3U9PH

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
184
Chain Sequence
EVKLQESLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGQGLEWMGGIWGDGRTDYNSALKSRLSISRDTSKSQVFLKMNSTDDTAIYFCTRCRRDSSYVVDAWGQGASVTVSSAKTTPKLVYPLAPVTLGCLVKGYFPEPVTVTWNSHTFPAVLQSGLYTLTSSVTVTCNVAHPASSTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Neutrophil gelatinase-associated lipocalin
total genus 28
structure length 184
sequence length 213
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH01
1FZJA 3T0BA 3QDGB 1M7IA 3GDBA 2YMXL 4B7LA 3HRZB 2FEDD 3CNKA 4UUJB 2AGJL 4ZAKC 1FORL 2Z93B 4HUNB 1B0RB 5T1DL 1ETZA 3IXTA 4LEOA 3KLHC 1NJ9B 4NKDB 2A83B 2X4QA 4ENED 4EDXB 2W0PA 4KH2A 4YFEA 4JN1H 4I18B 4KKBC 3QUYC 3GIVA 4EOWL 4K71B 4NM8H 4NQCE 2ZNWA 4F7TB 4F9LA 4IRSD 2WUBL 3IJHB 4K3EL 4QT5B 4KVNL 5FYLL 1P53A 4GKNA 3OAYH 3IETA 3BT2H 1KIPB 1QBBA 3GK8L 5JIKA 1H3XA 4LOUC 4NRZB 3KPRA 4I9WE 4J8RA 4OLWL 3QNXB 3A6OA 3ARDC 3MRIA 4JY5H 4Y2OA 5IJKA 4XHQA 5I30H 3O3EB 1P9MC 4KMTL 3VFMA 4D8PB 2NY5C 2XWBA 3OWEA 2GY5A 1KEMH 2NY0C 1MFEL 4X7SL 4PRIE 4RZCB 1C1EH 1JPSH 3W9EB 2GT9A 5IUSA 4IRZL 3BKJH 2Q8BL 3UZQA 5HYSG 4EN3C 1N0XL 3O81A 1XGTB 4HC1A 3QULA 1KN2L 3CPLA 5T3ZH 3MRPB 2DMKA 3E6HB 4ELMA 4W68A 2BNRB 1INDL 4CMMB 1OSZA 3MRKB 1MRFH 4QGYA 4JHZA 5FUZL 4G5ZH 4YNYA 3AM8C 1RULH 4YK4C 2DDQL 1U8PA 1XF5A 1WWAX 1XR9B 4MCZB 4X7DC 1R3JB 2GFBB 3AROA 5DFTA 3FCTB 1BQLL 1G6VK 5ESVA 2XZZA 2YA0A 4WFED 3RWIB 5A3IC 1HHJA 3VJ6B 3EYFA 1BFOB 1NCDH 1AD9B 1V3JA 3VXRA 5I16A 5E94B 2F53E 4M8QA 2E9JA 4OKVA 3B2VH 4P59L 4PJAB 4KROB 2CJUH 3NCJL 2W65B 4PYGA 5F9DC 1YEHL 1A6UH 1XGUB 1XF5B 4E41E 1CI5A 2YD5A 5E9DB 1HK6A 2P7TA 4JPIB 5AG8A 4NPYB 3KYOA 1F45A 3C8KB 4ALAL 1WAAF 2JKXA 5DC4B 3ILPA 2OZ4H 5E2UH 1HIML 3JV0A 3MLWL 1X6LA 1Q9LB 4JO1L 5E0QA 1NBVL 3VWKA 4KRPD 4RX4A 4OCXL 1FL3B 4HBCL 1JBJA 4RX4D 3R4DA 5F9AC 2HLAB 1L7TL 3K4DA 4F58H 4CBPA 4QWWD 5AZEL 4ZO8A 2OQJA 3AU1A 4KY1L 5GS1A 4G8GD 2X1OA 4KV5E 4P57A 2PO6D 4PJ9B 4PJXA 3BPNC 4H1LA 4XBEH 2XZAL 3OB0H 4XRCA 4DW2H 5LAXB 5FOJA 3S36L 4KTEH 3AY4A 5D7KE 1RZ7H 3MRQB 1VPOL 3NTCL 3KHOA 4OD3L 3MGTA 1LE5B 3G5VA 2KZWA 2NW2B 3O2VH 4MB3A 5E2TH 3PWLA 1U6AH 4LCWA 1JWMA 2AJXH 3WXWL 2X5PA 4D0BB 2ZCKL 1NEZB 3UJJL 1AXSB 1S9XA 2V9TA 2VH5L 2VDPH 3T65A 4F7EA 4KMTH 5E6IB 4GKOA 2WBJA 4PJBE 2ICES 2QQKH 5H94B 1MLBA 4QGTA 4OZGF 1G1CA 4UUJA 2GSIA 3RY5A 3WLBA 2DI7A 5E6ZA 3QFJE 1JWSB 1FL6A 2Q8BH 1I8IA 2FL5A 4M00A 4X6CB 2ATPB 1FFRA 5T3ZL 4HUWA 3P4NA 2DIJA 2X1WL 2YPVH 4HJGA 4Q2ZA 5BCAA 3MRDB 1HXMB 2HVKB 4G9FE 5JXEC 3IDMA 5IB2B 5IB3A 4C55A 5IGXH 4YUEH 3JV6B 4FQCH 5CIPB 1EGJH 3RWJB 1QVOB 3OPZL 1WV7T 5B38B 2KZ1B 1ZT7B 3JUZA 4L3ED 1F3JB 3HR5A 1KCRH 3R8BB 3C2AL 5FUCE 4Y16D 2NY1C 3RUGF 4DFIA 1K3ZA 3HZYB 3U0WL 3F7VA 4LGSB 5MEOA 3MZGB 4UV7L 4ZFOA 2YRZA 5GJTL 3QH3A 2AK1H 4GBXB 3HAEB 5EU6B 1SM3L 1PG7W 1CN4A 3UAJC 5I75C 1TVHA 4H20L 1ADQL 5DEGA 4LP4A 4NNYA 3HN3A 4BQ9A 1UXSB 5HI5D 3SQBA 3WS3A 2DBLL 4JFOA 1NGPL 2NY6C 1UCBL 3GIVB 3BO8A 5L8KB 4D9RD 4ZUTA 3DX7A 4KQ3L 3U36B 5CFHA 5I19L 1S7WA 2HTLD 2XI9A 2LTQB 5GGTH 4NKDA 1MFNA 2J8HA 2ZP0T 1I7ZA 2H2SC 1N5YH 1G6RH 1IGCH 1MCOH 1X5KA 2X70A 4I2XB 5D1ZC 4A6YL 4JO4H 1KENH 2DQHH 2P49B 3MLUH 5GSRB 2G60L 2ITCB 4U05A 2I07B 2GJ6B 4KVCH 4HEME 4LBEA 1JNHA 4L3AA 1NFIA 5SWQA 2B0SH 1D3CA 4GUPA 2DQFB 5D5MA 1ZGLM 1JGDB 2ICCA 1CFVH 4YAQB 1KEGL 2WK2A 2CRMA 3TH4T 5HYFA 4IOFD 1AO7D 1T66C 2OXHA 5D2NA 2V2TA 1KULA 2UVFA 2YWYA 1PYWB 2ZG1A 3QHZL 1WBZB 5I66B 3H2WA 2E9BA 5JHDA 1T1YB 2DB8A 4JANA 3SGEH 3VXUD 3UJTH 4QT5A 4NIKB 5JHLL 1DLHB 4IHOA 4MAUL 4BH8A 1JRHL 3MX0A 5DYOB 1NAMB 3DXAE 1RUQH 3JWDC 1MREL 1UH4A 1VFAB 1ZAGA 1REIA 2QQLH 4J3WA 4XZUA 4E5XA 1FNGA 1T03H 5JQ6H 3OXSA 5FKPA 1CDGA 2R4SH 4JVUA 4OIAA 1KPVB 4MA1C 4IRJA 1U58A 5C0CA 5GGUA 1I1YB 4Q0XH 5E4EB 3GJFK 1RHHB 2VRAA 5HD8C 2VL5A 3ARFC 1AJ7H 1V7MH 2EC9U 5FO8B 5LQBL 4NQXB 4XNYL 4ZUUB 2E7LA 5DD6B 4G8EA 1FQ9C 1OAKL 3BH9B 3R8QA 1IC7H 4TTDD 4Z7NE 2VR4A 4YK4B 1UYWL 1ZT4A 1NUNB 1PG7X 5TDNB 4H0IA 3PWPA 2PW1A 3RTQD 4OM0H 5DT1L 2NR6D 3BGMB 3F5WA 1NCBL 2X89D 5C08A 2IGFL 4XVSH 4UAOC 5GGQL 4MJ6B 4QLRA 2B1HL 3RVWD 3QJFA 1LK2B 2QBWA 2VJXA 3HNTH 4OGXL 2Z31C 4L8SA 5CMAB 3BMWA 3PP4L 3MNVA 2C3WA 2OTUB 2O93L 3T3PE 4P5TA 3QFDB 3UYRH 1UB6B 3RKPA 3LKNB 5FFLA 1O5DT 2R0ZH 1IGYB 4LRNH 3D2UA 4HLJA 1MI5D 3TBVB 3ROOA 5CJ8A 4PTUB 4JEGB 4BQ8A 3WS3B 3MGOB 5E6IA 1EIBA 3L9RA 4KAQH 4XGZA 3H9SB 1EEZB 3FJTA 4JFEE 3RL1B 5D5MF 5FKAA 1KTLA 4QRPA 2XQYK 1PVHA 1SYVA 4OIBA 5EPMA 2GCYA 4FQQA 4XI5D 4HQQH 4PJBF 4HKJB 5HTSA 1U58B 3AB0B 5BOZG 1MFCH 1T1XB 1U3HD 2Y72A 2W9EL 3LOWA 2Y1VA 3MRFA 3OQ3B 1DDHB 1R3LB 4K94L 2ZG3A 2ZCHL 1AD0B 4H0GA 3QQ3B 1QVOA 4X9HA 5CIPA 4YHOL 1MAJA 1GAFL 3RVVC 5IMOB 4ERSL 4YBQD 3K8MA 2Y5EA 2MTPA 5JUEL 3CIQA 5E5UB 4PG9B 1H0DB 1QG3A 5JZ7C 4P3DA 5CILH 3F65A 1P7QA 5D71L 4DGVH 3SBWC 1RVFH 2AXHA 1Q0XH 3RHWK 5EZLB 1JNNH 3CZJA 1FFNB 2DLFL 4MDIA 5SWZA 5JW5B 4J1UB 1AGDA 5EZOL 5KSBE 2CR6A 2EIEA 2DQGH 5HGBA 5DI8A 5AZ2L 2GAZB 5IB5B 1AQKH 1HZHH 2FYYB 5DJ0B 1YNLH 2Q7YA 1RZIB 2WP3T 2RBLA 3NFNA 5T33L 1R0AL 4WY7L 4MXWH 4N1EA 1BQHG 1NBYA 3KR3L 4ODHL 2ED8A 1JGUL 