3U9OA

Crystal structure of staphylococcal nuclease variant nviaga/n100g at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVGEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3u9oA00
1STBA 4TRDA 3TP8A 1SYEA 5DEHA 1STHA 4IALA 4ME5A 4PNYA 2LKVA 2F0KA 1A2UA 3MZ5A 2OXPA 3NXWA 3SK5A 5I9OA 4KHVA 2O4XA 5E3FA 1NUCA 5EKKA 3T16A 2F0LA 3C1EA 4NDXA 3SK4A 5CGKA 1F2MA 2RBMA 3TP5A 1KDCA 3QOJA 4DGZA 2RDFA 3MVVA 2M00A 3P1HA 4WORA 1U9RA 1ENAA 1SNMA 4K2KA 2SNMA 4KJOA 5CV5A 5IODA 2F0TA 3TP7A 5K5PA 4KJNA 2F0IA 4RKBA 5CV4A 1KDBA 2F0MA 4K14A 5EKLA 2F3WA 3SK8A 2OEOA 2EYJA 3LX0A 5C6AA 5IGGA 5KRUA 4MIUA 2F0VA 4F8MA 4PMCA 5I6YA 2F0NA 3BDLA 1ENCA 4KV6A 2F0UA 1STYA 4G57A 3T13A 5KGUA 4IZ8A 3NUCA 5KIXA 1EYCA 2F0HA 4ID6A 1EY7A 1KDAA 4E6IA 1NSNS 2WACA 1IHZA 1SNPA 4HTHA 4ODGA 5DAUA 5F2DA 1TT2A 1EY9A 1RKNA 2HQEA 2KQ3A 3DHQA 2SOBA 3HZXA 1F2ZA 5I6WA 3D4WA 3ITPA 3MEHA 3TP6A 2EY2A 2QDBA 4KD4A 3BDCA 2F0GA 4K5WA 1EYAA 1SYFA 1F2YA 1JOKA 4QB4A 1A3TA 1SNQA 5IGFA 1A3UA 1TQOA 4K6DA 3QB3A 3QOLA 4R8NA 5IOCA 4ZUIA 5KYLA 1SYBA 3NK9A 2PZWA 3NP8A 2ENBA 4OL7A 2PQEA 4NKLA 3D4DA 5CV7A 2NUCA 3VA5A 3H6MA 3SHLA 2PW5A 1KABA 5JOBA 3C1FA 4LAAA 1SYDA 5CC4A 4KY5A 3EJIA 2EYPA 3NHHA 5C5LA 1STGA 3SK6A 3D8GA 2EXZA 4HMIA 5CV6A 5C3XA 4H7BA 3D6CA 5CR3A 5HGTA 4F7XA 3U9OA 4EQOA 3SXHA 1EY6A 4J1MA 3EVQA 2F0PA 3MHBA 5C3WA 2KHSA 4N9PA 4HMJA 4K5VA 1KAAA 3RUZA 3OMCA 1SYGA 1SNOA 3PMFA 5NUCA 1EY4A 5J1ZA 5C5MA 3V2TA 5IGEA 2PZUA 4ZQ3A 3HEJA 1EY5A 3OSOA 2EY6A 5CV8A 4DU9A 1EY0A 1AEXA 2EYLA 2EYFA 5C4ZA 5HURA 5EGTA 4QMGA 4ZUJA 4S3SA 3SR1A 4KD3A 4K2LA 5KEEA 1JOOA 2PW7A 4J6HA 2F0QA 1JOQA 4KTAA 4NP5A 5CV9A 4EQNA 2OF1A 4YIJA 2PYKA 1TR5A 1SNDA 4DF7A 4B9WA 5M9OA 4B9XA 1STNA 1A3VA 2PZTA 3OWFA 4I65A 5E1FA 4N9TA 5I9PA 5J39A 3MXPA 3ERQA 5C4HA 1A2TA 2F0FA 2EYHA 2F0JA 4K8IA 4KY7A 4NMZA 2F0SA 3EROA 4KY6A 4QF4A 4RKLA 4EVOA 1JORA 4DFAA 2EYMA 3OMGA 1STAA 4PMBA 2EY5A 5J22A 3NQTA 3E5SA 5IGBA 5ISRA 2F0WA 4K5XA 1II3A 5IGDA 1EQVA 4EQPA 2F0DA 2RKSA 4K8JA 4IUNA 5IIFA 5JAVA 2EY1A 3DMUA 1EZ6A 3S9WA 1EZ8A 1EY8A 1SYCA 5KYIA 3P75A 1SNCA 1EYDA 2F3VA 2F0OA 2SNSA 2F0EA 3R3OA 5IGCA 2EYOA 4WRDA 3TMEA
chains in the Genus database with same CATH superfamily
4JVZA 3KF6B 1GO3E 4FXKC 1G6ZA 2DGYA 5HGQA 2K14A 3VDYA 1I5FA 3NELA 2L5TA 4X65Q 4DGZA 1EFWA 1SFOB 1LO5D 2EQSA 1HZ9A 4OX9Q 3ULJA 5IYDH 2AKWB 2MFIA 2DNCA 1PTOD 4QGUA 3M85A 4FVMA 4P75A 5KRUA 2A6HD 4WJ4A 1X6OA 5LHY1 1NNXA 4L5TA 1EY7A 3HFZB 5ELFA 5F2DA 1TT2A 3FDTA 1PFNA 1J5EL 4YWLA 1MBYA 4P73A 1GUTA 5K36G 1S72A 1NY4A 4A93G 2EJFC 3CMAA 5FJ8H 1GHJA 4NKLA 4A3IH 1S5BD 3CCQA 5C4JB 4PQXA 2F3IA 2R92G 3CP0A 3CF5A 3HKZG 3UDGA 3X3NA 1R4PB 4ILWA 4EQOA 4CGYB 2UXDL 4J1MA 3BVMA 4BY1G 3AQQA 4N9PA 1I6HH 4JI0Q 3SGIA 3OSOA 1E2ZA 1J9OA 1PH3A 4ZUJA 4QIWB 1PTOC 4S3SA 3LNNA 4J15A 1XTDA 3DM3A 2PQAA 4B9WA 1TU2B 3MA2B 3PO2G 2R7FA 3ERQA 3I56A 5M3MG 1LTLA 3GDEA 2KCCA 1TS3A 3BG3A 3OMGA 5M3FB 4PMBA 2NB0A 3NQTA 2NZOA 1WCMB 4K5XA 4DK0A 1F2LA 1IBMQ 4AIMA 2JSOA 5FLMG 3DMUA 2K4KA 5LMUQ 2HIVA 4OXPA 3OTOL 4JI4L 1X55A 4DUYQ 1WVLA 3R93A 2XGTA 3H15A 3GP7A 1M4VA 3HOWB 2UXBL 4WORA 1MI2A 4LFBQ 2WKDA 2SNMA 2AUJD 5CV5A 1U0LA 5KNCA 3GTQH 2PMZB 1CT1D 2H4OA 1L1OC 2NYZD 3GTMB 1SMYC 4RHRA 3GTGB 2PCFB 4HCSA 2VY3A 5I6YA 4X62L 1G51A 1IBLL 3EN2A 3K5NA 1C4QA 2XN9C 1EY9A 4ME3A 4B3MQ 1N36L 2L1BA 2SOBA 3NTHA 3NBHB 4FF1A 4AQYL 3E3XA 4IFDJ 4GN5A 3KJPA 2HD3A 2J0TD 2UXBQ 2KCTA 4QB4A 4C3HB 2JA9A 1PRTC 3MXNB 3QOLA 4C3JB 1CHPD 1TWAH 2YU9B 1DZ1A 1O80A 4OL7A 2LFNA 1GKHA 2NUCA 4XYQA 5C3EG 1X9NA 1L2FA 5LMUL 1ILPA 3J81j 1XWEA 5CV6A 2D5DA 3K80C 4B3SQ 2B2WC 1QNUA 2KENA 4L5QA 4RGMA 1NMFA 1FR3A 1WTOA 1LM0A 3NPPA 1SYGA 4NXNL 1IL8A 3I73A 2EXDA 3FKIB 2JA6H 1B1ZA 4LFBL 2EY6A 3J80c 1EY0A 1W6KA 4IPGA 3S17B 4FYDA 4ZAIA 5CBEE 2TSSA 5ELOA 3KLRA 1UE6A 3SR1A 4GKKL 2GN5A 1U4MA 1KL9A 2OF1A 4JI3L 1BKBA 2I5HA 2K5WA 4X62Q 5M9OA 1KRSA 1LTID 2PZTA 3OWFA 3G7LA 2RF4A 3J7ZC 1V1OA 4JI2L 3K6OA 4DFAA 3K0XA 2F03A 3CCUA 3VYRA 1G2SA 2CWAA 3CQZB 3J7AV 1CUKA 1ENFA 3S16B 4TSSA 4EQPA 1TS4A 4GNXA 3S9WA 2HDLA 4DN4M 5IT9c 2BE5D 2WKCA 5IP9G 3CC2A 2F0EA 4DV1L 1CKMA 5IP7H 4DR3Q 1STHA 3J80E 1Z7TA 2NVTB 2PNRC 1HTLD 4WJ3M 1HJPA 3CW2C 1S5ED 1C9OA 1SEBD 3F1ZA 5C0XI 4AYBB 1PZKD 2A73B 2F3WA 4OEMB 1LTGD 2L0CA 1EIGA 4ULLA 3UE0A 1GUSA 4PZ8A 3IFDA 2MPMA 1YEZA 3A8KE 5KIXA 2NWGA 4X3UA 4YWKA 2GVAA 2R92B 3GTOH 1IHZA 1E7ZA 3E9HA 4JOIC 3HZXA 3QIAA 3S1MH 1HXYD 4Z9CB 2QKIC 1GHKA 1AH9A 4IOCA 3U9SA 4YHHQ 3BYYB 1SBBB 1AFPA 4IJLA 4BY7H 1PH1A 3KF6A 4EX5A 2ZTDA 2R7ZH 3A5ZB 2UXDQ 2K7VA 2RA4A 3CRLC 2NN6H 3SXHA 3X3MA 3BYTB 1LTAD 4LWCA 5BN3A 4IUQA 1CZWA 2B2TA 5C4JH 3K59A 1O7IA 2GVBA 1DOMA 2BOSA 1B2TA 3K5OA 4LF5L 2YTXA 2K03A 3HG9A 1K83H 5IGEA 2H5XA 4HN7A 2K5QA 1YHAA 5ELEA 1WOCA 2EYFA 1YITA 4KD3A 3I4MH 1X65A 2IX3A 2F0QA 1K3RA 3G4SA 3VA7A 4WFN3 1A3VA 5E1FA 2ZM6L 4DR5L 4JI7L 1HZCA 1FNWA 2EYHA 2FHTA 3H0GB 3MTSA 1DONA 4KY6A 1Q46A 3C2PA 4X64L 1EWCA 1L0XB 3BS1A 3T1YQ 4A3KB 5M5WH 2Z6KC 3CMEA 4A3BB 3R3OA 2OCEA 1KLGD 2Z8LA 1ASZA 4TRDA 4RCNA 5ELDA 2B2VC 4POFA 1XMQQ 3RD4A 1RJTA 2VQFL 1IZ6A 1KNEA 1X3QA 2RBMA 4CDCC 1BCPB 5M3FH 2JK8A 1IKMA 2JJQA 4LF7Q 4K2KA 1O78A 3ONAB 1HFNA 2XVSA 4F87A 3HOWG 2B2UA 5K5PA 2QCPX 1HPCA 3CAMA 4WJWA 1PTOH 3FEWX 1S3OA 2ZJPA 3CHBD 2QF7A 3BDLA 2AQ1B 4KV6A 2VZAA 1KD1C 3PIPA 1Q1BA 4JK1C 2KQ3A 3S15B 1I4XA 4RAUC 4IUPA 1LTBD 4KD4A 3DWAA 4K5WA 4GNXB 4DPGA 3HOXG 2PNHA 5T1IA 3AFPA 1SYBA 1W3SA 3KBXA 1B4OA 1XTCD 2NZ1D 3SHLA 2B8FA 1TS5A 4ZKBB 5C4XG 5IYBG 3ERSX 4C2MB 3PO3G 4C3HH 3NENA 1M1KC 1K73C 2QILA 5DM73 3ULLA 5HGTA 4OHJA 1LV9A 3S1QB 5EQ0A 4A93H 4HJ8A 4IUTA 2RVLA 4G7HC 3GTGH 4DR7Q 1VQAA 3PMFA 4H44C 2E8GA 5JPMC 1R4QB 1C0AA 1LABA 1YI2A 2P5ZX 5C4ZA 2I0QA 3KFUA 1YHBA 3S2DH 4A3DG 2HHHL 3GTQB 4KTAA 5AJ3L 2PYKA 1MD2D 1SMXA 2E2JH 1I94Q 5EKIA 4N9TA 4A3JB 1V8QA 4PMWA 2KCMA 4DV3Q 1E2VA 1GVPA 3NBHA 1Z9FA 3GV6A 4FO2A 1WTVA 3T53B 1LT5D 1TWHH 5A35A 1QZHA 2VB2X 4A3EG 1EZ6A 1XXGA 1PYBA 4IOAA 2B2YC 2PO4A 2A1AA 3FP9A 3SVMA 3NE5B 3TP8A 3F2DA 3QR8A 2F0KA 2KCNA 3M7GA 1Q81C 3GTOB 1BCPD 3G6JB 2V1CC 5I4DA 1S40A 1E3PA 1HQRD 3C1EA 1X54A 3DXJC 3S15H 4IUVA 4TKOB 5FKAC 1YNNC 3TREA 1KNAA 1NTGA 4BBSH 4GLXA 1A6XA 3KLSA 1D1IA 3KUPA 2Z1CA 2D0PA 2CVRA 3DEPA 2ZXRA 1CSPA 2K04A 3DLLA 1OXTA 4N8FA 4DXGA 2F4VL 2EVBA 1VS0A 3PF4A 3PCOB 4I7AA 4A3EB 1K28A 2B63H 2A68D 3M4YA 4KK7A 1N9WA 2K01A 3K5MA 4NXNQ 2A19A 1RL2A 3JC66 4IFDI 5EJWA 2PI2E 4K6DA 4R8NA 1HNXQ 1OTCA 2XSCA 3VR5A 1TY0A 3LGJA 4DKAC 3IKJA 1AN8A 2YV5A 1Y8OB 3S1MB 2A6ED 3EJIA 3UDFA 1CA6A 1F9QA 1I3QB 2Z9HA 1Y1WG 2H1EA 4DAYA 5EPJA 5GROA 4DNIA 4MZ9A 2K5DA 2F0PA 1Q8KA 1AP0A 4GOPC 4PZ7A 1J6QA 3RN5A 4LNQA 4HJ7A 1A8VA 5C5MA 4YWMA 2JA7G 3PUWA 1NJIC 3MXNA 4QMGA 1QVGA 2KHJA 4OO1G 2FFKB 3B6YA 5M5YB 2RHSB 4CJ2C 2E2HH 4UP8A 2EOTA 2K1BA 5JJIA 4RA8A 4Y7NB 5JJKA 4C3IG 5H1SE 1D8LA 3MC0B 1DJRD 1B50A 1CKNA 1HFGA 4G7OC 3J81L 2VXWA 4GLAC 3GTKH 4A76A 3NTKA 4P72A 5EPLA 2NN6I 2PMZE 3V05A 5JEAH 1TY2A 1RTNA 5KYIA 1V1QA 1EYDA 4C3JG 1ICWA 3BJUA 1EIHA 3FPUB 1FGBD 5DEHA 1MHWC 2E2DC 3NXWA 2XRQD 4APVA 3W1GA 2L15A 1PFSA 2B2VA 2RDFA 5COYA 3M4PA 3P1HA 4R4CA 4U673 2N3SA 3HOYB 4KJOA 3T1HQ 3D3RA 3CCSA 4K14A 5EKLA 2AQ2B 5C44H 3JAME 3S14H 1MSGA 1KTKA 4UDUC 2R7DA 1YVCA 4PMCA 2QEXA 2D9UA 1STYA 1YIJA 4K6LA 4JI4Q 1I3QH 1YNJC 1FD7D 2HQEA 4DAVA 3HOZG 4X66Q 1L1OA 1OXUA 5FLXL 5GADC 5E7NA 4RH6A 3DM1A 1JOKA 1S5FD 1BXTA 1CK1A 1I4PA 4RCOA 3K57A 1A3UA 4GS3A 1CSQA 2DJGC 3ND9A 1Y14B 4CBVA 3U50C 5CV7A 4FF4A 2MO0A 3PUZA 1E22A 4DR2L 2QDLA 3HOYH 3M7NA 2A5HA 1WI5A 2ZM6Q 2IPKD 4DR5Q 2UXCQ 1B44D 3K81C 4JI8L 4HSVA 2I46A 4F7XA 3U9OA 2WB1G 5E4WC 2K5HA 1H9KA 5C3WA 3Q24A 3GTJB 3L2PA 2L55A 1B8AA 1VQ9A 2PZUA 4Y52H 2PI2A 5CV8A 2Q2TA 4BA2I 1Q90A 4GLVB 2X6LA 3HOUG 5LL6S 1C7YA 3BVZA 1VDZA 4XTCS 3CCJA 4ALPA 2FMMA 4DF7A 4GN4B 3AB9A 1VQDA 4JI7Q 1PA6A 5CYUA 1JJCB 2AWNA 3K0YA 2Z0SA 4NPSA 2I5LX 2VQEQ 1RIPA 4DR1Q 4A3CH 3MXUA 4LF8L 1QCBD 1SMYD 4XYOA 3EBEA 2ZXOA 1Q82C 4HAEA 4A93B 5IT9E 3DEOA 2SNSA 3PO3B 1SN8A 3MAQA 4P71A 5C0XJ 4R8IA 4K0KL 4ZLTF 2R92H 2KEEA 2OXPA 4DR2Q 2WAQE 3FVQA 2F0LA 4NDXA 1V43A 1K8AC 4NXML 4LF7L 1UUPA 3PUVA 2MUYA 4JI3Q 1D1KA 4RKBA 2F4VQ 3GQBA 4KMUC 5FO8B 4GNXC 2YU9H 2JQOA 5IGGA 4MNOA 4XT3B 3PIP3 2MQHA 1GUOA 1XJVA 1EYGA 2L11A 4G57A 2RQXA 4IZ8A 2Q8TA 4LF8Q 1EWHA 2HCIA 4A3GG 2WB1B 5IP7G 5BR8Q 1V1PB 5KNBA 1A63A 1GXDC 3U58A 3R8BA 5M5WB 3EIVA 1WTWA 1PFMA 4DA2A 3HOVG 5JEAJ 1PFBA 4HIMA 4ZUIA 4K0KQ 4DXFA 1UE5A 1XNQL 2E74C 3Q8DA 3AYHB 4P2CB 2B63B 4DNTB 1KABA 2CW0C 5JOBA 4BBRH 2YTYA 1IYVA 5IYBH 4LF6Q 3S1RB 4C3HG 4DV2Q 3ICEA 4H02A 2C9OA 1UNSA 