANA 4HWOA 4C6RA 4AJHA 2AG6A 3ZI0A 4IQ4A 2XSZD 2IUFA 2Y67A 1HFKA 2QS9A 1F0KA 3EFHA 3ESRA 2CKMA 4LKOA 2F7SA 4Q47A 3ZEAA 5ITSA 1EBBA 4PGMA 2FTKE 2YUTA 1GPUA 3EVBA 2WLTA 1XHLA 4JOQA 3K2EA 4I4TB 4KWHA 5EMLA 4IP0A 4D57A 4CL2A 1GTVA 2IIBA 3VOAA 4CEHB 1TQ8A 1QORA 2CNNA 2K2QB 4M8IA 3E8XA 4B83A 5U9CA 1OPXA 3AUKA 5JMPA 2J3LA 3EVAA 4M55A 1HWYA 4DR7B 4L4YA 4C6TB 5LZ7A 3QVLA 4WKOA 2HRQA 2BVNA 4HF7A 4TOIA 1I4TD 2I3ZA 2W22A 2EWWA 4BL5A 3W5VA 3ICQB 4BN5A 2OV6A 3F7NA 4IUDS 2P68A 1M66A 1PEAA 1XEXA 1V1JA 2EX0A 1ZNQO 1Z0ZA 1AUOA 2YWEA 2ZG6A 1Z39A 4LGYA 4EO4A 3L7NA 1GNVA 5BV1A 3KCQA 3TAHA 2O5RA 4LHEA 4Y6QA 4QBFA 3KVOA 5BYAA 1EVZA 1DSSG 1VLVA 4U7GA 1SQFA 2R7NA 2WIGA 3GVCA 4GX1A 4KQCA 2ZJFA 1YJXA 5J63A 2AZDA 3TZKA 1S02A 1EX1A 1HQYE 2GH1A 2NZVG 3GGGA 3KB2A 1H4TA 1MRZA 4YGXB 5FP0A 2MR5A 2XMQA 5UKDA 4DIDA 4F6CA 2YV3A 4BRZA 1RACA 3B12A 3IAHA 4IOMA 5F51A 5EMMA 4ZCSA 3T5BA 3NIGB 4BTLA 2BV3A 4FMDB 4QLAA 4F6RB 1ZJ5A 3WSWA 4NAHA 5DNDA 3RIEA 3SYRA 4RMIA 1S89A 3K8OE 1TZKA 1SVKA 5GONA 3PTZA 1EVLA 4GOKA 2NAFA 3RV4A 2X0FA 3JR7A 4A2QA 2C77A 2JRCA 4DMHA 1Q3TA 4B4KA 1JQ3A 2PHZA 2WJZB 2BFNA 2J5XA 4QODA 5D6OA 1CCWA 2C3MA 4PSAA 3PCXA 3VA7A 1FDVA 1BDBA 3CRRA 4N7MA 5BOSB 5IZ4A 3B51X 4KE7A 5KDLA 1DV1A 2W4MA 2CD9A 5L3QA 2ZPUA 2DHDA 4WERA 3AINA 3KC2A 3O4VA 4JENA 3B1XA 4XVHA 4YJ2B 3TLCA 2VHVA 3CW8X 2VQFB 1S6YA 2FY8A 1XNGA 3OJFA 3CWCA 5E2IA 2JHFA 3Q5EA 4W1RA 5G4LA 3R9KA 1Y3FE 4Y1EA 1U98A 4E13A 1R12A 4X62B 3PFIA 1V7CA 1GFSA 3IURA 3TLGB 1FRNA 1N1GA 5FWDA 4DSOA 1X7WA 5GGXA 3KE9A 2XDWA 4WESB 5L40A 2XV1A 4NE7A 1LS1A 1GTJ1 1DIBA 3DLPX 1HL7A 3SHTA 3KQMA 2NACA 1RHUA 1YC5A 3QQPA 3TLJA 2E49A 1ETHA 2Q4DA 3IMCA 2COKA 4TV8A 5JQWA 1ZKDA 2NN3C 3SZUA 1SO8A 3FDZB 1K4YA 4TUYA 4ENSA 2ATEA 2JAXA 3BL6A 3RH0A 2X9QA 3BMNA 1E4VA 3M81A 4AUEA 4N5LA 1E3WB 2AC4A 4HUJA 3THXB 1XDBA 3QTBA 1WTAA 4IV8A 1V1RA 4WUTA 4B82A 1UKVY 4XPIA 4TVKA 1E0KA 2XQFA 2WF8A 1UAGA 3RS4A 5D00A 1H8HD 3CGWA 3WWDA 4CF5A 1XRMA 5DN6D 1T5OA 1Z2CA 2PNFA 2MSKA 2VPQA 3AESA 4LK2A 2O50A 2SICE 4X5OA 4CKXA 4MKXA 4Z2AA 3S2FA 3UAYA 3DAFA 4BQNA 3UFBA 3GRKA 2EYUA 3A31A 4O0MA 3LDHA 1YRHA 2IUEA 1EFKA 2A57A 2WA1A 2WHPA 3AMVA 5ITZA 4J1QA 4ZK2A 2GRJA 1QG6A 2X7JA 5K0TA 3EGOA 3VR1A 1DARA 1YS6A 2ECPA 5HFJA 1IM8A 4JC0A 4CLOA 2ZITA 1O6FA 3N1UA 