3HLAB 1JV5A 2IEPA 4LRIA 5SWQB 2BVOB 5AZEH 1MCDA 1TXKA 1ZGLB 4HT1L 3MLVL 5BZWB 3LKSB 5ICYA 4JCMA 1R24B 3CLFL 3D0LB 1UG9A 1MCRA 5C07D 3ZYIA 3MYJB 6CGTA 3G08A 5FF6B 1JHLL 4LCWE 3A6CL 2QHRH 1IMHC 1MCQA 2E7MA 3UAJD 3LRHA 1JZ5A 3BKYL 4RMWA 1DQDL 5MEQA 2P5EE 4BKLA 4CVUA 2BSTA 2AJXL 4EI6A 4S11A 5D7LB 3EZ8A 4ZYKB 3V6FA 4JFFD 3TZVC 4OT1H 2IMMA 5E6YA 5GS3A 4Y16C 2COQA 3L3DA 5FDYA 3RAJH 4DQOL 1KSRA 4G6KH 2HRPL 1JHTA 1FFOB 1OARH 3QDJE 4BZ1L 2W60B 5MENA 3DRQA 5GZOC 3O0RL 4L3CA 1S7TB 4WI2A 5AYQA 3ZKSD 3HAEA 4M93B 4YDLB 4PRBA 4R9HA 1JFQL 3KYKL 1SEQL 4H1LH 3C2AH 2E7LC 3JTSA 3X3FL 1P9MA 3FFCD 3SE4C 4CVXB 1ZS8A 1NFDA 4Y16A 4GKZB 4X99A 3DO7B 5KSAB 1C16B 2H3NA 4OKDA 2DQCH 4UZGA 4HS6B 3B2VL 4P59H 3BZFA 3QUZC 5LGHH 3BPCB 1I7UB 2MWCA 5CZKA 4WRLA 1K6QH 1FLTX 1LEGB 1NLBH 2VIRB 3KPSD 3L3KA 1VACA 4KHTH 3WKNA 4N1HB 3NFPB 3NZ8A 2UY7A 1WFNA 4MA8L 3VJ6A 5LGKA 4M1DL 3FQNB 3HAEH 3CFJA 4RNRB 5BV7H 2G5RA 1AQDB 3JV4A 5CJ5A 3QDJD 2FECL 3WFDL 4X6CA 4NCC2 3ARRA 1OTTC 4BKLB 5GRXG 2R1WA 4LPYA 3MRBB 3HE7B 4LVEA 4ODUB 4X4ZA 1AC0A 2BX5A 4IRJB 2HMID 1MLBB 4KV5F 4ELMF 5EOTA 5A1AA 2AKRB 2EEBA 1FJ1A 5FV1L 5JW3L 5ID0A 2QADD 3PQYB 2EDEA 3OJVC 4KY1H 4Z7QE 3TVMB 3EJYD 2D7TL 3JV4B 1EVUA 2VDNL 3EO0A 4N0YH 1KJ3L 5DA4A 1E4XH 1ZLSL 5D7SL 4JKPL 4KZDL 2AJVH 1RZ7L 5I74C 4EDWH 4LCUB 3DO3A 4JY5L 3QSKB 2A74A 4V1DA 1WUNT 1IFHH 5F7NC 1MSPA 2AQ3A 2CLVA 4QRRB 2IQAB 3QBTB 1V3KA 2R1YA 1SQ2N 3BKCH 1YEGH 4FFZH 3ZMRA 2IAND 3MLVH 1J0JA 3FAWA 3DVIA 3WO4B 1DQML 1A21A 2H8PA 2PXYD 3U83A 4IRZH 3W5NA 2V2WA 1NLDL 3DURA 1KTDB 3FMGH 2PYEA 3HMWH 1G7IA 4WIQA 4YIQA 1T3FA 5HVGB 1TJIH 2HH0H 5B22A 4AEHH 5EIIA 5IV2A 2G5BA 3FB6B 1ZWIA 2BVEA 4C57C 3CFCL 1P4BH 5MI0C 1MREH 3V0WL 3VFOA 4HIJB 1P4IL 3DVNB 4L4TE 2ZUTA 3RRQA 5FB8B 2Y36H 1DJSA 3QCTH 4KKCD 1K85A 1BPVA 3HNSH 2DOCA 4FP8H 2WQ8A 1YN7B 1Z2KA 1P84K 3MV9A 2IG2H 2OR9L 4GRLC 3PWJA 2VLLB 1M7DA 5ICXA 6FABH 5CSZA 4JFQA 1XF3B 4XBGB 5DS8B 2ZSWB 1CBVL 5EC1A 2QHLA 3MNZB 2WNGA 3WIFB 1N2RB 3LQAH 4L4VE 4NKMB 4HLZH 1YQVH 4GSDL 4YPGA 5A2FA 1F3DJ 2JK5A 4OAWB 5J6HA 5DJ2A 3HKFA 4AEEA 2DQTH 2EDQA 5GRUH 3MTRA 5IBUG 1RIVH 2OR7A 1V7ML 4KI5E 4WI3A 4ZFOB 1UB6A 4Y5VA 3TVMC 3BAEL 1YECH 5DHYA 3MYZA 1WZKA 2AXJA 5F7UA 3OHXA 1TDQA 2VLJD 2X4PB 4H1LB 4XPFL 2ADGB 4LARH 4M48L 4PJDB 1W72H 4HK0B 2VXQH 1QBLL 3MXWH 4N0FA 3F6LA 4Z0BH 2I9LA 2MFNA 1RSFA 1KLGA 3CGTA 2BY0A 1EAPA 1X5YA 2H2SD 4RWYH 2B5IB 2EYSA 4PJEA 4JHWL 4XCYA 4YIQB 1UEYA 1X4YA 3AM8A 4QNPE 3C6LD 4J3SA 2MNUA 2LV4A 3SN6N 3VRJB 5CD3A 1JYXA 5FGBA 5C0BA 3B5TA 3UYRL 1DQTA 4Q6IB 3KYAA 1ZVSA 2VLMD 2IADA 3QISA 1AFVL 3MOAL 3P40A 1G7QB 5C0BD 1XH3A 3ILPB 5C0CB 4ZOEA 4P4RA 1AY1H 1UM5H 5E8DH 3VXNB 4XXDA 3MROA 5JOFB 4QRPE 3RWHA 4G6FD 4OFKA 2MKWA 3RBSA 4P9ML 1GSMA 4XCEB 4HWBL 1CLYL 5JA8B 2VQ1A 4Z7UB 3GMQB 4JRXA 1ZHBB 1IT9L 3NBNA 4PJ8A 1ETZB 4JFDB 1JNNL 3DIFA 4K2UL 3DGGA 5GS1B 1A9EA 3GSRB 3I6GB 5IB4B 4Y2DB 4MCZA 1IGYA 3QG7L 4LMQI 4ZO9A 5C0DA 2VUYA 5I9QB 1X7QA 3T0XA 2D31A 4HKXA 3QI9C 2EO1A 5DRWB 1VADB 3B9DA 5M94B 1EAPB 1P4IH 3CVIH 3D25A 1GJIA 1JZ8A 1T03L 4AYFA 3NIDE 3K7UA 4HFWA 3RWFB 1XCQB 1EHLH 3VRLF 2AS5M 2N7BA 4X98B 2Z92B 5L0QC 2ADGA 5E2VL 1FIGH 2Q8AH 3V4UL 5E8PA 5JPNB 4PGBB 3DTXA 4JQVA 1N7MH 2GJ6A 1A6WH 5C6TH 5D7IE 5TDPA 1DQQA 3IU3B 4WDIA 1BD2B 4RGMB 4RZCA 3VXSE 2ZSVB 1BVLA 5A2KH 3GGWB 3HG1A 4FFYH 2HTKD 2MOVA 4R0LA 4TULL 3TA3D 5IHZB 5IVNA 5FO8A 3GSXB 5H2BB 5DDHB 5GGQH 3TO4D 3KG5A 1G0DA 3FHQA 1MH5B 2ZUQB 4PTTA 2VITA 2XZCL 1I4FA 4CL7A 5JORA 1TENA 5JW4M 3LN5A 2IPKB 4PJEF 1LO4H 4LSRL 4NFDA 4X4MA 1KFAL 3O6FB 4WGVB 1WEJH 3PWUA 2GYSA 2WINB 2AI0H 1OGAA 1A9BA 3SKJH 3LQZB 4UDUB 2GTWA 4MJ5B 5CHNA 2GW5A 2FX9L 3S8WA 3FFCE 1QYGL 4J2XA 3MRLB 1U92B 5I6XC 4XP4L 3HG1B 3B2UD 5JHDE 3G9VA 2ARWA 5HHVL 1JCKA 5D2NB 3H3PH 3WDJA 5CBAB 1EFXB 4BJLA 1NCWH 5C07E 5DJ6A 4DKEL 1CXKA 4QHKI 4QOKE 4MA3B 2CDFA 1EUTA 3RVUD 3NH7H 1FG9C 4R2GB 2ICEA 3QUMB 3SDDB 2PCPA 2VDOH 2I27N 4PLNC 1GPOL 1HHGB 3BGFB 1L9MA 4XB8A 4YXKL 5ISZE 4YDLC 3WHXB 5KVEH 3HFML 4I0PD 5JPMB 3BH8B 3PUCA 1VEMA 1UACH 3P0YH 1NAML 1CTOA 4IIQA 3N1GC 4P5TC 1YY9D 5MEPA 1UJ3A 5SX5K 4MJIB 3WUWA 4GXVH 3JWDL 3FRPA 3RDTC 3VDCA 1ADQA 5E2WH 2C4XA 1SBSL 1NMAH 4HS8H 2MPAL 4RMVA 4OIIH 3TZVB 3GMNA 3MLSL 3PNWA 1BHGA 1F90L 1XFPA 3HUJF 1TITA 4PJ8B 4H26A 1OP3H 2F5AH 1XGYL 3D9AL 2X40A 1FC1A 5HHMB 1OAXH 3BEWB 3LS4H 1IAIM 4PLJC 5I1GH 5DUPL 4E0RA 2EDYA 3QXUA 3PV7A 5HYSA 1VFBB 1YJDL 4LLYB 5F1OB 2YR3A 4X9BA 3OKEA 2RAMA 3G5XA 3V0AC 5K9OA 4K8RD 4XVTL 4QHUA 4AH2A 3BH8A 2DTMH 3G9AB 5FYJE 5TFSL 1MPAL 4HAGA 4P23C 1KNOA 5AWNH 4EN3A 1A6VL 2PO6A 2C5DC 2GJZA 3MPCA 3ULUH 1MCLA 4NN5C 2ADFH 3EYVB 5L8JB 3F7VB 3TPUA 5TQ0H 4EJ1C 2CGRL 4JN2B 1ZLSH 3U9UB 1I9RH 3C9NA 5CGYC 1N64L 4KTEL 4Z7VE 3RX7A 4RISH 5GGRB 3VGDA 1CTNA 5DWUH 4M6AA 3ROOB 2I5YH 3BKYH 5EWIH 1QRNE 3V0WH 4EEEA 3MV9E 2OMNA 3MLZL 4OZHF 4OFVA 5IW6B 3O4OB 3GO1H 4BSVA 3VG9B 5FYJH 2FX7H 3OKMA 3OHXB 3GEWB 1RUPH 5FK9B 4XBPB 3ARGC 3MMEB 1S9VA 4V1DE 1QR1B 4FG6D 3MV8E 2N4IA 1I3GH 3LDBC 4HHAA 1NGYA 4ENEC 1KPRA 5I1CL 1TCMA 1I4FB 4XP5H 5T3XH 3GKWH 3DOSA 4L4VB 4MQTB 3RZCB 4V1DB 2Q76A 4ZG1A 4PGDA 4ACPA 5MEQB 3OR6B 