3U9PH

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
184
Chain Sequence
b'EVKLQESLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGQGLEWMGGIWGDGRTDYNSALKSRLSISRDTSKSQVFLKMNSTDDTAIYFCTRCRRDSSYVVDAWGQGASVTVSSAKTTPKLVYPLAPVTLGCLVKGYFPEPVTVTWNSHTFPAVLQSGLYTLTSSVTVTCNVAHPASSTKVDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
molecule tags Immune system
source organism Mus musculus
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
total genus 28
structure length 184
sequence length 213
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH01
5IV2A 3NZHH 1C8PA 5T3XD 4GRMA 1CR9H 3X11A 5L6YH 5D7KE 1JGVL 1SYVB 4HFUH 4LKXB 3CX5K 2KL6A 2OBGA 3A6BH 3CFKB 1INQA 1HDMA 5C0RH 2HWZL 2P8LB 4XNMB 5C08E 3IKKA 2I07A 3PWVA 5HYJA 5HHOA 4AQOA 3RGVB 4CMHC 5DD0H 3L3DA 3O6KL 2HLFD 3CDGB 4Z0XA 1CD1B 3DBXB 3KXFD 4KZEH 1OAYL 3O3BB 3DX6B 2R8SH 3LKSB 2A6DA 4JANB 2VNCA 1T5WB 4HPYH 1G7HA 1DQDL 4XCNA 3T04D 3WDHA 4HKZB 1KCUL 2YPLE 1MCPL 4NN6B 3AMKA 5TE7L 3U0TB 4KRPD 1I3GH 5DMGD 1J1PL 3ARBA 1JI1A 1B9ZA 5JW4M 1IFHH 1OAXH 1JGVH 5CKAA 2A1WL 3BP6B 3T0ED 3OBAA 2CD0A 1NMBL 4AY0A 5E2WL 2BSSA 3V5KB 3ZYZA 3TNMA 4K7PX 1URLA 3QPQC 5SWZE 4JPVH 1I3UA 3EFDH 3MRFA 4L8DA 4PYGA 5HHPA 1G0XA 1EGJL 1BQUA 1JWMB 5MHSD 2BSSB 4JO1H 3R1GL 2WBJD 5DJCA 4ZUTA 5CD3B 1NCCH 2PXYB 3V2AR 4Q58C 2AJVH 2QADD 4Y4HC 1RUPH 4Q9QH 1F11A 4LU5H 2EXYC 1HE7A 4FZ8H 4NNPL 1G9NH 4DGYL 3CVIL 4HIXL 4Y2DB 5HHME 3MV8E 1NUFA 3ARBB 1MREH 3RA7H 2HFEA 4F37F 3H9ZA 1OP3H 1KIUA 4ODHH 1S9WB 3OJDA 1KV3A 4EN3A 1G7HB 4RGNE 1PGRB 1IGCH 4KMTL 4YNYA 3DSNA 3UYRH 3AGVA 4QRPD 1KPUA 1GGIL 3JV5A 1IAOA 4XNUL 3TZVA 1A4KB 4EN3B 2NY0D 1S9WA 3EYQD 3REWB 2VDML 5GS1C 3NBNA 1A14H 1WK0A 1CDUA 1FORH 4LQ1A 1EJOL 4ZSOB 5FYLH 4Z7QF 2CKBB 3TJHD 2VKXA 3S4SG 3O3EA 1KCRL 2PXYA 1NJ9A 1S7VB 2I26N 3BPLB 2H1PL 5DSCA 4LGRB 5SX4I 3X11B 3HZMB 4Q2ZA 4GRMB 4LL9A 3IDYB 4YDKL 4I3GA 1TPXB 1L9NA 1ZA3B 3RFZC 4GXUN 1KOAA 5IVZB 5DHXB 4F9PA 3TNMB 4X7SH 4XCFL 3T2OA 4WV1C 3LPFA 5LGHH 4TPRH 4XVJH 1J0ZA 2Q3AA 4TOYH 3CZJA 5J0BA 3S97C 4BA8A 3ROLB 1UJ3C 5F9OH 4U1LB 1R0AH 2AXHA 9CGTA 2RB8A 4X83A 2CRYA 1QP1A 3BXNA 1QOKA 4MA8L 1CCZA 1JPGB 4G7YL 1KIRA 3OB0H 4P9HC 3VFPB 3ZYJA 4XC1L 3MJ8B 2EC9U 4HZLA 4AT6B 5CFHA 2DWDA 1IKFL 3MBEA 4XCNB 2A6DB 4RNRB 3DX6A 5LWYH 3T3PE 3IDYC 4Z0XB 4LF3A 4MLSA 1BIIB 4WUUE 4WFGE 5MEOA 2NY4C 4MNGA 3L3DB 4TYUA 3AB0B 1PY4A 5D7JC 5DRXA 5FYJL 3MRGA 3G9VA 5IHZB 5GRZA 1HDMB 3GSWB 1J0KA 4IRJD 5EZLA 5ACZA 4O2EA 4JFFE 5C07E 5DXWA 2XY1A 2XZCH 3B8YA 5CILL 5CWSB 3ULUC 4LKXA 4KMTH 2GUOA 4UAOC 5D2NC 2BVOA 1KCLA 5E9DD 1RZJH 4KAQL 3WKMH 4Z7NF 3MODL 3DECA 4EN3C 5EBLA 1FDLL 1JNNH 1MIML 5FHBL 5D2LB 1FQ9C 2R4SL 2IH1A 2DYPA 3TV3H 4PLOB 1J10A 2MQCA 3PHOA 3S36H 3WN5B 4AL8L 4E5XA 2ITDB 1CS6A 1S3KL 3LMJL 2D0GA 1FL6A 3RIAK 5HYJD 5HVHC 5C9JB 1MFEL 2OLDA 1ORQA 3RIAF 5DUBA 3QJFB 4X6CB 4JY4B 2F58L 1S8DA 2VO5A 5GIRB 2M8XA 3DURA 3E1F1 1CFNB 3IFPB 3LOWA 1DUYB 4IRZH 4XPTH 3DLQR 4R4BB 4AEHL 3B5GA 4IRSD 3WHXA 4BZ1L 1YC7A 5EOTA 4DTGL 3SOBL 1XMWA 2VERN 4R0LC 1IC5H 4ONHA 3QEQD 3LS4H 3CGTA 5E2WH 1MY7A 3IDXL 5JZ7C 5FCUH 3MCG1 4PJBF 3NACH 4YHPB 5EU3A 1BP3B 2D4FA 3OAYH 3MLRH 3VXSE 4HV8B 3MJ7B 4U1MB 2UY6A 4LLVA 3KJ4C 3ARGA 4XBEH 1ZT7B 3QUYA 43C9B 1SEBA 1TCRA 1KJMA 1Z9MA 3FRPA 2DQJL 1HI6B 1T1WB 5F1OB 2R69H 5GPRA 2ED7A 1Y18B 3F7PC 3KYNB 5C08A 5TQ2L 1Z9OA 2YD3A 3BPCA 4NUJB 2EZ0C 3UTQB 5LGJA 4N9GA 3VRIA 4BSWA 3S3PA 2P5EA 1CGYA 5FUOL 4JZJB 4NOFA 4RGMB 4ZMAT 2FZ3A 3U2SA 3CDFA 1E28A 1YEKL 1BFSA 5CEYA 5FO9A 1CXIA 2BXYA 1U92A 2DQHH 5C1MB 2F5BL 1G7MB 2W38A 2EEDA 1XEDA 2YZ1A 2DKMA 5DHYB 1A6AA 4AIXA 5TE6L 4PJFE 5I8OL 1UEMA 1XGTB 2KPNA 4PS4H 4Q97A 1FV1B 2V2TB 1B6DA 3OB8A 3MRQA 3QDHA 4KTYA 4ODVL 4OSUL 4NCDA 1U41A 3T0BA 2OL3L 4HW6A 3L3KB 1I8LC 4CUCA 3SHSA 4KDVA 4RFNC 4X7SL 2CQVA 4WJ5B 4I0KA 1GGBL 4OQTA 4U31A 1FAIH 1C12A 1ZWIB 3SDCD 1I7UB 4QTIL 3EHBD 2XWTA 3CLEL 5I74C 1NAKH 5FV2A 3JVGC 4H88L 3MLTA 3ZKNC 3ARGD 3BQUA 3C87A 1CXFA 4KWUA 4QNPF 5I1LA 4L1DA 4MA8H 4PG9B 4MXVE 2YRLA 2FH6A 1KLGA 1SJXA 1QLEL 5C08D 1DL7H 1U8HA 3WS3A 4LPWA 3WO3B 1FLTX 1FPTH 2DQIL 5B8CC 4YHYC 3Q6FA 4OD2B 4ERSL 3IAGC 3HAEH 2NY6D 3AS1A 4U3HA 5HDBF 4HWUA 1J7VR 3IAQA 3C60C 4ZSOE 3K74B 2KH2B 3LZFH 3C08H 1LO2L 1MCKA 4Y5XA 3ISWA 3FT3A 4XC1H 5EUOB 5I1HH 5INDA 4WWKC 1XR9A 5E2UL 5E6ID 1A1MA 4GRWH 1A7QL 1NBQA 1LO4H 1U3ZA 5SWQB 3MA7A 2P8MA 1X3DA 3HI5L 2HFGL 4D0CA 4RQQB 5KJRH 5HDOA 4R97B 3T2PA 2W0LA 4KVCL 5ETUB 5BVJB 1QUNA 1FAIL 3ARFA 4PY8J 5BZDB 2GK2A 3WIHA 4J3XA 1PX4A 3CFBB 4M6MH 3RDTC 5JTWA 3T0EE 2G60H 3H3PH 4HIXH 5JMRA 1OGAB 3IGAA 2WIIA 1DVFB 3QNZB 3HNVL 2OXHA 3ULUF 4NQEB 3D3VB 1RULL 3CNKA 5MI0C 4KJPD 5E4EC 1FYTE 2YA2A 3CSBA 1OAUL 2DAVA 5IIEA 5GGRA 1RZIB 3BZDA 1H9VA 3EYSL 4O00A 5DUPH 5EA0L 1J86A 3IDJB 5DQDL 3VA2C 3QO0A 1KXQE 1R5IA 4LPUA 1FGVL 3PV6A 4HSQA 