5CR3A 1E1TA 3N52A 3HOZB 3I55A 2A69C 2B2WA 1K0RA 4L63B 3S2DB 3HOXH 3L0OA 3J7A5 4DV0Q 1HRJA 2KHSA 3FKIG 1S5CD 4UY8C 2K50A 2Z4IA 4DV6Q 3OMCA 3R2TA 1CFMA 4XQQA 4JV5L 1OO9B 2CW0D 3W1BA 1A15A 1WCMH 2EJMA 2NZHA 3CCEA 1WTPA 3M3YB 1G2TA 4DV4Q 1D6EC 3OOCA 1VQBA 1VQMA 3NTIA 1JOQA 1QJOA 3QG1A 1NR2A 2Y0SE 1N34Q 3J80i 4A3FG 1MJEA 2UUAQ 1STNA 5JVH3 5J39A 2NVTH 1ESFA 1RD9D 4KY7A 1FL0A 1PRTF 4LF6L 4A3GB 1PZJD 4G7ZC 1I50H 1KHIA 2NVYH 4JG2A 5IYCH 5JAVA 2QW7A 5C44B 1UEBA 4DAYB 3S14B 1V1PA 1XX8A 1PTOB 1IKLA 1Y69U 3WDNA 1JJ2A 5IYDG 3HOXB 4DV6L 2HUGA 4ZQ3A 2IY5B 3F8TA 1SYEA 3OPOA 4YCWA 1VQ4A 4O0AA 1JB3A 2G5DA 3PO2B 2CQOA 5EKKA 3SK4A 4FDBA 1D5XC 1F2MA 1BBWA 2EPBA 2RHQB 1BBXC 5A2QE 3A56A 4EQ5A 5BN4A 1N34L 1PHJA 1X56A 4DAPA 4DV1Q 2UUAL 2K52A 2JP1A 1K8GA 4A3LH 2JA7B 1PH4A 1PV4A 2Q2UA 2C35B 5IY0A 3S1NH 4F8MA 3BZKA 1EYCA 4ID6A 4B3TQ 4HTHA 4OIJA 3KK7A 2CKZB 4BWGB 1Q12A 2VQFQ 1J5EQ 3MEHA 2D62A 3ULPA 3VR6A 4O1NA 3U4VA 4RFBA 1ZKOA 2EDGA 1PMRA 3QB3A 3H94A 3NK9A 1XMQL 4X66L 1FJGL 1K8MA 2BH2A 4HJAA 4L5SA 1LT4D 2MHVA 2VUMH 2J4XA 2WIIB 1B3AA 1ZXTA 4H13C 4H7BA 1ASYA 4RGOS 2UUCQ 3I4NB 4O42A 1HQMC 1Y8NB 3T51B 1EEFD 2RCNA 2R61A 2IHEA 4DK1A 3WOEA 5LMNW 2B2TC 1TIID 1Z6HA 1F9SA 1IYUA 2WAQB 4BA1I 3OIQA 4C2MH 1Y1WH 1X3PA 5HY6A 5C0XH 4JBJA 1L1OB 1DOLA 4KKUA 4JI1Q 3H91A 1SNDA 5I2YA 3L3OC 1DD2A 5I9PA 3V96A 1WD1A 3HOUB 1SROA 1BDOA 4GOPB 3OHXC 2KVMA 3I90A 1XNRL 4ZRZA 2A69D 5FK9C 5GQOA 1QE6A 4OWTB 1SAPA 2AWOA 1SLJA 1L0YB 5FO7B 1JWUD 4KN4C 2EY1A 4DR6Q 4IFDH 1WD0A 4CHTB 4MIUA 1XMOQ 3TMEA 3RNUA 3PUXA 2NVXH 4OGQC 3I72A 1VQHA 2AQ3B 2HHHQ 4N8X1 3CU7A 2WFWA 4DNRB 1Q8IA 4ZK9B 4KN7C 2L4NA 3NBIA 2N78A 2NVYB 1PVOA 1ZEQX 3KOJA 4CDEC 1KDBA 2F0MA 2XNAC 1EU4A 1TWAB 2AMCB 1AZPA 2L12A 2ALYB 4UHVA 3OW2A 3I2ZA 4DV3L 3T13A 4YY3Q 1E2WA 4E6IA 3JAMi 1QVFA 1M8AA 4LFCL 1B53A 5I6WA 3D4WA 3O13A 1E0BA 4DUZL 2DN8A 3I91A 2XWBB 4HEDA 1SYFA 1W2BA 1TQOA 1ML0D 1EWIA 3S2HH 4DV7Q 4BBSG 1I4GA 1PZID 2R93H 1EOTA 4HSPA 2RCFA 4CDFC 2Y0SB 2JE6I 4QJFA 1JMCA 1XPOA 2NVXB 3H6MA 3FPPA 2HQLA 2SEBD 5D14A 5KNDA 2EYPA 4X3TA 2EE1A 3D8GA 2JYOA 4LW1A 4ZCKA 2JA8H 2D0OA 4IPHA 3CPWA 1R9TB 4KKTA 3VR2A 2E2IH 1LACA 4L5RC 2B63G 3BZDB 4DR4Q 1WCMG 1CI3M 4FXGC 4GN3B 3STBD 1JWMD 3CCRA 4ZKCB 2UUBL 4XIGS 1D5ZC 5T1GA 1V9PA 1IW7C 2J7ZA 4BY7B 2ZJRA 3CC7A 5G3LD 3W3AA 4YCUA 1JQYD 1SE4A 1PXUA 1GM5A 4DV7L 1VF5C 1PH9A 2HDMA 2M2LA 1TR5A 3D31A 5IP9H 4A3BH 3RLFA 4HR7B 1EQRA 1OXXK 5BN5A 5GAGC 1FVIA 3A55A 1STAA 1LLRD 2YYZA 1EQVA 3KLWA 1EU3A 4BY1B 2SDFA 3UDIA 1QB5D 3CCLA 4MTNA 1VMCA 1SR3A 4IJHA 1BVSA 3HRZC 3BZCA 2EYOA 3TEHB 2E2HB 4OO1H 1STBA 4ME5A 4PNYA 3RLNA 4H0LC 2F52A 4OIKA 5TSSA 4HIDA 2O4XA 4OELB 2KECA 3MVVA 3OYYA 2AUKA 3EA6A 1SNMA 3L9AX 1F9RA 4RGTA 1HHVA 4BXXH 2XIWA 5CV4A 3LX0A 2JXMB 4XQNA 2F0VA 4DV2L 3EFXD 2IX0A 2F0NA 2F0UA 2A6EC 3NUCA 2BE5C 1U4LA 1SNPA 3VYUA 4MTKA 4KKSA 1PRTD 3OWEB 4LUVA 1QZGA 4RMFA 5C3EH 1IBKL 2K6AA 4UP7A 3J7YW 2PZWA 4LUOA 2ENBA 3GTMH 1QG7A 3M9BA 5CC4A 4A3GH 1H95A 1NMGA 3W5OA 1K0SA 2HT1A 1PYWD 2BH8A 1WTRA 1NBWA 2EXZA 2RSOA 3DWQA 3TQYA 5C3EB 3NWTA 1KIXA 3D6CA 5K36H 1TWCH 3AFQA 3HOVH 5FO9B 4PG3A 2DJFC 2N8NA 2BA0A 3S2HB 1T5XD 2K5NA 2HIXA 4DR3L 5GAHC 1EIYB 4LF5Q 3S1RH 1EY4A 5I2XA 3P7JA 1GUWA 2GA4B 4JI1L 1TWGB 2KEDA 3RLOA 4A3MG 2EYLA 2VW9A 5EGTA 1YHQA 4AQYQ 3M4OB 1Y1VB 3PIO3 1VQ6A 1FGUA 1DXMA 2E2IB 4LF4L 4A3DB 1FNVA 1SE2A 1YNND 4OWXB 4C3IB 1CZGA 3S24A 3S1NB 5C4HA 3PV0A 5LMNL 4LF9Q 4RKLA 3AU7A 1T5EA 1L0WA 2UXCL 3FMCA 1EEID 1STEA 5ELCA 1OXVA 1D2BA 5IYCG 2UU9Q 3QJYA 4K8JA 2G9DA 1EZ8A 1SYCA 1DGSA 2F0OA 2JA5G 4DUYL 1VQJA 3MZ5A 5I9OA 4DAMA 1UE1A 3Q22A 2NTTA 4CKEA 1TWFH 4FP5D 3ER0A 2M00A 3M3YH 1U9RA 1Y1WB 4JI5Q 1JC7A 3GO5A 1ILQA 3JAMc 3C46A 1VQ8A 4A3CG 4M1UB 5M3MB 1PRTB 2OEOA 1RF2D 1KQSA 1WTXA 3UI2A 4A3KG 1E24A 2MP1A 2JA5B 1YZ6A 3KDFB 4XT1B 1NSNS 3CCVA 4GOPA 3RZOH 5DAUA 3KF8B 3T1HL 4FNFA 3F2UA 5EBCA 1PDQA 5C4XH 1G291 3A8JE 2R93G 3K7UC 1NCVA 2Z6BA 1G91A 3A0JA 1NR4A 3J80L 5IGFA 3OW7A 5IOCA 4LF9L 4R9WA 4TQUS 3NP8A 4LK1C 2PW5A 1G6PA 1SYDA 2VUMG 2UU9L 1HR0Q 5C5LA 5EAYA 3SK6A 5JEAG 3HGBA 1SFOH 1Y1VG 3H3VH 3MEFA 1CKNB 4XQJA 2QA4A 4A3DH 3J81E 1EY6A 4OWWB 3HKSA 4KHPQ 4JYAL 2IJ0A 1BR9A 4DR7L 4IN3A 1RDPD 4EGVA 2JA5H 5J1ZA 2N88A 1VMPA 2O2LD 2N49A 3HEJA 2NTSA 1G8ZD 1JE4A 5HURA 2OTLA 1K3BC 2OWOA 2L9HA 1TS2A 3GTKB 1VCIA 3KJOA 3HOVB 4A3JG 3FRPB 4JBWA 5A2QL 4IO9A 5BR8L 3PIOA 4RHSA 4NMZA 5D65A 3GV3A 4LUZA 4C56C 1U4RA 2KA7A 4C1NK 2LXKA 3ZYYX 1PTOF 5IGBA 4UPAA 1HNZQ 1VQPA 3KDFA 1PLFA 4DR6L 1EUJA 1PH2A 4TVAB 1EY8A 1O7ZA 1VQEA 4JOIA 1B3QA 1SNCA 2F3VA 5M3FG 4RG1A 2ZT9C 5FLXc 1SDFA 3BU2A 4IALA 4CJ1B 2NVQB 1WFQA 1ESRA 4KHVA 3UDXA 1TXYA 4A3FH 3ND8A 1KDCA 3QOJA 4L8JA 1EIFA 4FF3A 4JW0A 4DV0L 1TWHB 2V4DA 3HKZE 4X3SA 1HA6A 3R2IA 3AMUA 4IFDG 5L37A 4GKJL 5C6AA 2BDNA 4CJ0B 3J81c 1HNXL 3HOUH 2JEAI 5KGUA 1VQFA 1EQTA 4DK6C 1KDAA 3PO2H 2NVQH 3A5UA 1SE8A 2CH4A 1D7QA 1SSOA 2A74C 3GTPH 4KLKA 2ATWA 4DUZQ 3TDQA 2QDBA 1EL0A 2K32A 3MFGA 1HA5A 1LYLA 1T9HA 1A3TA 1SNQA 4AYBG 5KYLA 2DNEA 3RN2A 1X3GA 1O7YA 3PO3H 2IHFA 1N32L 1KLUD 2PQEA 1U5KA 1WYDA 1LUZA 2DUDA 1A62A 2OT2A 3C1FA 1X3EA 2K28A 4KY5A 1QNKA 4R4OA 1CQVA 1HZBA 2C5CA 2VS1A 1KXLA 5C4XB 4QL5A 1Q7YC 1KRTA 3E0JA 2LXJA 5CORA 1SJED 2CWPA 3H0GH 3K8AA 3K58A 1N33L 5JVG3 4B3TL 1DM0B 3D0FA 2DY8A 3CQZH 4YHHL 1O7LA 3DWPA 1TWCB 3CKIB 3KF8A 2MGSA 2JA8G 4K2LA 2CFMA 4J6HA 4M8AA 4NP5A 4EQNA 5LL6X 2CH4W 4JV5Q 3VR3A 1VQCA 1FJGQ 2RSNA 3G71A 3I3CA 3NQIA 4A3IB 4A3FB 1JWSD 4BBRB 2VL6A 4Q5VA 2EYMA 3E5SA 3AEVA 2Z6KA 5CMDA 3P20A 2Q2IA 3BDOA 3P75A 4KI0A 2IWHA 5IGCA 3HS0C 2R3ZA 4BBRG 5D3DA 2Z4HA 3IAYA 3E9IA 4A3BG 3NWSA 2XWJB 5E3FA 1NUCA 3T16A 5IODA 1B9MA 2D2CC 2VB3X 1C8CA 3GTPB 1IBKQ 4JI0L 1XPRA 2UUCL 3SDZA 2LSSA 2BA1A 1ENAA 3PQIA 1WJJA 3G48A 2F0TA 4A3KH 1Q86C 4V190 5AJ3Q 4KJNA 2F0IA 2WV6D 4PZ6A 1PH5A 1H9SB 5DLQE 3WOFA 1TWFB 2WB1E 4R4QA 3TS2A 2E5LQ 2F0HA 1VQ5A 1B70B 2IW3A 4ODGA 5IT9L 1RKNA 2IT1A 3S17H 1RODA 5EBDA 4I7ZC 4BY1H 4NB3A 3BDCA 2F0GA 1EYAA 3Q0AA 1F2YA 3M4QA 2KJXA 3MFYA 2ZXPA 4B3SL 1BUVT 3GTLH 1XNRQ 1K83B 3FHWA 2OQ0A 1ICFB 1HCZA 3KBGA 1VF7A 1PYSB 4JYAQ 2RDHA 1D5MC 4BS9A 3QWNA 1CQFA 5M3MH 1BF4A 3A8IE 4HCEA 4DR1L 1S4ZA 1IW7D 4K5VA 2R7ZB 4NW2A 4JBKA 4OO1I 1SE3A 2K05A 5M5YH 2A68C 2XTIA 1UE7A 3OTOQ 3STBC 3V2TA 5JJLA 1ZYRD 2AHOB 2X6GA 1LT3D 3I4NG 2WP8J 1JICA 3SE0A 4AYBE 3TN2A 1JOOA 1NAPA 4B3ML 4F88A 5CV9A 2B29A 4LF4Q 4FXDA 4QUCA 2JA7H 4YY3L 2K33A 3TZUA 2R6GA 4JBMA 4NXMQ 3MXPA 3L7ZC 1VQ7A 5DM63 4POGA 4RWSC 4QF4A 3VYSA 3EROA 3I70A 2VQEL 1FYCA 4PV1C 5ELBA 2R7ZG 1II3A 3NSWA 4IPCA 5D3IB 4JI6Q 1F77A 3VYTA 1N36Q 2B39A 1EFID 3I7FA 4IUNA 4A75A 1J8IA 4C3IH 3KYHC 3IFTA 4DK3C 3H3VC 2VNUD 1IBLQ 2UUBQ 2NN6G 3CD6A 1BOSA 1A2UA 2NBFA 2CHBD 4V0BA 5CGKA 3VR4A 3EQLC 4ZYSA 2RDGA 5FOBB 1GUGA 3I4LA 3CRKC 1QUQA 1UAPA 3TP7A 3S16H 3D4RA 1S5DD 3PGZA 4JC0A 3SK8A 1SJHD 4IQZA 5IWAQ 2Q8IB 1BO0A 5FJ8G 4ABNA 4CKCA 1PH6A 1P16A 1QOHA 2FMCA 5C44G 4IPDA 1Q3LA 3I4NH 2ASBA 4LFAL 2B8GA 1IL2A 1HNWL 1JJGA 3ZJYC 3J81i 1Z47A 2JA6G 3J7AF 1GUNA 1SRUA 1U4PA 1VQKA 1RTOA 1SXTA 2I5MX 3SEBA 1GJXA 1BQQT 1E1OA 3VA5A 5IWAL 3W2DA 3GTJH 2PQAB 1ZYRC 1KC8C 4QQBX 1HR0W 4JI2Q 1CKOA 3HP3A 1EOVA 2K75A 1WTQA 1EQQA 2ICIA 2IL8A 1Y1VH 1STGA 1LTSD 3Q23A 4HIOA 2FINB 4HMIA 3TBIB 3I8ZA 3PSIA 3E0EA 2FXQA 4B08A 4P74A 3EVQA 1I4HA 4LFAQ 3I4MB 4HMJA 1JCKB 1KAAA 3HOYG 3NEMA 1SNOA 3I4OA 3MWYW 1TVXA 3TSSA 4DU9A 1HUMA 1AE3A 1JB7A 4JCVE 1I4RA 3RZDB 2FJ2A 1H9MA 3GD7A 3C3LA 4UP9A 2PW7A 2LY7A 4YIJA 1MIUA 1AE2A 5FLXE 2MNAA 1XPUA 1YJNA 1QVCA 2JN4A 2B3GA 2QGQA 2F0FA 2EIFA 4X3KA 2F0SA 2EJGC 3F2CA 3F2BA 5J22A 3PUYA 1H9JA 1HNZL 3A74A 1JT8A 4YCVA 1N8RC 5IIFA 4A3MH 1ET9A 5FLMH 2ZJQA 1UEAB 1LTTD 4RGNA 4A3JH 1CA5A 1DCZA 3TZDA 2F1MA 1I4QA 2E76C 3SK5A 1OXSC 5AFWA 2E75C 4Y7NH 3TP5A 3CC4A 3CCMA 3RZDH 4G4KA 3HKZB 1N32Q 4JPBW 4KHZA 3H3VI 4C3JH 5EPKA 2E5LL 4A3MB 4XXEA 1HTPA 4L6TB 1ET6A 1BBUA 3BVGA 4MHEA 1ENCA 2WACA 2A6HC 2HCCA 1VQIA 1JR0D 3DHQA 2O5JC 3A7LA 2Y0SG 1MSHA 1CM9A 4HJ5A 4DV4L 2EY2A 5GAEC 1Y8PB 4BBSB 5E4XA 1I6VC 1VQLA 2EZVA 1HZAA 3RR5A 1UWVA 3D4DA 1I6HB 2Q8RE 2WINB 4JI5L 1IYJB 3FKIH 3NHHA 2JA6B 3DUZA 1I50B 2LS01 1MJCA 3D6WA 3KLSX 4A3IG 1GD7A 1H9SA 3M4OH 3T56B 4A4IA 4LJZC 1B9NA 1YNJD 2IX1A 3RUZA 4XDXA 3PF5A 5J3BA 5NUCA 4IURA 1RCVD 3T1YL 1I94L 2WAQG 1EY5A 1LTRD 1AEXA 2CQAA 5ELNA 1RHPA 4JI8Q 2KOLA 4BXXG 4QCLA 2KUMA 2ZTEA 3A54A 2BDOA 1FNUA 4IUUA 3TS0A 2B2UC 5DNFA 5JPNC 1YJ9A 4X6AH 2BCOA 4CKBA 4GZYC 5M5XH 1AZQA 1QILA 3IRBA 1IXRA 1MGSA 2I07B 2ES2A 4HJ9A 1IBML 1PH8A 4B3RQ 2F0JA 4K8IA 4EVOA 1JORA 1YJWA 3HOWH 2EY5A 2ID0A 4C1NI 3JAML 3K5LA 4MN3A 2F0WA 2LMCB 3Q6SA 2F0DA 3T4AC 3QO2A 3G6EA 1YNXA 2Q2HA 2MO1A 4R4IA 5G3LF 4CDDC 1F9PA 5LMNQ 4OONA 4WRDA 2CCZA 5M5XB 2O5IC 2JEBI 2MJ8A 2LKVA 2OTJA 3K7AH 1VQOA 1VQNA 1H9RA 4QY7A 5KEEA 1A0IA 2G9HD 4A3LG 1X3FA 4QIWE 2YTVA 4B3RL 1C48A 5IE8A 2OQKA 4LFCQ 4O2DA 2M9VA 3RMHA 1B7YB 1AW7A 4R1JA 1XYIA 2R93B 2EYJA 3E6ZX 2KHIA 4U68A 4BY7G 3IL8A 4LMQD 3GTLB 2JA8B 1F2ZA 2N55A 3ITPA 3TP6A 1K8OA 1M90C 2QEJC 2TMPA 1HUNA 4DV5L 1P8LA 1CHQD 3OIPA 1MKHA 4FF2A 1NE3A 1YBYA 1QWYA 4UAIA 4J8QA 1HNWQ 3K7AB 3UE1A 3LWUA 2ZTCA 4DR4L 4AH6A 1GOZA 4LAAA 1BNZA 3A7AB 3U4ZA 3WWVA 2B2YA 2K5VA 2F4IA 1LT6D 5C3XA 3I4MG 4GKJQ 1ONLA 1Q1EA 2E2JB 3MHBA 4OX9L 5JJZA 1DYQA 1CTMA 2X69A 1XMOL 4JI6L 3N6RA 1HR0L 5CBAE 3TRZA 1W6JA 1DOKA 4A3EH 1KAWA 1XNQQ 4HIKA 3CPFA 1QUQB 2PPBC 3MXGA 4KHPL 1R9TH 1BCPF 4QUFA 3HOZH 1TKWB 1PH7A 3LWEA 3URYA 4B9XA 2A8VA 3S1QH 1X32A 4I65A 3H09A 4GKKQ 4X65L 1A2TA 3CXCA 5C0XG 1BCPC 2XRSD 2KBNA 3RZOB 4R4TA 4X64Q 1K9MC 2VUMB 3H0GG 5ISRA 1VQGA 1TWGH 4DV5Q 1JE5A 5IGDA 2RKSA 2DY7A 2ICEC 4Q0FA 1HH2P 1WTHA 1N33Q