1EVTC 4L8DA 5GHWL 5TE7H 1T22A 2YEZA 2APFA 4B41A 4P5TD 4G6ML 1OF2B 5FA3B 1NEZA 4HJJL 4LU5H 4R90H 1KIRB 4FP8L 3JWNC 2B1AL 4UOW1 4M5ZL 4PJXF 2VLRD 1PG7H 1C7TA 4FQCL 3WIIH 4FQ1H 2Z4QA 3QUXD 4RRPG 3L5HA 1CDHA 3KPLA 2R2EB 4DVBB 1QSFA 5DZOA 1PZUB 2BVOA 3G5YB 2BRRH 3OAUL 1KG0B 1NANI 3ARBB 1QBMH 4H25B 4N5ED 4TQEL 4HXAL 4GSDH 3C60A 3JBG7 3OKLB 5F9OH 4UMGA 4WTWA 2M2DA 5HGHA 4G9FD 2DKMA 3CFJB 2HKHL 4CUCA 1A7QH 4YXHL 3ARFA 2LE9A 2AGJH 3CC5B 4XGZB 4BH8B 5D6DC 1NH6A 1PY9A 3GIZH 1UH3A 3F7PC 2BP3A 2J88L 4G9FA 1LEKA 4J3VA 3TBVA 4JB9H 1VACB 2AJUL 1CVRA 2EDJA 5FAAA 5DQ9B 4KI5C 3ZL4L 1R3HB 1IGML 1DBKL 1BFSA 3ZTNL 2ID5A 2E7CA 2X9YA 4QRUB 2IQ9H 5HVHC 5E03A 2BNUA 3SQOL 3LKOA 4M6ML 4YO0A 3TN0C 3LIZL 3P4OB 3SKNA 3UX9B 1A1OA 1KELH 4AM0A 4GXUM 3NOIA 4MD0B 3AVEA 2VSCA 2NY4D 4QOKD 4X5WB 4X5LA 3VWJC 2ATKA 1CICB 1B2WH 4LEXL 1A1MA 2M8XA 3S96A 5D1XA 1HQRA 5ISZB 1I3VA 5CEZL 1D5IH 5E1AB 3IVKB 1MJUH 4MSWA 3UXFA 5JHDD 1EHNA 1ROWA 1KB5B 2BNQA 3VH8A 1QFHA 4Z5RA 3L3HB 5C9KA 2XPGA 1SJEA 4TUKH 3OKNA 3R1GH 4UDUA 1FNAA 4LVHB 1S7QA 3I02B 2CMRH 5ITFB 2CD0A 4J7RA 3WL9A 1T1WB 2BY3A 1PAMA 2E6JA 1WCBB 2FJFA 3O6FA 3EYSH 2CIKB 4FXGA 4P2CG 1G7PB 2OK0H 3RVTC 3RPIB 4Q74A 3QI9A 4U6YB 4G5ZL 3UJTL 5E7FA 3UPRA 1UZ6F 3T2OA 1FIEA 1MHCA 3DV6A 3MUZ1 1DN0A 3GMPB 3SGDH 1WWWX 4NRXB 5CZVL 5LGHL 5FO7A 3TYFB 4MJ6A 3AFLA 4HGWA 1J1OH 4U49A 3PWNA 3VFRB 2BVPA 2WANA 2WIMA 1BQLH 2Q8AL 4JFYB 1RZFL 4PJ7F 1INEH 4M5ZH 5HHOA 1FNLA 2R2HB 2J4WH 2YBRB 3H9HA 3TCXA 4JY4A 3QDAA 2IAMA 3PHOA 2LU3A 2A74B 3B83A 4P2OB 5ETUA 3TT3L 5ACZA 1JZ2A 3ULVC 3EYUH 4HBCH 2CIKA 4DZ8A 4XX1E 4L9DA 4PRIA 4LIQE 5BVPH 3O4LB 1GZQA 4R4ND 3NABH 3QXAA 1FYTB 2D7PA 2DQJH 1VADA 3WFBH 3I02A 3ARBA 4QWWC 3QO0A 2RCSH 2OZ4L 1FN4A 1KCVL 2VLME 2EDOA 3PGDA 3NCBB 2R2EA 1ITCA 3D3VE 1N59A 1RMFH 1NKRA 1WZ1H 3IDYB 3CFEA 4OLUL 5I17B 1M7IB 2EIBA 3QB7C 4RBPK 3QNYA 3LKPB 3RNKA 1HXYB 3KYMB 1FBIH 3HCVB 4HXBH 1I85A 1OSPL 1QLRA 3ZKNC 1ONQB 3MRJA 1J0HA 3QEQB 4TVPE 3TBTA 3KPQA 2DYPB 1RUAL 3Q6FB 5D7JA 4LSTL 4R97C 3V4VL 5GZOD 1S5HB 3HLAA 4QHNA 1YEIL 1E6JH 4PIRF 5EUOB 5ETUB 5ACZB 5ILTL 4UTAL 3T0EA 5JZ7D 3EBAA 2VIRA 3MRQA 2DM4A 1MRCL 5J12B 2J6EA 1WBYB 4WTZA 5AYUL 4NO0B 5HHVH 2GITB 3CAFA 1ES0B 3MLUL 3T04D 5L2JA 2DLGA 3TFKC 2CR3A 4HIEA 5HGAA 4J1UA 1KACB 2AP2A 5JXAL 2Y9RT 3P9LA 2VAAA 1GGBH 3NH7L 1X3DA 4LSQL 1YUHB 3I9GL 3WJJA 3HI6L 4QXWA 2DL2A 2F19L 4M1CC 1ZT1A 4UIMA 3VGGA 4K94H 5JXEA 4OI9A 2R0LL 3W82A 3VRLE 1FN4B 4L3EB 1GAFH 2AJYL 1MUJB 2J6EH 3QAZB 5C6WH 4Z5RB 2VKXA 3BUYB 1OWWA 4NUJB 4PB9L 3NGBB 1NFDF 3AS2A 4ZS6C 1H8NA 1WZLA 4GBXD 1FAIL 4XC3H 4PJDE 2CKBH 5DD5L 1RUQL 4DFHA 1DUYB 2OMBA 3O2WL 5FM5O 1QNZL 2ITDA 5LQBH 3MRRA 4CU6A 4NN6C 2H2PC 2MJWA 3MYJA 2PTUA 1I9RL 4WUUA 2XZQH 1VB9A 3EW3B 4TULH 3T65B 4ZFGH 4G7VL 3WIFA 1E28B 43C9B 1ORSB 2CO7B 4HUMB 5K9JH 4PLKD 3HZYA 1VKXB 1TQCB 5GGSA 4KK9C 4FQLH 4NRXA 5IESH 5T1KB 4A6YA 1MHHA 3KLSA 1UM4L 4AT6A 1UCTA 4LSUH 3MFGB 5GS0H 1Z9SA 1FSKC 2W60A 1T1YA 2AK1L 1CGVA 1IM3A 1QUNA 5GSVB 1SEBA 4HZLA 5CJQH 3HC4L 1R3KB 4PJHE 1T5WA 4UT9L 1GL4B 4LRNL 4L1DA 2IGFH 3D85A 2GJ6D 1QA9B 3FRUA 3S97C 1W0YT 4PGZA 5HYIA 1X6NA 1IAIL 1BQUA 2EO9A 3X14B 1L7IL 5FIEA 1VFMA 3QNZB 2OSLA 1U42A 4Q9RL 1IAKA 5EU5B 5FECB 4XHJC 3U2SA 5LWYH 1FO0H 1WTGT 5FHBH 3VH8B 4NQDD 1MIMH 3KPLB 3H3PL 4MD5B 2OLDA 1MFAH 1AY1L 3MNWB 4QKXB 2GJZB 4JHBA 1MQKH 4PJDF 1GGYA 4U4BA 4KPHH 3S96B 1JYNA 3BW9A 2R0ZL 1A6TA 2XACC 1CK0L 2CLVB 1NCTA 5F3HA 1GPOH 1KC5L 5KVFH 5F7MC 1CLYH 3VXUB 5CHNB 4JGJA 3SKMA 5FGRA 1UA6L 2ARJA 5F9WB 2D3VA 2V5MA 4KK6D 3VXMD 2DM7A 5JHLH 3EZJB 4DN3H 2X2YA 2X4UB 1JRHH 3FQTB 1KXVC 1NAMA 2W9DH 2X42A 1J9CT 3SDCC 2NY3D 4M9OA 2EXYD 2A77L 2FO1A 3LN5B 4I5BB 2W0KA 3GIZL 4U2ZA 3HZKB 2EDWA 1XR8B 1G9ML 4HKBA 4C54A 4JR9L 2B2XL 2AJ3A 4NC1C 1KPRB 3VW3H 4XNXH 3VWKD 1WLHA 1AO7A 5DFVD 4Z7OF 3UDWC 4Z78A 2AJYH 2J6EL 3MMEA 3QEHA 5D93C 4Z76A 5DJZA 1XGRA 2HMIC 1A7RH 2VXUH 1LDSA 1F3JA 3VG0H 3LH2L 3MZTA 1MHCB 3O41B 5IF0B 3TNNB 3U4EB 3P30H 1EK3A 3BDBA 1CGSL 2NY5H 3GHBH 5D2NE 3RGHA 4ZAKA 5EZIL 2IANA 4F3FB 1KUMA 4L9LB 5EOQL 1HCFX 4ZXBB 5KVMC 2F5BH 4S1SH 4OAWA 5J6HB 1QRKA 2VDMH 4XMPL 5BO1L 5DHVH 2DL9A 3QUYB 4W4OC 1W72A 1N8ZA 3EO1B 4HIIA 3EFFB 4MJ5A 3BT2L 4XPGH 3L3IA 3QWQB 5D2LF 4CADA 4IRSA 3I84A 4Y5YA 5DVOA 4JKKA 1MI5B 1V7NH 3SGDI 4LCCC 4XH2A 2BY1A 4JZNA 4H8WC 3SDYH 5FYKE 4H26B 1EZVY 1QKZH 3P11L 4JM2A 2LFGA 1GC1H 3MLYL 3UYOD 4EUPB 3QUYA 1TLKA 2H26A 1YEJH 4N5UA 1TJIL 3O11B 4EDXA 5FK9A 1P2CA 1QSEE 1DBAH 3C5SB 3ZHDA 4U1NB 1K2DA 4R4BA 2G60H 5T5FL 4XVUC 3C6SA 3VFTA 3Q6GL 2R0KL 4NWTH 4QHKJ 4R0LB 5IHZA 4Q9RH 4HF5H 3JXAA 1G6RA 3GSUA 2ZSVA 5KN5A 1W0VA 2BMKA 2P5EB 4OTXL 1J0YA 4GAJH 2E27L 3BH9A 4HEPG 4QNPF 3RP1A 3BMVA 3EYVA 1BQHA 3BIKB 1EUUA 2A6JA 5FECA 5FOBB 3L3OB 3DWTA 4K3JL 3DXAA 2CK0H 3FN0L 2ICEB 4QXUH 1WBYA 4RDQG 1TMCB 3V7MA 3WFCL 3IT8D 1NBQA 4X8JB 4Y0GA 4PJBA 2P1YA 1F58L 1JGVL 2LAGB 3NCEB 4OZIF 2DM2A 2YRPA 3CFDB 5CEXB 2G2RA 3ECBB 1IM3B 4JE4B 1P2CB 3IFOA 4BFBD 2CKNA 1WT5A 3QZWG 1VSCA 1I8KB 2ADIA 5EUKA 2WWKO 3QIWA 3RX5A 1H0DA 5IFAL 1YNKL 5JTWA 2FEEL 3DX9B 2XIDA 2HT4D 2O5YH 4Y88A 1TVBA 4PBWD 4QEGA 1HE7A 