2HIAA 3VHXA 2B2CA 2QTVA 1DTSA 2NNLD 4JKIA 4ER6A 1NW7A 4I8DA 2WTXA 3DNPA 1RLJA 1RBQA 4V38A 4DAEA 4LJSA 3UAZA 3LXMA 1M7GA 1BEEA 1IOVA 4BX9A 4CIYA 5MDHA 2HF2A 4L4SA 4L75A 1T8PA 1G59A 2AJDA 1VE9A 3BKXA 4GRDA 5MN5A 2J7PA 2YIVX 3DQQA 5JZOA 1CUHA 4H1VA 1A2OA 4JD5A 4RFVA 2GT1A 3EN0A 1K7EB 4C6TA 1S2IA 1U11A 1MX1A 4DLKA 5C4GB 2HMAA 2HOQA 3Q0EA 3QVWA 1KKUA 1U0OC 1ZUD1 5A2GA 4IJUA 1B0ZA 5JJIA 1WETA 2JHCA 2VBGA 2VSYA 2BMAA 2YJZA 3BH6A 3HV2A 4H7FA 3N0VA 4GF5A 3HTXA 1R0LA 1D1PA 3HLTA 4FBMA 1L4BA 4IXNA 3VH4A 1CFJA 5KTKA 2ZTVA 3CEAA 2ZAMA 3A1FA 3AJRA 2EERA 1NQAO 2O5VA 3OPVA 2WICA 3KQHA 2QUIA 3F2VA 4XGRA 2F1JA 3X1KA 1XMOB 1GKKA 4P5DA 5B3LA 4UNIA 4AQDA 2XMSA 1H6CA 1E1CB 2PX4A 4JC5A 4UNSA 3RYFB 4EI2A 3OE7D 3UH1A 4E4YA 3HZZA 2Z8YM 1P91A 3L0CA 2UUBB 4N76A 1JT2A 3DDCA 3L0IB 1SC6A 4ED9A 4XYBA 2R751 5EXDA 1X70A 3H05A 1C7EA 2OECA 3HK2A 4LWPA 4AX8A 4XRGA 1JE1A 3Q5DA 1TKCA 5JXIA 3UHFA 3ASVA 3FOZA 2GNOA 1HEIA 3E9DA 4ETWA 2SCUA 121PA 5CXSA 5IAEA 3OFSA 3T9FA 4BMNA 3IDQA 4NV1A 5HMLA 2ISQA 1WWKA 4GBGA 2V6FA 5B7PA 1ZWLA 2Q3MA 2WWXA 4WBSA 1I5OA 3I30X 1U02A 4REOA 1TAHA 5LWQA 1IK4A 1X94A 5FHQA 5AVQA 2YMQA 1DQNA 2G8NA 4KQ9A 3ZDAA 2ZRQA 2OAEA 5LOVF 1DQYA 1TMYA 2YJTD 3PX2A 4ZI5A 3EDRA 2VJPA 4B32A 2Z08A 2XQGA 2RCNA 3GU3A 1N2CE 3MTEA 5L3RA 3WLRA 1YE3A 1RHRA 1T36B 2XEXA 2IS4A 2OCDA 4EX6A 2IU4A 1N5JA 2YVAA 3OQNA 3GLKA 2NU9A 4RPJA 1LI7A 3GG2A 3GRYA 4O2BA 5CM2Z 4CPDA 4LNUB 1DBIA 4H7JA 2VT6A 4KIGA 5IKPA 1R50A 3EBLA 4JVLA 2O8EB 1H8EA 4NWIA 4N8DA 5J3JA 3NHFA 1R0BA 3V1UA 1J0EA 2NYAA 3FY4A 1EGQA 4FSDA 3H8VA 4WXHA 2ILVA 1V5FA 4MB0A 4KMSA 3LGSA 4DCTA 1L9XA 1Q19A 4L5IA 1SXJC 2DKFA 1U8TA 2OXIA 3VI3B 5IFKA 2H06A 2AWNA 3QMMA 1G2OA 3E4DA 4W5HA 1D8AA 4KJZA 5C4MA 1RPZA 4UCFA 2B98A 2H0AA 4BGIA 1I8TA 1ABFA 2PGXA 2FWMX 2GN6A 3KM0A 4YPOA 1K7FB 3K20A 4G4SP 4UHJA 5IMBA 1TVKB 3UUEA 2OC4A 1ESMA 2AUTA 1INLA 1NKSA 4LDJA 2GM5A 4OBBA 1Z5NA 1HOTA 3FFTA 3WIOA 4YYEA 1T9BA 1XAGA 1UXJA 3MHPA 3QXGA 1SD1A 4AROA 3A1CA 3K30A 2K87A 4RM3A 5I5EA 2ZYUX 4C89A 2H17A 1O4WA 2IYVA 3RUAA 1TVKA 4M1SA 3ZCVA 4M53A 4YQZA 2PGLA 1OIXA 4G25A 3Q4GA 4FXOA 1C1YA 2BELA 3FX2A 4ONEA 3T7DA 4OSOA 3CNEA 1TCUA 4G1FA 3GCDA 2H1RA 2I7CA 4FILA 5TQ0B 3VYWA 3WX0A 4CRWB 4BY9E 1P9WA 1PJ3A 2V1XA 5B58T 2I65A 4RTKA 1G6Q1 5CFZA 