chains in the Genus database with same CATH topology
4FXKC 1G6ZA 2L5TA 4DGZA 1SFOB 1LO5D 2DNCA 1PTOD 3M85A 4FVMA 5KRUA 2A6HD 5LHY1 1EY7A 5ELFA 5F2DA 1TT2A 3FDTA 1PFNA 1MBYA 1GUTA 5K36G 2EJFC 1GHJA 4NKLA 1S5BD 5C4JB 4PQXA 3X3NA 1R4PB 4ILWA 4EQOA 4CGYB 4J1MA 3BVMA 4N9PA 3OSOA 1E2ZA 1J9OA 4ZUJA 4QIWB 1PTOC 4S3SA 3LNNA 4B9WA 1TU2B 3MA2B 3ERQA 2KCCA 1TS3A 3BG3A 3OMGA 5M3FB 4PMBA 2NB0A 3NQTA 1WCMB 4K5XA 4DK0A 1F2LA 2JSOA 3DMUA 1WVLA 3R93A 3GP7A 1M4VA 3HOWB 4WORA 1MI2A 2WKDA 2SNMA 2AUJD 5CV5A 5KNCA 2PMZB 1CT1D 2H4OA 2NYZD 3GTMB 1SMYC 4RHRA 3GTGB 2PCFB 4HCSA 5I6YA 3K5NA 1C4QA 2XN9C 1EY9A 2L1BA 2SOBA 3NTHA 4FF1A 4IFDJ 2J0TD 4C3HB 4QB4A 1PRTC 3QOLA 4C3JB 1CHPD 2YU9B 1DZ1A 1O80A 4OL7A 2LFNA 2NUCA 4XYQA 1ILPA 1XWEA 5CV6A 2D5DA 2B2WC 1QNUA 4RGMA 1FR3A 1WTOA 3NPPA 1SYGA 1IL8A 3I73A 3FKIB 1B1ZA 2EY6A 1EY0A 1W6KA 3S17B 4FYDA 4ZAIA 5CBEE 2TSSA 3KLRA 3SR1A 1U4MA 2OF1A 2K5WA 5M9OA 1LTID 2PZTA 3OWFA 3G7LA 1V1OA 3K6OA 4DFAA 2F03A 3VYRA 1G2SA 3CQZB 3J7AV 1ENFA 3S16B 4TSSA 4EQPA 1TS4A 3S9WA 2HDLA 4DN4M 2BE5D 2WKCA 2F0EA 1STHA 3J80E 1Z7TA 2NVTB 2PNRC 1HTLD 1S5ED 1SEBD 5C0XI 4AYBB 1PZKD 2A73B 2F3WA 1LTGD 2L0CA 1EIGA 4ULLA 1GUSA 3IFDA 2MPMA 3A8KE 5KIXA 2NWGA 4X3UA 2R92B 1IHZA 3HZXA 3QIAA 1HXYD 4Z9CB 2QKIC 1GHKA 3U9SA 3BYYB 1SBBB 1AFPA 2K7VA 2RA4A 3CRLC 2NN6H 3SXHA 3X3MA 3BYTB 1LTAD 5BN3A 4IUQA 1CZWA 2B2TA 3K59A 1DOMA 2BOSA 1B2TA 3K5OA 2K03A 3HG9A 5IGEA 4HN7A 2K5QA 5ELEA 2EYFA 4KD3A 2IX3A 2F0QA 3VA7A 4WFN3 1A3VA 5E1FA 1FNWA 2EYHA 2FHTA 3H0GB 3MTSA 1DONA 4KY6A 3C2PA 1EWCA 1L0XB 3BS1A 4A3KB 4A3BB 3R3OA 1KLGD 2Z8LA 4TRDA 4RCNA 5ELDA 2B2VC 3RD4A 1RJTA 1KNEA 1X3QA 2RBMA 1BCPB 1IKMA 1HFNA 4K2KA 1O78A 3ONAB 2XVSA 4F87A 2B2UA 5K5PA 2QCPX 1HPCA 4WJWA 1PTOH 3FEWX 3CHBD 2QF7A 3BDLA 2AQ1B 4KV6A 1Q1BA 4JK1C 2KQ3A 3S15B 1I4XA 4RAUC 4IUPA 1LTBD 4KD4A 3DWAA 4K5WA 5T1IA 1SYBA 3KBXA 1B4OA 1XTCD 2NZ1D 3SHLA 2B8FA 1TS5A 4ZKBB 4C2MB 2QILA 5DM73 5HGTA 4OHJA 1LV9A 3S1QB 5EQ0A 4IUTA 2RVLA 4G7HC 3PMFA 4H44C 5JPMC 1R4QB 1LABA 5C4ZA 3GTQB 4KTAA 2PYKA 1MD2D 5EKIA 4N9TA 4A3JB 1V8QA 4PMWA 1E2VA 3NBHA 3GV6A 4FO2A 1WTVA 3T53B 1LT5D 5A35A 2VB2X 1EZ6A 1XXGA 2B2YC 2PO4A 3SVMA 3NE5B 3TP8A 2F0KA 2KCNA 3M7GA 3GTOB 1BCPD 3G6JB 5I4DA 1HQRD 3C1EA 3DXJC 4IUVA 4TKOB 5FKAC 1YNNC 1KNAA 1A6XA 3KUPA 1D1IA 3KLSA 2Z1CA 2CVRA 3DEPA 2ZXRA 2K04A 1OXTA 4DXGA 2EVBA 4A3EB 2A68D 3M4YA 4KK7A 2K01A 3K5MA 4IFDI 5EJWA 4K6DA 4R8NA 2XSCA 3VR5A 1TY0A 3IKJA 1AN8A 1Y8OB 3S1MB 2A6ED 3EJIA 1CA6A 1F9QA 1I3QB 2H1EA 4DAYA 5EPJA 2K5DA 2F0PA 1AP0A 5C5MA 3PUWA 3MXNA 4QMGA 4OO1G 2FFKB 5M5YB 4CJ2C 2EOTA 2K1BA 4RA8A 4Y7NB 4C3IG 3MC0B 1DJRD 1B50A 1HFGA 4G7OC 3J81L 2VXWA 3NTKA 5EPLA 2NN6I 3V05A 5JEAH 1TY2A 1RTNA 5KYIA 1EYDA 4C3JG 1ICWA 1EIHA 3FPUB 1FGBD 5DEHA 2E2DC 3NXWA 2XRQD 2B2VA 2RDFA 5COYA 3P1HA 4U673 3HOYB 4KJOA 3D3RA 4K14A 5EKLA 2AQ2B 3JAME 1MSGA 1KTKA 4UDUC 4PMCA 2D9UA 1STYA 4K6LA 1YNJC 1FD7D 2HQEA 4DAVA 1OXUA 5FLXL 4RH6A 3DM1A 1JOKA 1S5FD 1BXTA 1CK1A 1I4PA 4RCOA 3K57A 1A3UA 3ND9A 4CBVA 5CV7A 4FF4A 3PUZA 3M7NA 2A5HA 2IPKD 1B44D 4HSVA 2I46A 4F7XA 3U9OA 5E4WC 5C3WA 1H9KA 3Q24A 3GTJB 2L55A 2PZUA 5CV8A 4BA2I 1Q90A 2X6LA 5LL6S 3BVZA 1VDZA 4XTCS 2FMMA 4DF7A 3AB9A 5CYUA 2AWNA 3K0YA 3MXUA 1QCBD 1SMYD 4XYOA 2ZXOA 4HAEA 4A93B 5IT9E 3DEOA 2SNSA 3PO3B 3MAQA 5C0XJ 4R8IA 4ZLTF 2KEEA 2OXPA 3FVQA 2F0LA 4NDXA 1V43A 1UUPA 3PUVA 2MUYA 1D1KA 4RKBA 3GQBA 4KMUC 5FO8B 5IGGA 4XT3B 3PIP3 1GUOA 2L11A 4G57A 2RQXA 4IZ8A 2Q8TA 1EWHA 2HCIA 2WB1B 1V1PB 5KNBA 1GXDC 3R8BA 5M5WB 1WTWA 1PFMA 4DA2A 5JEAJ 1PFBA 4ZUIA 4DXFA 2E74C 4P2CB 2B63B 4DNTB 1KABA 2CW0C 5JOBA 1IYVA 3S1RB 4C3HG 2C9OA 1UNSA 5CR3A 3N52A 3HOZB 2A69C 2B2WA 4L63B 3S2DB 1HRJA 2KHSA 1S5CD 2Z4IA 3OMCA 3R2TA 1CFMA 4XQQA 1OO9B 2CW0D 1A15A 2EJMA 1WTPA 3M3YB 1G2TA 1D6EC 3OOCA 3NTIA 1JOQA 1QJOA 3QG1A 1NR2A 1STNA 5JVH3 5J39A 1ESFA 1RD9D 4KY7A 1PRTF 4A3GB 1PZJD 4G7ZC 5JAVA 5C44B 3S14B 1Y69U 1V1PA 1XX8A 1IKLA 1PTOB 3WDNA 3HOXB 2HUGA 4ZQ3A 1SYEA 3OPOA 1JB3A 3PO2B 5EKKA 3SK4A 1D5XC 1F2MA 2EPBA 1BBXC 5A2QE 3A56A 5BN4A 4DAPA 2JP1A 2JA7B 4F8MA 1EYCA 4ID6A 4HTHA 4OIJA 3KK7A 4BWGB 1Q12A 3MEHA 2D62A 3VR6A 4O1NA 4RFBA 1ZKOA 2EDGA 1PMRA 3QB3A 3H94A 3NK9A 1K8MA 1LT4D 2MHVA 2J4XA 2WIIB 1B3AA 1ZXTA 4H13C 4H7BA 4RGOS 3I4NB 4O42A 1HQMC 1Y8NB 3T51B 1EEFD 2R61A 4DK1A 3WOEA 2B2TC 1TIID 1Z6HA 1F9SA 1IYUA 2WAQB 4BA1I 3OIQA 1X3PA 5C0XH 1DOLA 4KKUA 3H91A 1SNDA 5I2YA 3L3OC 1DD2A 5I9PA 3V96A 1WD1A 3HOUB 1BDOA 3OHXC 2KVMA 3I90A 4ZRZA 2A69D 5FK9C 1QE6A 1SAPA 2AWOA 1L0YB 5FO7B 1JWUD 4KN4C 2EY1A 4IFDH 1WD0A 4CHTB 4MIUA 3TMEA 3PUXA 4OGQC 3I72A 2AQ3B 3CU7A 4DNRB 1Q8IA 4ZK9B 4KN7C 2L4NA 3NBIA 2NVYB 1ZEQX 1KDBA 2F0MA 2XNAC 1EU4A 1TWAB 1AZPA 2L12A 3T13A 1E2WA 4E6IA 1M8AA 1B53A 5I6WA 3D4WA 3O13A 1E0BA 2DN8A 3I91A 2XWBB 4HEDA 1SYFA 1TQOA 1ML0D 1I4GA 1PZID 1EOTA 4HSPA 2Y0SB 2JE6I 2NVXB 3H6MA 3FPPA 5D14A 2SEBD 5KNDA 2EYPA 4X3TA 2EE1A 3D8GA 2JYOA 1R9TB 4KKTA 3VR2A 1LACA 3BZDB 1CI3M 4FXGC 1JWMD 4ZKCB 4XIGS 1D5ZC 5T1GA 1IW7C 2J7ZA 4BY7B 5G3LD 3W3AA 1JQYD 1SE4A 1PXUA 1VF5C 2HDMA 2M2LA 1TR5A 3D31A 3RLFA 4HR7B 1OXXK 5BN5A 3A55A 1STAA 1LLRD 2YYZA 1EQVA 1EU3A 4BY1B 2SDFA 1QB5D 1VMCA 3HRZC 2EYOA 2E2HB 4OO1H 1STBA 4ME5A 4PNYA 4H0LC 4OIKA 5TSSA 2O4XA 2KECA 3MVVA 2AUKA 3EA6A 1SNMA 3L9AX 1F9RA 4RGTA 1HHVA 2XIWA 5CV4A 3LX0A 2JXMB 4XQNA 2F0VA 3EFXD 2IX0A 2F0NA 2F0UA 2A6EC 3NUCA 2BE5C 1U4LA 1SNPA 3VYUA 4KKSA 1PRTD 3OWEB 2K6AA 3J7YW 2PZWA 2ENBA 1QG7A 5CC4A 1PYWD 1WTRA 2EXZA 2RSOA 3DWQA 5C3EB 3NWTA 3D6CA 5K36H 5FO9B 2BA0A 3S2HB 1T5XD 1EY4A 5I2XA 3P7JA 1GUWA 2GA4B 1TWGB 2KEDA 2EYLA 5EGTA 3M4OB 1Y1VB 3PIO3 1DXMA 2E2IB 4A3DB 1FNVA 1SE2A 1YNND 4C3IB 1CZGA 3S1NB 5C4HA 3PV0A 4RKLA 3AU7A 1T5EA 3FMCA 1EEID 1STEA 5ELCA 1OXVA 1D2BA 3QJYA 4K8JA 2G9DA 1EZ8A 1SYCA 2F0OA 3MZ5A 5I9OA 3Q22A 2NTTA 4CKEA 4FP5D 2M00A 1U9RA 1Y1WB 1JC7A 3GO5A 1ILQA 3C46A 4M1UB 5M3MB 1PRTB 2OEOA 1RF2D 1WTXA 3UI2A 2MP1A 2JA5B 4XT1B 1NSNS 5DAUA 4FNFA 3F2UA 5EBCA 1PDQA 1G291 3A8JE 1NCVA 1G91A 1NR4A 3J80L 5IGFA 3OW7A 5IOCA 4R9WA 4TQUS 3NP8A 4LK1C 2PW5A 1SYDA 5C5LA 3SK6A 5JEAG 3HGBA 4XQJA 3J81E 1EY6A 2IJ0A 1BR9A 4IN3A 1RDPD 4EGVA 5J1ZA 2N88A 1VMPA 2O2LD 3HEJA 2NTSA 1G8ZD 1JE4A 5HURA 2L9HA 1TS2A 3GTKB 1VCIA 3HOVB 3FRPB 4JBWA 5A2QL 4RHSA 4NMZA 5D65A 3GV3A 4C56C 1U4RA 2KA7A 4C1NK 3ZYYX 1PTOF 5IGBA 1PLFA 1EY8A 1O7ZA 1SNCA 2F3VA 2ZT9C 1SDFA 4IALA 4CJ1B 2NVQB 1ESRA 4KHVA 3ND8A 1KDCA 3QOJA 4L8JA 4FF3A 1TWHB 2V4DA 4X3SA 1HA6A 3R2IA 3AMUA 4IFDG 5C6AA 2BDNA 4CJ0B 2JEAI 5KGUA 1EQTA 1KDAA 1SSOA 2A74C 3TDQA 2QDBA 1EL0A 2K32A 3MFGA 1HA5A 1A3TA 1SNQA 5KYLA 2DNEA 1O7YA 1KLUD 2PQEA 2OT2A 3C1FA 4KY5A 2K28A 1QNKA 1CQVA 2C5CA 5C4XB 3E0JA 5CORA 1SJED 3K58A 5JVG3 1DM0B 2DY8A 1O7LA 3DWPA 1TWCB 3CKIB 3KF8A 2MGSA 4K2LA 4J6HA 4M8AA 4NP5A 4EQNA 5LL6X 3VR3A 2RSNA 3I3CA 3NQIA 4A3IB 4A3FB 1JWSD 4BBRB 4Q5VA 2EYMA 3E5SA 5CMDA 3P20A 3BDOA 3P75A 4KI0A 5IGCA 2IWHA 3HS0C 2R3ZA 5D3DA 2Z4HA 3IAYA 3NWSA 2XWJB 5E3FA 1NUCA 3T16A 5IODA 1B9MA 2D2CC 2VB3X 1C8CA 3GTPB 3SDZA 2BA1A 1ENAA 4V190 2F0TA 4KJNA 2F0IA 2WV6D 1H9SB 3WOFA 1TWFB 2F0HA 2IW3A 4ODGA 5IT9L 1RKNA 2IT1A 1RODA 5EBDA 4I7ZC 3BDCA 2F0GA 1EYAA 3Q0AA 1F2YA 2KJXA 3MFYA 2ZXPA 1BUVT 1K83B 1HCZA 3KBGA 1VF7A 2RDHA 1D5MC 4BS9A 3QWNA 1CQFA 1BF4A 3A8IE 4HCEA 1S4ZA 1IW7D 4K5VA 2R7ZB 4NW2A 4OO1I 1SE3A 2K05A 2A68C 3V2TA 1ZYRD 2X6GA 1LT3D 2WP8J 1JICA 3SE0A 3TN2A 1JOOA 1NAPA 4F88A 5CV9A 4FXDA 4QUCA 2K33A 3TZUA 2R6GA 3MXPA 3L7ZC 5DM63 4RWSC 4QF4A 3VYSA 3EROA 3I70A 