1A14L 2VIRB 5D5MB 3FCTB 1II4E 4OZGA 5EZJB 2LAAA 2YEZA 3LN9A 4NCC2 4Y5VB 3UAJC 4ELKA 3N85L 4KKLD 2OTPA 3MRNA 1RV6X 5FECA 1EEYA 1HHIA 4ZYKA 1A3RH 4LK4A 2YPLB 3SEPA 5IBTH 5C6TL 2HLAA 3BKYL 1SYSA 3QO1B 3QXWA 4PJFA 3L3JA 3FRUB 3I2CL 3SCMD 3GJFH 3KYMA 5ENWB 4QCIB 5HDQL 4OIBA 5JW4N 3OXSA 1CDCA 4NOBA 1YYMH 2IGFH 2Y5EA 4JDZA 2FCBA 2BRRH 2P45B 4I9WD 2DQDH 4KTDH 5CJQL 4XWOD 5DJ6B 3VFOA 4Z8FL 4JY5H 3CSPA 4X7TA 2AABL 5L2JB 3CVHA 5LBSH 4MQ7A 5HVHB 3MXVH 2HTKD 3LKNB 2LVEA 3BN9D 1YEEL 3C5ZD 3MYJB 1WC7B 4KK8D 2PW1B 3X14A 3WN5C 1XH3B 1U3HC 2LU7A 3SGJC 4GW4A 3K8LA 3QIBD 4NJAH 2GCYA 3T09A 3Q1SH 5D8JH 1MFEH 4OKVB 1W2KT 2M2DA 4X6FA 4EUPG 4AJ0A 3KPPB 3LAFA 3U30B 4L4TD 1UB5A 5JUEH 4KVNL 4FQHA 1ZT1B 3IRZA 5C0CB 5I19L 1XCQB 5C8JA 2VABB 4DVRL 4UAOB 5D2NB 3NIFF 1LEKB 4DN4L 1CZ8H 1FZKB 1MQKH 2VAJA 5E94B 3B3IA 4WUKH 2F74B 1J9CT 4HIHB 3QT2A 4X6CF 3KLDA 3SCMA 5J1SC 4IIQB 3SKNA 1TMCB 5EUOE 4GW1A 5I30L 1VADA 1LK2A 2V2WB 3BKMH 5HI3C 2W65A 4MQTB 1B0WA 4U6TA 1DQDH 3M1BA 4NT6A 1XGPA 5C09B 1X9QA 4POYA 1TETH 3FONA 5E4EB 5I6XB 4DOHB 3CFDA 3H3BC 4DGIH 1NSNL 2GK0B 3QAZC 1IGYA 4LGSB 4U3XA 3NCJH 3ME0A 1M71B 2EH8H 3HG1B 1JV5A 1WWCA 5CSZB 2DTML 3S5LG 1FJ1A 4J4PD 3W39A 3IKCB 2CKBH 4P46D 4ZOEA 1V5JA 5JW3L 4PY7A 4EI6A 1UZ6E 4IEFB 5BV7B 3E2HB 5D1ZC 2QQKL 5HTSA 5EIIA 4R2GC 5DC0A 4WV1B 2Q6WA 1UZ8B 4R97C 1C5BH 1EEZA 1RK0B 3GO1L 3RVVC 1KT2B 1MH5A 2DRUA 1EEZB 3MQIA 4MAYA 3MLXL 5C6WH 4LVOB 1ZGLB 3CSYA 2WK2A 4OD3H 1JTOA 4EI6B 3OV6A 1RIHH 2IFFL 4MX7B 2NNAA 5ISZB 5HHNB 4Z5RB 1J0HA 2W07A 1MI5D 4BH8A 3WJJA 4E41D 3GKWL 3BGFC 2HLFC 4Z7QE 5CEZE 1U8PB 1A6UH 3F7RA 2QJDA 3BJ91 3BO8A 3QDMD 1N0LA 4CNIA 1KJ2H 2R0WL 5LAXA 4NQCE 4PJDF 2VDNL 4LNRA 4NT6B 2BX5A 4QTIH 1IM9A 3MCKA 2R1WA 2NXYD 1TDQA 4M6ML 1SM3L 2QR0B 1ORSA 1QZ1A 3HE6A 5B3JE 1QSZA 4MMXC 1AXSB 2ID5A 4IIQA 5IBLD 4XPBL 4U6XA 5E99L 5DURB 2MKWA 3IB4A 4YPGA 5SWSD 4LSDA 3AS3A 1RI8A 4X8XA 1JYVA 4MSWB 2VABA 3QPQD 4Y19D 3LRHA 4I48A 3HNSH 1RUMH 4K3EL 2YD1A 4EQ3A 1WEJH 4XRCB 5HHXL 1CT8B 2XXCB 4OZIA 1FGNH 1AQDB 4M4RA 4HMCA 2WQRA 4OLVL 1MY5A 4JFEA 4Y4HD 1J8HB 4KHXH 4UQ2A 2IANE 1DDHB 4E41A 1WAAF 1ODAA 5DD1H 1H3WM 3OKEB 4LARH 1S5HB 2ENSA 25C8L 4YHOL 1YMME 2FECL 5C07B 3ZDYE 1BPVA 3P3YA 1RZFL 1LNUB 1PBYA 1AR1C 1R3HA 3P4OB 3UO1L 4NRZA 4ZO6A 4PD4J 5DUML 3UZVB 4I4WB 4Y88A 1MPAL 2NY3B 1FORL 4JLRA 1EBPA 2YPVH 1X5XA 2KQNA 4LASL 4CRPA 3I3EA 1FFRA 3FO2A 4PJCB 2JIXD 1EAPA 1QFUH 4M1GH 4ZO8A 3GK8H 4M6NL 3BSZH 3L3JB 3FT4A 4HAFA 3ZDXF 2F54E 3GUTB 1IMHC 3QO1A 2F5BH 3X17A 5JLZB 3ARWA 2HT3D 3S88L 1XGUB 3JZ7A 5EO9A 1VFUA 2DQEL 3H7LA 4PRNA 3VFUB 3D0VB 3I84A 3BVNB 3C5ZA 3DO3A 2QQQA 4NZUH 1MREL 1MCRA 5IHUH 3RA7L 3MLZH 5GGQL 1PKQE 2CLZA 4K8RH 3IFNL 5I1CL 1JWUB 5IW1B 1X5FA 4OZGB 5E8EB 1OAQL 1J5OL 5DK3A 2HTLC 3GSRA 4JFED 1RK1B 3ARDD 1F4WH 3SDYL 3JWDC 5AZEL 5IESL 1P69B 1X4XA 2A6IB 2R15A 4L3EE 1JFQH 4Z7UE 1OTUC 5CBEB 1TJGL 1A21A 3KWWA 1KN2L 2DMBA 2JCCA 2IADA 3BEVB 3MNVA 4WEMB 4X9GA 5IB3A 3FQUA 4D3CH 3KG5A 2Y9RT 5K9QG 3U4EB 1NCAH 3RP1A 2GHWB 2FH8A 5IFHH 2WIIB 3QNZA 5JXED 3O45B 2VLLA 4NO2B 3UJTL 2BJML 3DUSA 1C08B 1DEEA 1OB1A 1KJ3H 5H2BB 2GTZA 4QRQA 4OI7A 4L5FH 3DV4B 1G7QB 2BY1A 3QDGE 5ETUA 3RWIB 1QKZH 5BVJA 2XN9D 5E0QA 5CGTA 2GITB 4AYFA 1FYTD 4D0CB 3MRCB 4X4MA 2Z91A 1EFXD 4PGZA 3HE7B 2VXSH 1FZMA 2G75A 4I2XE 4ZFFA 1L7TL 2AJSH 2P5ED 1GJIA 1H15B 1OSZB 5EZIL 1OSPH 2IQ9H 3GRWH 3ULUD 5ALBL 3O4OC 3DNKA 4NRXA 4LBEA 1NEZG 3JXAA 4C83B 4ZUUB 3MLWL 4DZBA 2F8VA 4G3YH 3UTOA 5TGBA 3WS3B 2IEPA 4AL8H 2OTWB 4UIMA 4X9BA 1DQLL 4PG9A 5D7LA 4OZHE 1KULA 2DQTH 3MLYH 1Z3GL 2X4PB 1D6EA 3ULSA 2XFXA 3C6SB 4OZIF 2EIDA 5EU7C 3PJSB 1JYNA 3KJ6H 3MRLB 4RISL 1NGQH 3X3GH 1HSAA 4M8QA 3OGOE 4NSKA 2A9NH 4NYLB 4YQXH 3IFNH 3WL9A 4IMKA 4ZUVB 5C0DB 4L9LA 1IQWL 4QHUA 2P48B 3N1MC 2H26A 2CUIA 1EDQA 3I6KA 5DK2A 1MCOH 2V7NB 3EFFB 3V0VA 5L2KA 4I3SH 2AK4D 4MVBC 1A6AB 5A2LH 3W2DL 4HS3B 1KYOJ 2NZ9D 1CI5A 2GTWA 1EFXA 4XI5D 1G7MA 1J1XL 4HS6B 3S4SB 5CEYB 3OKNB 5K59F 5E56A 8FABA 1RIUL 3ARVA 3MSPA 3U2SB 5EU4B 2Z92B 2FRGP 3DWTA 5DYOB 2OCFD 1NBVL 3I9GH 5DFTA 1BFVH 3LQZB 1P4LA 5JZ7D 4NUJA 4WHYH 3O9WC 5C08B 3VWKD 1JMZA 4NQED 2VZTA 4OFPA 5HI4C 3MV7E 1SQ2N 4MJ6B 1HI6A 3TBVA 3MRKA 5IVOA 5H35A 1S7QA 1MHHB 4L4VB 5K9KB 1ZXQA 3MUY1 4NN7B 3MJ6A 1KPVA 1CFVL 4XNQB 2Z9TA 4HV8A 4JRYD 3VDAA 3LKOB 5DD5L 3EO9L 3PHQB 3VG0H 1BZ7B 5D7IB 4PJAA 2WBWB 3JTSB 4MXQD 3QUKB 5J6GA 2FX9L 1RU9L 3UDWA 1P53A 5EU6D 4ZQKA 2PXYC 3K4AA 2HMIC 3KPSD 4KQ3L 3HR6A 2R2BA 2D9CA 2AK4A 1KCVL 1RJZA 2BFVL 4JB9H 1P7QB 4UDTA 2ARJQ 3MXVL 1C5BL 1NANH 4QXUL 4N9OB 4P2OA 2KBGA 4DCQB 4UDUB 4HMDA 5EWIL 1RIVH 1RJYA 1MCHA 4NZRL 2VLKE 3DURB 1G6RH 4X4XA 4KU1A 2IF7A 3QJFA 4PJEA 4NKMA 2ZUQB 5D7IE 3TCLA 3RDTA 2WZPD 3LY6A 3KXFB 4JN2B 1MJ7L 1AP2A 5C9JA 3BGFB 4WTWA 1FBIH 3BEWB 4IOIA 4NP4H 2EDQA 4HG4J 3RPIA 1DBKH 4GAFB 3X13A 