2HLHA 2EKDA 3HU5A 1AHIA 5E6SA 2J08A 4K9RA 3OF3A 4C5AA 4FB5A 4OEHA 4P4TA 5JZ9A 5DM2A 5P8WA 1CJCA 1TZ2A 4Q1DA 2J33A 3CISA 2DOKA 3QFHA 5FR2A 4GMGA 4AZ3A 4Y1GA 4B46A 4EMTA 1MEEA 1N1EA 3DE4X 1XHFA 2BGNA 3C2QA 4UD2A 5FOSA 3DULA 3W9SA 1SD5A 2IHVA 2EX1A 2F3PA 2KB0A 3SOZA 1GPKA 1Q7RA 2W98A 4U63A 4UVEA 3TXYA 4AYTA 1OI3A 4UM8B 4ZYXA 3ADDA 1Y3CE 4J1SA 2Y0EA 3DAOA 4MW2A 5LLDA 4ZV7A 4IHJA 3NAQA 4OQNA 3RVPA 1Z74A 3D54D 4K8RB 3W5IA 3STHA 2BFCB 3KXIA 1DOAA 5K3OA 4Q0MA 4MR7B 1KO5A 1LLDA 2Z9CA 1DLJA 2P2ZA 4TV8B 3RYCA 2LXNA 5FBVB 3BE8A 3HCFA 2R8OA 5LYJB 3P97A 3C0KA 5A5FA 4BNNA 1V2HE 3BD7A 3PYLA 2C2OA 4DRXA 1GT6A 5BV0A 2EWVA 3IERA 3FFXA 3TZCA 1PS9A 4ZXPA 1N9GA 3C7DB 2JS7A 4GQIA 2PTGA 3R7NA 1E3SA 5CAEA 2X8JA 4CLEA 3FIUA 4KC0A 4ZT4A 4XWKA 1M7HA 8GPBA 1KDOA 4ZHQB 4BQPA 1A1VA 2M6SA 2DPYA 2XRMA 2YHSA 1W44A 3F5SA 2GUWA 1GU0A 2ZJ3A 3D02A 4FNOA 3QXJA 2WG2A 5DULA 5I8PA 5JJLA 3QE4A 2FPPA 2Y71A 3PEUA 2OEPA 3CO0S 5M2QA 3IP1A 1AMUA 2ON6A 3GJ6A 2REOA 3I6QA 2RDMA 5BOSA 1TUBA 2D8MA 5K3FB 2OR3A 1KC1A 2ZUTA 4A8TA 1GQ2A 3HPRA 2D4AA 3G6KA 4BLPA 3L8CA 4R2WA 5DM70 1P7CA 1Q1NA 1GGMA 3TL3A 1SD2A 5FL7D 4BE7B 4GEKA 5AT1A 2MYTA 1XU4A 2VJCA 3GZTB 3E53A 4YX9A 1RRPA 4TKMA 4X3CA 4JEMA 4M21A 5TF0A 4EJ0A 5KX5B 4BECA 1G9XA 2PZ8A 3KQSA 3GGPA 3KPWA 4MVJG 4PSVA 3SJBA 2B6HA 4RVOA 5B6IA 3GAZA 4DEYA 1WS6A 2C54A 4QUBA 4IQFA 4ZYVA 2OUIA 3IHLA 1IBMB 3AM3A 3DEYX 3L49A 4RMGA 2DUJA 2CK3A 3BK2A 1LGYA 4G0MA 4BO7A 3QZUA 1Y6FA 1VGRA 1OVGA 2C7GA 1WSWA 3OVMA 5FTJA 1CUUA 1KKLA 3AYXB 3UIEA 3RB8A 1NW5A 3HLYA 3R5FA 5F76A 3S8MA 3H4TA 3ZV5A 3D5TA 3L0OA 4D8YA 3G8DA 4EPXA 5LYJF 3D9QX 1HQKA 4PGFA 1PNQA 2Z30A 1OBCA 2R6ZA 4R8MA 3RFVA 4BNFA 1JHPA 3DT6A 4WKGA 1E3TA 1UBLS 1VMAA 3HRIA 4PGAA 5EQJB 1JJAA 2Q5OA 4OYRA 3BQNB 4QGGA 1LFAA 5JDIC 2XA2A 4MUYA 4XW2A 3TDNA 1WF6A 3MJ4A 4O59O 3W8DA 1JKMA 2E2WA 1XMXA 4DPLA 2V7TA 5F7ZA 1CB7A 1G8SA 2WU8A 2YWDA 3A04A 3AESB 4PY2A 4DQKA 3G85A 4U6SA 1I7NA 3M4NA 1U1DA 3N8HA 3DG9A 1VI6A 1FPMA 1SC9A 3CH6A 1YA6A 2BHTA 3UHAA 3ESXA 1NONA 2H1WA 5FUWA 4BC1A 2PG3A 3R0IA 3ZE6A 1S3SA 2PTHA 4R6XA 3T9EA 2ZZKA 1HE1C 1CE8A 3BWXA 4G84A 2O2ZA 4G09A 1VE1A 5JD4A 3FWNA 2WSMA 1L8OA 1ZIOA 4BE4A 2D3WA 4C7JA 4F86A 2O2DA 3L4BC 3SC2A 1GA6A 3KNZA 1O6GA 2DPXA 3AEQA 4ZTUB 3SZRA 5FFFA 2CY0A 4GDMA 