1FYCA 4PV1C 5ELBA 1II3A 3NSWA 5D3IB 1F77A 3VYTA 2B39A 1EFID 4IUNA 1J8IA 3IFTA 3H3VC 2VNUD 2NN6G 1BOSA 1A2UA 2NBFA 2CHBD 4V0BA 5CGKA 3VR4A 3EQLC 4ZYSA 2RDGA 5FOBB 1GUGA 3I4LA 3CRKC 1UAPA 3TP7A 3D4RA 1S5DD 3SK8A 1SJHD 4IQZA 2Q8IB 1BO0A 4ABNA 4CKCA 1QOHA 2FMCA 1Q3LA 2B8GA 1Z47A 3J7AF 1GUNA 1U4PA 1RTOA 1SXTA 3SEBA 1GJXA 1BQQT 3VA5A 3W2DA 1ZYRC 3HP3A 1WTQA 2ICIA 2IL8A 1STGA 1LTSD 3Q23A 2FINB 4HMIA 3TBIB 3I8ZA 4B08A 3EVQA 1I4HA 3I4MB 4HMJA 1JCKB 1KAAA 1SNOA 3MWYW 1TVXA 3TSSA 4DU9A 1HUMA 1I4RA 3RZDB 2FJ2A 1H9MA 3GD7A 3C3LA 2PW7A 2LY7A 4YIJA 5FLXE 2F0FA 4X3KA 2F0SA 2EJGC 5J22A 3PUYA 1H9JA 5IIFA 1ET9A 1UEAB 1LTTD 4RGNA 1CA5A 1DCZA 3TZDA 2F1MA 1I4QA 2E76C 3SK5A 1OXSC 5AFWA 2E75C 3TP5A 4G4KA 3HKZB 4KHZA 5EPKA 4A3MB 4XXEA 1HTPA 4L6TB 1ET6A 3BVGA 4MHEA 1ENCA 2WACA 2A6HC 2HCCA 1JR0D 3DHQA 2O5JC 3A7LA 1MSHA 1CM9A 2EY2A 1Y8PB 4BBSB 5E4XA 1I6VC 2EZVA 3D4DA 1I6HB 2Q8RE 2WINB 2JA6B 3NHHA 3DUZA 1I50B 2LS01 3D6WA 3KLSX 1H9SA 3T56B 4LJZC 1B9NA 1YNJD 2IX1A 3RUZA 4XDXA 5NUCA 4IURA 1RCVD 1EY5A 1LTRD 1AEXA 2CQAA 1RHPA 2KOLA 4QCLA 2KUMA 3A54A 2BDOA 1FNUA 4IUUA 2B2UC 5DNFA 5JPNC 2BCOA 4CKBA 4GZYC 1AZQA 1QILA 1MGSA 2I07B 2F0JA 4K8IA 4EVOA 1JORA 2EY5A 2ID0A 4C1NI 3JAML 3K5LA 4MN3A 2F0WA 2LMCB 3Q6SA 2F0DA 3T4AC 3QO2A 5G3LF 1F9PA 4WRDA 2O5IC 5M5XB 2JEBI 2MJ8A 2LKVA 1H9RA 5KEEA 2G9HD 1C48A 2M9VA 3RMHA 1XYIA 1AW7A 2R93B 2EYJA 3E6ZX 4U68A 3IL8A 4LMQD 3GTLB 2JA8B 1F2ZA 2N55A 3ITPA 3TP6A 1K8OA 2QEJC 2TMPA 1HUNA 1CHQD 3OIPA 4FF2A 1QWYA 4UAIA 4J8QA 3K7AB 3LWUA 1GOZA 4LAAA 1BNZA 3A7AB 2B2YA 2F4IA 1LT6D 5C3XA 1ONLA 1Q1EA 2E2JB 3MHBA 5JJZA 1DYQA 1CTMA 2X69A 3N6RA 5CBAE 1W6JA 1DOKA 2PPBC 3MXGA 1BCPF 4QUFA 1TKWB 3LWEA 3URYA 4B9XA 1X32A 4I65A 3H09A 1A2TA 5C0XG 1BCPC 2XRSD 3RZOB 2VUMB 5ISRA 5IGDA 2RKSA 2DY7A 2ICEC 4Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STB A;  4TRD A;  3TP8 A;  1SYE A;  5DEH A;  1STH A;  4IAL A;  4ME5 A;  4PNY A;  2LKV A;  2F0K A;  1A2U A;  3MZ5 A;  2OXP A;  3NXW A;  3SK5 A;  5I9O A;  4KHV A;  2O4X A;  5E3F A;  1NUC A;  5EKK A;  3T16 A;  2F0L A;  3C1E A;  4NDX A;  3SK4 A;  5CGK A;  1F2M A;  2RBM A;  3TP5 A;  1KDC A;  3QOJ A;  4DGZ A;  2RDF A;  3MVV A;  2M00 A;  3P1H A;  4WOR A;  1U9R A;  1ENA A;  1SNM A;  4K2K A;  2SNM A;  4KJO A;  5CV5 A;  5IOD A;  2F0T A;  3TP7 A;  5K5P A;  4KJN A;  2F0I A;  4RKB A;  5CV4 A;  1KDB A;  2F0M A;  4K14 A;  5EKL A;  2F3W A;  3SK8 A;  2OEO A;  2EYJ A;  3LX0 A;  5C6A A;  5IGG A;  5KRU A;  4MIU A;  2F0V A;  4F8M A;  4PMC A;  5I6Y A;  2F0N A;  3BDL A;  1ENC A;  4KV6 A;  2F0U A;  1STY A;  4G57 A;  3T13 A;  5KGU A;  4IZ8 A;  3NUC A;  5KIX A;  1EYC A;  2F0H A;  4ID6 A;  1EY7 A;  1KDA A;  4E6I A;  1NSN S;  2WAC A;  1IHZ A;  1SNP A;  4HTH A;  4ODG A;  5DAU A;  5F2D A;  1TT2 A;  1EY9 A;  1RKN A;  2HQE A;  2KQ3 A;  3DHQ A;  2SOB A;  3HZX A;  1F2Z A;  5I6W A;  3D4W A;  3ITP A;  3MEH A;  3TP6 A;  2EY2 A;  2QDB A;  4KD4 A;  3BDC A;  2F0G A;  4K5W A;  1EYA A;  1SYF A;  1F2Y A;  1JOK A;  4QB4 A;  1A3T A;  1SNQ A;  5IGF A;  1A3U A;  1TQO A;  4K6D A;  3QB3 A;  3QOL A;  4R8N A;  5IOC A;  4ZUI A;  5KYL A;  1SYB A;  3NK9 A;  2PZW A;  3NP8 A;  2ENB A;  4OL7 A;  2PQE A;  4NKL A;  3D4D A;  5CV7 A;  2NUC A;  3VA5 A;  3H6M A;  3SHL A;  2PW5 A;  1KAB A;  5JOB A;  3C1F A;  4LAA A;  1SYD A;  5CC4 A;  4KY5 A;  3EJI A;  2EYP A;  3NHH A;  5C5L A;  1STG A;  3SK6 A;  3D8G A;  2EXZ A;  4HMI A;  5CV6 A;  5C3X A;  4H7B A;  3D6C A;  5CR3 A;  5HGT A;  4F7X A;  3U9O A;  4EQO A;  3SXH A;  1EY6 A;  4J1M A;  3EVQ A;  2F0P A;  3MHB A;  5C3W A;  2KHS A;  4N9P A;  4HMJ A;  4K5V A;  1KAA A;  3RUZ A;  3OMC A;  1SYG A;  1SNO A;  3PMF A;  5NUC A;  1EY4 A;  5J1Z A;  5C5M A;  3V2T A;  5IGE A;  2PZU A;  4ZQ3 A;  3HEJ A;  1EY5 A;  3OSO A;  2EY6 A;  5CV8 A;  4DU9 A;  1EY0 A;  1AEX A;  2EYL A;  2EYF A;  5C4Z A;  5HUR A;  5EGT A;  4QMG A;  4ZUJ A;  4S3S A;  3SR1 A;  4KD3 A;  4K2L A;  5KEE A;  1JOO A;  2PW7 A;  4J6H A;  2F0Q A;  1JOQ A;  4KTA A;  4NP5 A;  5CV9 A;  4EQN A;  2OF1 A;  4YIJ A;  2PYK A;  1TR5 A;  1SND A;  4DF7 A;  4B9W A;  5M9O A;  4B9X A;  1STN A;  1A3V A;  2PZT A;  3OWF A;  4I65 A;  5E1F A;  4N9T A;  5I9P A;  5J39 A;  3MXP A;  3ERQ A;  5C4H A;  1A2T A;  2F0F A;  2EYH A;  2F0J A;  4K8I A;  4KY7 A;  4NMZ A;  2F0S A;  3ERO A;  4KY6 A;  4QF4 A;  4RKL A;  4EVO A;  1JOR A;  4DFA A;  2EYM A;  3OMG A;  1STA A;  4PMB A;  2EY5 A;  5J22 A;  3NQT A;  3E5S A;  5IGB A;  5ISR A;  2F0W A;  4K5X A;  1II3 A;  5IGD A;  1EQV A;  4EQP A;  2F0D A;  2RKS A;  4K8J A;  4IUN A;  5IIF A;  5JAV A;  2EY1 A;  3DMU A;  1EZ6 A;  3S9W A;  1EZ8 A;  1EY8 A;  1SYC A;  5KYI A;  3P75 A;  1SNC A;  1EYD A;  2F3V A;  2F0O A;  2SNS A;  2F0E A;  3R3O A;  5IGC A;  2EYO A;  4WRD A;  3TME A; 
#chains in the Genus database with same CATH topology
 4JVZ A;  3KF6 B;  1GO3 E;  4FXK C;  1G6Z A;  2DGY A;  5HGQ A;  2K14 A;  3VDY A;  1I5F A;  3NEL A;  2L5T A;  4X65 Q;  4DGZ A;  1EFW A;  1SFO B;  1LO5 D;  2EQS A;  1HZ9 A;  4OX9 Q;  3ULJ A;  5IYD H;  2AKW B;  2MFI A;  2DNC A;  1PTO D;  4QGU A;  3M85 A;  4FVM A;  4P75 A;  5KRU A;  2A6H D;  4WJ4 A;  1X6O A;  5LHY 1;  1NNX A;  4L5T A;  1EY7 A;  3HFZ B;  5ELF A;  5F2D A;  1TT2 A;  3FDT A;  1PFN A;  1J5E L;  4YWL A;  1MBY A;  4P73 A;  1GUT A;  5K36 G;  1S72 A;  1NY4 A;  4A93 G;  2EJF C;  3CMA A;  5FJ8 H;  1GHJ A;  4NKL A;  4A3I H;  1S5B D;  3CCQ A;  5C4J B;  4PQX A;  2F3I A;  2R92 G;  3CP0 A;  3CF5 A;  3HKZ G;  3UDG A;  3X3N A;  1R4P B;  4ILW A;  4EQO A;  4CGY B;  2UXD L;  4J1M A;  3BVM A;  4BY1 G;  3AQQ A;  4N9P A;  1I6H H;  4JI0 Q;  3SGI A;  3OSO A;  1E2Z A;  1J9O A;  1PH3 A;  4ZUJ A;  4QIW B;  1PTO C;  4S3S A;  3LNN A;  4J15 A;  1XTD A;  3DM3 A;  2PQA A;  4B9W A;  1TU2 B;  3MA2 B;  3PO2 G;  2R7F A;  3ERQ A;  3I56 A;  5M3M G;  1LTL A;  3GDE A;  2KCC A;  1TS3 A;  3BG3 A;  3OMG A;  5M3F B;  4PMB A;  2NB0 A;  3NQT A;  2NZO A;  1WCM B;  4K5X A;  4DK0 A;  1F2L A;  1IBM Q;  4AIM A;  2JSO A;  5FLM G;  3DMU A;  2K4K A;  5LMU Q;  2HIV A;  4OXP A;  3OTO L;  4JI4 L;  1X55 A;  4DUY Q;  1WVL A;  3R93 A;  2XGT A;  3H15 A;  3GP7 A;  1M4V A;  3HOW B;  2UXB L;  4WOR A;  1MI2 A;  4LFB Q;  2WKD A;  2SNM A;  2AUJ D;  5CV5 A;  1U0L A;  5KNC A;  3GTQ H;  2PMZ B;  1CT1 D;  2H4O A;  1L1O C;  2NYZ D;  3GTM B;  1SMY C;  4RHR A;  3GTG B;  2PCF B;  4HCS A;  2VY3 A;  5I6Y A;  4X62 L;  1G51 A;  1IBL L;  3EN2 A;  3K5N A;  1C4Q A;  2XN9 C;  1EY9 A;  4ME3 A;  4B3M Q;  1N36 L;  2L1B A;  2SOB A;  3NTH A;  3NBH B;  4FF1 A;  4AQY L;  3E3X A;  4IFD J;  4GN5 A;  3KJP A;  2HD3 A;  2J0T D;  2UXB Q;  2KCT A;  4QB4 A;  4C3H B;  2JA9 A;  1PRT C;  3MXN B;  3QOL A;  4C3J B;  1CHP D;  1TWA H;  2YU9 B;  1DZ1 A;  1O80 A;  4OL7 A;  2LFN A;  1GKH A;  2NUC A;  4XYQ A;  5C3E G;  1X9N A;  1L2F A;  5LMU L;  1ILP A;  3J81 j;  1XWE A;  5CV6 A;  2D5D A;  3K80 C;  4B3S Q;  2B2W C;  1QNU A;  2KEN A;  4L5Q A;  4RGM A;  1NMF A;  1FR3 A;  1WTO A;  1LM0 A;  3NPP A;  1SYG A;  4NXN L;  1IL8 A;  3I73 A;  2EXD A;  3FKI B;  2JA6 H;  1B1Z A;  4LFB L;  2EY6 A;  3J80 c;  1EY0 A;  1W6K A;  4IPG A;  3S17 B;  4FYD A;  4ZAI A;  5CBE E;  2TSS A;  5ELO A;  3KLR A;  1UE6 A;  3SR1 A;  4GKK L;  2GN5 A;  1U4M A;  1KL9 A;  2OF1 A;  4JI3 L;  1BKB A;  2I5H A;  2K5W A;  4X62 Q;  5M9O A;  1KRS A;  1LTI D;  2PZT A;  3OWF A;  3G7L A;  2RF4 A;  3J7Z C;  1V1O A;  4JI2 L;  3K6O A;  4DFA A;  3K0X A;  2F03 A;  3CCU A;  3VYR A;  1G2S A;  2CWA A;  3CQZ B;  3J7A V;  1CUK A;  1ENF A;  3S16 B;  4TSS A;  4EQP A;  1TS4 A;  4GNX A;  3S9W A;  2HDL A;  4DN4 M;  5IT9 c;  2BE5 D;  2WKC A;  5IP9 G;  3CC2 A;  2F0E A;  4DV1 L;  1CKM A;  5IP7 H;  4DR3 Q;  1STH A;  3J80 E;  1Z7T A;  2NVT B;  2PNR C;  1HTL D;  4WJ3 M;  1HJP A;  3CW2 C;  1S5E D;  1C9O A;  1SEB D;  3F1Z A;  5C0X I;  4AYB B;  1PZK D;  2A73 B;  2F3W A;  4OEM B;  1LTG D;  2L0C A;  1EIG A;  4ULL A;  3UE0 A;  1GUS A;  4PZ8 A;  3IFD A;  2MPM A;  1YEZ A;  3A8K E;  5KIX A;  2NWG A;  4X3U A;  4YWK A;  2GVA A;  2R92 B;  3GTO H;  1IHZ A;  1E7Z A;  3E9H A;  4JOI C;  3HZX A;  3QIA A;  3S1M H;  1HXY D;  4Z9C B;  2QKI C;  1GHK A;  1AH9 A;  4IOC A;  3U9S A;  4YHH Q;  3BYY B;  1SBB B;  1AFP A;  4IJL A;  4BY7 H;  1PH1 A;  3KF6 A;  4EX5 A;  2ZTD A;  2R7Z H;  3A5Z B;  2UXD Q;  2K7V A;  2RA4 A;  3CRL C;  2NN6 H;  3SXH A;  3X3M A;  3BYT B;  1LTA D;  4LWC A;  5BN3 A;  4IUQ A;  1CZW A;  2B2T A;  5C4J H;  3K59 A;  1O7I A;  2GVB A;  1DOM A;  2BOS A;  1B2T A;  3K5O A;  4LF5 L;  2YTX A;  