5B4MD 1DQJB 4I1NB 3E3QE 3QO1B 4M9PA 3AREB 3ECBA 1OAUL 3WD5H 3BZ4B 4PJGB 4XT1C 3NA9L 4EIGB 4K3HA 2NX5D 4X6DB 5DJXA 3UP1A 4FQJL 2DJUA 4NFBA 1FNFA 2J7LA 1TNMA 4JVWA 1JK8B 3V95A 1CFTB 2NXYC 1RZJL 2Z35B 3Q3GB 3UO1L 2J5LC 1B2WL 1LEGA 4PGBA 4XWGH 5F1NA 3MUHL 1UKTA 3BIAX 4JFFB 2B8OT 4IIQC 4OZGA 1T21A 5BQ7A 3JZ7A 2VDRH 3VFGH 2VLKB 1BD2A 1B3JA 1BVZA 2FX7L 2X70B 3TO2B 4U1IB 4U2YA 1F11A 2XKNB 1UB5A 4QXTA 5ELIA 2YPKB 3JTSB 4ONGL 1KN2H 2Z92A 5GGSY 2CO6B 1V8HA 2VLKA 4Y8AA 4NQEE 2DRUA 1WJ3A 2O61B 1G7IB 4NO2B 4NQUA 4R7NB 4JQIH 5F1NB 3SPVB 3VFMB 4FA8A 2MHAB 5A3ID 1EDQA 1KLUA 3OGOE 1Q9WA 4KK8D 2NY0B 3LEXA 4CN1A 2R1XB 5C0GA 4M1GL 1ZA6B 4XCFH 5EOCL 1IJ9A 4NNYB 1MAML 2OX5A 3QR2A 1VKXA 5B3JE 5CJBA 3QA3B 1DN2A 4TPRH 3WL9B 2IC2A 5GRJH 2F15A 4NNPH 4WUUB 4HF5L 2AK4B 1OP9A 1KCKA 4P4KA 4ODXA 4HMCA 3T1FB 3B5GA 3TA3A 2FATL 4GLRI 5J1TC 1VA9A 1XH3B 2XTJD 2UUDK 1A6UL 1ZHLA 4JAMB 1O0VA 1U8PB 1FRGH 1FLRL 1IQDA 5DLMH 5I0DA 5FEBA 3U7YL 1FJ1B 1QBML 4TQEH 1DSFH 3MJ9H 5IWLA 1EJ6A 5J7CC 4O4YL 4Z7NF 1C5DA 4URTB 4QHMA 4YZFF 2CXGA 1E4XI 3MRPA 4M43L 1PLGH 1FORH 2YA1A 2XTJE 3HUJA 3TVMD 1Z3GH 4WI8A 1RVFL 4BK4A 4B50A 1G7MB 5I15H 1QFUH 1D9KC 3DX8B 2XT1B 1PQZA 5D1XC 2ATPA 3QAZC 4NWUL 2CRIA 4D0DB 4DWHA 2M26A 5AZ2H 2JCCE 2PF6A 4LVOC 2YBRA 1NMBH 1IGFH 1UWEL 1C7SA 4QRRD 1I7UA 3SGKC 2DAVA 3KPNA 1V05A 1N3NA 1C16A 3MLRH 5F9WC 1ZHKA 3PJSA 1PX4A 1FP5A 5IHBA 2QSTA 2YZ8A 4AY0A 2K1MA 4I48B 4WJ5A 1VGKB 4KVNH 5DJ8A 4WHYH 1PEWA 4OCLC 5BV7C 1UM5L 1BZ7B 3T77A 3GM8A 2P7TB 1ORSA 4JPIA 2JB5L 4PJ7B 5DQDH 1KG0A 1JNLH 4EOWH 5DVMA 3QNYB 5LWYL 2DYPA 2ZCKH 4LBEB 2E7BA 4U1JB 2UZXB 3QA3A 5EU4A 4M93C 3BEVA 3UJIL 2R29H 3RPIA 3FO2A 3EYFB 1EA9C 1F2QA 2GKIA 3ARVA 1D9KD 1JGEA 4Z6AT 3LVEA 4MD4A 1GGCH 3GMLB 1IAII 2FJGA 3PWJB 4AIOA 3O6KL 5I1IH 1NL0H 2R1WB 4NZTL 4OLYL 3WJLA 3CFCH 1Y6MR 1UKSA 2XPGB 2IAMB 3PHOB 1OSZB 3MRKA 4HIXH 5DFWH 1JUFA 2Z8VC 1CR9L 3FB6A 1NCCL 4JDVB 3DARA 4M7ZB 1SEBB 4HZLB 4CAGA 4X6DE 5ALBH 2R2HA 3H9HB 3KLAB 1XGYH 3D9AH 4BFGA 4GKSA 4S1DC 5IHUH 4G42A 1QP1A 1QNZH 2NY6D 4KJWC 5KSAA 1S7RB 2BJML 3KPSE 1XCQA 4NGHH 2F5BL 3EJYC 1MNUH 1KXTB 5FO7B 1MCWW 3NIGE 5ANMB 5HGDB 5CP3A 1N3NB 3GRWH 3O45A 5EUOE 1U8KB 3I85A 3TO4C 4K55A 4Z77A 4AMKL 2EYRA 2FEEI 3QXDA 3H9YA 4GW1A 3HZKA 5CEZE 3S5LG 3TA3C 2C1PB 2LTQC 1S7QB 1HXYA 1OAKH 2VTFA 1BD2E 3C6LB 1BBDH 4EXPX 3VD3A 2HA1A 4CJ1A 3HUJB 3GHEH 2EECA 4RQQB 3G5YA 35C8H 1XEDA 4XXDB 1A7BA 1CYGA 1XIWD 1K4DB 1T89C 4MZ2A 1CL7H 5I1JH 2BC4B 1I3RA 3UPCA 4GRWH 1ADQH 3IDNB 5EPMB 1EMTL 4LVHC 3QRGH 1CZ8L 1QLEH 1IBGL 2D9CA 3PDDA 1E6JL 4OFYA 1OM3L 3V5HA 4X5WA 1MCHA 3EOYG 2EH8H 4NQDA 4LK4A 4P4KB 2JJSC 4X6CF 4I3RH 1ZHKB 3PP3H 4GRWB 4TSBL 5IW3A 5J3HC 5IM7B 4IMLB 3SCMA 4D3CL 4PV8A 4ODWA 5B4MC 3QIWC 1BMGA 2FYYA 5GHWH 3T0EB 3AS1A 2I9LB 4OF8A 4Y2DD 4O58H 4KDTC 4A6YH 3OKDB 5KJRH 4K2UH 4JDZB 2YZ1A 1MI5E 4GMTH 3GSNH 3M45A 5D93B 1OTUD 5IP4A 3F8UB 1JNHB 3ZE0F 4TUOA 2XXMB 3BD5A 5C09E 5SV3A 3V6ZB 4APQA 1P4BL 5FYKD 1I8LC 5C1MB 3DETD 4PR5B 4X9IA 4MJ2A 3RNKB 2EDRA 1CXFA 2X41A 5BXFA 4P9MH 5T3XD 5T1MA 1HSAB 2KKQA 1ACYH 2PO6C 1MCPH 3C60D 3ORJA 4U33A 3VXSB 3FFDA 5KVDH 4HGMA 1CR9H 1BD2D 3CVIL 4OFPA 5GJSH 5HYJB 2R69H 5IW1B 2NNAA 3MRHA 4MNQA 3KJ4B 3HE6D 4FFWC 3SDAA 1T7YA 2FDBP 3VFSB 2EH7L 4X9FA 5FA3A 5D7LA 3TA3B 4YHMH 5CSZB 5JIIA 1IM9B 1UFUA 5E2JA 3H42H 1YMHB 1MEXH 3RWDA 2Y4SA 3BKML 4G7VH 4PGDB 5DMYA 4MHHI 1NBZB 3WN5B 2EIDA 3RJDA 4LNRB 3NACH 3VFSA 3HC0B 1FGVH 1I9JH 2CRYA 2CJUL 1CFQA 5IF0A 5IW1A 5C6PB 4YUEL 5FYKU 3NN8B 3FO9B 1MFBL 1VFBA 4YHLL 4MCYB 4ZNCD 1AH1A 4WHYG 1ODAA 4OZ4B 1KLUB 2VLJE 4XPTL 5T1LD 4OZFA 4BYHA 4F33A 3SO5A 4YH6A 3ARUA 5EBMB 4P46A 3V6OC 4FZEH 2BOBA 1YYLH 4YBQC 5F7EH 2A6KA 1XMWA 1ZT7A 4LAQL 4HPYH 3DRQB 1FE8H 4JDTH 2VDLL 2JJUA 4RA0C 3IXAB 3HG1D 1Y6NR 2JCCB 1FFPA 1EFXD 1N5YL 4GRLD 4PRNA 1FNEB 3O6ML 4K23L 3PP4H 2L0DA 4WHTA 1KN4L 1GIGL 1AXTL 3LRSB 4DUXA 4X6FA 5D2LB 5C70A 1JWUB 1NBZA 3WN5A 3LQMA 4L29A 3VXQB 2DD8L 5IJKC 4J3OC 4F7MB 3OAYK 3GMOA 1NFIB 1IM9A 1PSKL 2FJGB 1KENL 1F5WA 5IMKB 4R26L 4UOW0 2ICWA 5EO9A 3QWOB 1F2XK 2FECI 4OD3H 2A6DA 4MJID 3HHRB 3RIAF 5HI4C 2EZ0C 2PR4H 1KNOB 1Q0YL 1LVEA 4PJGA 3MRFB 1G6RL 5F44A 1GGIL 4P2YA 3NPZB 1T04A 2P47B 3V5KB 3C6SB 3VFTB 1U91A 2P4AB 3UJJH 3GBML 3WEXA 5E08H 4Q7DA 5HVHB 1RUMH 1FNGB 3SOBH 2V6HA 2XN9A 3NGBC 4CGTA 2W0FB 3T0VA 5HYSB 1UEMA 1Z3GL 4J6RL 4NYLA 5HHPB 4P4RB 1RIUH 1FYTA 2BNUB 3DJ9A 4DTGL 5GQBA 2WINA 4P23D 2XKSA 2VQTA 5C0AD 3CH8A 5DVNA 5DYOA 4OFYD 3S35H 4KK9D 5HDQL 2UWEE 1N5AA 1T4KB 4LVOB 3M8OL 2J4WL 1T20A 1BJ1J 3U7YH 3N0PB 1MJJB 2NR6C 5TQ2L 2X4OB 3EYUL 4JJHA 1Z9MA 1QFPA 1IKFL 5LBSH 4QRSA 4IOIB 4WFHE 2I60H 4XPHL 2MPAH 2H2PD 3IKKA 4R7DA 3REWA 5BZDB 5B38G 5J1AB 2YA2A 3G6JF 3MNVB 4GBXC 3OKLA 3IF1A 2E8ZA 1J7VR 2HKHH 4U1HA 3X17A 1NSNL 5GIRA 3M17A 3EFDH 3OXRB 2AXGA 2KDGA 4U7SA 2FHFA 3GB7B 5D6CB 1Z9LA 2VLKE 4N8PA 3H6JA 8FABB 2R23A 3WO3B 4QY8A 4APQD 4JN2A 3BKMH 5I1HL 5DMKB 1SJHA 2CRZA 4U1GB 3TNNA 1VENA 4YHKH 4MA1B 3UTOA 2IBZX 2SEBB 5CEYA 3UTPD 4M7LL 5H35A 2A73B 1LMKA 4N9GA 4ZO7A 1QACA 5DJ2B 4LPXA 4Y5XA 4G8EB 2VDRL 3CSPA 4KJQD 3QIBD 3RY6C 3PXJA 2WUCH 3MBXL 