1C29B 2PU5A 4ITRC 4AP9A 4FFWA 5AVRA 3GDHA 2BH2A 2NADA 2QX7A 2W71A 1R8QA 3MS7A 3QLUC 4LRYA 4AURA 4AL4A 1SIOA 1QX3A 4JUIA 4HBGA 5IK2A 5B4UA 3TGPA 2WSBA 1P1RA 3K09C 2IPOA 2JBHA 1UKCA 2GA9A 2GSDA 1XDGA 5K0SA 3TLKA 1YB1A 2AYXA 4AF6A 1NVXQ 1BVHA 3HCDA 3V5NA 4LK3A 3NHRA 1KYZA 3NIDB 1DWQA 4ALIA 3AZOA 4TM7A 4WFKA 5HIIA 2YRXA 2EG9A 5T4HA 4M22A 2B94A 4CDRA 1X7HA 1OU0A 3EW9A 3I83A 3TLAA 2HNBA 4W5TA 5AM0A 2D5LA 2RHDA 2O20A 3HG7A 1A5BB 3M4XA 3KKZA 4WNAB 5DIFA 2ACVA 2QPLA 3SPXA 1AD2A 3H99A 3MMNA 2ZBEA 5K2MA 3AK4A 1CXZA 3K8QA 3LBFA 4EABA 4TT8A 3B9RA 2B9EA 1BQEA 2VDNB 4PG6A 4WNCA 4AMGA 2UDPA 2V8OA 3THRA 2YXDA 3BE4A 3IEMA 5JSZB 2QG4A 3BEOA 1VHQA 2VI5A 3O38A 3TSYA 3OIDA 3MUNA 1UQRA 4NLLA 4YLEA 4D3YA 4H31A 4YJHA 2ICAA 4KO1S 3STWA 2OCGA 1Y34E 4DKJA 3IQZA 1R9JA 2NUPA 2FUKA 2JLAA 3MA0A 4OP1A 4RQTA 2QQEA 3UV3A 4MWOA 4F3YA 5CFOA 1YULA 4E30A 1DEOA 4NOMA 4X71A 1L5ZA 3ZYCA 7GPBA 2KWIA 2CEKA 5AXAA 5KNDH 3P52A 4PPQA 4BJ6A 1PJ8A 2P30A 1KDTA 3UXHA 3GLFB 1G8FA 1PR5A 4GMKA 4TYQA 4AG5A 4EL0A 3ZVNA 1L5SA 2J3EA 5AXCA 1EEHA 2NO6A 3K2BA 2HU7A 3TEMA 4UTNA 5JSQA 1ZVMA 4W9NC 2GBLC 2Q2VA 5EC8A 4PLZA 3WL6A 4EHAA 4B4WA 2WZBA 2G67A 1VPLA 3FZNA 4F85A 2ET6A 1OXVA 2GMWA 2YMMA 3CCCA 3KHKA 5H68A 3WLLA 5JNWA 1BVYF 2F3RA 4AO8A 1SXGA 5U4XA 1W6UA 1K0FA 1SN7A 1QPGA 2HMTA 1CF4A 1T0UA 4JH0A 4FW9A 2I29A 2YNMC 1XDWA 2PGOA 3TZ6A 3X2EA 1Y1LA 1MO3A 3TFWA 2VPWA 2G0AA 1LI5A 4G0NA 4OB6A 3U3XA 1T1GA 1SVSA 3NTRA 5LBUA 2Z4RA 2ZBVA 1IY1A 1V45E 3ZCRA 2X5XA 3WBKA 4AYXA 1GU7A 1TYEB 2QV7A 3IEUA 4BLQA 4DNXA 1NE7A 5CXQA 1ZK3A 2VJNA 3HDYA 1JG6A 3TINA 3TJZA 1A77A 4QVIA 3NTLA 4HDOB 2ATXA 3TM4A 1A8IA 4KNYA 4ZOLA 1S2OA 4EB6B 3CUVA 3DVRX 1G8JA 1OZHA 1UFRA 1T9HA 1T8WA 4GE3A 5GY7A 4BX0A 1K8XB 5HOQA 4N3BA 1EU1A 2XEDA 3L93A 4EG5A 3O3CA 4KYIB 1YKSA 3HCBA 4JNKA 4P83A 2HBRA 1GCUA 4ZO8A 4GOND 2PT5A 1HUQA 3L7OA 1CD5A 4ITVA 1GA4A 2IF2A 1S96A 4J7AA 4OM8A 4Q7EA 3G0BA 5IKOA 2BGUA 1L7QA 2ASEA 3S28A 2WT4A 5KTRA 1DQZA 1N4DA 5D1HA 4AC9A 3MGBA 4FCCA 2B5OA 2D59A 1V43A 5FF9A 3WGHA 4ZDIA 1UPBA 2CNOA 1SXHA 2IPLA 1OD6A 3B85A 1DB3A 3N2GB 4DIEA 3A9WA 3DCYA 4E0BA 2C2BA 4TTSA 4KXUA 4QPCA 4RF5A 2O8CA 4HQ0A 5JWHA 4INZA 1EFVB 1YZ3A 1THMA 1OSNA 2FMKA 4NAUA 4RK6A 3T5GA 2PZMA 4Q4DA 3TBHA 2HEIA 4EB8A 2XXJA 3WAKA 2QW0X 2QSYA 