2K03 A;  3HG9 A;  1K83 H;  5IGE A;  2H5X A;  4HN7 A;  2K5Q A;  1YHA A;  5ELE A;  1WOC A;  2EYF A;  1YIT A;  4KD3 A;  3I4M H;  1X65 A;  2IX3 A;  2F0Q A;  1K3R A;  3G4S A;  3VA7 A;  4WFN 3;  1A3V A;  5E1F A;  2ZM6 L;  4DR5 L;  4JI7 L;  1HZC A;  1FNW A;  2EYH A;  2FHT A;  3H0G B;  3MTS A;  1DON A;  4KY6 A;  1Q46 A;  3C2P A;  4X64 L;  1EWC A;  1L0X B;  3BS1 A;  3T1Y Q;  4A3K B;  5M5W H;  2Z6K C;  3CME A;  4A3B B;  3R3O A;  2OCE A;  1KLG D;  2Z8L A;  1ASZ A;  4TRD A;  4RCN A;  5ELD A;  2B2V C;  4POF A;  1XMQ Q;  3RD4 A;  1RJT A;  2VQF L;  1IZ6 A;  1KNE A;  1X3Q A;  2RBM A;  4CDC C;  1BCP B;  5M3F H;  2JK8 A;  1IKM A;  2JJQ A;  4LF7 Q;  4K2K A;  1O78 A;  3ONA B;  1HFN A;  2XVS A;  4F87 A;  3HOW G;  2B2U A;  5K5P A;  2QCP X;  1HPC A;  3CAM A;  4WJW A;  1PTO H;  3FEW X;  1S3O A;  2ZJP A;  3CHB D;  2QF7 A;  3BDL A;  2AQ1 B;  4KV6 A;  2VZA A;  1KD1 C;  3PIP A;  1Q1B A;  4JK1 C;  2KQ3 A;  3S15 B;  1I4X A;  4RAU C;  4IUP A;  1LTB D;  4KD4 A;  3DWA A;  4K5W A;  4GNX B;  4DPG A;  3HOX G;  2PNH A;  5T1I A;  3AFP A;  1SYB A;  1W3S A;  3KBX A;  1B4O A;  1XTC D;  2NZ1 D;  3SHL A;  2B8F A;  1TS5 A;  4ZKB B;  5C4X G;  5IYB G;  3ERS X;  4C2M B;  3PO3 G;  4C3H H;  3NEN A;  1M1K C;  1K73 C;  2QIL A;  5DM7 3;  3ULL A;  5HGT A;  4OHJ A;  1LV9 A;  3S1Q B;  5EQ0 A;  4A93 H;  4HJ8 A;  4IUT A;  2RVL A;  4G7H C;  3GTG H;  4DR7 Q;  1VQA A;  3PMF A;  4H44 C;  2E8G A;  5JPM C;  1R4Q B;  1C0A A;  1LAB A;  1YI2 A;  2P5Z X;  5C4Z A;  2I0Q A;  3KFU A;  1YHB A;  3S2D H;  4A3D G;  2HHH L;  3GTQ B;  4KTA A;  5AJ3 L;  2PYK A;  1MD2 D;  1SMX A;  2E2J H;  1I94 Q;  5EKI A;  4N9T A;  4A3J B;  1V8Q A;  4PMW A;  2KCM A;  4DV3 Q;  1E2V A;  1GVP A;  3NBH A;  1Z9F A;  3GV6 A;  4FO2 A;  1WTV A;  3T53 B;  1LT5 D;  1TWH H;  5A35 A;  1QZH A;  2VB2 X;  4A3E G;  1EZ6 A;  1XXG A;  1PYB A;  4IOA A;  2B2Y C;  2PO4 A;  2A1A A;  3FP9 A;  3SVM A;  3NE5 B;  3TP8 A;  3F2D A;  3QR8 A;  2F0K A;  2KCN A;  3M7G A;  1Q81 C;  3GTO B;  1BCP D;  3G6J B;  2V1C C;  5I4D A;  1S40 A;  1E3P A;  1HQR D;  3C1E A;  1X54 A;  3DXJ C;  3S15 H;  4IUV A;  4TKO B;  5FKA C;  1YNN C;  3TRE A;  1KNA A;  1NTG A;  4BBS H;  4GLX A;  1A6X A;  3KLS A;  1D1I A;  3KUP A;  2Z1C A;  2D0P A;  2CVR A;  3DEP A;  2ZXR A;  1CSP A;  2K04 A;  3DLL A;  1OXT A;  4N8F A;  4DXG A;  2F4V L;  2EVB A;  1VS0 A;  3PF4 A;  3PCO B;  4I7A A;  4A3E B;  1K28 A;  2B63 H;  2A68 D;  3M4Y A;  4KK7 A;  1N9W A;  2K01 A;  3K5M A;  4NXN Q;  2A19 A;  1RL2 A;  3JC6 6;  4IFD I;  5EJW A;  2PI2 E;  4K6D A;  4R8N A;  1HNX Q;  1OTC A;  2XSC A;  3VR5 A;  1TY0 A;  3LGJ A;  4DKA C;  3IKJ A;  1AN8 A;  2YV5 A;  1Y8O B;  3S1M B;  2A6E D;  3EJI A;  3UDF A;  1CA6 A;  1F9Q A;  1I3Q B;  2Z9H A;  1Y1W G;  2H1E A;  4DAY A;  5EPJ A;  5GRO A;  4DNI A;  4MZ9 A;  2K5D A;  2F0P A;  1Q8K A;  1AP0 A;  4GOP C;  4PZ7 A;  1J6Q A;  3RN5 A;  4LNQ A;  4HJ7 A;  1A8V A;  5C5M A;  4YWM A;  2JA7 G;  3PUW A;  1NJI C;  3MXN A;  4QMG A;  1QVG A;  2KHJ A;  4OO1 G;  2FFK B;  3B6Y A;  5M5Y B;  2RHS B;  4CJ2 C;  2E2H H;  4UP8 A;  2EOT A;  2K1B A;  5JJI A;  4RA8 A;  4Y7N B;  5JJK A;  4C3I G;  5H1S E;  1D8L A;  3MC0 B;  1DJR D;  1B50 A;  1CKN A;  1HFG A;  4G7O C;  3J81 L;  2VXW A;  4GLA C;  3GTK H;  4A76 A;  3NTK A;  4P72 A;  5EPL A;  2NN6 I;  2PMZ E;  3V05 A;  5JEA H;  1TY2 A;  1RTN A;  5KYI A;  1V1Q A;  1EYD A;  4C3J G;  1ICW A;  3BJU A;  1EIH A;  3FPU B;  1FGB D;  5DEH A;  1MHW C;  2E2D C;  3NXW A;  2XRQ D;  4APV A;  3W1G A;  2L15 A;  1PFS A;  2B2V A;  2RDF A;  5COY A;  3M4P A;  3P1H A;  4R4C A;  4U67 3;  2N3S A;  3HOY B;  4KJO A;  3T1H Q;  3D3R A;  3CCS A;  4K14 A;  5EKL A;  2AQ2 B;  5C44 H;  3JAM E;  3S14 H;  1MSG A;  1KTK A;  4UDU C;  2R7D A;  1YVC A;  4PMC A;  2QEX A;  2D9U A;  1STY A;  1YIJ A;  4K6L A;  4JI4 Q;  1I3Q H;  1YNJ C;  1FD7 D;  2HQE A;  4DAV A;  3HOZ G;  4X66 Q;  1L1O A;  1OXU A;  5FLX L;  5GAD C;  5E7N A;  4RH6 A;  3DM1 A;  1JOK A;  1S5F D;  1BXT A;  1CK1 A;  1I4P A;  4RCO A;  3K57 A;  1A3U A;  4GS3 A;  1CSQ A;  2DJG C;  3ND9 A;  1Y14 B;  4CBV A;  3U50 C;  5CV7 A;  4FF4 A;  2MO0 A;  3PUZ A;  1E22 A;  4DR2 L;  2QDL A;  3HOY H;  3M7N A;  2A5H A;  1WI5 A;  2ZM6 Q;  2IPK D;  4DR5 Q;  2UXC Q;  1B44 D;  3K81 C;  4JI8 L;  4HSV A;  2I46 A;  4F7X A;  3U9O A;  2WB1 G;  5E4W C;  2K5H A;  1H9K A;  5C3W A;  3Q24 A;  3GTJ B;  3L2P A;  2L55 A;  1B8A A;  1VQ9 A;  2PZU A;  4Y52 H;  2PI2 A;  5CV8 A;  2Q2T A;  4BA2 I;  1Q90 A;  4GLV B;  2X6L A;  3HOU G;  5LL6 S;  1C7Y A;  3BVZ A;  1VDZ A;  4XTC S;  3CCJ A;  4ALP A;  2FMM A;  4DF7 A;  4GN4 B;  3AB9 A;  1VQD A;  4JI7 Q;  1PA6 A;  5CYU A;  1JJC B;  2AWN A;  3K0Y A;  2Z0S A;  4NPS A;  2I5L X;  2VQE Q;  1RIP A;  4DR1 Q;  4A3C H;  3MXU A;  4LF8 L;  1QCB D;  1SMY D;  4XYO A;  3EBE A;  2ZXO A;  1Q82 C;  4HAE A;  4A93 B;  5IT9 E;  3DEO A;  2SNS A;  3PO3 B;  1SN8 A;  3MAQ A;  4P71 A;  5C0X J;  4R8I A;  4K0K L;  4ZLT F;  2R92 H;  2KEE A;  2OXP A;  4DR2 Q;  2WAQ E;  3FVQ A;  2F0L A;  4NDX A;  1V43 A;  1K8A C;  4NXM L;  4LF7 L;  1UUP A;  3PUV A;  2MUY A;  4JI3 Q;  1D1K A;  4RKB A;  2F4V Q;  3GQB A;  4KMU C;  5FO8 B;  4GNX C;  2YU9 H;  2JQO A;  5IGG A;  4MNO A;  4XT3 B;  3PIP 3;  2MQH A;  1GUO A;  1XJV A;  1EYG A;  2L11 A;  4G57 A;  2RQX A;  4IZ8 A;  2Q8T A;  4LF8 Q;  1EWH A;  2HCI A;  4A3G G;  2WB1 B;  5IP7 G;  5BR8 Q;  1V1P B;  5KNB A;  1A63 A;  1GXD C;  3U58 A;  3R8B A;  5M5W B;  3EIV A;  1WTW A;  1PFM A;  4DA2 A;  3HOV G;  5JEA J;  1PFB A;  4HIM A;  4ZUI A;  4K0K Q;  4DXF A;  1UE5 A;  1XNQ L;  2E74 C;  3Q8D A;  3AYH B;  4P2C B;  2B63 B;  4DNT B;  1KAB A;  2CW0 C;  5JOB A;  4BBR H;  2YTY A;  1IYV A;  5IYB H;  4LF6 Q;  3S1R B;  4C3H G;  4DV2 Q;  3ICE A;  4H02 A;  2C9O A;  1UNS A;  5CR3 A;  1E1T A;  3N52 A;  3HOZ B;  3I55 A;  2A69 C;  2B2W A;  1K0R A;  4L63 B;  3S2D B;  3HOX H;  3L0O A;  3J7A 5;  4DV0 Q;  1HRJ A;  2KHS A;  3FKI G;  1S5C D;  4UY8 C;  2K50 A;  2Z4I A;  4DV6 Q;  3OMC A;  3R2T A;  1CFM A;  4XQQ A;  4JV5 L;  1OO9 B;  2CW0 D;  3W1B A;  1A15 A;  1WCM H;  2EJM A;  2NZH A;  3CCE A;  1WTP A;  3M3Y B;  1G2T A;  4DV4 Q;  1D6E C;  3OOC A;  1VQB A;  1VQM A;  3NTI A;  1JOQ A;  1QJO A;  3QG1 A;  1NR2 A;  2Y0S E;  1N34 Q;  3J80 i;  4A3F G;  1MJE A;  2UUA Q;  1STN A;  5JVH 3;  5J39 A;  2NVT H;  1ESF A;  1RD9 D;  4KY7 A;  1FL0 A;  1PRT F;  4LF6 L;  4A3G B;  1PZJ D;  4G7Z C;  1I50 H;  1KHI A;  2NVY H;  4JG2 A;  5IYC H;  5JAV A;  2QW7 A;  5C44 B;  1UEB A;  4DAY B;  3S14 B;  1V1P A;  1XX8 A;  1PTO B;  1IKL A;  1Y69 U;  3WDN A;  1JJ2 A;  5IYD G;  3HOX B;  4DV6 L;  2HUG A;  4ZQ3 A;  2IY5 B;  3F8T A;  1SYE A;  3OPO A;  4YCW A;  1VQ4 A;  4O0A A;  1JB3 A;  2G5D A;  3PO2 B;  2CQO A;  5EKK A;  3SK4 A;  4FDB A;  1D5X C;  1F2M A;  1BBW A;  2EPB A;  2RHQ B;  1BBX C;  5A2Q E;  3A56 A;  4EQ5 A;  5BN4 A;  1N34 L;  1PHJ A;  1X56 A;  4DAP A;  4DV1 Q;  2UUA L;  2K52 A;  2JP1 A;  1K8G A;  4A3L H;  2JA7 B;  1PH4 A;  1PV4 A;  2Q2U A;  2C35 B;  5IY0 A;  3S1N H;  4F8M A;  3BZK A;  1EYC A;  4ID6 A;  4B3T Q;  4HTH A;  4OIJ A;  3KK7 A;  2CKZ B;  4BWG B;  1Q12 A;  2VQF Q;  1J5E Q;  3MEH A;  2D62 A;  3ULP A;  3VR6 A;  4O1N A;  3U4V A;  4RFB A;  1ZKO A;  2EDG A;  1PMR A;  3QB3 A;  3H94 A;  3NK9 A;  1XMQ L;  4X66 L;  1FJG L;  1K8M A;  2BH2 A;  4HJA A;  4L5S A;  1LT4 D;  2MHV A;  2VUM H;  2J4X A;  2WII B;  1B3A A;  1ZXT A;  4H13 C;  4H7B A;  1ASY A;  4RGO S;  2UUC Q;  3I4N B;  4O42 A;  1HQM C;  1Y8N B;  3T51 B;  1EEF D;  2RCN A;  2R61 A;  2IHE A;  4DK1 A;  3WOE A;  5LMN W;  2B2T C;  1TII D;  1Z6H A;  1F9S A;  1IYU A;  2WAQ B;  4BA1 I;  3OIQ A;  4C2M H;  1Y1W H;  1X3P A;  5HY6 A;  5C0X H;  4JBJ A;  1L1O B;  1DOL A;  4KKU A;  4JI1 Q;  3H91 A;  1SND A;  5I2Y A;  3L3O C;  1DD2 A;  5I9P A;  3V96 A;  1WD1 A;  3HOU B;  1SRO A;  1BDO A;  4GOP B;  3OHX C;  2KVM A;  3I90 A;  1XNR L;  4ZRZ A;  2A69 D;  5FK9 C;  5GQO A;  1QE6 A;  4OWT B;  1SAP A;  2AWO A;  1SLJ A;  1L0Y B;  5FO7 B;  1JWU D;  4KN4 C;  2EY1 A;  4DR6 Q;  4IFD H;  1WD0 A;  4CHT B;  4MIU A;  1XMO Q;  3TME A;  3RNU A;  3PUX A;  2NVX H;  4OGQ C;  3I72 A;  1VQH A;  2AQ3 B;  2HHH Q;  4N8X 1;  3CU7 A;  2WFW A;  4DNR B;  1Q8I A;  4ZK9 B;  4KN7 C;  2L4N A;  3NBI A;  2N78 A;  2NVY B;  1PVO A;  1ZEQ X;  3KOJ A;  4CDE C;  1KDB A;  2F0M A;  2XNA C;  1EU4 A;  1TWA B;  2AMC B;  1AZP A;  2L12 A;  2ALY B;  4UHV A;  3OW2 A;  3I2Z A;  4DV3 L;  3T13 A;  4YY3 Q;  1E2W A;  4E6I A;  3JAM i;  1QVF A;  1M8A A;  4LFC L;  