2HKFL 2VL4A 4WO4D 1N2RA 2DLEA 4HIXL 1AGCA 4XTRC 2APXA 3GZKA 5ERWA 1JGLL 3V7AG 1HILB 3QCVH 4V1DD 5IFJB 1Q9OA 3QP3A 4WEBL 1NLDH 4JRXB 3MO1A 5D9SA 5JXAH 1CICA 3T3MF 5CEZH 4PJFF 5T5FH 2EDXA 1UM6H 1MFEH 4P5TB 3EOAB 4KAQL 2R56H 1S9VB 1C1EL 4PS4L 1A3LL 4JPVL 5HHXH 4P9HH 3ARYA 4ODTH 2OBGA 4L9LA 3T2NL 4K8RL 5J1SC 4R90L 2D7QA 3WE6B 1M71B 4GG6B 3T77B 3D3VD 4D2NA 4ORGA 2QADC 3MJ8A 4KKLD 2ZKHH 3MV8A 2IADB 4XPAH 4X98A 3GKWL 1QSEA 4LLVB 5D2NC 4IDJL 3KYKH 4Q6YA 2WSKA 4NKIH 1MJ8H 4DQOH 1Q38A 1GGTA 2NY7H 4YHNB 4G9FB 4YDIH 3QFJA 1UQSB 2P5WE 1G9NC 1A2YB 3SGEI 3I6LE 1O7VA 2YKLL 4OLEA 2G75B 1NC2D 4PRDB 4ZDHB 4OSUL 1G9EA 5IJVB 3SOBL 3AREC 2EKSA 3BDYL 5IK3B 3ULVD 4IS6A 3CXDL 3WFDH 1YMMD 1IGTA 3MSPA 2FL5B 1AP2A 2ZG2A 4UT6L 5E99L 4M02A 3B8SA 2IMNA 2Q3AA 1CDUA 2YMXH 1HHKA 1YNKH 1L0YA 1C8PA 1JPGB 3O8XD 4MGXA 3RPKA 1BP3B 1H5BC 3IAQA 4UB0H 1OTUC 1MCFA 5D72L 3VGHA 4KHTL 5DK2A 2VXTL 4JFED 1BOGA 1IGFL 1UWEH 3FB5B 4Y2DC 3IRPX 2R4SL 3VXNA 5IVOA 3QJHB 2I25N 1ERNA 2JF1A 5CILL 5CP7A 1NBVH 4UBDC 1S5IH 2YK1L 3OX8B 4RFEB 1MH5A 3AMKA 4OB5L 5JOFA 4Z8FH 4LSTH 1MPAH 4LVNB 3QDGA 1YNLL 4UNTA 5ISZD 1XGPA 3KPNB 1W72B 3UBXG 2X4TB 4I77L 3VRJA 5CD3B 2ESVD 3L7FB 2W59A 3L1OH 3BD3A 5I1KH 4YFDB 4Y4KA 3QHFL 5KVGH 3VE0B 1HH6B 4GRMB 4MXQC 4JFZL 4JFPA 4G7YH 4MAYB 4O02H 1IFHL 1SJHB 2W9LA 1N6UA 1J86A 1ZVHA 1JGUH 5D7IB 4ZD3L 3ZE1E 5KTEH 5ENWB 1ZE3C 3QQ4B 2FWOB 5T3XE 4BH7B 2QQQA 3QJFB 2FJFB 4JQIL 4DGYH 4U1IA 5HYQA 1NUGA 1NDGA 4WUKL 2BXYA 3QQ4A 5L7XH 1UZ8B 4V2BA 2B5IC 3O2DL 3RNQB 5I30L 3W0WB 1K8IB 1QR4A 3LV3B 4U6XA 4WI6A 1Q8MA 4ZFFA 3IDJB 3MUGB 3H42L 3NN8A 4CN6A 3GMMA 1DZBA 4HMDA 4QRPD 1G7LB 1N6VA 4JR9H 4J8RB 4XNZC 3T0DA 5AAMA 3WLBB 1RIHH 1CXIA 3BKJL 5ID1B 4X7TB 1BM3L 4Z7UE 2BCKA 3KPPA 5KAQG 4LNRA 4EI6B 4P2OD 1CU4L 4KJWD 5KVDL 1JNJA 2A1WH 5IVXF 4NQVA 3BYYA 1ZHNA 1QOKA 4WNQA 3OG6B 2Y6SC 2HFFB 3EO0B 4XNUL 3S9DB 4CDGC 3ULUE 4FQLL 5I8KH 4TVPH 3E6FB 2IJ0C 1J8KA 1IKNC 2NLJA 1UM4H 4P57B 5EUKB 2FRGP 1AHWC 4EI5A 2YPKA 4MA8H 4ELMB 2K3TA 1AXIB 4JPWH 4JZJB 2OZ4A 1PYWA 5I66A 1A7QL 4GAYB 4PJXB 1NLBL 3VFOB 3MXWL 4P3CL 4NZDA 4C56B 3GHEL 4YBLC 4L4TD 4U3CA 2YD8A 1DEEB 4D9LH 4DKDC 1E4JA 2P45B 1NGZB 3SE8H 1Q1JH 4ZTPH 4ALAH 2JB6B 2QEJA 5TJWK 4GMSL 3BWAB 4O5LH 2KPNA 4MB4A 1TZGH 5J89A 1U41A 1RU9H 4HH8A 4NO0D 2AV7B 3Q0HA 1S7UB 2O5ZL 3BOVA 3VFRA 4F7EB 2AERT 4JM4H 5F9JB 3MOAH 4UT9H 4P99A 5H37G 1Z6JT 3LPFA 1VEOA 3HMXA 3V4PH 1U92A 4ZOBA 3ZHLA 3C8KA 1M1SA 2AEQH 5DGRA 4YPGB 5KVFL 1F6LL 1IAIH 5K93A 3VGFA 3V6BR 1M6OB 1MVUB 3DXAD 4KI5D 3TFKD 1MF2H 4ESKA 4NQCB 1A3RH 3HB3D 1XCTA 1OGAD 3RWIA 1QFWH 3WXVL 2AJVL 1TIUA 2C4FT 2CXKA 5SWSA 1MFAL 4OZFH 4B53A 4RFNC 3STZB 3MV9B 2R9HD 3AXLB 4PLKC 1AP2B 1JI1A 2CMRL 3K1DA 4DOHB 5ABDE 2R1XA 1GGIH 4WU5A 4I18C 1LO3L 2XA3A 5FUOL 1NCCH 1TZHA 1CCZA 2FO4A 4XAWL 2BSTB 5LXGH 5EU6A 4LDEB 1Q72L 5BS0B 4TTDC 4GRWF 3L9RB 2LAAA 1QRND 1A0QL 1AC6A 3L3OA 4GW1B 4UINH 2NTSP 4YHNA 4GQPH 3RVXD 3FRUB 4RNRA 2VUOA 1UB5B 4QXTB 2FD6H 3BPLC 2FSEB 5F6IB 3O45B 1CD9B 3BGAA 2ZPKL 1CFNB 5B39A 12E8H 3D0LA 1IAMA 5KN5B 2X4PA 3ARDB 5ICZA 2BSRA 4Z7UF 5CINL 3V6ZA 4F57H 5ADPH 4AT6B 5IB2A 1HHIB 25C8L 2DS4A 4R4NC 1OB1B 3MRIB 4D0CB 3BZEA 5T1KD 3C60C 1UADC 5DRXB 2XWTB 4M1CD 3DV4A 4PLJD 2XZQL 4ZFGL 5IROC 1MWAA 2CKBA 1KIPA 4OM1H 5D6DA 1A6WL 5KSUB 4QRRE 3CMGA 3MO1B 3MRCA 3O2WH 2YD7A 4P5KA 1LD9A 4XVJH 5D9SB 3RWGB 3BYTA 2Z8SA 1FC2D 4J4PA 2Y07H 5TF0A 3QDMA 1DVFC 1FFOA 4RAUA 1W72L 2VLLA 4JFDA 4GKNB 3F7YA 3QEQE 3BSZH 3BAEH 1BOGB 1DBJH 2I9TA 3B9AA 4NNXB 2HLFD 5HVWA 1SM3H 1SJXA 1JZ4A 4JHWH 1B0RA 5CJQL 4X4XA 1N59B 2R0WH 1ZTXH 3IFOB 4EUPG 4PRPA 3ESUF 5EN2A 3ZTJH 2NLJB 1MUJA 2AEWA 2NW3A 1NGPH 5DK0B 1QPPA 2GJ6E 1G9MC 3QXAB 1YPZF 2Q86B 2G5BB 2X4SB 1KJVB 5A2LH 2ZKHL 1S78D 3UC0L 3BW9B 3HMXL 1E6OH 3V8OA 5TE4H 3U4AA 3W39A 4LP5A 4ZPVB 1UQSA 2WBKA 4Y4FD 3CDGB 3B9KB 5H37H 1G0XA 1T7ZA 3GMOB 1MCOL 2ARJQ 4JPVH 5HHXL 5AYUH 4LASH 4NC0B 4MVBC 4Y89A 2APTA 3GM0A 2XICA 4OV6F 1CFVL 3QRFM 3IDJA 3LRSA 2FGZA 4J4PC 4NUGH 1DQLH 1CE6B 3B9KC 3CXDH 4WVRA 4FXKB 1B6UA 3VWKB 1E27A 5C8JA 3M07A 2VN7A 1JMZA 1WWBX 5H8DA 5B8CA 4AEHL 2VDKL 5EFIB 5F88B 1BGXH 1PKQE 4C56A 3DYMA 4MCYA 1P7QB 3IFLH 4LHUA 1PY4A 2PYFB 4QXUL 1AIFA 3HI5L 3S37L 4M43H 3D18A 1RI8A 3FO0L 3LN4B 3QQ3A 3UBXI 2MCG1 3P0VL 2IF7A 4U6VH 3MREB 4FQHB 4BZYA 4FMKA 3C87A 1ZLWK 3PWPB 4XP9L 1SJEB 1VGEL 2QKIB 4ZXBD 2OR9H 4P49A 4Y1AD 1GZQB 4OZHE 1A7PH 2ITDB 4Y4FC 4G8GE 4KC3B 2VNCA 5I1KL 5B3JF 3U0TA 3OGCB 5EBGA 1WF5A 1JWUA 5EU4B 1MJ7L 5C0AA 2YN5A 2BVQA 4CMMA 1D6VL 4AIXA 1CE1H 5E2VH 1XF2A 1S5IL 3C08L 3D2UB 4ZD3H 2MCPH 4RMUA 1U0QA 1J88A 2VERN 1XT5A 1LK3L 5GIRB 4WWKB 1BZ7A 1CLOH 3LIZH 2V9QA 3WS6A 4HG4J 3PL6A 2KBGA 3TIEA 3EKCA 3TYFA 5IV2B 3MLWH 3P4MB 3V52L 4TSAH 4HWZB 4BM7A 4AL8H 3LRGA 2BFVL 3ZKQD 1G7HB 5EBMA 3EJJX 3IDXH 1U3HA 3P4LA 1LK2A 1MY5A 2XOTA 4PGCA 3UO1H 5GGSB 2X05A 2WW8A 1E4WH 3RFZC 4HUUB 2QJDA 3WIHH 3IFPB 1SVCP 1X4XA 1ES0A 1FHGA 3A6CH 1I1FA 1ZHBA 3A6BH 5SX4I 4JFHE 4OZGB 2CLZA 3V7AE 3KHQA 1H5BB 4YGVA 4ZUVA 3FL7A 4OUOA 3LN9A 2ENSA 4KI1A 4LF3A 1F02I 3P9MB 4YEEA 3UMTA 4ODWB 3VFVA 2BERA 2XY1A 4G6JH 4M5YH 3LD8B 2XN9B 1FPTH 