2OFOA 2XBUA 5I4KA 4CIAA 8OHMA 3G2HA 3RYCB 3L7MA 4N5MA 4C05A 1A04A 1DNPA 4BMSA 1BKSB 4WK0B 1SB9A 4F9GA 2QTNA 3ONFA 1KGSA 3ZTWA 4MXDA 5HQ3B 5K0FA 1CVIA 2JEOA 4P4UA 3VYUB 2A9QA 2ZWPA 1CIJA 2O3RA 3WLAA 3ZBQA 3OC6A 1ZIDA 2O14A 2G9QA 3AQ4A 5JPCA 3KEMA 2BI8A 4HZGA 1O7JA 2BGRA 1D2CA 1V8OA 4AZSA 4B48A 3R8FA 2D6FA 4LC1A 4M36A 1P4JA 1M1NB 2P6NA 3H1GA 4ZDWA 4NCIA 1PR9A 2ZRBA 4O4HB 4OF4A 4L4XA 4B5LA 4IEIA 5BNWA 1GTSA 3QTTA 3S7TA 2I80A 3TAUA 3OCWA 1IEXA 4DNPA 1QIEA 1RBZA 1LBQA 1T1RA 4K9SA 2EKZA 1ISRA 1PG0A 1P29A 2BMEA 3CLSD 3IHKA 2HCTA 7ADHA 2CN1A 1RIIA 3U3JA 4U9HS 3PRYA 4KWCA 4IRXA 4JEUA 4LC9A 4CCSA 3CR8A 1CB0A 3NIBA 3K96A 2NZJA 1U0BB 1L8AA 1Y98A 3OSZA 2G1KA 3FPSA 3KPUA 1CETA 3C1AA 1G21E 3RJ5A 4DE5A 5F73A 4I1VA 1EHYA 3DM9B 1NBMD 4N39A 3OUZA 4K2AA 3OKFA 2VRCA 2I4MA 2AFIB 4Q12A 5I7VA 3OP4A 2QLTA 2H2AA 4N54A 5A6SB 4BMCA 2QZPA 2Y1CA 1WABA 1KFJB 1Y1SA 4PLYA 4C4AA 4PYLA 2JIOA 1HTBA 2R96A 3CVWA 5TX7A 3DL0A 3U16A 3S4YA 1GADO 3L41A 4XSHA 4LEIA 3QPBA 5EJAA 1T9CA 4YP7A 3DXFA 2C82A 1JLLA 2EQBA 1J7JA 1PS8A 2J67A 3IUMA 4RS3A 5KVVA 2QOEA 3V4LA 2C0CA 1CVRA 3G49A 3HSKA 3QXSA 5KTTA 1EG7A 3RIYA 2UV8A 5A0FA 5IJZA 2FPIB 2ZI3A 4DA8A 2FWRA 3E7DA 1L5RA 5BMVB 1OX4B 1PZFA 1S3FA 2ZYAA 2J5QA 4YP0A 3ZU4A 3LT5A 2H85A 2IIVA 3ZHVA 4QNMA 2ZCUA 2XVXA 4ZICA 3TBFA 1TVMA 2CFSA 3Q7RA 1BXRA 5AP9A 3NTOA 5DT2A 3ITKA 2JFPA 1UBRS 1WZCA 1QGUA 2WYHA 4U4AA 4DF3A 5EP4A 4YRFA 5C80A 3BXHA 5LYYA 2FSVC 1TEXA 2RFLA 1BNCA 2WKRA 1PKEA 2D1QA 3BM5A 2P5YA 2J0SA 4NCBA 1QZZA 5DU2A 2IFTA 3BFKA 4G4IA 4BP8A 4GICA 5A5EA 2FOLA 2QG6A 3PWSA 4BE9A 1XZGA 2I1QA 3A6FA 4EENA 4MVJA 5ILGA 2JLQA 1GTMA 1KZ4A 5AXDA 2PUEA 2B4RO 3W90A 1IUOA 4CF6A 1JEEA 1N75A 2ZK7A 4P3YA 1PEDA 4WX2B 3ACCA 3QFSA 1EDEA 3VJKA 3PXGA 3NU1A 1SXJA 4MKHA 4OMUA 1E5LA 3AP2A 4PPGA 3VPDA 3QKTA 5HRAA 4INJA 5DJ5A 1SOWA 4ALNA 1CUXA 1P4AA 3AEQB 4UBOA 4ZOEA 5L3QB 2WOOA 4EY6A 4DADA 2Q2WA 1OTHA 3G17A 2DUUA 4A6PA 5ARDA 1Q91A 2WMDA 4C08A 1MOQA 4N7RA 3RT1A 3IJ5A 1BVUA 3BL8A 4QWMA 4XARA 1PJAA 3R3VA 3TW8A 1HYQA 2C58A 4O5AA 4KSCA 3C3DA 3TR0A 4A0RA 2QW8A 1KIFA 4RVCA 9LDTA 4QYTA 4O4LF 4ZQFA 3DEIA 2D2VA 4R1SA 1WZ2A 1HXHA 5LZ5A 4HS4A 5L6MB 3HJTA 3RG8A 4DV1B 4LF8B 3R0QA 1O87A 2D5IA 1P2SA 3DAYA 3LVBA 4CR6A 2ZS8A 5BV8A 3S7ZA 4ETNA 4RXUA 1PNRA 4J0KA 