5IQ9A 4G3YL 1L0QA 3B83A 1P84J 3MOAH 2CLRA 2I9LB 1U91A 4XP1L 3U6RB 4G9DA 2D7PA 4ZAKC 1FG2A 4NKDA 4MD5A 3ULVF 3VGGA 5C0IB 4CJ1A 1UM6L 3DX9B 5CEZD 1NCUA 4JO4L 3PDGA 1M7IB 4OLZH 1T66C 3VFVA 4QRPE 4MZ2A 4LCIH 1HXMB 5DT1L 5KSAD 2VDPH 1LMKA 5D1XD 5GHWH 4H25B 4WWKD 2EDBA 4MDIA 2R9HD 4P2OD 4YR6B 4X6DB 5IG7A 3QIBA 4YH6A 5DRXB 3SKJL 5EO1A 4MNGB 4JY6A 3KHQA 3DVGB 2SEBB 4Q9BA 1NC4D 3BWUC 2P4AB 4KROD 4NZTL 1OW0A 3EUUA 3EJYC 5GHWL 2XXMB 2KDGA 2R39A 3QWRA 1TNNA 1A47A 5E7FA 3WXWH 3F62A 3OMZA 1G9EA 4ZFZB 3C9NA 1HEZA 4BZ1H 3KLAB 4LDLB 1LEGB 1NFIB 2R4RH 3SDCB 1BVKB 2CDGA 1N0XH 1E4WH 4BSVB 5DHVH 4APQB 1JUFA 4QHLB 4NKIL 4XNZC 4Z7OF 4FQXC 5C0BA 5KW9L 4NCC1 3SJVD 35C8L 1BD2A 4RWYL 4I8DA 3RX5A 1F8TL 2GFBB 4QRRE 5F93C 1RZ7L 5F3HB 1FPTL 2DQIH 1HHKA 4L3EA 4QXTA 3HZMA 2A0LC 4Q2ZB 2FBJL 5I66A 1V3MA 3KPRD 5AYUL 5K9OA 4WY7L 3RRQA 2HFTA 2FL5B 4XH2A 4L4VE 2XQBH 3O3EB 1G1CA 3VJ6A 4DN3H 1N5AB 2CKBA 1XF2B 2X4QB 1G6VK 2XA8L 1LK3L 5TQ0H 3LD8B 4QNPE 5L2KD 5E95B 2IMNA 3REWA 5DJXB 3SCMC 4EQ2A 1JYWA 1D5XA 4CN4A 4PJ8B 3UTSD 5CEXB 5IESH 1KPUB 3ZDZF 4C56E 5DVLA 43CAB 15C8L 3K2MC 25C8H 5DEGA 5GGRY 1N5YH 4J12A 4Y5YB 5DJYB 3RVUD 4JFQB 4L29A 2WBJA 1IEAA 3PGCB 1JTPA 3ZE2F 5EOCL 3RVXC 3O9WB 3F8UB 2X7LA 1NBYA 3CVHL 3JWNC 3K8MA 3GZKA 1X6LA 5DDHA 5L7XH 4Y2DA 1I1AB 1BOGA 2X41A 1PAMA 2IPUK 4OZGE 3V6FA 4PREA 1JIBA 4HS8H 1PG7H 3GBML 4PRPB 4HWEH 3GMRB 3TT3H 4ENED 4EBQH 1NEZA 1QQDA 2QQLH 5FO7A 1JWMA 2E6QA 1YN6B 4OUUA 1QR1B 5AUMA 1DQJB 4LSPH 5ILTL 5DJ8A 1I1AC 2GIYA 1CE6A 1FVEA 2BVQA 3MV9D 5GSVB 3HAEA 4YBQD 5F7YC 3VI4F 1I8LA 4TPRL 1WIOA 4Q9CA 1A7OL 5EORL 2HA1A 4Y5YC 2MWCA 2ADGB 2NW2B 2XN9E 12E8H 1U2HA 2CGRH 2FX8H 3QDAA 4FZEH 2DWEB 4LVNC 1T2XA 4YK4B 3NFNB 3PWPA 3FL7A 2ICWI 3GNML 2UWEB 2NYYC 3LS5H 3RWEB 5A2KH 3O3BA 4NFCA 1YNTA 3DBXA 5GS3A 2GQHA 4LSUH 4F3FB 1RAMA 1ED3B 3RGVA 1QFPA 3HZVA 5GGUB 1MCSA 1IC4L 5FYKD 4K7FA 1ZE3C 3F6IA 4TUOA 4OGXL 3GMMA 4OLWL 4MQSB 5D1ZD 4FQPA 2NY1D 4BK5A 5C7XL 3UPAA 2X9XA 3OAUL 1R3JA 4PP2B 3RZCC 4OZ4A 1TJHL 5ESQB 1KXVC 1AFVH 2BNQB 1NH6A 4FQXB 4CVZA 2ZOKA 5BJTB 4ONGH 4RRPA 1KIPA 4LDEB 5KSAA 2ATKB 1NCDL 4N0FB 4R8WL 4Y7MA 4UV4L 5A3ID 4TVPH 2L4OA 5BRZB 3VWJB 1S9VA 1QFWH 2VXTH 5KN5B 4ZUWB 3P0GB 2BY0A 3KPQA 4W70A 2VL5A 2VZVA 1S7WA 5EC2A 3I6LD 4B41A 1DLHA 4HKXA 1JNJA 1YQVH 3CFIC 1D5MA 1RUKH 5HVFB 1NCBH 1V7NH 1RVFL 4YEEA 4H0IA 3TA3B 5FB8A 2XWJB 4OFIA 1IFHL 4W6YB 1NBZB 5F89B 5ESAA 3SOBH 2ZUSA 5I8CB 5DO2D 5A16A 3PWNB 3KPNA 2UUDH 1NGWA 4N8CH 4Z95L 1IAMA 1SJVA 2G5BA 4OGXH 5I75C 2NCMA 4W4OA 3SJVA 3MRDA 4HIJB 1NSNH 4U2YA 3H9HA 5LKNA 4K71C 1S7UA 4UT9H 5J06A 1CD9B 2BVPA 4FQIH 4GRLA 2EE2A 4Q0XL 4ZS7L 2XY2A 3EYUH 5EU6E 1J1OH 2UY7A 3W11C 3IFOA 1B4JL 1UJ3A 5I30H 1EHLL 3UJTH 3TWCL 2JK5A 3THMH 1NFDF 3MRRB 5F21B 5HI5D 3WE6A 1YY9C 4MJIA 4X5XA 2XTJE 2G5RA 2NW3B 3SPVB 2XPGB 4P4KB 1B0GB 3P0VL 4X98B 2NXZC 2NR6C 5IWLC 4JEGB 5D7LD 1XCTA 3GMPA 2XICA 2X42A 2P49B 2VAAA 3GMQB 4NWUH 4LCCB 3KS0H 3MRJB 4HKJA 1KJ2B 1J05B 1GAFH 4NPYB 4HK0B 4UV4H 5J12C 1KN4L 1C5DA 2J8OA 3AUVA 3LKQB 4OZIE 4LVEA 1T2QH 3QXUA 4GMSL 3UC0H 3KS0J 4P0DA 1EEQA 1T7YA 1TZGL 3S98A 5LWYL 2ZOLA 5C0BE 2ORBL 5ADPH 4K3EH 2X1PA 4XNXH 2XZQL 5ICYB 4NN7C 3MMEB 1KNOB 1G7LA 1X7QB 1MFNA 2J6EL 2WWMD 4LCWA 1J0JA 5T5NF 4HF5H 4O2FB 1GCFA 2H3NB 1NUGA 4XX1E 3QG6B 5H94A 5FUCE 2G60L 3TH2T 1I3VA 5BV7H 4HJJL 3DMMC 5F96H 4JHWL 3LS5L 3P11L 1D9KC 5TFSH 1K8DB 4O5LH 4NPYA 5CD5D 5JXEC 1IC7L 5I9QC 5D7JB 3SBWA 3CZFA 3GJFK 1A7QH 1T1ZA 2NY4B 4HKJB 2X4OB 5GJSL 1L6ZA 3G04B 1XGRA 3RL2A 3G04A 3NZ8B 4BM7A 3EDDA 3GMPB 2DM3A 1T1ZB 3QHZL 4IRJB 4RAUB 3I85A 3GGWB 3DVFA 3PQYE 4JG1H 1X5JA 3V52L 3UYOD 2NW3A 3QXAB 4N0CC 2J4WH 4KI5F 1OP5K 2CO6B 5C0EB 3VFTB 3HS0B 4PJ7F 4RX4D 4TNVK 3QISA 1UJ3B 3L5HA 4QRRD 3VFWB 1K6QH 3FFCA 4NHUA 3WEXB 1D6VH 3AS2A 4PRID 4EIZC 4O2FA 2W9DL 4O9HL 3KPRE 3Q48A 3V4UH 3B2VH 5KANI 5EIVA 1ND0B 1G7LB 1K2DB 1X7QA 3H9HB 1FE8L 5DR5H 5BS0E 3D87B 1JPSH 1LEIB 1FBIL 4NFDA 4UOJA 2C3HA 5ICYA 4OCNC 3TF7C 1CU4L 5EOCH 5FIEA 4PJDE 3QUZC 4J8RA 4FFVC 3BPLC 3DSFL 4EUPB 4UB0L 4JVWA 3ZSSA 1EO5A 2DTSA 5I8CA 4NM4H 5JDSA 2J8UA 3TFKD 1HQRA 3DMMB 3FB8A 5KZCD 3OKYA 2WUCL 4PR5A 4FFWC 5HHOD 3OKMB 1GZQB 2ADJB 4FXKA 1DCLA 2Y25A 3ZTNH 2NZ9C 1KG0B 2A83B 2VAAB 4HDIA 4WI6A 2H2PC 4QOKA 1G9NL 2P44B 4DGYH 2VR5A 3LHPL 3ZYIA 2R23B 1P2CA 1CLZH 4OIIH 3WNLA 5E8OA 1BQLH 1RQ5A 2VLJE 2GI7A 1FIGL 1WAAA 4JZNA 3MOQA 4MJ5B 4P99A 4X5XB 1MWAB 2VDQL 3EOTL 1G9MC 3INUL 3BKJH 1XF5A 4Y1AB 3C6LA 3D1MC 4DEPC 3S36X 3GRWA 1KIPB 2I24N 3U4BL 4S10A 1DBKL 3GM0A 5FGRA 1BMGA 4JDVA 4XP4L 1MRDH 4Z7WB 2WLYA 3BH8B 3VXTB 4E9LA 3QB7C 1NGZA 3BPNC 1U8JB 3WLWD 1QG3A 2WV3A 5BOPA 4WTZG 1EMTL 1F02I 3NFPA 4GO6B 1R3JB 4Y2OA 3DO7B 4OD1L 4QRRB 3J8F7 3QDME 4HIJA 5DR5L 4KK5D 4EOWL 4JGUA 4BFEA 3C2AL 5D5ME 5E2TH 3GMMB 3TBSA 4PJ9D 4BKLB 1YUHB 4PP1C 3PQYB 4Y16C 2GT9A 