1DDHA 5KAQF 3TV3L 2NTFA 3CUPA 3SDCB 4MDJB 1HDMA 5E4IA 1A6TB 2L4OA 2Q1EA 4ZFZB 2RFXA 3EGSB 3U30C 1U8LA 3WDIA 2E27H 1QYGH 4U6HA 3WLWD 1NCNA 3C5JB 4RDQF 4XXCC 1GC1C 1NJ9A 4S10A 2HFGL 4CN4A 4OCSH 1VDGA 4CMHC 3BI9X 3KXFB 4Q9QL 4DAGH 3PGDB 1CG9B 5T1MB 3QI9D 1CT8A 3JVGA 5MHSD 2PN5A 1DQLL 1U8NA 2X1XR 1PJ9A 3HZVB 3OSKA 3O9WC 4U1MB 3TBYB 1KCUL 3Q5YA 2Y5TB 2FX8L 2QSCH 5IFAH 1F6AA 1DP0A 4MJ4A 5LBSL 1R6VA 4YGVB 5JUEH 2R9HC 3ZKXB 4B0MM 2O5YL 1BGXL 4RBPH 3GFUA 4OF0A 3ISWA 3WFEH 3OKDA 2NY2D 4FQ1L 2ZCHH 4PBXA 4HUUA 2CKBB 4PTTB 2O26U 5EZOH 4V2CB 2WBJD 2HG5B 1K4CB 5H35B 4IJ3B 1OP3K 4OQTH 5JDSB 1F97A 2A6JB 2BVYA 4YQXL 5IMOA 4FQXD 4ZNEA 3TO2A 5C6TL 2BSRB 4NWUH 3WNLA 4O2CA 2PW2A 2V7HA 5T5NF 4G42B 4I0KA 2J88H 1CDBA 1QSFB 5TDPB 3RDTD 5MENB 2QSVA 1N64H 1B4RA 5LKNA 5DD6A 1MCSA 4XMKH 4HKZA 2HWZH 1TZIA 4M6MH 2GTWB 2VZVA 1OLLA 5TQ0L 1F4XH 1CXEA 1EEQA 1R5WA 3EO9L 5HHNB 5F3BA 2EDTA 1I8MB 4OZIB 5C7XH 4JQXA 1LK3H 4RISL 3D25B 15C8L 1U95A 1T1WA 2C3XA 3SDXE 5T33H 5K9OB 1JYWA 4PRIB 4JLRA 4BSJA 3DROA 5D8JH 4L5FH 4YHZH 4DGIL 3OKYA 2C1PA 3KPMA 1TJHH 2P8MA 3F7YB 2X1PA 5DJAB 4HKZB 5CP3H 1R3IL 1T5XA 1W0WB 3HNVH 4WFGE 1OWRM 5IQ9B 1TETL 4P9HL 4OT1L 3QPQC 5DO2D 5DC0A 5ISZA 2FNBA 2CIIB 2AK4D 3OKOA 5DZNA 3FT3B 5HXMA 1MJUL 4ONFH 5DMGD 1AO7E 3DMMB 3TBSB 3GMNB 3E6HA 3NCFB 2OM5A 3CH1B 1AR1C 1TQCC 5T3XL 4WO4A 2EDBA 5F7LB 3IU3A 4KKBD 2OXGA 2XFXB 3GJEB 4OTXH 1MJ8L 1IC5H 4LLAA 5DMIH 5EO9B 5T3ZE 1PG7L 1D9KA 5KW9L 5DI8B 2PW1B 2NTFB 4LU5L 2E8YA 4NJ9H 4TPRL 4YXKH 5JOPE 2DQIH 3QUKA 2R4RH 2V2XA 1MCKA 4NQXA 4JRWA 4TYUA 5SWZD 1QSVA 2OR8A 1I1RA 3U48A 4HUXA 5E99H 5F71A 1UJTA 1ZK9A 5CJOL 1YY9C 1X7QB 3PQYA 2H9GB 2AQ2A 3KPRB 3MA9L 3SJVE 1YYMH 2FO4B 1JHKL 5HGHB 4M6OH 4ZS7H 4AH2B 3MRLA 4S1QH 4ZOCA 4FMFA 2FCBA 2DQJL 1KTKE 1ZTXL 2NW3B 3LD8C 4MVBD 4RMQA 4D9RE 3EYOA 1TTGA 4OGAC 2DLFH 2AVGA 1D6EA 1A1MB 1A9BB 3Q48A 4P46D 7FABL 4TOYL 1AXSA 1S9XB 1QZ1A 1X4ZA 2E7HA 4CJ0A 4OD2A 5F7FA 4JFOB 2A38A 4GMSH 5A16B 1X5JA 4ERSH 3G6AB 5HY9A 3GKZA 3F6IA 3DVFA 3S5LA 2FIRT 1NQBA 4OJFL 1CICC 3K4AA 5EU6E 3MGOA 3SJVD 3PWNB 3U7WL 5IG7B 3BHBA 2ADFL 2D7TH 3ZT6A 2ADJB 4MXVE 3UZVB 1LEKB 2UV3A 4F7MA 2UUDH 3SKOA 3UC0H 3N1FC 5FGCE 2D0GA 3BZEB 1PKQB 4UQ2A 4PJCB 2IAMD 4NZTH 4P23A 4P2RA 3BE1H 3LZFL 3D39D 2OTUA 4NSKB 4ZTOH 3DHJA 1GGBL 2O5XH 3BFOA 3IDMB 3L95A 2EICA 4L8SB 1FFPB 2ICWI 4QF1A 1P4LB 5DJZB 4PBVC 3OBAA 1WCBA 1Q72H 4P2RB 3ZDXF 5J9PB 3KYOB 1PKQA 4UQ2B 4WEMB 4HV8B 4DN3L 3O6FC 2E9WA 3INUH 2R2BA 4M7ZC 1ZLVK 4X4YB 5DUBB 4F33B 1KTDA 2HFFA 3L7FA 2JK5B 4OLYH 5C0RL 1AGFB 1NGXA 5I16B 3AXLA 3DX6A 1EEYB 3ULVH 3E8UL 2VAJA 2YD3A 1RHHA 2CKBL 3CDCA 1BEYH 1H3VA 5SWSD 1MY7A 3DHMA 1U3YA 4M8QB 4WI7A 3U7AA 1MNUL 2HT2D 4C83A 3JWOC 3ZKMC 1MVUA 4M7JH 2CDEA 4CW1B 2VISB 3QIWB 5DD5H 2YUVA 4RFOH 1QR1A 1MLCA 2NY3C 4X0KB 3EHBC 1K4DA 2GAZA 1OD7A 5IB5A 2RIKA 3N85L 4GG6E 5I1EH 4HIJA 4XC3L 4MNGE 4KK6C 1B0WA 5JLZB 2N7AA 1V3MA 1MELA 5AUMB 4E42A 2F74B 3SDAD 2XG4A 2DQTL 5GRUL 4WO4C 5CEXA 1UWGH 3SE9L 1HH9A 5JO5B 3VXPA 5HHOE 1XGTA 4JRXE 4YDJB 1J5OL 4FTVE 1C12B 1QLEL 4HIEB 3QDMB 2YD1A 1HIMH 3WBDA 1I75A 2XA8H 2QQNL 2GITA 1QBLH 1K5NB 3BIKA 1L0QA 1HKFA 3JWOL 2NZ9D 3DBXA 4J12A 5AG9A 1GRWA 3H9SE 1OAZH 1F4WH 4PV8B 3ESVF 5D1XD 5TPWL 3QXTA 1OB1A 3ELAT 4D0CA 4PP2B 4KMLB 1A14H 4UT7L 4K23H 4KKLC 3ULSA 5B39G 4W4OA 4D0BA 2YXFA 4I18A 3RU8L 1D5XB 1EEZA 1L7IH 4HS3A 4Y19D 2CIIA 1NC2A 5HPMA 3MNZA 1I8KA 3DX7B 3IXTB 4PJ9C 3FQUB 3W9DB 4HWBH 4M4PA 1LP9E 4IRSB 3TGXA 4X7FC 2NQCA 1HHKB 5I1DA 5LXGL 3WV0A 2F19H 2BNQE 4JPKL 4PY7B 4ZTOL 5GZNC 1JI2A 3MLXL 4JLRB 4Z0XB 4LSSL 4Z7OE 2Z91B 3FN3A 4WW2C 5GJSL 1IM9D 1EJOH 2K9UA 4PJIB 5IEHA 3FB8A 1C5BL 5GGVY 2VR9A 4XCNB 2XKNA 1X9QA 4HPOH 1P7KA 2EDHA 5TF1H 2FR4B 1G7JB 4KU1A 3V6OA 4UB0L 4JVPA 4YHML 3LS5H 4YLQT 3T0WA 4OF7A 1F6FB 2HYMA 4PREA 5KS9F 5FYKH 1Z0NA 4PPTA 4CVXA 1FAIH 3BWUC 2DMBA 3FFCA 5T5NG 2BSED 5CKGA 4CU8A 1EO5A 3QG7H 3O3DA 2DF3A 4PP2A 2H6PB 3ME0A 4FFVD 3PP3K 3FQRA 3I3DA 4YQXH 4HFUH 1KJMA 5DJXB 3ZT5A 3WKMH 3QDHA 2BNRD 4HWUA 1WBXB 3MV7A 5HDBF 1K9TA 2E6QA 4U0QB 3FQUA 4WI4A 3W9DA 1BX2B 1YYLL 1NGWB 5KVGL 1NCDL 1OT1A 2HJKA 3ILQD 3DX9A 4KDVA 3PXHA 1YA5A 1U8NB 3EO9H 3MODL 5FO9A 1F8TL 5IT2H 2BNQB 1BREA 1L7TH 5C7XL 2PYEE 4YX2H 4HSQA 1RJLA 4OM0L 3PV6A 1NKOA 3I2CL 3FO2B 1CQKA 5DQJB 5KSBA 1WGOA 3CPLB 3GSQA 2JELL 4OI7A 4LQ1A 3A67H 2E6PA 3U82B 1TQBC 1UKQA 1U2HA 4IIQB 3MJ7B 3MOBL 1J1XH 1KV3A 1UT9A 5GRZA 5I8OL 1A1OB 3V4VH 1WSST 5MHSE 1NC4A 3GSVB 3K2MC 3VFVB 5A43C 2AQ1A 4D8PA 3CX5K 2J8UE 4EUPH 3F12B 3T0EC 1N0LA 2NY1B 3D85B 3TBWB 1U8HA 3CXHJ 3L6FA 3WJJC 4GKZA 5TGBA 1DBMH 4JZJA 1EFQA 4WU7A 1D5MA 1UENA 2A1WL 4QTHB 5FDWB 32C2A 4G8GB 4GG8B 5IVZA 1LDPL 4NO2A 4HK0A 1KCUH 1XAUA 3T4YA 3BN9D 4HWZA 1SBSH 3STLB 4IDJH 1H9VA 1NCAH 2ED7A 3HI5H 3QUZD 4PJCE 1RUML 4QTHA 5FDWA 4R96B 3WIIL 5K9KB 1MCWM 3BDXA 2LVEA 5J0BA 4JM2D 2I26N 2CDEB 4KMQA 4DTGH 4HCRA 2E3VA 4YXLH 4PJ5D 1T2JA 5KVEL 3VXUA 5HI3D 1C08A 3MGAA 1YYML 4XB7A 3D39A 4YBHA 1SHMA 2V5YA 3EFDL 3U4BH 4FHBD 2WWMC 2VABA 4XP1H 3MACH 1FZMA 1SYVB 2JJTA 4Y7MA 3WFZA 3VXRB 3KPOB 1JK8A 1OAQL 4X7EC 2HT2C 1F4YL 4WENB 3LHPH 3QWOA 