4RA6B 2B8JA 4AICA 2H1IA 3DWIA 4J1TA 2UUPA 1SH7A 4QDXA 4XUGB 3GW8A 1UWCA 2IQIA 2ZXFA 3PX3A 4FMDF 1GVHA 1F8UA 4PN7A 3ZHBA 3AEXA 5LWHA 1RKUA 4P86A 5JAPA 2JGLA 2ZPAA 2ABWA 1L7XA 4JI6B 2DH5A 2YFHA 3IOBA 3WRXC 1EA5A 2D8AA 2WYWA 3LA8A 4WXYB 2HMUA 3DDNA 4HNQA 3UMFA 3VU1A 1V4NA 4ALLA 4QGSA 5KSOA 4Q1EA 5EHGA 1K92A 3D8HA 1XRQA 2YY5A 1G5QA 4JC4A 1BWPA 5FFNA 3MPOA 3CEHA 5FR1A 3SIWA 4XR9A 1F8XA 3AVOA 4TV9F 1LB1B 3AY6A 5GJWC 2EZ4A 3WJ1A 4EGJA 2K4MA 5J2UF 5HZKA 5AHXA 5D3MA 2Q9BA 5ECYA 3GJ7A 1ONOA 5H3HA 1ZUHA 3F9RA 1H6DA 4DPKA 4E5PA 4WXRA 2DHEA 3T7JA 2ZB8A 1Z2NX 1RI3A 5ITZB 1ISSA 1RM5A 2RH8A 4IY1A 3DMFA 4B43A 4PYNA 1EGVB 1B43A 4ZYLA 5AH0A 4DV3B 5AI0A 1XZNA 4GP6A 3UB4A 1I2DA 1E69A 3KKKA 3LIIA 1KK0A 2RK4A 1KI3A 2J0VA 2Q3EA 3BX1A 4LNHA 3GLGA 4TKZA 3FN4A 2XB2A 3QU4A 1M1YE 2ECKA 4EVQA 2OXFA 1UFKA 4OHRA 2FUNB 3ROTA 2AQ8A 5CNKA 1V6CA 5A9SA 4IJVA 2NO9A 1B1CA 2O23A 1XA3A 5DHFA 3NV9A 4NICA 4IF4A 1KP3A 2WHRA 3OZVA 3ZQUA 4D99A 1BRTA 2ZGVA 3BMNB 3PYMA 4K7JA 3STUA 4ND6A 1XO1A 1BEUB 1N92A 4D96A 3DBLA 5KQRA 1J5PA 4YRRA 2YXEA 2EGGA 4NARA 3AXSA 3OX3A 4CM4A 4TQUS 4DG5A 1CIVA 3B5JA 1IPEA 1TJ3A 2Z95A 4NULA 1L5LA 2IYQA 4IIFA 4BFUA 5BWMA 1AHPA 1OHHA 5CJJA 2HCRA 4ND7A 4BJ3A 4YAIA 5DMXA 3W04A 2LPMA 2ZU6A 2HX1A 3CLTD 5HIJA 5LP6B 4NNOA 2DFPA 5B2FA 5LDHA 4PNZA 3DR5A 2GPBA 3LVRE 3F8SA 1I0LA 3QVOA 1YR2A 1T6YA 1G5IA 2NM0A 2ZRCA 4WZBB 5F2EA 4D1YA 3I5XA 5IASA 1E3LA 4ML3A 1XWWA 2N47A 3M49A 1NC1A 1RC8A 1IIBA 1RDFA 2VDQB 3VJMA 3EEOA 4YRMA 3TEJA 1PZGA 1S9DA 2NVUA 4BFTA 4X94A 2BONA 5DISB 1JLMA 4F56A 3ZXIA 3SWWA 5CBKA 1MC4A 5CLJA 4YP5A 3TPCA 2IYZA 5TT1A 2YIMA 4RY9A 5JOQA 1OWOA 1Z6PA 4XSGA 1N2HA 3KSRA 4JEIA 4WKBA 3ZD9A 4I1PA 4AKTA 5BQXA 4UFOA 4PX5A 1L7AA 2Q0HA 5EIOA 2IELA 2WLSA 4PPYA 4O4HF 4EO9A 1HETA 4U3JA 5IUNC 4ISCA 4EUHA 5I51A 1K9SA 4I4IA 4MS4B 2W2LD 1ZY2A 3CZ5A 3EZ2A 1RCTE 2EAUA 3ABZA 1GRQA 2HJRA 2JLSA 3N6VA 3ZDDA 3MUFA 2MSWA 2FFQA 3FYUC 3J81k 2GDJA 2J46A 4N01A 2CJWA 1U8AA 2ZYRA 2PKQP 3QVTA 2EEPA 2B25A 3NAMA 3KKOA 3KQWA 3OEHD 4ZAXA 4KQIA 4AJPA 1DXHA 3OHSX 4OUDB 4JP3A 4LYJA 4UU7A 1SCUA 3ZJYA 4KAJA 2QN9A 3UJCA 3GJ0A 3R7LA 1FDTA 1E9BA 4HAYA 1CUDA 2CLLB 4NBVA 4WASA 1N2BA 4PNPA 5E4TA 1QE5A 1Y3HA 2F00A 3KUKA 4JX8A 4RCZA 4G85A 3IBGA 4R1MA 2V7UA 1ZI6A 3JTMA 1UT8A 1EZ1A 