1ULVA 4DZ8A 3ILQD 4M7KH 5F89A 1HCFX 1KTRL 5CINH 1F2XK 3BX7C 4G8GD 4RBPH 4FQQB 5F7WC 4DKAA 3C8HA 2EDFA 4YXKL 5B39G 1RURL 4Q6IA 1AHWA 4GUPB 2CJUH 4C4KT 1R24A 2J6EA 4FP8H 2DD8H 2X4UA 4P4KD 1NC4B 1WT5A 4S1QH 4TSBL 5I76A 1S7WB 3CDYA 2VL5B 2XI9A 2EO1A 2AEQL 1M6OB 5F9AC 4OIIL 3IXAA 4HFUL 3T8XA 5IBUG 1S9VB 2R0LL 1E0OB 2V5YA 3STLB 3UZEA 1I7TA 1Z3GH 2Y36L 3GMNA 5T3ZL 1E6JH 4FTVD 2IALB 2NLJB 2DQDL 5IVXA 4XBGB 1Z9LA 1LP9A 2EE3A 4JCLA 1YMMD 3IVKB 3CIQA 4OJFH 4FQXA 4WTZA 1WIPA 4NM8L 2BNQA 1WBZB 3GKZA 4FFYL 3GJEB 3OJVC 1TJIH 5IJVB 1QBML 1NCWL 2ZSVB 3G9AB 3D18B 3O0RH 3PL6A 3FO0H 4PUBL 3R0NA 4N90D 4WI5A 5KSAC 4TUOB 2O5XL 2X7LB 2PR4L 1IGIH 2VLRB 4D9LL 1T04A 4K94L 2C1OA 4HGWA 5DMGC 3U4BH 1KFAL 2F54D 3DOSA 1UCBH 4F3FA 5TF1L 3TNNA 3MJGX 4TSCL 4EUPH 4M5YL 2EXWD 4KI5C 2AK1H 3WFDL 2ESVA 3DI2B 4NQTA 3GIZL 4K9EH 3B2UD 5DFWH 4PV8B 5CEXA 2WINA 2BNRE 3CFEB 3BP7B 3QYCA 2FHCA 2OJEB 3LHPH 3R8QA 1A5FH 1RUQH 3LQAC 3QR2A 2XZAL 3MLVL 3ARED 3EYOA 1F6LL 4FMKA 4AM0A 1FNEB 2VC2L 2FB4H 4ZTPL 1XF2A 2VDLL 1N5AA 2X1WL 1XR8B 4JPWL 4PJEE 5DD5H 1N64L 1FVEB 5D72L 3UJIL 5I66B 1HQ4A 4AEFA 32C2B 3GSQB 3P30L 2W60A 2QSTA 4HHAB 5JA8B 4NDMA 5CJBA 1DQJA 1WWBX 1KENH 3K0WA 5AUMB 1LO5B 1JPSL 2DIBA 2MNUA 4DGVH 3ZHLA 4UU9B 5BV7C 3GMRA 4D9QD 2XTJD 4QHLA 2YD2A 4JM4L 2QSCL 3U7WL 2DQCL 3TM6A 2DF3A 3KYAA 5T1MA 2ERJC 3S88H 5D7LE 4UNUA 1FL3B 3QDGD 3O9WA 1HEZB 2L7UA 3T0WA 1HH6A 3OKKA 3PGCA 4KGLA 1I7RB 1MCEA 3T77A 4NQDE 4WI7A 5MENE 2DN7A 1PZ5A 4PRAA 4QOKD 2AGJL 5JXAL 2BOBA 4HUWA 4OLZL 3ZHKA 1D5XB 5E1AB 4JY6B 1UM6H 4QY8B 1Z6JT 4MB5A 5K93A 1Q0YH 4YDIL 1E6OH 2Y06L 5IG7B 4YR6A 4Y4HA 5IB2A 1X5KA 3SDYH 2PO6B 4H25A 4IRSA 3TBWA 2D03H 4K7PL 4PJGB 5FV1L 1CN4A 2GY5A 3C6LD 4X6BA 1WV7T 1K8IB 4GKSA 3EJZC 2FL5A 4KKBD 3SKMA 1HHGA 5DJ0B 5IROA 1EFQA 3TJEH 1LDSA 2I9TA 4NKDB 4CN6A 2NY2C 4M7ZC 5DA0B 3NACL 3QG7L 2MCPH 1HZHL 4P3WA 4MAYC 4UV7L 2D7MA 4Z78A 4P5MA 4LRIA 1U3HB 2WQ8A 4EVNB 4E0RA 4JRYB 1IC5L 4U05A 3UX9B 3WNKA 3FRPG 2VISB 3HFMH 5IQ9B 2VYRE 3X13B 3BPNB 4WDIB 1R6VA 1FVDA 4BSVA 2RCSL 3ALXA 5FA4B 1BVKA 3UYPA 4AMKH 1VENA 2BZDA 1NFIA 2JKXA 5FUOH 1AP2B 1UACL 2WANA 1U8NA 3QCTH 2M1KA 3KXFA 4JN2A 5FUCC 2AXGB 5ALCL 3MBXH 2CRIA 4ONOA 3WJLA 4PGEB 1RJLA 4GRLD 4UMGA 3LRSA 3P73B 3G6DH 2Z35A 4W6WB 4P3CH 1RUPL 4Q9QL 5DJ2A 4TRPH 2JTDA 2I5YL 3ARQA 4ZPTA 5F7EH 2NY2B 1WTGT 1N2RB 2NYYD 4XTRC 4WIQA 3HR5A 4KGJA 4PFEA 5FOJA 3NGBB 5A2IH 1KN2H 4XNZB 2YD6A 3NTCH 1KGCD 4JREB 5D7SH 4OQ1A 2D31A 3IDUA 4MD0B 2APBA 5LXGL 1IGML 3MLVH 3K81A 1JGLL 4U1SA 1MHCA 1EAJA 4JHAH 3LS4L 5D7IA 2VITB 4JGJA 4QHMA 3VI4E 1TZIA 3PHQA 1K9TA 3LKOA 1W0WA 3GIVB 1DN2A 1W0YT 4Z7UB 4XBPB 1WWWX 5B38A 1MCLA 2J88L 1U91B 3KPSE 1IGTA 3NIDF 2VZSA 1MCPH 2I9LA 1CXKA 1BIHA 1T0MB 4NZUL 5ILTH 2CLRB 5J7CC 5H35B 1VEPA 4JFDA 3FN9A 2VZ3A 3K2UL 3T1FB 2JJWA 3QJHA 5CMAA 2XN9A 1AC0A 3RTQC 1DQTA 3IDGA 5GRXG 3UTTA 2E9IA 5CGMA 3FHQA 1VGEH 5HHOE 1P4LB 3W2DH 1GXEA 3M8OH 4ETQA 5DD0L 3OX8A 2AJZA 4WNQB 2VXQH 4X5WB 5IB5B 3GSUB 4Z7VF 3RDTB 4DUXA 1IE5A 1A2YA 3VD9A 3I02B 4HS6A 3MRHA 4QRPA 4F7PB 3FFDA 1ZLUH 4P5KA 3STZA 1E6JL 1I9IL 1RJYB 3QFJA 3AREA 3G6AB 3F6LA 3I6KB 5DK2B 2GEEA 3O11A 3EBAA 5CEZH 4HUVB 3PWPE 1OF2B 4JKKA 1BF2A 4Z7NE 5JO5A 3RI5F 2R2BB 4DWHA 4UNVA 4ZNCD 4RCAA 3N9GH 1JRHH 3MRLA 1ZVHA 3H9SA 3RUGF 5HSFA 4D0BA 2D7NA 4U6HA 5IFAL 5DEZA 3DIFB 5DHVB 4OFDA 3VXOA 5ICZB 3QIUA 3VXRA 1KPVB 3D2UD 1R5WB 3MLPA 3UTTD 5DZLA 1QVOB 2R2EB 1L0XA 3MRKB 4LBEB 4NRXB 3NCCB 5E99H 4RX4A 2HKHL 3VG0L 5HI5C 3BRFA 4LOUD 3MLSL 5KVEH 2ICEB 2F9BT 3HFML 4H8WL 2MCG1 4PRBA 4MJ4A 5DYOA 3GSVA 2LFGA 4J6RH 2GITA 1FO0B 8FABB 3TBYA 4U1GC 3I50L 1CDHA 5KTEH 3RWIA 3JBG7 1BVLA 4KKNA 5C0JA 3U0PB 4A6YA 1DR9A 3BT2L 3MRIB 5HBBA 4C54A 2VLRE 1V05A 1U0QA 3OJMB 4KKAD 5I1DB 2HG5B 1JF6A 3W9EA 1FO0L 2H26B 3EOBB 4BZYA 5ID1B 2CJUL 4L9LB 5C0DA 2KZWA 3WL9B 4FTVE 1SVCP 2O5ZL 5EBMB 4JO1L 4WFEE 1IT9L 4PJ5A 4U6VH 3MA9L 4KXZI 5GRVK 3QIUD 3VXRD 3S5LB 1MJUL 3WFHA 2XFXB 1D5BA 3KPSA 4PJIA 3CLFH 1P6AB 3QIWD 1D6EB 4K23H 2RHEA 1N4XL 2PTUA 3ARSA 2DYPD 3LN5A 4RMWA 2FLRT 4DUWA 2NTFA 3V6ZB 3QNYA 4RMRA 1NGPL 3KPOB 3NCMA 3HNTH 4F8TA 2X4NA 4EOWH 4NWTL 4ZUUA 4OD1H 1C1EH 3BDYL 5FGCE 2Z4QA 5J1AA 4OCLC 4GKZB 4JPIB 3RX8A 4U0RC 3TEUA 1Z2KA 3D0VA 3RDTD 1KACB 5EO9B 5EN2A 3PWUA 1H0DB 1J11A 2APFA 3V5DA 5DD6A 1A1OA 1WCBA 4O02H 1A6VL 1NFDB 4NQDA 3WNPA 3MRCA 2BMKA 1EAPB 5MENA 2VSCA 4WHTA 2YBRB 1S7SB 2V7HA 5ESVA 4K3DH 3MGAA 3VGAB 1KYOK 1F90L 1P7KB 5C09E 3MFFB 1AGDB 1YEHH 2VLME 1F00I 2DLEA 5IR1B 2DLFH 1LO2H 3NN8A 3LIZH 2CIIB 1FP5A 2VN4A 2F19L 3GMOA 3ROOB 3RWGA 4EKXA 3ECBB 5CP7A 4M43H 2D9QB 1FZOA 3QDMB 2A73A 3RWCB 3WNOA 3O4OB 3FQUB 4OF5A 1RFDH 3QWQB 3EO0A 1WZLA 2XNAA 4N0RA 4U6VL 5F88A 4HPOH 3MV9E 3HE7C 5D2NE 3CC5B 4Z7WE 3NVQA 4ZOCA 3FN0H 4GAGL 5F7KC 2EYRA 3DSFH 1QSEB 5EU7E 1Y0LB 3F12A 5TE7H 4JFDD 1CWVA 1RK1A 