2GSGA 1AKJA 4ZUSB 1HDMB 3QYCA 4S0TD 3UBXB 1K8DB 2VXTH 3BESR 4ZODA 2AJUH 2VL5B 4L8CA 3MRNA 3LS4L 2VMFA 2Y06L 3K1KC 4G7YL 3EUUA 4MD0A 1IGMH 2DQGL 3H3BC 4X6CE 1URLA 1E4KC 2B20A 3G5ZB 5IB3B 2DTML 1OAUH 5DXWA 4UI2A 2VDML 4XMPH 4ODBD 1N6QH 5J6GB 1JGLH 3LKOB 4YO0B 2D03H 4N8VA 4HPYL 5GISL 5CJXA 2ADIB 1MAKA 1ZS8B 3KJ6H 5EZIH 4GS7C 4BFIA 3CSBA 2FBOJ 1D5ZB 2VYRE 2GT9B 5HGGS 3W11C 2BK8A 2NY4C 1BECA 3VWJD 4F15B 4LPWA 4S0SD 4JANB 3P9LB 4O02L 3V5DA 4N9OB 4WU7B 3T2NH 5I73B 3B6SB 3DIFB 1S7XA 4M1GH 3MLZH 3WDHA 4YHYC 1T7WA 4YX2L 2R0KH 4NWTL 3QUMH 2EEDA 4QHNB 1A2YA 5EU6D 5FYJL 2VQ1B 4JM2F 5BRZB 2UWEF 3TBTB 4Z95H 4OCYL 3PL6D 2JELH 5DD1L 5GS1C 1DUYA 4PREB 3VWKC 1MRFL 1QLRB 3LKRA 3OGCA 4GAGL 4GAJL 1JWMB 2EIZB 1AFVH 3X13B 2Z9TA 3V6OE 5I1CH 1FH5H 1MCIA 2Z31D 2VDOL 3MJ7A 4F7TA 4Z7WF 1OQOA 2MKLC 3AUVA 5ANME 5EBWB 5C0RH 3GJEA 1PFCA 4U31A 1KF9B 4S1RL 1P6AB 5HYJA 4F57L 3DVNA 3QPQD 2A83A 4TUJB 1X5IA 4I2XA 1U3JA 1UA6H 1JL8A 1J0IA 3O8XB 4IS6B 4K3JH 3JWDH 4X4XB 1I7ZB 1ZT1B 2Z91A 1RK0B 2P42B 1P7HL 1AIFB 5I18H 3ES6A 4JFEB 3J7HA 3QNZA 3BDYH 5C0IB 3HR6A 4XI5C 5BOPA 1KB5L 2EDNA 2J8UB 5EFIA 2P44B 3QUKB 4NQED 3HE6A 2OL3L 1CDJA 4GH7B 4JO1H 4PRHB 5DUPH 3L3IB 4FXKA 1ACZA 4D94A 2YXMA 3BSZL 2F53B 1QSFE 5I8EA 5JW5A 4LL9A 1J05B 1FG2B 1V5JA 1YEKL 3DI2B 4GJTB 4JPWL 1W8OA 3VMNA 1BFVL 3SDXA 1JGDA 1NSNH 4OIIL 3EOTH 4GRLA 1OGAE 3ZDZF 4BZ2L 4U3XA 4MAYD 5DD3H 1A14L 2FGWH 4UT7H 1AJ7L 1X5ZA 4K7FB 3NA9H 1A6VH 2V7NB 3H0TB 3FT3A 3PHSA 1E28A 1AGEB 5I1JL 1NEZG 3QEGH 3PWVA 4XC1H 4L3CB 1IC4H 2EEAA 5I8CB 4FXGB 4FFYL 2PYED 3RKDC 4JREB 3IF1B 1CZ8H 2H41A 3KWWB 5EULV 3CK0L 1G0YR 1ZMYA 3RWEB 2UWEB 3KR3H 4MNHB 3S4SB 1PBYA 2DKUA 5E8OA 1BJMA 4ZUTB 2YC1B 3KS0J 4NOBA 2EE6A 4TSBH 4M3KB 4HWEH 5CGYD 5E1AA 1P5VA 2A73A 1JWSA 1PDKA 3BPLB 4UILL 1A0QH 3O6LL 2JIXD 2JLLA 5IIEB 3ZO0A 4OF5A 4JY4B 5FM4A 4CNIA 1A6ZB 5D1ZD 3G6JB 3U9PH 1MIEL 3HE7C 3K3QA 5DTFA 3TNMB 5LCVH 4KTDH 2FD6L 5DURD 5CIPH 5KG9B 1LEIA 3NZHH 1HQRB 2PW2B 1BM3H 3ES6B 4JFEA 2BVPB 1A4KA 1LO5A 4Q97A 1IL1B 3RTQB 2VDQL 4X5XB 2FX9H 2XWBB 1OY3B 1OGTA 2Z8WC 1NFDB 2ZUUA 4N0UB 2FZ3A 5MI0B 1CF8L 2IANE 2Y23A 5IHUL 3C5JA 4XAWH 1RUKL 5F6HJ 4RFNB 3BPOB 2NXZC 3PDOB 4NBXB 1NCWL 2BJMH 2HVJB 4UOJA 1LE5A 4NGHL 1KJ2L 4XCFL 4YR6A 1Z0MA 3U1SH 3IJYA 4Y1AA 5ICZB 4WTZG 2AEPH 5C2BH 1T1ZA 3VXQA 1DTUA 1RZJC 4PJFA 2OTWA 5ALBL 4DN4H 4K9EH 4H8WL 5EB9A 3CFBA 2UZIL 3VU2A 5I1EL 1FNEA 3LY6A 3TYGH 2JE8A 5LVEA 3CX5J 1YEEH 3RY6A 3KLDA 4YFLI 2UZYB 1T1ZB 4JG0L 1FGVL 1I9JL 1R5IA 4NJAL 3O3BA 4LGPB 3Q1SH 4I2XE 5E5RB 4DGVL 2R15A 1FZOB 5D72H 5I71B 4OQTA 2YD9A 3SGJC 5CD5D 1OT2A 4FOMA 4HGKC 1GVIA 1KCVH 4M1DH 5SX4H 3WYRA 5C0JA 5ITBL 4N8VG 3P4MA 1BF2A 1RPQA 3U79A 3WNMA 1XCTB 1EX0A 1ZHNB 2NXYD 4KQ3H 3JUYA 3B2UC 1NMBL 4JZJC 3CFIC 3ZHKA 2R39A 4P3WA 3P4OA 2XWJB 5GGTL 4FTVB 5JMRA 1QEWB 1SYSB 4QRUA 4TN9A 5HHOB 5HYJE 2XQYG 3FB7A 4OLUH 5BJTB 4I3RL 3RGVA 4P2QA 3ABZA 3UROR 3ULUD 4X99B 5ILTH 2AEIT 5BVJB 4Y1AE 3B6SA 1RJZB 4XC1L 3GSWA 4O58L 5D5MB 2QKIA 5BS0D 5BRZE 2W91A 5MERA 2HLAA 1OSPH 1JNLL 2C3GA 4XBPA 3CCHB 4R0LC 5E7BA 2YPLE 4WUKH 4TVSa 4AEIH 4RMRA 1G7PA 5FUOH 3T0EE 3L95B 2YOCA 4JDVA 1JPFA 1JF6A 12E8L 4Y5VB 3C2SA 2Z4QB 2GCYB 4K7PY 4LSQH 4L8CB 1MIEH 1U8OA 4TRPH 5C0DB 4LCCA 4XNQA 3WFHB 4YHIB 5DRZB 2A77H 1CXHA 3WHE1 2R0LH 2QQLL 3HA0A 3MRHB 4MNQB 3ROLA 5I75B 3RL2A 3OR6A 5EA0L 1AGBA 1CGWA 4R4FH 3QFJD 4O2FA 4JFXB 3GI8L 1IRAY 2P5WB 1FZKA 4JFQB 1YY8B 1J8HD 3C5ZD 1MHPL 4UU9B 3OKEB 3HCVA 2AJSH 4G6KL 2YPLB 3VMPA 4PY8I 1OAQH 1EO7A 1KTRL 3MBED 3C5ZA 2CLRB 4K3DH 1ZLUH 5HBBA 1FVDA 1HHHB 4HWBA 5DGQA 2APWA 3AAZA 1G7QA 3DECA 3RDTA 4F7CB 4K7PL 3GJFH 3O8XA 2P8MB 5TH2B 1BBDL 4P4KC 5L88H 2V17H 4KHXH 4L3EA 3I75B 2BVUA 3D39E 1YQVL 5TDOB 2BZDA 3WCYA 1YEDB 1AGDB 2EKSB 3OJDA 1HWGB 2NX5A 3UPAA 2RCSL 1BIIB 3GRWL 1A5FL 3BQUA 3IGAB 4DEPB 3PIQB 5IM7A 2HJKB 1TCRA 2VAAB 5ACLA 1OAYL 3B9KD 4N8CL 3DURB 4YFLF 3KPSB 5CCKH 4J4PD 3WHXA 4OLVL 4H5SA 2V5RA 3PGFL 1E4XL 3FT2B 2EH8L 3GJFA 4MQ7A 3FONB 3QIBA 2YN3A 5F93C 2IPUG 2BDNL 3LEYL 1IEBB 4EDWL 4Y5YC 1IC1A 2X4NB 2Q86A 1IBGH 1IARB 3TCLB 5DQDL 2XWTA 3U6RB 3BJ91 4NRYA 5MP6L 3CH1A 3HE7D 3PABB 2VSDA 3I3BA 3PV6B 4K8RH 4QYOA 3BEWA 4X5XA 1P7QD 3Q6GH 1AD9A 2VXSH 2QADB 3PQYD 5ID0B 2XZAH 4DW2L 1CFSA 4J6RH 2IBGA 4RGND 1FH5L 4XBGA 4KJPD 5DS8A 4CNIB 1T5XB 4XPAL 4X7CC 2YUWA 4GXUN 3QPXH 4Y4FA 3GBMH 4S1RH 3QO0B 2G2RB 2X4RB 4NUGL 4R8WL 2G9HB 5E8NB 5GGTA 1N6QL 1BIHA 3DMMC 2GK0A 5DDHA 1CT8B 1Q9WB 3E0GA 3RVVD 5FA4A 4I4WB 3S3JA 4NHCL 5D70L 2DWEA 4QRQB 2JJWA 4LKCA 1HKLH 2IANB 4PRAB 3LQAC 3S88H 1F3DH 5T3ZD 4P2OA 3NFPA 5FCUH 2CDFB 3QIBC 5I1LB 5FXCH 2DJSA 4ZPTA 5JPNA 4LLVA 4HS6A 2F54B 1EFXA 3CU1A 1CBVH 2WBJC 1PKOA 4PJAF 4UIKL 3ARGD 4WWKD 5DR5L 3MOQA 2WUBH 3DTXB 3EOBA 2NPLX 4DZBB 3LQAL 1A7NL 1L0XA 1WK0A 4NPYA 4YHKL 3MCG1 3PJSB 2ENYA 3NACL 4LKXA 5BZDA 4NC1E 4S2SB 5I1AB 1S7UA 1WFUA 2HG5A 3VG0L 1RZFH 2W65A 1IEAB 5IGXL 4KTYA 1A6PA 1MEXL 4C56E 3VI3E 4WFEE 3RZCC 1F00I 3P73A 2OYPA 3VD4A 2VOTA 1T20B 3NAAH 1BFOA 3KJ6L 4XZUB 1E4WL 4MLIA 4PB0H 1JHLH 3BEVB 1HI6B 2Y5TA 1KEML 1XZ0A 2VXQL 2X7LB 3QG6A 3I3EA 1FL5A 2HWZL 1INQB 3F7QA 