2XD4A 2GZ1A 3LX4A 1FFSA 2OILA 2VHEA 4XFDA 4B3GA 4A27A 1RAEA 1SVIA 5DE3A 3H5LA 1GGVA 2SECE 4F2GA 2AC2A 4INPA 1Y1RA 4F3CA 3EISA 1JDZA 2ZKIA 3DAHA 4RL4A 4XWGA 1X74A 1S2LA 2DLDA 3S55A 4BNDA 3MVEA 4GX0A 3I6BA 5FLXA 1MC1A 5EPEA 1NQOA 1DS6A 4A5OA 4B9AA 1K5DA 3GFQA 2ZEJA 2R7KA 3NM5A 3FLAA 1R6TA 4M98A 5ALWA 2DULA 4A3SA 3GYBA 1T2DA 5JS1A 2QI9F 1J2YA 3OTWA 3JQAA 5EXSA 3RLIA 2TMYA 2CV0A 2G36A 2P0EA 4C2TA 2X1VA 1QX4A 3QFFA 1RBYA 4QXRA 2RGAA 5TMDA 3TSCA 1S1MA 3B1KA 3QLVA 3WLNA 2NU7B 1KERA 4MR8A 4X61A 4ZAYA 5KOJB 3II6X 1Z2DA 1CR4A 4I08A 1T36A 2A9JA 3U4CA 4YCLA 3THWB 5LUAA 2A92A 2ZIGA 3X43A 2C97A 4E2FA 1A88A 3D1LA 3CX6A 1N2JA 2FFJA 2EEZA 4CIVA 3FPAA 3WKAA 3X1XA 1DHRA 4CTOA 4RHFA 4QYWA 2P9HA 1GZ3A 4GYYA 1NYLA 4GC9A 3EY9A 4QPDA 4ZRNA 2BEKA 3ILYA 2C4WA 1SQGA 2I6QA 1IK6A 1XTKA 4AAYA 2IOFK 2RGNC 1PD0A 1YVDA 2PEZA 3C8UA 2HQRA 3FFWA 3HFJA 4HGOA 4PG5A 4ZO6A 5EWMB 4EKGA 4ZIRB 5GIOE 1RR6A 3EHDA 3EA5A 3GEIA 1WXIA 4XRRA 2DBZA 1AA9A 4MLPA 5P21A 3GA7A 3JY6A 2ZULA 1E7QA 3IVXA 4F2WA 3E7XA 5AVZA 2PT6A 1PGNA 1TQHA 1QV6A 1TI7A 1VL6A 2HREA 2B99A 3DQPA 2ANBA 1QQ7A 3D2BA 4URWR 4WXEA 3SR4A 2O3SA 4FWIB 3HUEA 2FUG6 3I04M 4YBZA 3RTAA 4YI3A 1GCGA 1RRFA 5EKTA 5L8VA 3S8YA 1RP7A 2AC7A 3H42B 1JSXA 2IA5A 4KFUA 2G5CA 5LMNB 1D07A 1PYGA 1VSUA 1OBOA 1Y6ZA 3IAUA 1C4OA 4K03A 4W4TA 4BJ5A 1IEQA 3LXXA 2Q8NA 1XRRA 4EQZA 1E32A 4F2PA 1RABA 2JJYA 4NU8X 4LYFA 1DFIA 4KX5A 5KC9A 3PUVA 4FK8A 4PX2A 2BR5A 4OX9B 1IY0A 1O6BA 3SQNA 4HN4B 4ZEVA 4QXPA 1UQTA 2NU6B 1PSWA 2XGSA 2ZI5A 2XR1A 2H3EA 1QH1B 2Q5CA 2OK7A 3EH1A 4IAOA 3HYCA 1FTWA 3QXXA 3GA0A 4FYVA 4TUYF 3KLMX 1QK5A 3B1WA 4CMCA 1XK6A 1CQPA 3CF2A 1NPDA 2EFYA 4YAEA 3T7TA 1OGYA 4GE0A 3VPCA 3NBZC 2AMVA 3WK9A 1BX0A 1YBVA 3E23A 2UYGA 3CNNA 2BSXA 3GCXA 4KAAA 2I76A 2IW3A 1V16B 1Q5PA 3RU7A 2BFAA 2ZE5A 3ZIAA 5J2UB 2JFGA 5IZCC 4S2EA 4FGWA 1LCIA 2H51A 2QUJA 3L9XA 4C7KA 3LNCA 1L7MA 3LT4A 2C94A 3Q87B 5K45A 1M34A 2ALJA 3LL4A 2BPOA 4Z0HO 1SULA 1MFPA 2X8BA 1KNQA 3CR3C 3H3XA 5DO9A 4WLVA 1B3BA 4WOBA 4J90A 3A0UA 5DTIA 3SX4A 4IDNA 3IQGX 4Z4QA 4BFSA 2OT3B 4GKAA 4LCBA 3SEFA 2DCUA 4J3FA 1IBCA 2G71A 4BKQA 4CM9D 4IXDA 3ZK8A 4YP9A 1MDFA 1YD7A 1IY2A 3RJ9A 2QBYA 2KHZA 2QL9A 4CLXA 1ZP6A 5ICFA 1YTUA 1PV2A 2RSLA 1Q1QA 1C3OA 3AERB 4HSEA 2PS0A 5F1PA 3UAVA 5LD2C 3VO9A 