4F33B 5B4MD 4CBPA 2ZKHL 3OSKA 4M3KB 4CL7A 3OF6D 5E8EA 3QI9D 4CGTA 2YMXH 3RZCB 3DXAE 1JWUA 3EDFA 4OCSL 4HJJH 4WHDA 5DI8B 4NNXB 1MCJA 1RZKL 5HGHB 4NQDD 3QWOA 4JM2F 3VFUA 5EDXA 4PS4L 5MEND 5IB4B 5CIPH 4MWFA 1LE5A 3ALWA 1AGCA 1YMMA 2Z93A 5JLZA 4UILH 3MUJA 4Q9RL 4TTDD 2EDJA 2QR0A 1I7ZB 1MAKA 5F1KC 1P5UA 4PJCA 3VWKA 1NAMH 3V9FA 5D6CA 1W72H 2H2PD 2IFFH 5FM4A 5JPMB 5KSUB 5D1ZB 1ERNA 3MRMB 2A9MH 3A67L 4GRWE 1JK8B 4LKCA 5FHAL 4N1HB 5TQ2H 4WVRA 1OQOA 4J3VA 5GGTA 3NH7L 5CUSH 3KPRA 5ID0B 3LH2L 4XVUD 4OCXH 2ESVD 6FABH 3BWAA 4M9OA 5BS0A 3IRPX 2YPVL 5EFIB 3BQUD 3HPJA 4HC1L 2ATPA 1ZGLA 4JKWA 1DBJH 3X3GL 1UM4H 5F96L 1AO7A 4Y19A 1MH5B 3OF6A 4U1IB 1IQDB 2VXVL 5FXCH 4HCRA 1H3VA 3FFCE 1EV2E 1AQDA 1JNHB 1MNUH 1U8LA 3FN3A 4Y4FC 5BMFH 5I1IL 5M7QA 1XIWB 4PJIF 4OI8A 5I9QB 1JCKA 3UTSA 1HXYA 5F44A 2Z8WC 4XXCC 1TJIL 1KJVA 5DD1L 4HWNA 5E2VL 3FB7A 4P2RA 4OZFB 1FJ1B 5EOCJ 3W39B 4PP1D 1DTUA 4GT7A 4F7EB 4U1KB 1Q72H 4JZOA 4Q6YA 1U8MB 2F53D 1DQMH 4WO4A 4S11A 2YA0A 5EZIH 3U79A 1INEH 5IMLB 4TULH 4KTEH 4I0CC 1ORSB 2W65B 2HFGH 3MOBH 3ZE0F 4G5ZL 1U58B 4DVRH 5J13C 3MCKB 4GW1B 1E4XI 3MLUH 2AJ3A 1MFCL 5LG1A 1Q0XH 4PJ8C 5HY9B 2YUVA 1G0YR 2JIXA 1F4YL 1HWGB 4GOSA 1BJMA 2N7AA 5HPOA 2FJGA 1B4RA 2GYSA 5BQ7B 1OL0A 2EE9A 1MAMH 3ZL4L 2VLJA 2NNAB 2XKNB 4GSDH 5MERB 3U7YL 4M62L 3L5WA 5ALCH 3CSYB 3UTSB 2Q1EA 4H1LG 4MJ2A 1LVEA 1U8LB 1JNHA 2G2RA 1L4IA 1WZKA 3LKRA 3VXPB 1GGCL 1QO3B 5CJOL 1KT2A 1O5DT 1T2JA 4OF8A 4U1IA 1YYLH 4PJXF 4Y19B 2FYYA 2WUCH 1B4JH 2K7PA 3RKPA 1PSKL 3W5NA 3C2AH 4WV1A 1XH3A 4ODSL 2NX5D 3HPJB 2QSVA 5EBWA 4XP9H 2C3WA 3MYJA 3PIQA 5BS0B 3C8KB 4G8IB 3L3OB 3IKCA 3CVHB 2F53A 4JVUA 2AJUL 1CFBA 3OTTA 3HG1A 4K8RL 5EUKB 1F3JA 4ETYA 1WSST 4LQFL 4LKCB 2GK0A 1A3RL 1JK8A 3CFDB 4JO3H 4LSRH 2VQ1B 5DRWA 4QGYA 4NHCL 5D1ZA 1TJHH 3M1BB 2ARJA 1AXIB 5ENWA 5GQBA 2HRLA 2J12B 3ARTA 4QT5A 4YO0A 1VADB 2V2WA 3MNZA 4PJFB 5C0BD 3BDBA 4K3GA 4P5TB 3S35L 5K9QI 1L7TH 4RGND 1RVFH 2BSTA 1AGCB 4HCRH 2E8ZA 5HVWA 1UVQA 1EEYB 1HHIB 3IFLH 4IOFC 5HGHA 4KDTA 2C1PB 1FZKA 4ALAL 3IU4H 4Z77B 3T0DA 3TA3C 3SQBA 5C8JB 2K9UA 2BJMH 4MNQB 1P6FA 3CFJB 1RZ8B 4MQXD 4XNYL 3TO4B 4B0MM 1FNSH 4ELMB 2VIRA 4UINH 1F58H 4O4YL 2MQ0A 3QO0B 2XACC 5FYJH 1AR1D 3KVQA 4AH2A 4FN0A 2JELL 2MPAH 3V7AE 1DQLH 1WCQA 1QACA 5F88B 5GGRB 4YHLH 1S7RA 1NAMA 1WC7A 2CRMA 2VWEC 3VWJC 5JUEL 1G84A 1WQVT 3KYKL 5DJZB 1CK0L 3MLWH 1AJ7H 4X7TB 3DETC 3UPRA 2COQA 5JHLH 5M94B 5B8CB 1LO4L 4LRNH 5ERWA 3C5JB 2IAMC 4JRXB 3VH8B 3CFBA 5JW4R 5DVKA 1XGYH 2AJUH 2AXFA 3D2UB 3MFFA 5I1CH 5GRJH 2HJLB 4NQCB 2HKHH 2VJXA 3KYMB 3PABA 2BMKB 5J1TC 1IGIL 1ZHKA 3MA7B 4PRIE 3BRGC 2BNRA 2X4TB 1A1OB 4P2QE 1JZ2A 2D0HA 2GSGA 1H0DA 4RFNB 4X8JB 3A6OA 5IFJB 4OGAD 5EB9A 4ZYKB 4M61A 3OR7A 3BW9A 3EJZD 5BS0D 1HOCB 3GIZH 2N4IA 4K9EL 2Q8BH 3UJIH 5D72H 1NLBH 1OGTA 1DZBA 1YEFH 4XPFH 1XGQB 4OQTH 1KBGH 1A7NL 4YX2L 2OR9H 1OOAA 3G5ZA 5ELIA 1TTGA 5HDBE 4OLYH 4LEXH 3CMOL 3U1SL 4NC1C 5J8OA 5JDJA 4K94H 3EOYG 5D5MA 3WDIA 4OCMC 4KAQH 1CD8A 2IANA 1FFOB 3O8XD 5GS0D 3M17B 4UZGA 1G9MH 5I1LB 5ANME 3IDJA 2FIKB 3WFHB 3LEXA 2PYEE 3F5WB 1GIGL 3MLUL 4R4ND 5F72S 5IIEB 3H9SD 1C16A 1WFTA 4Y4KC 4XWGH 4WJ5A 2VR9A 3CCHB 3PHSA 3QDJA 4WO4D 3HTLX 3P4MB 1I9RH 3OKLB 5F9JB 4U33A 1CL7I 1LO0H 4JHBA 4O51B 1B2WL 4Y5VC 3X3FL 4ZUSA 5CINL 3SDAD 5I1KH 1BVLB 1T80A 1I9EA 5FO9B 4R96B 4HJ0D 5HD8C 3V6OA 2HT2D 3V5HB 1A1MB 1WFUA 4N9GB 1JZ6A 5LGJB 2E7LA 2AI0L 1PY9A 2Z0BA 1FRGH 1NCBL 1V7NL 5DMKB 4OD2A 4OQTL 3BP4A 3D39D 4Z0BH 2BVTA 4ELMF 1OD9A 1EXUA 1FG9C 2QLVB 3QEQE 3HMXA 3RNKA 2YD8A 4OCYH 5DHVA 5FHAH 1I8KB 4JGMA 5JOPE 5E2TL 5SWZA 5I1AA 3BQUB 3HA0A 3INUH 3LD8C 3LEYH 4G6JH 4U6HB 1U8OA 4P2RE 5GS2D 2I27N 4NBXB 4NKOB 5TJWK 4PJ5D 4HK3N 4RFOH 1I7UA 2BNQE 4NNYA 4ONHB 4WRLA 4NC1E 1LO3H 3L95A 4C56B 1MFBL 1OTTC 3SE9L 4WWKA 4XPGH 1WBXA 1CQYA 1DUYA 1JPTL 2Z31D 2DQUL 4G6ML 4A2LA 5IB1A 3RWHA 3IXTA 4YHIB 5JW3H 1TQBC 3EOTH 1N6UA 4K7PY 4PRIA 2P24B 2P5WE 3VWKC 1JPFA 3QEUB 1U92B 1P4BL 3FFDB 3WIFB 1EZVX 4OF6A 1Z0MA 3DVNA 5I71C 5LCVH 4YDJA 2FZ3B 2ZKHH 4RAHA 1EMTH 4X5WA 4FZ8L 3DRQB 1WFOA 5B39B 3OX8B 5FUZL 5DLMH 1WUNT 5F6IB 5FF6A 1CDBA 2NY5L 4QEGA 5BXFA 3BPCB 4FXLA 5JOEA 5KVMC 3L7FA 4IHOA 4PRHE 4XB8A 4R4FL 3QJHB 3BKJL 5IK3B 3GSXA 3U0WH 1IEBB 1SEBB 1TCRB 1IEHA 1F4AA 5F1NA 2ARWA 3ARGB 2ZPKH 4PJ7E 1RSFA 4WUKL 3TESA 5DQJB 4M43L 1J88A 3VXSA 5HYQB 3WO4C 5CZXD 3QBTB 2AQ1A 4K3JL 3MXWL 1BQHG 3GO1H 3DRTB 2GUOB 4YHPA 3PWJA 2Q3ZA 5HXMA 5DQDH 1KLUA 4LOUC 1V7MH 5ACZB 4AEEA 1NUDA 5KVFH 3VE0B 4TSBH 3GSWA 3MRGB 1FFPB 5IHZA 2E9JA 4PRPE 2PKDA 4M8VA 4C58B 5JORA 1KTKE 4PJHF 5FYKU 3FTGA 3DJ9A 4UUJB 1ZHLB 1MCNA 1BIIA 4UTAL 1N2RA 4FQ2L 5I1GH 4DKEH 3S7GA 2DDQH 1BEYL 1J18A 4HBQA 4MCYA 3O6KH 2YC1B 3U82B 1RJLB 1K5NA 3J7HA 3L6FA 2E9BA 4JY5L 4KKAC 5GRUH 4ORZC 2DWDB 5FO8A 4BQ8A 4KRLB 1ORQB 5KOMC 1WZ1L 4G80A 4OZGF 3C2SA 