1B53 A;  5I6W A;  3D4W A;  3O13 A;  1E0B A;  4DUZ L;  2DN8 A;  3I91 A;  2XWB B;  4HED A;  1SYF A;  1W2B A;  1TQO A;  1ML0 D;  1EWI A;  3S2H H;  4DV7 Q;  4BBS G;  1I4G A;  1PZI D;  2R93 H;  1EOT A;  4HSP A;  2RCF A;  4CDF C;  2Y0S B;  2JE6 I;  4QJF A;  1JMC A;  1XPO A;  2NVX B;  3H6M A;  3FPP A;  2HQL A;  2SEB D;  5D14 A;  5KND A;  2EYP A;  4X3T A;  2EE1 A;  3D8G A;  2JYO A;  4LW1 A;  4ZCK A;  2JA8 H;  2D0O A;  4IPH A;  3CPW A;  1R9T B;  4KKT A;  3VR2 A;  2E2I H;  1LAC A;  4L5R C;  2B63 G;  3BZD B;  4DR4 Q;  1WCM G;  1CI3 M;  4FXG C;  4GN3 B;  3STB D;  1JWM D;  3CCR A;  4ZKC B;  2UUB L;  4XIG S;  1D5Z C;  5T1G A;  1V9P A;  1IW7 C;  2J7Z A;  4BY7 B;  2ZJR A;  3CC7 A;  5G3L D;  3W3A A;  4YCU A;  1JQY D;  1SE4 A;  1PXU A;  1GM5 A;  4DV7 L;  1VF5 C;  1PH9 A;  2HDM A;  2M2L A;  1TR5 A;  3D31 A;  5IP9 H;  4A3B H;  3RLF A;  4HR7 B;  1EQR A;  1OXX K;  5BN5 A;  5GAG C;  1FVI A;  3A55 A;  1STA A;  1LLR D;  2YYZ A;  1EQV A;  3KLW A;  1EU3 A;  4BY1 B;  2SDF A;  3UDI A;  1QB5 D;  3CCL A;  4MTN A;  1VMC A;  1SR3 A;  4IJH A;  1BVS A;  3HRZ C;  3BZC A;  2EYO A;  3TEH B;  2E2H B;  4OO1 H;  1STB A;  4ME5 A;  4PNY A;  3RLN A;  4H0L C;  2F52 A;  4OIK A;  5TSS A;  4HID A;  2O4X A;  4OEL B;  2KEC A;  3MVV A;  3OYY A;  2AUK A;  3EA6 A;  1SNM A;  3L9A X;  1F9R A;  4RGT A;  1HHV A;  4BXX H;  2XIW A;  5CV4 A;  3LX0 A;  2JXM B;  4XQN A;  2F0V A;  4DV2 L;  3EFX D;  2IX0 A;  2F0N A;  2F0U A;  2A6E C;  3NUC A;  2BE5 C;  1U4L A;  1SNP A;  3VYU A;  4MTK A;  4KKS A;  1PRT D;  3OWE B;  4LUV A;  1QZG A;  4RMF A;  5C3E H;  1IBK L;  2K6A A;  4UP7 A;  3J7Y W;  2PZW A;  4LUO A;  2ENB A;  3GTM H;  1QG7 A;  3M9B A;  5CC4 A;  4A3G H;  1H95 A;  1NMG A;  3W5O A;  1K0S A;  2HT1 A;  1PYW D;  2BH8 A;  1WTR A;  1NBW A;  2EXZ A;  2RSO A;  3DWQ A;  3TQY A;  5C3E B;  3NWT A;  1KIX A;  3D6C A;  5K36 H;  1TWC H;  3AFQ A;  3HOV H;  5FO9 B;  4PG3 A;  2DJF C;  2N8N A;  2BA0 A;  3S2H B;  1T5X D;  2K5N A;  2HIX A;  4DR3 L;  5GAH C;  1EIY B;  4LF5 Q;  3S1R H;  1EY4 A;  5I2X A;  3P7J A;  1GUW A;  2GA4 B;  4JI1 L;  1TWG B;  2KED A;  3RLO A;  4A3M G;  2EYL A;  2VW9 A;  5EGT A;  1YHQ A;  4AQY Q;  3M4O B;  1Y1V B;  3PIO 3;  1VQ6 A;  1FGU A;  1DXM A;  2E2I B;  4LF4 L;  4A3D B;  1FNV A;  1SE2 A;  1YNN D;  4OWX B;  4C3I B;  1CZG A;  3S24 A;  3S1N B;  5C4H A;  3PV0 A;  5LMN L;  4LF9 Q;  4RKL A;  3AU7 A;  1T5E A;  1L0W A;  2UXC L;  3FMC A;  1EEI D;  1STE A;  5ELC A;  1OXV A;  1D2B A;  5IYC G;  2UU9 Q;  3QJY A;  4K8J A;  2G9D A;  1EZ8 A;  1SYC A;  1DGS A;  2F0O A;  2JA5 G;  4DUY L;  1VQJ A;  3MZ5 A;  5I9O A;  4DAM A;  1UE1 A;  3Q22 A;  2NTT A;  4CKE A;  1TWF H;  4FP5 D;  3ER0 A;  2M00 A;  3M3Y H;  1U9R A;  1Y1W B;  4JI5 Q;  1JC7 A;  3GO5 A;  1ILQ A;  3JAM c;  3C46 A;  1VQ8 A;  4A3C G;  4M1U B;  5M3M B;  1PRT B;  2OEO A;  1RF2 D;  1KQS A;  1WTX A;  3UI2 A;  4A3K G;  1E24 A;  2MP1 A;  2JA5 B;  1YZ6 A;  3KDF B;  4XT1 B;  1NSN S;  3CCV A;  4GOP A;  3RZO H;  5DAU A;  3KF8 B;  3T1H L;  4FNF A;  3F2U A;  5EBC A;  1PDQ A;  5C4X H;  1G29 1;  3A8J E;  2R93 G;  3K7U C;  1NCV A;  2Z6B A;  1G91 A;  3A0J A;  1NR4 A;  3J80 L;  5IGF A;  3OW7 A;  5IOC A;  4LF9 L;  4R9W A;  4TQU S;  3NP8 A;  4LK1 C;  2PW5 A;  1G6P A;  1SYD A;  2VUM G;  2UU9 L;  1HR0 Q;  5C5L A;  5EAY A;  3SK6 A;  5JEA G;  3HGB A;  1SFO H;  1Y1V G;  3H3V H;  3MEF A;  1CKN B;  4XQJ A;  2QA4 A;  4A3D H;  3J81 E;  1EY6 A;  4OWW B;  3HKS A;  4KHP Q;  4JYA L;  2IJ0 A;  1BR9 A;  4DR7 L;  4IN3 A;  1RDP D;  4EGV A;  2JA5 H;  5J1Z A;  2N88 A;  1VMP A;  2O2L D;  2N49 A;  3HEJ A;  2NTS A;  1G8Z D;  1JE4 A;  5HUR A;  2OTL A;  1K3B C;  2OWO A;  2L9H A;  1TS2 A;  3GTK B;  1VCI A;  3KJO A;  3HOV B;  4A3J G;  3FRP B;  4JBW A;  5A2Q L;  4IO9 A;  5BR8 L;  3PIO A;  4RHS A;  4NMZ A;  5D65 A;  3GV3 A;  4LUZ A;  4C56 C;  1U4R A;  2KA7 A;  4C1N K;  2LXK A;  3ZYY X;  1PTO F;  5IGB A;  4UPA A;  1HNZ Q;  1VQP A;  3KDF A;  1PLF A;  4DR6 L;  1EUJ A;  1PH2 A;  4TVA B;  1EY8 A;  1O7Z A;  1VQE A;  4JOI A;  1B3Q A;  1SNC A;  2F3V A;  5M3F G;  4RG1 A;  2ZT9 C;  5FLX c;  1SDF A;  3BU2 A;  4IAL A;  4CJ1 B;  2NVQ B;  1WFQ A;  1ESR A;  4KHV A;  3UDX A;  1TXY A;  4A3F H;  3ND8 A;  1KDC A;  3QOJ A;  4L8J A;  1EIF A;  4FF3 A;  4JW0 A;  4DV0 L;  1TWH B;  2V4D A;  3HKZ E;  4X3S A;  1HA6 A;  3R2I A;  3AMU A;  4IFD G;  5L37 A;  4GKJ L;  5C6A A;  2BDN A;  4CJ0 B;  3J81 c;  1HNX L;  3HOU H;  2JEA I;  5KGU A;  1VQF A;  1EQT A;  4DK6 C;  1KDA A;  3PO2 H;  2NVQ H;  3A5U A;  1SE8 A;  2CH4 A;  1D7Q A;  1SSO A;  2A74 C;  3GTP H;  4KLK A;  2ATW A;  4DUZ Q;  3TDQ A;  2QDB A;  1EL0 A;  2K32 A;  3MFG A;  1HA5 A;  1LYL A;  1T9H A;  1A3T A;  1SNQ A;  4AYB G;  5KYL A;  2DNE A;  3RN2 A;  1X3G A;  1O7Y A;  3PO3 H;  2IHF A;  1N32 L;  1KLU D;  2PQE A;  1U5K A;  1WYD A;  1LUZ A;  2DUD A;  1A62 A;  2OT2 A;  3C1F A;  1X3E A;  2K28 A;  4KY5 A;  1QNK A;  4R4O A;  1CQV A;  1HZB A;  2C5C A;  2VS1 A;  1KXL A;  5C4X B;  4QL5 A;  1Q7Y C;  1KRT A;  3E0J A;  2LXJ A;  5COR A;  1SJE D;  2CWP A;  3H0G H;  3K8A A;  3K58 A;  1N33 L;  5JVG 3;  4B3T L;  1DM0 B;  3D0F A;  2DY8 A;  3CQZ H;  4YHH L;  1O7L A;  3DWP A;  1TWC B;  3CKI B;  3KF8 A;  2MGS A;  2JA8 G;  4K2L A;  2CFM A;  4J6H A;  4M8A A;  4NP5 A;  4EQN A;  5LL6 X;  2CH4 W;  4JV5 Q;  3VR3 A;  1VQC A;  1FJG Q;  2RSN A;  3G71 A;  3I3C A;  3NQI A;  4A3I B;  4A3F B;  1JWS D;  4BBR B;  2VL6 A;  4Q5V A;  2EYM A;  3E5S A;  3AEV A;  2Z6K A;  5CMD A;  3P20 A;  2Q2I A;  3BDO A;  3P75 A;  4KI0 A;  2IWH A;  5IGC A;  3HS0 C;  2R3Z A;  4BBR G;  5D3D A;  2Z4H A;  3IAY A;  3E9I A;  4A3B G;  3NWS A;  2XWJ B;  5E3F A;  1NUC A;  3T16 A;  5IOD A;  1B9M A;  2D2C C;  2VB3 X;  1C8C A;  3GTP B;  1IBK Q;  4JI0 L;  1XPR A;  2UUC L;  3SDZ A;  2LSS A;  2BA1 A;  1ENA A;  3PQI A;  1WJJ A;  3G48 A;  2F0T A;  4A3K H;  1Q86 C;  4V19 0;  5AJ3 Q;  4KJN A;  2F0I A;  2WV6 D;  4PZ6 A;  1PH5 A;  1H9S B;  5DLQ E;  3WOF A;  1TWF B;  2WB1 E;  4R4Q A;  3TS2 A;  2E5L Q;  2F0H A;  1VQ5 A;  1B70 B;  2IW3 A;  4ODG A;  5IT9 L;  1RKN A;  2IT1 A;  3S17 H;  1ROD A;  5EBD A;  4I7Z C;  4BY1 H;  4NB3 A;  3BDC A;  2F0G A;  1EYA A;  3Q0A A;  1F2Y A;  3M4Q A;  2KJX A;  3MFY A;  2ZXP A;  4B3S L;  1BUV T;  3GTL H;  1XNR Q;  1K83 B;  3FHW A;  2OQ0 A;  1ICF B;  1HCZ A;  3KBG A;  1VF7 A;  1PYS B;  4JYA Q;  2RDH A;  1D5M C;  4BS9 A;  3QWN A;  1CQF A;  5M3M H;  1BF4 A;  3A8I E;  4HCE A;  4DR1 L;  1S4Z A;  1IW7 D;  4K5V A;  2R7Z B;  4NW2 A;  4JBK A;  4OO1 I;  1SE3 A;  2K05 A;  5M5Y H;  2A68 C;  2XTI A;  1UE7 A;  3OTO Q;  3STB C;  3V2T A;  5JJL A;  1ZYR D;  2AHO B;  2X6G A;  1LT3 D;  3I4N G;  2WP8 J;  1JIC A;  3SE0 A;  4AYB E;  3TN2 A;  1JOO A;  1NAP A;  4B3M L;  4F88 A;  5CV9 A;  2B29 A;  4LF4 Q;  4FXD A;  4QUC A;  2JA7 H;  4YY3 L;  2K33 A;  3TZU A;  2R6G A;  4JBM A;  4NXM Q;  3MXP A;  3L7Z C;  1VQ7 A;  5DM6 3;  4POG A;  4RWS C;  4QF4 A;  3VYS A;  3ERO A;  3I70 A;  2VQE L;  1FYC A;  4PV1 C;  5ELB A;  2R7Z G;  1II3 A;  3NSW A;  4IPC A;  5D3I B;  4JI6 Q;  1F77 A;  3VYT A;  1N36 Q;  2B39 A;  1EFI D;  3I7F A;  4IUN A;  4A75 A;  1J8I A;  4C3I H;  3KYH C;  3IFT A;  4DK3 C;  3H3V C;  2VNU D;  1IBL Q;  2UUB Q;  2NN6 G;  3CD6 A;  1BOS A;  1A2U A;  2NBF A;  2CHB D;  4V0B A;  5CGK A;  3VR4 A;  3EQL C;  4ZYS A;  2RDG A;  5FOB B;  1GUG A;  3I4L A;  3CRK C;  1QUQ A;  1UAP A;  3TP7 A;  3S16 H;  3D4R A;  1S5D D;  3PGZ A;  4JC0 A;  3SK8 A;  1SJH D;  4IQZ A;  5IWA Q;  2Q8I B;  1BO0 A;  5FJ8 G;  4ABN A;  4CKC A;  1PH6 A;  1P16 A;  1QOH A;  2FMC A;  5C44 G;  4IPD A;  1Q3L A;  3I4N H;  2ASB A;  4LFA L;  2B8G A;  1IL2 A;  1HNW L;  1JJG A;  3ZJY C;  3J81 i;  1Z47 A;  2JA6 G;  3J7A F;  1GUN A;  1SRU A;  1U4P A;  1VQK A;  1RTO A;  1SXT A;  2I5M X;  3SEB A;  1GJX A;  1BQQ T;  1E1O A;  3VA5 A;  5IWA L;  3W2D A;  3GTJ H;  2PQA B;  1ZYR C;  1KC8 C;  4QQB X;  1HR0 W;  4JI2 Q;  1CKO A;  3HP3 A;  1EOV A;  2K75 A;  1WTQ A;  1EQQ A;  2ICI A;  2IL8 A;  1Y1V H;  1STG A;  1LTS D;  3Q23 A;  4HIO A;  2FIN B;  4HMI A;  3TBI B;  3I8Z A;  3PSI A;  3E0E A;  2FXQ A;  4B08 A;  4P74 A;  3EVQ A;  1I4H A;  4LFA Q;  3I4M B;  4HMJ A;  1JCK B;  1KAA A;  3HOY G;  3NEM A;  1SNO A;  3I4O A;  3MWY W;  1TVX A;  3TSS A;  4DU9 A;  1HUM A;  1AE3 A;  1JB7 A;  4JCV E;  1I4R A;  3RZD B;  2FJ2 A;  1H9M A;  3GD7 A;  3C3L A;  4UP9 A;  2PW7 A;  2LY7 A;  4YIJ A;  1MIU A;  1AE2 A;  5FLX E;  2MNA A;  1XPU A;  1YJN A;  1QVC A;  2JN4 A;  2B3G A;  2QGQ A;  2F0F A;  2EIF