3R0XA 4RTRA 4MW4A 1H9CA 3PC6A 5KWVA 1XD2A 2P0AA 2Z2ZA 1OIWA 4KIFA 4NIMA 4KRGA 1R4NB 3KE8A 3PJGA 1S3GA 4L3VA 1MA0A 5DN6A 5IULC 1ANKA 9LDBA 2C96A 3U4IA 3PUXA 1KOFA 1DIRA 1JS1X 1SHTX 2FPOA 2SNIE 4I3FA 1H8ED 3D8TA 3AKYA 4OJNA 1YVUA 4X1KA 4XQGA 1A8QA 5BN4B 3W9UA 3SM3A 3OHMA 3NASA 5CNMA 2VTBB 1FFDA 4XD7D 1LRLA 3WL7A 1TW3A 4RYDA 2BGKA 3HJCA 5ALKA 3TLGA 1ZNXA 2JPDA 5DTQA 5GZ1A 1RBMA 2I2XB 3ZV7A 3WADA 3L7BA 3E3LA 3LX8A 4NENA 5T3YA 3U80A 5LNK1 2A5DA 2B9VA 1TF2A 4I2VA 4EJFA 3EZNA 2HFJA 4N65A 4M46A 4NMXB 2VZ8A 2QYHA 3I42A 1Z4NA 1PSDA 1O2DA 1RWBA 2LE0A 3N8KA 3P5SA 4LZLA 5C5CA 2FEKA 2HYIC 2KPOA 2WNHA 2FSGA 1R1DA 1KBOA 4PS1A 4FLEA 3U48A 1BXRB 1J2JA 4HN9A 3DZFA 4IJQA 2CLSA 4C3ZA 2WWFA 1AT1A 2ZRGA 2C61A 2EF0A 2UYOA 3AU9A 3MUEA 3IV9A 1YE5A 3NW9A 3VR6A 4HB2A 3VDQA 5LOVB 3WBFA 3I04A 3MJRA 3X1YA 3E7WA 1WLYA 4D3DA 3ZNOA 1KYQA 1Q77A 4Q7KA 5ABPA 5LQUA 2C2WA 2JFXA 4J4BA 2WT9A 3PFNA 5HSGA 2AFRA 3S6JA 5J23A 1QS0B 2D1TA 2C98A 1E2JA 4NI5A 2GUGA 1M2JA 4K28A 5TQ2A 3AR7A 2FE4A 3SC3A 1H3NA 3H4MA 3PDCA 3W3AD 2A0YA 5L53A 3RUEA 4R7TA 1C80A 1L0BA 3CNBA 4HUQB 5K51A 1L5KA 1P74A 3WMEA 4IS3A 4Z86A 4X6LA 4I0WB 2JASA 1I3KA 2XIQA 1WXFA 3LBHA 4JVOA 5DM4A 4G1VA 2A8YA 3RSQA 3TSOA 4B3FX 4FP9A 3EQ6A 4QQKA 3I73A 2O0LA 3TYXA 2H16A 5B4VA 1QDLB 1FLDA 3ZD8A 4LFAB 1JEQA 3UJ8A 1Z8FA 3PDUA 4FDAA 4WY5A 1KSFX 5ELLA 2IYLD 1JVSA 3EASA 4M89A 3WGVA 4E1VA 2QZ4A 4I55F 2P2NA 3CGGA 4ARIA 1QTIA 4MPRA 4MJXA 2CVHA 1QAOA 2YDXA 2E9SA 2HY7A 3Q12A 3ZOKA 4CV2A 4DN6A 7REQA 4MQ6A 2PD6A 3E0XA 4FJ0A 1P60A 3EEFA 1WY7A 3CMCO 5LA6F 3BE6A 2HDOA 3LKDA 3A4IA 4PZPA 4FQ8A 2B37A 1N6RA 1OXBB 1QO9A 4HDKB 4YMUA 3DMYA 4FLFA 2Q2QA 1HZZC 1XRSB 2QN8A 1QU2A 4WN9B 2ZWAA 1E7RA 1PL6A 2WW8A 3P4XA 3CVYA 1KMIY 4U7DA 2OHVA 5E1MA 1HDYA 1HM5A 2Y4NA 1JG1A 5CH5A 4E5KA 1Q22A 2ODTX 2QD4A 2WHXA 1NJGA 2AHOA 4Q9HA 1XLWA 1A1SA 1OT3A 3C5WP 4RZUA 2R4TA 2J3QA 3H65A 3EPHA 1H4VB 1UK9A 2FJUA 2A0XA 2K7ZA 2O07A 1QO0D 1GN9A 2L82A 2PPLA 3ENNA 2YWJA 2NO0A 4EPVA 1G291 4KNVA 3ZY5A 4CV3A 2Z2IA 3EXHB 3KQPA 3TD9A 3M6IA 3SS7X 1NJ5A 4JU8A 3SDBA 3U7EB 1VPWA 3UGTA 1PNVA 4C4SA 5JAIA 2IT1A 2QJFA 4R2JA 2X7XA 2JJMA 4U0KA 4DLLA 1UOQA 3OTGA 4TS4A 2A0KA 1JMYA 2WD9A 4DTIA 2XTAA 1TOAA 5BY2A 2WQ6A 1PIWA 1PUJA 1QCCA 2FGKA 4W82A 3ZKAA 3ZHTA 5KSYA 4B2IA