4G42B 4DQOL 1S9KC 4C59B 2OSLA 3HLAA 3OGCB 1SY6L 2UZXB 5DEFB 3ROLA 4D9QE 1MJJA 3SE9H 1DE4B 1BBDL 3CFCH 2DBJA 3EYVB 5ACMA 4POZC 4UBDC 2DL2A 1XZ0A 3VFNA 5GISH 5DD3L 5D71H 4R0LB 4HXBL 4NQXB 4GKOA 5IVZA 3ZKMC 2DYPB 4XNXL 4Z7UF 5C6TH 3S37H 2R9HC 1NDMA 4Z78B 1I1RA 2DQGH 2FB4L 4ZTPH 4KUZH 3NA4A 2VUYA 5JW5B 1BQHA 4M1CC 3G08B 5I1EH 4JFYB 1S7TA 1IQWH 4YZFE 3O6ML 1QNZL 3GB7B 3TN0B 1M7DB 5DSCB 2H45A 4HWZB 2J8UF 5GJSH 1K8IA 4GKSB 5I1KL 3EJYD 2ED8A 4JKPH 5JQ6H 4HWEL 5KSVB 1Z5LA 3BGMA 2AQ2A 4O5LL 2G9HA 4Y4HB 4ZSOA 1QLRB 2QKIA 4J6RL 4XCYB 1KCKA 4YBLB 3VGFA 1DUZB 1BF8A 4PV9B 3BISA 1OARH 4LF3B 4JR9L 3MGOA 3VXUD 4FTVA 1MCBA 4RFEA 1ZEAL 1BGXL 4R6UA 4RNRA 1A7NH 4NQSB 5E4IA 3UPCA 4X4ME 4OKDA 1KB5H 4FQXD 5T1KB 4WCYL 3OJDB 1KEGL 4EDXB 3U4AA 5ICXA 4HZLB 4AT6A 3MJ8A 3NA9H 1AJ7L 4F8QA 1KIRB 1CXEA 4NWUL 5CJ8A 2NY1B 1OARL 3QUMB 4X0KB 4PJXE 3MJ9A 4RDQF 1UKSA 5T1MB 1JE6A 3MNWA 1QD0A 1DN0B 1F11B 4MS8D 4RGOL 2ICCA 3CX5J 5B38G 4BFBD 4Y8DC 5I1GL 1XIWC 5INCA 2BOCB 2EDYA 3N85H 5CBAA 5DC9B 3UBXA 4Q74A 1A6WH 5FDWA 3QH3A 5F7HA 3Q2CA 2APWA 4L8DB 4P23C 1YN7A 1GZPB 3BUTA 3C08L 4M93B 1EBAA 3V5KA 1NC2B 3GSNL 5INCB 2OR8A 5E5MB 5LGKA 2DQGL 1NJ9B 4S2SB 4UT7L 4Y16A 3BP6A 2MPAL 3I75A 3HUJF 2VMFA 4L4TE 1EHAA 1UYWH 3QUMA 4X0KA 1H5BC 2Z31A 3H3KA 1I9JH 1UXSB 3RY6C 4TTDC 1U6AH 2F15A 4KK9C 1FFQA 2FJHA 1KGCE 4HKZA 5I6XC 1T5WA 1CLCA 1ITBB 2NX5A 4JANA 5TFSL 3KYKH 2X2YA 1I85C 4YNYB 1YQ2A 4RFEB 3HB3C 1CD1A 3AROA 3QCTL 4HUUA 2FGWH 4ENEC 2K1MA 4Y1AD 3HG1D 1P7HL 2WUBH 5HYJB 4HD9A 2X4RA 3ARYA 2Q7YB 2VB5A 5KSVA 3SE3C 3I75B 3D18A 3TPKA 1BHGA 1PG7W 4FNLH 2YXMA 5CD3A 1QFWM 3CMGA 4LEOB 4PTTA 1SMAA 3ESVF 4ODHL 1NC2A 4GW5B 3RU8L 4Y4FD 1TQBB 2APVA 5D7JD 4YPJA 1KIQB 3MXWH 4XMPH 2C3GA 5FDWB 3M07A 8CGTA 3SO3C 4GG8A 1Q1JL 2FO4A 3UTZA 1VKXA 1I7TB 1H3GA 4XNYH 3DXAA 1I4FB 4KHXL 3V0WL 1KELL 1PJ9A 3EO9H 2OL3B 3B43A 1U95A 4IOSD 3BIKB 4MJID 1Q9KA 4DKDC 1F2QA 1NC4A 4NUGH 1KXTB 3QHTC 2HRPL 1AHWB 1G7JA 4GUPA 1UH4A 4D9RD 1JI2A 3S8WA 2CK2A 3L5XH 1EA9C 3Q0HA 4M3JA 4JAMB 4V2BA 1AKJB 2VXUH 3LSOB 2D7QA 4NQCD 5F8RC 1ZMYA 1MCDA 3P4LA 1JVKA 5GGTH 4YUEH 5GZNC 2VZ1A 5CZVL 1RD6A 5C7XH 2E7LC 2QKIB 4XCYA 1QLRA 4BKLA 1FFPA 4GFTB 1Z5LB 3BGMB 3PL6D 4GG6E 2GW5A 5TF0A 2YR3A 4P57A 5J6HB 2MHAA 4B5EA 1KLUB 1HN1A 2EDEA 1VEOA 3DO7A 1ZHNB 2X70A 5ITFA 1KENL 3NFPB 2HJFB 4P4RB 1IJ9A 4OB5L 3RHWK 5HYQA 3TN0A 1YEDA 5MP6L 4KXZH 4HUKB 5L8KB 1AQKH 3O4LB 1ADQH 1BQHB 3BH8A 5D1QD 3QUXC 4MD4B 3QULA 1NDMB 4CW1A 2ZZUT 3O8XB 1CTNA 2HVJB 4OZHB 3GSXB 3C6LB 1X5ZA 2E7CA 3LH2H 2A2QT 3WD5H 4JM2C 3B5HA 2WIMA 5LJYH 3SQOH 3ULVC 1UH3A 5CEZL 1MJJB 3DHMA 1KCRH 1A9EB 1P5VA 2IH3A 1INEL 2H8PA 5HGAB 1DLFH 2B4CH 4FQLH 1N7MH 3SY0B 4EI5A 5T1KD 3ES6A 2Y7QA 3CUPB 5DO2C 1DVFC 1U36A 2C7UA 4QOKB 1DBAL 2E3VA 4HDIB 2XV6B 5FO8B 3N1QC 4ZDHB 1JPFB 2B0SH 3ILPB 1YEFL 4XPFL 2P24A 1T3FB 5E2VH 3QUMH 2DTMH 3W5MA 3L7EB 4YHIA 4ZFGL 1IM3A 3QPXL 1HQRB 5C2BH 4TUJB 2J8UB 4EBQL 4YFEA 4Z9KB 5I1IH 1MHPH 1CE1H 1AE6L 5AG8A 4HIEB 4WW1B 4G6AD 1B2WH 4JRXD 3IDMA 3WIHL 1T1YB 3TA3D 4J8RB 2PN5A 1MIEL 4QWWD 1CYGA 3GHEL 2JJVA 3W0WB 5AAWA 3VE0A 4MQXC 4H5SA 2UYLA 1PLGL 4JKPL 1CF8H 5JQ6L 1HHHB 1YY9D 1A6TA 1U8OB 5F7DA 3ARFC 3Q6GL 5SWZB 5I1AB 5IMMB 1YMHA 4ODTH 2HT4C 3MBED 1N0XL 1IC1A 3FQNA 4FQLL 5CKGA 5HVGB 2NR6D 3FQTA 1DEDA 3WEXA 1EXUB 1Q8MA 3DGCR 4ZFOL 5BMFL 3VWJD 3TVMA 5F1NB 5HYFA 3SDCC 1V3KA 1IEBA 1G6RB 3HHRB 4N8VG 4DN4H 4LHJB 5GZOD 5LQBL 4UT6L 5JR1L 4J3TA 1PZUB 2WMPA 4U7KA 2VLMD 3QXAA 3PGDA 3G5YA 3F7VA 2QV2A 1GC1C 1TCMA 4LVOC 3GGWA 2Q76B 5HPMA 3WLBB 1EO8L 1FNFA 4IRJA 5SX5K 1B0RA 4U0QB 5B39A 4LLDB 1XAUA 2DQFB 3UMTA 1OAXL 4GG6F 3KPTA 2CGRL 1OLLA 2BDNH 2FX8L 2H9GA 4YDJB 4D9LH 3DVNB 4R96A 1T21B 2X4OA 3NABL 4N68A 4WW2A 5IHUL 1P84K 1TETL 5A43C 3EDEA 3U83A 3RGVD 3WXVL 1ZHBB 4O51A 3IXTB 5IB1B 5DMJB 4OGAC 3V6OC 1JYXA 2WWMC 2W9EL 4HG4K 1NL0L 4JZJC 1MRFH 4RGMC 1PFCA 4FQ1L 3D0LA 5IBUB 2XRAL 4NWTH 4QXWA 2FSEA 1TITA 1F90H 5KBNC 5L9DL 1C16B 2VDOL 1PG7L 3SKOA 1K4CA 4JM2B 4XCEB 1UA6H 4X80H 3O8XC 1LHZA 4UTAH 2W9LA 2FIRT 4K23L 3VGBA 3NTCL 3IFLL 5L7XL 4LQFH 5CD5C 5E08H 5LVEA 3M17A 2IANB 4K3JH 2O61B 3G6JB 4HEME 3BP5A 2BNUB 2VDQH 5AYQA 4C57C 2QEJA 2D03L 4ZOAA 2W91A 2ZCLL 1C1EL 3LKQA 1OGTB 3TO2B 1HOCA 4PJ9A 1R3IL 4JQXA 3QZWB 1QYGL 3IJHB 1H8SA 5EPMB 4NIKB 5A1AA 4N0CD 4X8JA 5JXAH 3GJFA 5ADOH 2BNRB 2X4TA 5FGBA 4TVPL 1JHKL 2VH5L 2C4FT 2ZSWB 4ODXA 4ODUA 2LTQB 4PBWD 4QKXB 1MWAL 3A6CH 4FNLL 4KKLC 2HJLA 2HT2C 4NQCA 3DUHA 4I5BB 2DKSA 4JQVA 4P4KA 2Q8AL 1EERB 3RQ3A 5I17A 4U1NA 3WFBL 2IBZY 5GSRA 4HQQH 1FN4A 3EOAB 2BC4A 5DVMA 3P4MA 2JK5B 3MREB 3QDJB 3WXVH 5FK9A 1FNGA 2OXGA 4AZ8A 3IFOB 4HJGA 5F8QC 1FH5H 3RWJA 1BZ9B 3SE4C 3OHXB 2XA3A 4N0YH 3AM8A 4PGDB 3GI8H 3AXLB 5IM7B 3UJJH 4LNVA 5JHDA 2XKUA 3WFEL 3TYFA 5ACLA 3I9GL 2VN7A 4NZRH 4OFYD 4TQEH 5L88L 1BWWA 2IWGA 4V2CB 4PRHB 