A;  4X3K A;  2F0S A;  2EJG C;  3F2C A;  3F2B A;  5J22 A;  3PUY A;  1H9J A;  1HNZ L;  3A74 A;  1JT8 A;  4YCV A;  1N8R C;  5IIF A;  4A3M H;  1ET9 A;  5FLM H;  2ZJQ A;  1UEA B;  1LTT D;  4RGN A;  4A3J H;  1CA5 A;  1DCZ A;  3TZD A;  2F1M A;  1I4Q A;  2E76 C;  3SK5 A;  1OXS C;  5AFW A;  2E75 C;  4Y7N H;  3TP5 A;  3CC4 A;  3CCM A;  3RZD H;  4G4K A;  3HKZ B;  1N32 Q;  4JPB W;  4KHZ A;  3H3V I;  4C3J H;  5EPK A;  2E5L L;  4A3M B;  4XXE A;  1HTP A;  4L6T B;  1ET6 A;  1BBU A;  3BVG A;  4MHE A;  1ENC A;  2WAC A;  2A6H C;  2HCC A;  1VQI A;  1JR0 D;  3DHQ A;  2O5J C;  3A7L A;  2Y0S G;  1MSH A;  1CM9 A;  4HJ5 A;  4DV4 L;  2EY2 A;  5GAE C;  1Y8P B;  4BBS B;  5E4X A;  1I6V C;  1VQL A;  2EZV A;  1HZA A;  3RR5 A;  1UWV A;  3D4D A;  1I6H B;  2Q8R E;  2WIN B;  4JI5 L;  1IYJ B;  3FKI H;  3NHH A;  2JA6 B;  3DUZ A;  1I50 B;  2LS0 1;  1MJC A;  3D6W A;  3KLS X;  4A3I G;  1GD7 A;  1H9S A;  3M4O H;  3T56 B;  4A4I A;  4LJZ C;  1B9N A;  1YNJ D;  2IX1 A;  3RUZ A;  4XDX A;  3PF5 A;  5J3B A;  5NUC A;  4IUR A;  1RCV D;  3T1Y L;  1I94 L;  2WAQ G;  1EY5 A;  1LTR D;  1AEX A;  2CQA A;  5ELN A;  1RHP A;  4JI8 Q;  2KOL A;  4BXX G;  4QCL A;  2KUM A;  2ZTE A;  3A54 A;  2BDO A;  1FNU A;  4IUU A;  3TS0 A;  2B2U C;  5DNF A;  5JPN C;  1YJ9 A;  4X6A H;  2BCO A;  4CKB A;  4GZY C;  5M5X H;  1AZQ A;  1QIL A;  3IRB A;  1IXR A;  1MGS A;  2I07 B;  2ES2 A;  4HJ9 A;  1IBM L;  1PH8 A;  4B3R Q;  2F0J A;  4K8I A;  4EVO A;  1JOR A;  1YJW A;  3HOW H;  2EY5 A;  2ID0 A;  4C1N I;  3JAM L;  3K5L A;  4MN3 A;  2F0W A;  2LMC B;  3Q6S A;  2F0D A;  3T4A C;  3QO2 A;  3G6E A;  1YNX A;  2Q2H A;  2MO1 A;  4R4I A;  5G3L F;  4CDD C;  1F9P A;  5LMN Q;  4OON A;  4WRD A;  2CCZ A;  5M5X B;  2O5I C;  2JEB I;  2MJ8 A;  2LKV A;  2OTJ A;  3K7A H;  1VQO A;  1VQN A;  1H9R A;  4QY7 A;  5KEE A;  1A0I A;  2G9H D;  4A3L G;  1X3F A;  4QIW E;  2YTV A;  4B3R L;  1C48 A;  5IE8 A;  2OQK A;  4LFC Q;  4O2D A;  2M9V A;  3RMH A;  1B7Y B;  1AW7 A;  4R1J A;  1XYI A;  2R93 B;  2EYJ A;  3E6Z X;  2KHI A;  4U68 A;  4BY7 G;  3IL8 A;  4LMQ D;  3GTL B;  2JA8 B;  1F2Z A;  2N55 A;  3ITP A;  3TP6 A;  1K8O A;  1M90 C;  2QEJ C;  2TMP A;  1HUN A;  4DV5 L;  1P8L A;  1CHQ D;  3OIP A;  1MKH A;  4FF2 A;  1NE3 A;  1YBY A;  1QWY A;  4UAI A;  4J8Q A;  1HNW Q;  3K7A B;  3UE1 A;  3LWU A;  2ZTC A;  4DR4 L;  4AH6 A;  1GOZ A;  4LAA A;  1BNZ A;  3A7A B;  3U4Z A;  3WWV A;  2B2Y A;  2K5V A;  2F4I A;  1LT6 D;  5C3X A;  3I4M G;  4GKJ Q;  1ONL A;  1Q1E A;  2E2J B;  3MHB A;  4OX9 L;  5JJZ A;  1DYQ A;  1CTM A;  2X69 A;  1XMO L;  4JI6 L;  3N6R A;  1HR0 L;  5CBA E;  3TRZ A;  1W6J A;  1DOK A;  4A3E H;  1KAW A;  1XNQ Q;  4HIK A;  3CPF A;  1QUQ B;  2PPB C;  3MXG A;  4KHP L;  1R9T H;  1BCP F;  4QUF A;  3HOZ H;  1TKW B;  1PH7 A;  3LWE A;  3URY A;  4B9X A;  2A8V A;  3S1Q H;  1X32 A;  4I65 A;  3H09 A;  4GKK Q;  4X65 L;  1A2T A;  3CXC A;  5C0X G;  1BCP C;  2XRS D;  2KBN A;  3RZO B;  4R4T A;  4X64 Q;  1K9M C;  2VUM B;  3H0G G;  5ISR A;  1VQG A;  1TWG H;  4DV5 Q;  1JE5 A;  5IGD A;  2RKS A;  2DY7 A;  2ICE C;  4Q0F A;  1HH2 P;  1WTH A;  1N33 Q; 
#chains in the Genus database with same CATH homology
 4FXK C;  1G6Z A;  2L5T A;  4DGZ A;  1SFO B;  1LO5 D;  2DNC A;  1PTO D;  3M85 A;  4FVM A;  5KRU A;  2A6H D;  5LHY 1;  1EY7 A;  5ELF A;  5F2D A;  1TT2 A;  3FDT A;  1PFN A;  1MBY A;  1GUT A;  5K36 G;  2EJF C;  1GHJ A;  4NKL A;  1S5B D;  5C4J B;  4PQX A;  3X3N A;  1R4P B;  4ILW A;  4EQO A;  4CGY B;  4J1M A;  3BVM A;  4N9P A;  3OSO A;  1E2Z A;  1J9O A;  4ZUJ A;  4QIW B;  1PTO C;  4S3S A;  3LNN A;  4B9W A;  1TU2 B;  3MA2 B;  3ERQ A;  2KCC A;  1TS3 A;  3BG3 A;  3OMG A;  5M3F B;  4PMB A;  2NB0 A;  3NQT A;  1WCM B;  4K5X A;  4DK0 A;  1F2L A;  2JSO A;  3DMU A;  1WVL A;  3R93 A;  3GP7 A;  1M4V A;  3HOW B;  4WOR A;  1MI2 A;  2WKD A;  2SNM A;  2AUJ D;  5CV5 A;  5KNC A;  2PMZ B;  1CT1 D;  2H4O A;  2NYZ D;  3GTM B;  1SMY C;  4RHR A;  3GTG B;  2PCF B;  4HCS A;  5I6Y A;  3K5N A;  1C4Q A;  2XN9 C;  1EY9 A;  2L1B A;  2SOB A;  3NTH A;  4FF1 A;  4IFD J;  2J0T D;  4C3H B;  4QB4 A;  1PRT C;  3QOL A;  4C3J B;  1CHP D;  2YU9 B;  1DZ1 A;  1O80 A;  4OL7 A;  2LFN A;  2NUC A;  4XYQ A;  1ILP A;  1XWE A;  5CV6 A;  2D5D A;  2B2W C;  1QNU A;  4RGM A;  1FR3 A;  1WTO A;  3NPP A;  1SYG A;  1IL8 A;  3I73 A;  3FKI B;  1B1Z A;  2EY6 A;  1EY0 A;  1W6K A;  3S17 B;  4FYD A;  4ZAI A;  5CBE E;  2TSS A;  3KLR A;  3SR1 A;  1U4M A;  2OF1 A;  2K5W A;  5M9O A;  1LTI D;  2PZT A;  3OWF A;  3G7L A;  1V1O A;  3K6O A;  4DFA A;  2F03 A;  3VYR A;  1G2S A;  3CQZ B;  3J7A V;  1ENF A;  3S16 B;  4TSS A;  4EQP A;  1TS4 A;  3S9W A;  2HDL A;  4DN4 M;  2BE5 D;  2WKC A;  2F0E A;  1STH A;  3J80 E;  1Z7T A;  2NVT B;  2PNR C;  1HTL D;  1S5E D;  1SEB D;  5C0X I;  4AYB B;  1PZK D;  2A73 B;  2F3W A;  1LTG D;  2L0C A;  1EIG A;  4ULL A;  1GUS A;  3IFD A;  2MPM A;  3A8K E;  5KIX A;  2NWG A;  4X3U A;  2R92 B;  1IHZ A;  3HZX A;  3QIA A;  1HXY D;  4Z9C B;  2QKI C;  1GHK A;  3U9S A;  3BYY B;  1SBB B;  1AFP A;  2K7V A;  2RA4 A;  3CRL C;  2NN6 H;  3SXH A;  3X3M A;  3BYT B;  1LTA D;  5BN3 A;  4IUQ A;  1CZW A;  2B2T A;  3K59 A;  1DOM A;  2BOS A;  1B2T A;  3K5O A;  2K03 A;  3HG9 A;  5IGE A;  4HN7 A;  2K5Q A;  5ELE A;  2EYF A;  4KD3 A;  2IX3 A;  2F0Q A;  3VA7 A;  4WFN 3;  1A3V A;  5E1F A;  1FNW A;  2EYH A;  2FHT A;  3H0G B;  3MTS A;  1DON A;  4KY6 A;  3C2P A;  1EWC A;  1L0X B;  3BS1 A;  4A3K B;  4A3B B;  3R3O A;  1KLG D;  2Z8L A;  4TRD A;  4RCN A;  5ELD A;  2B2V C;  3RD4 A;  1RJT A;  1KNE A;  1X3Q A;  2RBM A;  1BCP B;  1IKM A;  1HFN A;  4K2K A;  1O78 A;  3ONA B;  2XVS A;  4F87 A;  2B2U A;  5K5P A;  2QCP X;  1HPC A;  4WJW A;  1PTO H;  3FEW X;  3CHB D;  2QF7 A;  3BDL A;  2AQ1 B;  4KV6 A;  1Q1B A;  4JK1 C;  2KQ3 A;  3S15 B;  1I4X A;  4RAU C;  4IUP A;  1LTB D;  4KD4 A;  3DWA A;  4K5W A;  5T1I A;  1SYB A;  3KBX A;  1B4O A;  1XTC D;  2NZ1 D;  3SHL A;  2B8F A;  1TS5 A;  4ZKB B;  4C2M B;  2QIL A;  5DM7 3;  5HGT A;  4OHJ A;  1LV9 A;  3S1Q B;  5EQ0 A;  4IUT A;  2RVL A;  4G7H C;  3PMF A;  4H44 C;  5JPM C;  1R4Q B;  1LAB A;  5C4Z A;  3GTQ B;  4KTA A;  2PYK A;  1MD2 D;  5EKI A;  4N9T A;  4A3J B;  1V8Q A;  4PMW A;  1E2V A;  3NBH A;  3GV6 A;  4FO2 A;  1WTV A;  3T53 B;  1LT5 D;  5A35 A;  2VB2 X;  1EZ6 A;  1XXG A;  2B2Y C;  2PO4 A;  3SVM A;  3NE5 B;  3TP8 A;  2F0K A;  2KCN A;  3M7G A;  3GTO B;  1BCP D;  3G6J B;  5I4D A;  1HQR D;  3C1E A;  3DXJ C;  4IUV A;  4TKO B;  5FKA C;  1YNN C;  1KNA A;  1A6X A;  3KUP A;  1D1I A;  3KLS A;  2Z1C A;  2CVR A;  3DEP A;  2ZXR A;  2K04 A;  1OXT A;  4DXG A;  2EVB A;  4A3E B;  2A68 D;  3M4Y A;  4KK7 A;  2K01 A;  3K5M A;  4IFD I;  5EJW A;  4K6D A;  4R8N A;  2XSC A;  3VR5 A;  1TY0 A;  3IKJ A;  1AN8 A;  1Y8O B;  3S1M B;  2A6E D;  3EJI A;  1CA6 A;  1F9Q A;  1I3Q B;  2H1E A;  4DAY A;  5EPJ A;  2K5D A;  2F0P A;  1AP0 A;  5C5M A;  3PUW A;  3MXN A;  4QMG A;  4OO1 G;  2FFK B;  5M5Y B;  4CJ2 C;  2EOT A;  2K1B A;  4RA8 A;  4Y7N B;  4C3I G;  3MC0 B;  1DJR D;  1B50 A;  1HFG A;  4G7O C;  3J81 L;  2VXW A;  3NTK A;  5EPL A;  2NN6 I;  3V05 A;  5JEA H;  1TY2 A;  1RTN A;  5KYI A;  1EYD A;  4C3J G;  1ICW A;  1EIH A;  3FPU B;  1FGB D;  5DEH A;  2E2D C;  3NXW A;  2XRQ D;  2B2V A;  2RDF A;  5COY A;  3P1H A;  4U67 3;  3HOY B;  4KJO A;  3D3R A;  4K14 A;  5EKL A;  2AQ2 B;  3JAM E;  1MSG A;  1KTK A;  4UDU C;  4PMC A;  2D9U A;  1STY A;  4K6L A;  1YNJ C;  1FD7 D;  2HQE A;  4DAV A;  1OXU A;  5FLX L;  4RH6 A;  3DM1 A;  1JOK A;  1S5F D;  1BXT A;  1CK1 A;  1I4P A;  4RCO A;  3K57 A;  1A3U A;  3ND9 A;  4CBV A;  5CV7 A;  4FF4 A;  3PUZ A;  3M7N A;  2A5H A;  2IPK D;  1B44 D;  4HSV A;  2I46 A;  4F7X A;  3U9O A;  5E4W C;  5C3W A;  1H9K A;  3Q24 A;  3GTJ B;  2L55 A;  2PZU A;  5CV8 A;  4BA2 I;  1Q90 A;  2X6L A;  5LL6 S;  3BVZ A;  1VDZ A;  4XTC S;  2FMM A;  4DF7 A;  3AB9 A;  5CYU A;  2AWN A;  3K0Y A;  3MXU A;  1QCB D;  1SMY D;  4XYO A;  2ZXO A;  4HAE A;  4A93 B;  5IT9 E;  3DEO A;  2SNS A;  3PO3 B;  3MAQ A;  5C0X J;  4R8I A;  4ZLT F;  2KEE A;  2OXP A;  3FVQ A;  2F0L A;  4NDX A;  1V43 A;  1UUP A;  3PUV A;  2MUY A;  1D1K A;  4RKB A;  3GQB A;  4KMU C;  5FO8 B;  5IGG A;  4XT3 B;  3PIP 3;  1GUO A;  2L11 A;  4G57 A;  2RQX A;  4IZ8 A;  2Q8T A;  1EWH A;  2HCI A;  2WB1 B;  1V1P B;  5KNB A;  1GXD C;  3R8B A;  5M5W B;  1WTW A;  1PFM A;  4DA2 A;  5JEA J;  1PFB A;  4ZUI A;  4DXF A;  2E74 C;  4P2C B;  2B63 B;  4DNT B;  1KAB A;  2CW0 C;  5JOB A;  1IYV A;  