4LFHD 3WLWC 5K9JL 2XN9D 1NC4B 1TNNA 3ZDYE 3QH3B 3SDCD 1LE9A 4DVBA 1S9YB 4FZEL 4ZSOB 4OLWH 3V5KA 4EI5B 1J10A 1DLFH 1FDLH 4YWGH 3QCVL 2IPUK 1IILE 4JZOA 4OZFG 4KUCD 1F3RB 5CGTA 4JQVC 2NW2A 1CVSC 1QKZL 3P11H 4IEFB 5KS9B 4HMEA 4YHPB 4MD5A 4X7SH 4AEFA 3A6BL 4QY8B 3KXFD 4OZHA 43C9A 3S3SA 2VLJB 3NPSB 4EZMA 4F37F 2XQBH 4Q58C 3NIGF 3MLYH 1YC8A 4J3UA 3VD5A 3JVGC 3KYNA 2BCKB 3KPPB 5EOCH 5J12C 1GYAA 1QTYT 3DUSA 3GUTA 1U8JB 3BZFB 5GGRY 4N0FB 4XP5L 4MS8D 1IKNA 4XCYB 3PHQA 5LG1A 5E9DD 4EKXA 3GSNL 3ZZ1A 4DKEH 2HJLA 1BOYA 4KQ4H 2WP3O 5F1IB 3GNMH 5BW7A 1RULL 3M8OH 1YEDA 3QDME 3V8CA 3ZDYF 1B9ZA 2WBJB 4UT6H 4G6MH 1D7FA 4HJJH 1WWCA 4HJ0D 4EBQL 4X0KA 3SDAC 1DE4A 4OGYH 3D69B 3RIFK 3MRGB 3D1MC 2Z0BA 1YEFL 4AENB 1T7VA 2D7NA 3P0VH 2XN9E 4N8VB 4U6VL 1GOFA 2EDKA 3CDFA 2A9ML 5J13B 1F4HA 4LCYB 4NHCH 4KGLA 1MQ8A 3DNKA 5BJTA 4OSUH 4RIRA 3WFCH 1HKLL 2P5WA 4K07A 5CUSH 4FQQB 5EO1A 2HRLA 4OZGE 5HVFB 3S88L 2A6IA 3BJLA 5ID1A 2YD4A 3WD5L 4NKMA 2PO6B 4PJ9D 3GSVA 1RK1A 2WMPA 2B7DT 4PJIA 4NZUH 1OAXL 4JJ5B 2DWEB 1OQXA 3NIFF 1OF2A 4F9PA 2HT4C 4ELKB 3NIDF 2ZUXA 4R7NA 1XGPB 2ZZUT 4NBYB 1VHPA 2Q76B 3CSYB 3MJ6A 1DQJA 1CDYA 5TPWH 3ZTNH 5E8PB 3H7LA 1UWXH 4F37K 4P9HC 5I6XB 5I2IB 2P48B 1Q9KA 2IQ9L 3FTGA 1OTTD 4FNLL 3H7BA 3W0WE 4PR5A 3RUGA 5DK2B 1D5XA 4R96A 1NAKH 1IQWL 3C8HA 5L2JB 3LPGA 2QQKL 1D6EB 1HNFA 1E27B 3MRCB 3W2DH 5D7JC 1BWWA 1JVKA 3DGGB 2HKFH 2F8XC 3I6KA 2J1KA 3PWPE 3DV4B 3VXRE 1BAFH 4IBLT 1GGCL 1KJ2A 1I85C 1CXLA 1GHFL 3FQRB 1J87A 3QCUH 1A47A 4LHJB 2HAZA 3FB7B 3X12B 1PSKH 5J57B 4QCIB 2IBBA 4QHLA 1P5UA 4U1KA 4Z7WB 1UGNA 4LLMA 1C5BH 1WAAA 3ZSSA 1QSEB 3W39B 2EC9T 4Y5VC 1YEJL 3KPRD 1QHOA 1RV6X 4ZQKA 1P7KB 3NCCB 1BIIA 2ZPKH 4MYWB 2BNRA 4HC1L 4NQSB 4ISVB 4Y8DC 3MBEA 3G04B 4LLYA 3E3QC 2NYYD 5HPOA 4AQ1B 2V5TA 3WHE0 5EO0B 1MOEA 5EN2B 4PRPB 3GI8H 1CLCA 3OL2A 4NZJA 1ZLUK 5C08E 4X8JA 3ARWA 1MHPH 2W9DL 5HDQH 2UYLA 2AJSL 3S35L 4PRDA 1OPGL 4DCQB 4P3CH 4WFFD 5I1DB 4R3SA 2DKSA 1J5OH 2IFFH 1G9MH 1QD0A 5CGMA 2E9IA 2VITB 3FN0H 5E2UL 1FAKT 1FFQA 3SDDD 3GSNB 3U0PA 1GCFA 1UCBH 3KPRE 3CX2A 3SJVB 3QIUD 3IB4A 3F58H 4ZTPL 5H2BA 5E6IC 3P73B 5KZCB 1OVZA 2R8SH 1L4IA 4DZBA 4JRYE 1KIQB 4UTBL 5IFHL 1CGYA 3BVNB 4LCUA 3VFNA 1Z5LB 3OB8A 4POYA 2W07A 2IAMC 2KQMA 3U6RA 1XGUA 1HHIA 1A22B 1KXQE 1JJUA 3DYPA 2PNDA 1WAAE 2FJHA 5FM5M 3EOAA 1TZGL 2JB5H 4MWFA 4M61B 2EXWD 3IKCB 4PJ8D 2X4QB 5DJYB 5F70A 4KGJA 4W81A 4KVCL 2PETA 4P2QD 5DK3A 4YC2C 2MQ3A 1Q1JL 5HHMD 1EGJA 3VXME 1KYOJ 1HZHL 2ZSWA 1II4E 1AO7B 3KVQA 2RQ8A 1HWHB 2KH2B 5BS0A 1PZ5A 1BZ9B 1F4AA 5C0FA 3GSRA 3I6GA 4JO4L 3QHFH 5F8QC 1MJJA 1XR8A 2VH5H 5FB8A 3B4NA 3KNBB 4LLQB 2WIIB 1A3RL 1ED3A 4WV1B 4HJ0C 4UINL 5FYJU 4NQDE 4LFHG 1WC7A 5SWSB 5KTEL 3VXTB 4KDWA 4IDLA 1NUDA 4UQ3A 3BPCA 3IU4H 1RUKH 3T2QA 2C7UB 5HI4D 2AJZA 4Y19A 1CG9A 2FB4H 5CINH 4GO6B 2DQUL 3ULVL 3DUUA 4YXLL 5L7XL 2C3HA 4OCWL 2PTTA 8CGTA 5DJDB 4M7KH 5C0JB 4L1HA 1I8LA 1G7LA 1EEYA 4RFOL 3SBWA 1MCPL 1YC7A 4NRZA 1PEZA 2GI7A 4G9DB 4HD9A 3BUTA 3NFNB 1FZOA 2HFTA 2AJ3B 1RJYA 4DOHE 1FO0B 4YHIA 4FS0A 3OPZH 1KT2A 2DLTA 25C8H 3U2SB 4POUB 1DEEA 2EH7H 1N5AB 1T4KA 3DGCR 5CZVH 3GRWA 5EDXA 1U8JA 3CSGA 4K7PX 1JUFB 4NT6B 1G7MA 2C3VB 1J1OL 5GRVL 5HHPA 4MB5A 1AD0A 3VXPB 4QF1B 3UDWA 3S35X 3WNKA 4XNUH 3RX8A 5I74B 4Y2DA 4PD4J 3CFEB 3IFNH 5AUMA 4D9LL 1KPUB 4OBSA 4E41A 1IE5A 1TTFA 5C09A 1FV1B 1CLOL 1R3LA 5D1XB 4NKOA 2VLRB 5TH2A 2L7JA 3UTPE 4XNZB 3EGSA 1HHHA 2BRRL 1KYOK 1PLGL 1DBKH 2B4CC 2O5ZH 3GSWB 1AKJB 3KXFE 4WGWB 4WV1C 4UDTB 3SDXF 3MOBH 4AG4H 4XWOD 5DRNB 1YPZE 2AJZB 1VCAA 2VKWA 4Y19B 2WV3A 3AC0A 5DEFB 3DRTA 1UXSA 1QFUL 1IEHA 5DVLA 3MV7D 5F97E 4LOUD 4Z7VB 3WNNA 3VXTA 3VDAA 2IH1B 4FQJH 1QEWA 2J8UF 3QRGL 3RZWA 2B4CL 3S36H 3GMMB 2XY2A 3FQWA 1R3HA 4ELME 5C0GB 1ZA6A 3MJ9A 4M4RA 4UDTA 4M5YL 4MNGB 3TJHD 5L9DH 3L3GB 1I7RA 3TT1H 4U7KA 1U3HB 3QIUA 4BSVB 1U8OB 3BN3B 4MAYC 4PJEB 3H8NA 4S2SA 5I1AA 4FQ2H 4EBQH 3E2HB 3DX8A 4TUKL 2P8PA 2FHBA 5DD0L 1S8DB 4WI5A 4GQ9H 1YEFH 3MJGX 4I8DA 5TGBB 4BH7A 3GI9H 5L2KE 4IRJC 4OCSL 4XNMB 1ZANL 2F58L 4PJGF 2D2OA 2DBJA 1JPST 3G5ZA 1I7RB 1UH2A 3QHZH 2BRQA 4LCIL 3L5JA 3K81A 3HC0A 1LHZA 3IJSB 5E8EA 1CICD 1HH6A 4GRMA 4Y4KB 2FX8H 2QSCL 2IPTL 4R4FL 4QRQA 2W92A 1NCAL 2C1OA 3IDIA 4JO2L 3MV01 2VZ1A 4YPJA 3C5ZC 1MFDH 4MSWB 4HAFA 5GRJL 4N0CC 2DQUH 3PDOA 5D7JB 1XGQA 3RY4A 1OCWH 3MLTA 3OX8A 1S3KH 5TF1L 3G6DH 2DI9A 2CDGB 3C08H 2VR5A 1JN6A 3HUJE 3KGRA 3WKML 5C07B 4C4KT 3G5VB 2D03L 3LEXB 4YDKH 5JW4Q 5D1QB 2BNQD 3QT2A 2VZSA 3G6JA 2APVA 2NCMA 3TO4A 2JCCF 5BVPL 1R5IB 3GSOB 1X5GA 4BQCA 3X11A 4XMLH 2FLRT 5F7DA 7CGTA 4W6XB 4NT6A 3WNPA 1U95B 4G8IB 3T1WA 4AIZA 4LLUB 3EDFA 2V2TB 1FNSL 1GGUA 1WZ1L 3VRIB 4YHLH 2UWEA 4LAQH 3IAPA 3BP4B 5GISH 4XPGL 3HZMA 2GK2A 3D85D 3BXNB 1I3GL 2I07A 1H5BA 4G6JL 4ZPVA 2HVJA 3T09A 4I0PC 2FLBT 3VRIA 5C9JA 2QHRL 4G6AC 1MVFA 4G43B 2MQCA 4ORGB 1OD9A 4WHCA 3RVUC 3V9FA 1GOHA 1S7SA 2A0LD 2OJEA 1B90A 3V5DB 4Y4HA 5CWSB 1JZ3A 4AJ0A 3OXSB 5FKPB 4GW4A 1BZQK 3QXWA 2DLHA 4RAVA 1DN0B 3TIDA 4PS4H 2X9WA 3UTSE 4IOIA 3QO1A 4YE4L 3AAZB 3QUZB 4E0RB 3PWUB 2XNAA 2P24A 3CMOL 3QPXL 4U6YA 3RUGB 4JM2B 4EUPA 3UZEA 3K2UH 1OARL