3CFJA 2VWEE 4QRTA 1NGWB 4U6YA 1IAKB 1OAKH 3FMGH 5HGGS 4Z77A 2FDBP 1BECA 2P8PB 1OTTD 3VGHA 3LQMA 2AXJA 4IS6B 4ZTOL 3VGDA 5IMOB 3BW9B 3OR7B 2XWJA 5FOBB 2Y6SD 5KVGL 2F54A 3ULVE 3AAZA 5KAQF 2BSRB 5D9SB 2P5WB 4CU8A 3HG1E 4YGVA 3TPUA 1NGXA 1GRWA 2YN3A 4HKXB 3W81A 4QT5B 3WSQL 3PABB 2C4XA 4LLWA 4FXGA 1Q94B 2DI7A 3VI3E 2FJFB 4MAUH 4ONFH 4HFWA 1T0NA 1J0YA 2AXFB 3D2UA 3GSNB 3BD5A 2PR4H 3M8OL 2AQ3A 5C3LD 3SDXB 3DI3B 5ERWB 3DUUB 4NGHH 4FQJL 3S35X 2B1HH 2VLKD 1UB6A 4XP6L 2KUTA 3QQNA 1C7SA 1KB9K 3K2UH 4Z7VA 1D5IH 3P9WB 1AKJD 4F7CB 4PBVC 5DJZA 2GAZB 3PIQB 1OQXA 5BJTA 3MLSH 4YGAB 2ZOKB 5IHBA 2CDEA 5K59E 2CLVB 1NGQL 2VDLH 5GJTL 3L3HB 4RDQG 4AENB 1QO3A 4IDLA 4P23B 4R7NB 5CLWA 4PJDB 4LAQH 3L5WB 4U3CA 3P4NB 1BX2B 4P46C 1UM5L 1YPZB 2XKNA 4M7JH 1MCOL 2AEQH 3HZVB 3QUML 4PJAE 2W92A 1ED3A 4Z76A 4R2GD 4UOW0 4M6OH 5BQ7A 4YHYB 4XHJD 3PGFL 3E6FA 4J2XA 4HC1A 1K3IA 3IDNB 1PQZA 3CXDH 4HUNB 4MGXA 2BSTB 4YXKH 5CGYD 3NFNA 3PWPB 4UQ3B 2FX7H 1AO7D 1U58A 3SGDI 5GS0H 3QIWA 2J1KA 4OTXL 1U8IB 3CFCL 5IMKA 2NW2A 1V3LA 2ARJB 4OZFH 4ONFL 4OM1H 4FFZL 3WYRA 3ULUL 2YSSB 1PEZA 4IMKC 4JKMA 4JZOB 3O6LL 3HAEB 5AZEH 3ARBC 1J1OL 2ORBH 1CDJA 3OAZH 4G8IA 5T5NG 3KHOA 4FQJH 2F58H 1YJDH 1MQKL 5EBWB 2FWOB 3L3GA 1KTLB 4RSVA 3STBA 2RGSA 1XIWA 3CU1A 4L8SC 3SBWC 5IBLC 3ZT7A 1OT2A 2GY7B 3S96A 2NXYB 4P3DB 4PREB 3LKRB 4PD4K 3O6FA 3DGGA 2N7BA 1BOGB 2FEEI 3HPLB 5D1XB 2ATPB 1JGDB 1NBYB 5EFIA 5ANMA 3QEHB 1FNSL 1JWSA 2QADB 3ZDZE 3U9UB 3TV3L 2WBJB 4P2QB 4DW2H 4JFQA 4OAWB 3LV3B 1YEEH 1ZV5A 1FCGA 4KJYA 1EK3A 3GSOA 4NRYA 1I3RB 3QDJE 5TE4H 2BSED 2AJ3B 5D6CB 4R4FH 1T7VA 4F58L 5L2KE 1YEHL 3QFJE 4KRPC 4WTXA 3D69A 4HZAA 2JJUA 4TNVF 4BFIA 1BAFH 4N8VA 4MWFB 1LE5B 4LCUA 2XTJC 1AC6A 2CR3A 4O02L 4U1KA 2CPCA 1WJ3A 4F7EA 4P59L 4MCZA 1XIWD 2Q86A 3CH1A 4KKCC 1ES0B 4JFOA 3RZCA 1I75A 4OLUL 3FB7B 5DJDB 4ORGA 1KJVB 2ICWJ 4F9LC 1HXYB 3BI9X 1XFPA 3RL1A 4WI4A 3X12B 4G9FD 1MHEA 4U1GB 4XCCH 1NLDH 4MNQE 4OFVA 3U36B 3CC5A 1AO7B 4YHNB 1R0AL 3FQRA 1NKOA 5EU6B 3ARUA 2XNAB 2X4SB 3RAJL 3C9NB 1KCVH 2BFVH 2HTLD 3FB5B 2O5YH 4X6EA 4DW2L 3TN0D 2BHYA 3GMOB 1NGYA 2APXA 4ZODA 4J4PA 2DMKA 2Z8VC 1IGJA 2Y07H 3NIFE 1RULH 3AMLA 3C5SB 5KOVC 5I71B 4GBXB 2W9EH 1P7KA 3CK0H 2IC2A 1DBBL 2NY2D 4WW2C 3VWKB 1I8IA 2PYFA 2F5AH 1I7ZA 4MAYD 4R9HA 1IZKA 4KFZC 2WNGA 4HX1B 4NO5A 1BBJB 3ZO0A 4GXVH 5DD6B 4XB7A 1BM3H 1W0VB 1YC8A 3BPOC 1GGTA 4P46B 4P2RD 2AV7A 2XG4A 1KB5L 1YA5A 5J1AB 3JSSA 5B21A 2BNQD 5D96B 4EEEA 3GMLA 2B8OT 3S6CA 2EDKA 1CVSC 1YY8A 3KPOA 5T1LB 3QNYB 1VACA 4J3UA 2Y36H 1ZLUK 4GRLC 1DLFL 4X7CC 2EDHA 2EYRB 3EJJX 5E5RB 1UT9A 1GSMA 5GS0L 5I1JL 2YWZA 3S5LA 2DM4A 4QRSB 3HE6C 3TGXA 2ZP0T 3VD5A 1VEMA 3EO0B 1YZZA 3NAAH 2A73B 3RWCA 2QQNL 1FZOB 5TF1H 3B9AA 3ECBA 4L3CA 1AD0A 1AGEA 1FC1A 3NN8B 4LHUG 2YOCA 3MRIA 1A6ZB 3WUWB 4MNHB 4P9MH 3IU3B 1AGDA 3JTTB 3NCYS 3FQWB 5T3XH 3JUYA 4IMLB 3VRLF 5ESVB 3C09C 2V7HB 2YBRA 2AK4B 3OKDA 1FO0A 4KDTC 3TC9A 4Y0GA 4RIRB 1IILE 3CH8A 3K3QA 4XP5L 4XXDB 1VDGA 2V5SA 1EHLH 1UWGL 3QUKA 3TT3L 5MEQA 1H3UA 1IGCL 3PWUB 5D7KD 1EIBA 2CKBL 4RRPG 3K1DA 1CGSL 2I5YH 5F7EL 2FGZA 4KUZL 2PCPB 3AU1A 4LIQL 4JO2L 3UEZA 5C0FB 2Z4QB 2F8OA 1KTDA 3R06B 1CZ8L 3CVIH 5IOPB 2X4NB 5IOPA 1BFTA 1VHPA 3TIDA 5F7LB 5MEPB 4H1LA 1MCWM 5J3HC 4B7IA 5ICZA 1PX3A 2YD9A 3LN5B 4PB9L 2E7BA 2EDNA 1R3KB 2AERT 1GHFH 4X99B 1KJ3L 3O9WD 1D5BB 3LQZA 3ULVD 5E8PB 5F3BA 5E6IB 2DLGA 2OK0H 4PJ5B 3I2CH 5GGVH 5JO5B 4B7LA 4YFLI 2I60H 4M7KL 2BVUA 5J89A 3RJDA 4K2UL 2HG5A 4X5LA 5ADOL 1MF2H 3G6AA 3W9DB 1A6ZA 3AREB 3SKJH 4KZDH 2EKSB 4H0HB 4A6YB 1AD0B 3V0WH 2FBJH 3P0YL 4XHQA 4L3CB 1T7XA 1ADQL 1F4HA 2ZG3A 4QHUB 1KCUH 4FMFA 5SWZD 2CUHA 1HKLH 3BE1H 5EZOL 2HMID 1J8KA 4NYLA 4G6AC 2IAMB 2P42B 1U8KB 4I18C 2OQJB 4JFXB 3WKNA 4MDJB 5KG9B 4QWWC 2PO6C 4FQ2H 2GJZB 5GISL 4NUGL 4X9IA 5E8PA 1S9YA 4PJ7B 1EVTC 4FA8A 1S7XB 3C6SA 1ZTXH 5IF0A 3ARPA 4YFLF 3TJEL 3UTTB 3UP1A 2WLZA 5IT2L 4GRWF 2R56H 1QSEE 1VACB 2HT4D 3MBEC 5MEPA 3MV8D 2OTWA 2IQAA 3P2TA 2HH0L 3QHFH 2R2EA 3R4DA 3N0PB 3GMLB 4LSQL 4YHLL 4NM4L 4YDIH 3QIUB 3VXRB 4RA0C 3LPGA 4OLXH 5FUZH 5GZOC 1TZIB 5MI0B 1Z0NA 1ZA6B 3CSGA 1OSZA 2OP4L 1ZAGA 4MD0A 3WKML 2EZ0D 3H9SB 1DBMH 3GSNH 4ZFFB 3QHFL 2R1XA 4HX1A 4NO5B 4RIRA 3IF1A 3QXTA 2BY2A 2VE6B 1H3PH 1SBSL 3MCLH 5EWIH 2R0KL 1OF2A 1MJ8H 4JQIL 4IMLA 4HUVA 1K6QL 1ZANH 5H2BA 3JTTA 1OB1B 4ODWB 3DUSB 4NO2A 2EC9T 5GGVL 1IGJB 1E27A 1CG9A 4KK6C 5HYJE 5DZOA 1UZ6F 2MTPA 1MFAH 4ONGL 4LLQB 2CMRL 1TVDA 5IW3A 4HWBA 3V52H 1CD0A 1NMCB 1OWWA 5E6ZA 3WMSA 4XAWH 1JN6B 2N56A 3P0YH 4HH9A 2B7DT 3KWWB 4KY1L 3OQ3B 4ETQB 5CBEA 3LDBC 2XWBA 1GGUA 5FA4A 3PQYD 4XGZA 3HUJB 2AEIT 3RVTC 1NUNB 4WI8A 1TTFA 4LIQH 5B38B 2OI9B 4OGZA 1ES0A 3WIHH 4XBPA 2EYTB 3L1OL 3EO1B 3P9MB 2Q86B 4N5ED 1VGKB 1CE1L 1MHPL 4QXGL 2NY6C 4LLMB 3QSKB 2MOVA 4HLZG 2AV7B 4M4PA 3C60D 4PRNB 3HI5H 4V1DB 4WCYH 2W0FA 