3S1R B;  4C3H G;  2C9O A;  1UNS A;  5CR3 A;  3N52 A;  3HOZ B;  2A69 C;  2B2W A;  4L63 B;  3S2D B;  1HRJ A;  2KHS A;  1S5C D;  2Z4I A;  3OMC A;  3R2T A;  1CFM A;  4XQQ A;  1OO9 B;  2CW0 D;  1A15 A;  2EJM A;  1WTP A;  3M3Y B;  1G2T A;  1D6E C;  3OOC A;  3NTI A;  1JOQ A;  1QJO A;  3QG1 A;  1NR2 A;  1STN A;  5JVH 3;  5J39 A;  1ESF A;  1RD9 D;  4KY7 A;  1PRT F;  4A3G B;  1PZJ D;  4G7Z C;  5JAV A;  5C44 B;  3S14 B;  1Y69 U;  1V1P A;  1XX8 A;  1IKL A;  1PTO B;  3WDN A;  3HOX B;  2HUG A;  4ZQ3 A;  1SYE A;  3OPO A;  1JB3 A;  3PO2 B;  5EKK A;  3SK4 A;  1D5X C;  1F2M A;  2EPB A;  1BBX C;  5A2Q E;  3A56 A;  5BN4 A;  4DAP A;  2JP1 A;  2JA7 B;  4F8M A;  1EYC A;  4ID6 A;  4HTH A;  4OIJ A;  3KK7 A;  4BWG B;  1Q12 A;  3MEH A;  2D62 A;  3VR6 A;  4O1N A;  4RFB A;  1ZKO A;  2EDG A;  1PMR A;  3QB3 A;  3H94 A;  3NK9 A;  1K8M A;  1LT4 D;  2MHV A;  2J4X A;  2WII B;  1B3A A;  1ZXT A;  4H13 C;  4H7B A;  4RGO S;  3I4N B;  4O42 A;  1HQM C;  1Y8N B;  3T51 B;  1EEF D;  2R61 A;  4DK1 A;  3WOE A;  2B2T C;  1TII D;  1Z6H A;  1F9S A;  1IYU A;  2WAQ B;  4BA1 I;  3OIQ A;  1X3P A;  5C0X H;  1DOL A;  4KKU A;  3H91 A;  1SND A;  5I2Y A;  3L3O C;  1DD2 A;  5I9P A;  3V96 A;  1WD1 A;  3HOU B;  1BDO A;  3OHX C;  2KVM A;  3I90 A;  4ZRZ A;  2A69 D;  5FK9 C;  1QE6 A;  1SAP A;  2AWO A;  1L0Y B;  5FO7 B;  1JWU D;  4KN4 C;  2EY1 A;  4IFD H;  1WD0 A;  4CHT B;  4MIU A;  3TME A;  3PUX A;  4OGQ C;  3I72 A;  2AQ3 B;  3CU7 A;  4DNR B;  1Q8I A;  4ZK9 B;  4KN7 C;  2L4N A;  3NBI A;  2NVY B;  1ZEQ X;  1KDB A;  2F0M A;  2XNA C;  1EU4 A;  1TWA B;  1AZP A;  2L12 A;  3T13 A;  1E2W A;  4E6I A;  1M8A A;  1B53 A;  5I6W A;  3D4W A;  3O13 A;  1E0B A;  2DN8 A;  3I91 A;  2XWB B;  4HED A;  1SYF A;  1TQO A;  1ML0 D;  1I4G A;  1PZI D;  1EOT A;  4HSP A;  2Y0S B;  2JE6 I;  2NVX B;  3H6M A;  3FPP A;  5D14 A;  2SEB D;  5KND A;  2EYP A;  4X3T A;  2EE1 A;  3D8G A;  2JYO A;  1R9T B;  4KKT A;  3VR2 A;  1LAC A;  3BZD B;  1CI3 M;  4FXG C;  1JWM D;  4ZKC B;  4XIG S;  1D5Z C;  5T1G A;  1IW7 C;  2J7Z A;  4BY7 B;  5G3L D;  3W3A A;  1JQY D;  1SE4 A;  1PXU A;  1VF5 C;  2HDM A;  2M2L A;  1TR5 A;  3D31 A;  3RLF A;  4HR7 B;  1OXX K;  5BN5 A;  3A55 A;  1STA A;  1LLR D;  2YYZ A;  1EQV A;  1EU3 A;  4BY1 B;  2SDF A;  1QB5 D;  1VMC A;  3HRZ C;  2EYO A;  2E2H B;  4OO1 H;  1STB A;  4ME5 A;  4PNY A;  4H0L C;  4OIK A;  5TSS A;  2O4X A;  2KEC A;  3MVV A;  2AUK A;  3EA6 A;  1SNM A;  3L9A X;  1F9R A;  4RGT A;  1HHV A;  2XIW A;  5CV4 A;  3LX0 A;  2JXM B;  4XQN A;  2F0V A;  3EFX D;  2IX0 A;  2F0N A;  2F0U A;  2A6E C;  3NUC A;  2BE5 C;  1U4L A;  1SNP A;  3VYU A;  4KKS A;  1PRT D;  3OWE B;  2K6A A;  3J7Y W;  2PZW A;  2ENB A;  1QG7 A;  5CC4 A;  1PYW D;  1WTR A;  2EXZ A;  2RSO A;  3DWQ A;  5C3E B;  3NWT A;  3D6C A;  5K36 H;  5FO9 B;  2BA0 A;  3S2H B;  1T5X D;  1EY4 A;  5I2X A;  3P7J A;  1GUW A;  2GA4 B;  1TWG B;  2KED A;  2EYL A;  5EGT A;  3M4O B;  1Y1V B;  3PIO 3;  1DXM A;  2E2I B;  4A3D B;  1FNV A;  1SE2 A;  1YNN D;  4C3I B;  1CZG A;  3S1N B;  5C4H A;  3PV0 A;  4RKL A;  3AU7 A;  1T5E A;  3FMC A;  1EEI D;  1STE A;  5ELC A;  1OXV A;  1D2B A;  3QJY A;  4K8J A;  2G9D A;  1EZ8 A;  1SYC A;  2F0O A;  3MZ5 A;  5I9O A;  3Q22 A;  2NTT A;  4CKE A;  4FP5 D;  2M00 A;  1U9R A;  1Y1W B;  1JC7 A;  3GO5 A;  1ILQ A;  3C46 A;  4M1U B;  5M3M B;  1PRT B;  2OEO A;  1RF2 D;  1WTX A;  3UI2 A;  2MP1 A;  2JA5 B;  4XT1 B;  1NSN S;  5DAU A;  4FNF A;  3F2U A;  5EBC A;  1PDQ A;  1G29 1;  3A8J E;  1NCV A;  1G91 A;  1NR4 A;  3J80 L;  5IGF A;  3OW7 A;  5IOC A;  4R9W A;  4TQU S;  3NP8 A;  4LK1 C;  2PW5 A;  1SYD A;  5C5L A;  3SK6 A;  5JEA G;  3HGB A;  4XQJ A;  3J81 E;  1EY6 A;  2IJ0 A;  1BR9 A;  4IN3 A;  1RDP D;  4EGV A;  5J1Z A;  2N88 A;  1VMP A;  2O2L D;  3HEJ A;  2NTS A;  1G8Z D;  1JE4 A;  5HUR A;  2L9H A;  1TS2 A;  3GTK B;  1VCI A;  3HOV B;  3FRP B;  4JBW A;  5A2Q L;  4RHS A;  4NMZ A;  5D65 A;  3GV3 A;  4C56 C;  1U4R A;  2KA7 A;  4C1N K;  3ZYY X;  1PTO F;  5IGB A;  1PLF A;  1EY8 A;  1O7Z A;  1SNC A;  2F3V A;  2ZT9 C;  1SDF A;  4IAL A;  4CJ1 B;  2NVQ B;  1ESR A;  4KHV A;  3ND8 A;  1KDC A;  3QOJ A;  4L8J A;  4FF3 A;  1TWH B;  2V4D A;  4X3S A;  1HA6 A;  3R2I A;  3AMU A;  4IFD G;  5C6A A;  2BDN A;  4CJ0 B;  2JEA I;  5KGU A;  1EQT A;  1KDA A;  1SSO A;  2A74 C;  3TDQ A;  2QDB A;  1EL0 A;  2K32 A;  3MFG A;  1HA5 A;  1A3T A;  1SNQ A;  5KYL A;  2DNE A;  1O7Y A;  1KLU D;  2PQE A;  2OT2 A;  3C1F A;  4KY5 A;  2K28 A;  1QNK A;  1CQV A;  2C5C A;  5C4X B;  3E0J A;  5COR A;  1SJE D;  3K58 A;  5JVG 3;  1DM0 B;  2DY8 A;  1O7L A;  3DWP A;  1TWC B;  3CKI B;  3KF8 A;  2MGS A;  4K2L A;  4J6H A;  4M8A A;  4NP5 A;  4EQN A;  5LL6 X;  3VR3 A;  2RSN A;  3I3C A;  3NQI A;  4A3I B;  4A3F B;  1JWS D;  4BBR B;  4Q5V A;  2EYM A;  3E5S A;  5CMD A;  3P20 A;  3BDO A;  3P75 A;  4KI0 A;  5IGC A;  2IWH A;  3HS0 C;  2R3Z A;  5D3D A;  2Z4H A;  3IAY A;  3NWS A;  2XWJ B;  5E3F A;  1NUC A;  3T16 A;  5IOD A;  1B9M A;  2D2C C;  2VB3 X;  1C8C A;  3GTP B;  3SDZ A;  2BA1 A;  1ENA A;  4V19 0;  2F0T A;  4KJN A;  2F0I A;  2WV6 D;  1H9S B;  3WOF A;  1TWF B;  2F0H A;  2IW3 A;  4ODG A;  5IT9 L;  1RKN A;  2IT1 A;  1ROD A;  5EBD A;  4I7Z C;  3BDC A;  2F0G A;  1EYA A;  3Q0A A;  1F2Y A;  2KJX A;  3MFY A;  2ZXP A;  1BUV T;  1K83 B;  1HCZ A;  3KBG A;  1VF7 A;  2RDH A;  1D5M C;  4BS9 A;  3QWN A;  1CQF A;  1BF4 A;  3A8I E;  4HCE A;  1S4Z A;  1IW7 D;  4K5V A;  2R7Z B;  4NW2 A;  4OO1 I;  1SE3 A;  2K05 A;  2A68 C;  3V2T A;  1ZYR D;  2X6G A;  1LT3 D;  2WP8 J;  1JIC A;  3SE0 A;  3TN2 A;  1JOO A;  1NAP A;  4F88 A;  5CV9 A;  4FXD A;  4QUC A;  2K33 A;  3TZU A;  2R6G A;  3MXP A;  3L7Z C;  5DM6 3;  4RWS C;  4QF4 A;  3VYS A;  3ERO A;  3I70 A;  1FYC A;  4PV1 C;  5ELB A;  1II3 A;  3NSW A;  5D3I B;  1F77 A;  3VYT A;  2B39 A;  1EFI D;  4IUN A;  1J8I A;  3IFT A;  3H3V C;  2VNU D;  2NN6 G;  1BOS A;  1A2U A;  2NBF A;  2CHB D;  4V0B A;  5CGK A;  3VR4 A;  3EQL C;  4ZYS A;  2RDG A;  5FOB B;  1GUG A;  3I4L A;  3CRK C;  1UAP A;  3TP7 A;  3D4R A;  1S5D D;  3SK8 A;  1SJH D;  4IQZ A;  2Q8I B;  1BO0 A;  4ABN A;  4CKC A;  1QOH A;  2FMC A;  1Q3L A;  2B8G A;  1Z47 A;  3J7A F;  1GUN A;  1U4P A;  1RTO A;  1SXT A;  3SEB A;  1GJX A;  1BQQ T;  3VA5 A;  3W2D A;  1ZYR C;  3HP3 A;  1WTQ A;  2ICI A;  2IL8 A;  1STG A;  1LTS D;  3Q23 A;  2FIN B;  4HMI A;  3TBI B;  3I8Z A;  4B08 A;  3EVQ A;  1I4H A;  3I4M B;  4HMJ A;  1JCK B;  1KAA A;  1SNO A;  3MWY W;  1TVX A;  3TSS A;  4DU9 A;  1HUM A;  1I4R A;  3RZD B;  2FJ2 A;  1H9M A;  3GD7 A;  3C3L A;  2PW7 A;  2LY7 A;  4YIJ A;  5FLX E;  2F0F A;  4X3K A;  2F0S A;  2EJG C;  5J22 A;  3PUY A;  1H9J A;  5IIF A;  1ET9 A;  1UEA B;  1LTT D;  4RGN A;  1CA5 A;  1DCZ A;  3TZD A;  2F1M A;  1I4Q A;  2E76 C;  3SK5 A;  1OXS C;  5AFW A;  2E75 C;  3TP5 A;  4G4K A;  3HKZ B;  4KHZ A;  5EPK A;  4A3M B;  4XXE A;  1HTP A;  4L6T B;  1ET6 A;  3BVG A;  4MHE A;  1ENC A;  2WAC A;  2A6H C;  2HCC A;  1JR0 D;  3DHQ A;  2O5J C;  3A7L A;  1MSH A;  1CM9 A;  2EY2 A;  1Y8P B;  4BBS B;  5E4X A;  1I6V C;  2EZV A;  3D4D A;  1I6H B;  2Q8R E;  2WIN B;  2JA6 B;  3NHH A;  3DUZ A;  1I50 B;  2LS0 1;  3D6W A;  3KLS X;  1H9S A;  3T56 B;  4LJZ C;  1B9N A;  1YNJ D;  2IX1 A;  3RUZ A;  4XDX A;  5NUC A;  4IUR A;  1RCV D;  1EY5 A;  1LTR D;  1AEX A;  2CQA A;  1RHP A;  2KOL A;  4QCL A;  2KUM A;  3A54 A;  2BDO A;  1FNU A;  4IUU A;  2B2U C;  5DNF A;  5JPN C;  2BCO A;  4CKB A;  4GZY C;  1AZQ A;  1QIL A;  1MGS A;  2I07 B;  2F0J A;  4K8I A;  4EVO A;  1JOR A;  2EY5 A;  2ID0 A;  4C1N I;  3JAM L;  3K5L A;  4MN3 A;  2F0W A;  2LMC B;  3Q6S A;  2F0D A;  3T4A C;  3QO2 A;  5G3L F;  1F9P A;  4WRD A;  2O5I C;  5M5X B;  2JEB I;  2MJ8 A;  2LKV A;  1H9R A;  5KEE A;  2G9H D;  1C48 A;  2M9V A;  3RMH A;  1XYI A;  1AW7 A;  2R93 B;  2EYJ A;  3E6Z X;  4U68 A;  3IL8 A;  4LMQ D;  3GTL B;  2JA8 B;  1F2Z A;  2N55 A;  3ITP A;  3TP6 A;  1K8O A;  2QEJ C;  2TMP A;  1HUN A;  1CHQ D;  3OIP A;  4FF2 A;  1QWY A;  4UAI A;  4J8Q A;  3K7A B;  3LWU A;  1GOZ A;  4LAA A;  1BNZ A;  3A7A B;  2B2Y A;  2F4I A;  1LT6 D;  5C3X A;  1ONL A;  1Q1E A;  2E2J B;  3MHB A;  5JJZ A;  1DYQ A;  1CTM A;  2X69 A;  3N6R A;  5CBA E;  1W6J A;  1DOK A;  2PPB C;  3MXG A;  1BCP F;  4QUF A;  1TKW B;  3LWE A;  3URY A;  4B9X A;  1X32 A;  4I65 A;  3H09 A;  1A2T A;  5C0X G;  1BCP C;  2XRS D;  3RZO B;  2VUM B;  5ISR A;  5IGD A;  2RKS A;  2DY7 A;  2ICE C;  4Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...