3GBLA 4XVSH 1EO8H 4W4OC 1BBJA 3O81A 3NFSH 1TLKA 2H1PH 5SWSB 1LDPL 3DX7A 2W0PA 3O3UN 1G9NC 3QFJD 1PG7X 5I2IA 4H8WC 3NOIA 5IBTL 2LVCA 5DVNA 1UQSB 4GBXA 5IKCB 2E5EA 1I3RA 3JV4B 4PJXB 4XMKL 3TO4D 1IRAY 4Q6IC 4NRYB 2OR9L 4ZPTB 5E9DE 1MLCB 4X6DE 5C70A 3NFSL 6FABL 4D8PB 1I7RA 2Q8BL 3T77B 1Q0XL 1BVZA 5JPNB 3EYQC 2HKFH 2FD6H 2VZOA 3GBNH 2VLKB 4HXAL 4S1DD 4BFGA 5B4MC 5FEBA 5I16A 1NAKL 2EKJA 1R5VA 4TVPE 3OKEA 4KTEL 2AXGA 3U7AA 2EIBA 1MCWW 4M5YH 1IAIM 1I1YA 4BQBA 1VFOA 1PYWA 5EU6A 3FQRB 3DGGB 3RNQA 4UQ2B 1EHNA 2XQYG 1J12A 4YHNA 1FVDB 5D70L 4RWYH 4WDIA 2P46B 2ZUVA 1NBVH 3PP3H 4UU9A 4ZD3L 4Q9RH 3N1PC 1KTLA 4MJIE 1U3HA 4EVNA 3VFSB 3RVXD 5DJDA 4CU7A 4JFOB 2W60B 4S1QL 1RZGB 3GSQA 4OJFL 3UROR 1HQ4B 3HRPA 1NQBA 4YPGB 5C0AA 3K46A 4WEBH 1LO0L 4U6XB 4W81A 2WBKA 2QHRH 3KPMA 4MA3A 4X6BB 4UT9L 1T4KB 3CK0L 3HE6B 4YAQA 1FNEA 1LDPH 2DM7A 4PGBA 2ADIB 2IPTH 1IM9B 4QY8A 3VMOA 1LP9F 4WY7H 3CFEA 2BOBB 4HUWB 4JHAL 1ZS8B 5DMYA 4PV8A 5I1JH 4G8GE 3GSOB 3QUYC 2DD8L 1G9ML 2EIEA 3GI9H 4DEPB 3DYMA 1OPGL 4S1RL 1QLFB 3VXSD 3WHE1 4OLEA 1OAKL 4N0UB 2YPKA 4XWOC 2L0DA 4DKEL 1OGAD 4HGWB 1T04B 1XGYL 1YPZA 4LPVA 3BYYA 4YDVA 3VCLA 3P4NA 4TSAH 4DFIA 5D1XA 3KLHC 5ALBH 1F58L 3MODH 3RWDA 1FYHB 4J23A 4P3DA 3QIBC 3L3HA 1RZKH 1JZ8A 2OTUB 1UZ8A 2PUQT 5SV4A 5IT2H 2FATH 3WCYA 5GGQH 3U48A 4YDLB 3QZWG 1AIFB 2IALA 1DBBH 2JJTA 5DLML 4HHAA 2DDQL 4HBCL 1WICA 3NCFB 4FG6C 4RWHA 3HKFA 3T3MF 3RZCD 1FHGA 2YSSA 3U0WL 4PLKD 3I6GB 1KELH 1X5AA 3BIBX 4KY1H 4ZNEE 4BZ2L 1B88A 2O5YL 4HFWB 4BH7A 5CGYC 2GSIA 2IPKA 3T2QA 4KQ4L 3EYOB 4CVUA 4LMQE 1ZTXL 2GJ6A 4TSAL 1NC2D 4YGVB 3TPUB 1T20A 5D9SA 4I2XB 1QEWA 2R0ZH 2WINB 3NCBB 5AD0B 1MCQA 2H6PA 1ZK9A 1D3CA 2R69L 3ZDYF 3IDNA 2W1NA 3C8DA 4YXLH 5IW6B 4IS6A 4XP9L 1E4XH 3DV6B 4KQ4H 1UA6L 4PPTA 4PJHA 2C1OB 2FEDD 3WFCH 1YUHA 1ZT1A 2VLRA 1BX2A 5E08L 1MF2L 1UB5B 2UZIL 4U0RB 2IPTL 4BK4A 1M1SA 3T0VA 3BZ4B 3VXMA 2ZSVA 2R29L 3VXNB 5JHDB 3QFDA 2X40A 1F3DJ 3B9KD 3BOVA 3PNWB 4KRPB 3REVA 5IJVA 5IM7A 3QI9A 5IVNA 1MJ7H 4OZFG 4LSUL 1FZJB 1WBZA 2VDOH 5EORH 4JO2H 1OTSD 3CXHJ 2RBLA 1HKLL 3BE1L 3RWJB 4BQ6A 1AGFA 4DGVL 5AWNH 4KUCD 5FYLL 1TIUA 2NLJA 2DLHA 1EZVY 1FNGB 1RIVL 1HWHB 4IRZL 1QFOA 4FFZH 4MHHG 5IGXL 3U7WH 4JO3L 4LSRL 1XF5B 4W4NA 1UB6B 1ZVSA 1MFCH 5I17B 4IOFD 2YN5A 1T03H 3MX0A 3GSNA 1RZFH 3IXAB 4Y2DD 1M6OA 2FX7L 2R23A 3O3AA 2FJFA 1AY1H 4YLQT 2J8UE 4GBXD 2HYMA 4LLWB 3F7YA 5FKAB 2ZG1A 3G5XB 4ODUB 2E8YA 5D93C 2A83A 2NXYC 2X4UB 4Q6IB 2XA8H 3GJFB 2EC8A 2F54B 1GZQA 1MRCH 2BVYA 5EPMA 4MA1B 4OZHF 4F7TB 4I0PB 3IJHA 3FB8B 4QOKE 3TH3T 1NCCL 5FECB 4PJ9B 2R4SH 4GQ9H 1RUML 3F58H 1N8ZA 4ODBD 4DZ8B 15C8H 4I0PC 3SDDA 5J12B 2A6KB 1K85A 3OPZH 4C55A 2VDRH 2BNUA 4J7RA 5JHDE 1H3XA 2QHRL 2D4DA 3BD3A 1CGSH 4CMMB 2O61A 2VL4A 1ZT4B 3TBTA 1DBJL 4RMVA 4GMSH 3D39A 4LEXL 3ZKND 3LN4B 1RJCA 2Q87A 1CF8L 4X4YB 2OI9C 4XWGL 4O58L 3ARZA 1EHXA 1PKQB 3O4LE 1GOHA 4OM1L 4UIKH 4YJZL 5EO0A 1M05A 5AEAA 2DIAA 1F13A 2D7OA 5AYUH 3VFWA 2FSEB 1AE6H 1UG9A 4N5UA 1CK0H 4R3SB 1PW3A 4U7SA 3D3VA 1KC5L 4Y1AA 5FKPB 2YZ8A 2ZCKL 3HS0A 1CBVL 2BC4B 3DX8A 3ABZA 1MWAA 4MJ5A 2JE8A 4HWBL 2QQNH 3WSQH 2GJ6E 3HCVB 2H2SD 4I9WE 2E27L 2JLLA 5E8OB 4KHTH 5EOQL 3WUZA 1P2CB 5DWUL 1T21A 3NZ8A 1XGRB 1GAFL 4N8CL 2WW8A 2CK0L 2OYPA 1T1XA 1U2CA 2YD7A 3DMMD 5KZCB 2B1HL 1B0RB 1C5CH 4G8EB 4FXKB 1AI1L 4Y4FA 4ZFOA 1D9KD 4LSTL 2I25N 3EYUL 4R2GB 3SDDD 4JPVL 4FQIL 3E2HC 1OT1A 2DJ4A 1LP9E 4MAUL 5IQ7L 4LDOB 3TO2A 1ETZB 2JELH 3IYLW 4HC1H 1G6RA 1KBGL 3K4ZA 3H42H 2ZNXA 2Q20A 4Y4KD 1TQCB 2ZPKL 3QG6A 3WO4B 2C4FU 3THML 2YUWA 4HPOL 4X7DC 2JCCE 4A2MA 3AY4C 1CIDA 3MLTB 1K2DA 3MBXL 5HJ3A 2NY5H 5HYSB 3ET9F 5DT1H 2H32H 2XWTB 1K4CB 4XCEA 4X9HA 5GRJL 4LVHC 1JL8A 1CGXA 1T1YA 4OLXL 4G8GB 3IDMB 1CICC 4CDHA 1U93A 3S35H 4ZS6D 1ETZA 4Z95H 1KEML 3BDXA 3MV8A 3FQXB 4I18B 2A74A 3L7EA 1ZHBA 4PJGF 3ZHDA 3QQ9D 1GGCH 1MQ8A 4QO1A 3NGBC 4RAUA 2VDPL 1JPTH 4ZFOB 5KSBA 3MRJA 3U30C 3S9DB 3PWLB 3QUZD 3RL2B 4TVPD 2KQMA 5I18L 4WFFE 3CX2A 4WU7A 3UCRA 3V7AG 2Q76A 5HPMB 2EEAA 5EZOH 1VFAA 2Q8AH 3PF2A 5BO1L 4R7DB 4G7VL 1Y18A 1UGNA 5DRNB 1T1WA 1MAJA 1EGJH 2FNBA 2EDOA 2B5IC 2HVJA 4OZHA 1KJMB 3SDXF 2ZUTA 1A7BA 3MACH 4V1DE 1JHLL 5C0ND 5TH2B 5DJAB 5JIHA 3O4LA 5ITBH 1CDYA 2H3NA 2YK1H 1M05B 3PP4H 4E41E 5CAYB 4LLYA 3BYTA 4K8RC 4LSQH 1HHHA 2VDKH 2FLBT 1RHHA 4M7ZB 4UB0H 3IJYB 1ZT4A 2PF6A 4CMMA 2C26A 2DLIA 4H26B 5E9DB 3W82A 1JF5A 2EO9A 2A6KA 4DOHE 5DFVC 3SDDB 4JFEE 1N8ZB 4FQCL 1BJ1J 2DBLH 4H20H 5GRWA 3EKCA 5EOTB 12E8L 5C3TA 5J57B 3LSOA 4JAMA 4KZEL 3MA9H 4KQ3H 5C2UB 3TA3A 4HK0A 1CFNA 4KK5C 4CDGC 4GKNA 5D70H 5SWSE 2LAGB 3JV0A 1S9XA 3VXUA 3VG9C 4X6CA 1JTTA 3HMXL 1OCWL 4LCCA 4XI5C 2HWZH 2C7UB 1F5WA 3D9AL 1Q9KB 3O2WL 4M6OL 2RIKA 5ECJE 3MV7A 3O3AB 1U95B 3GBNL 4HXAH 5HGAA 3SGEI 2X5PA 3KPQB 2IH3B 5T1DL 1B0GA 2NPLX 2ITDA 4JB9L 4HS8L 1C5CL 3SGJA 2IAND 4GG8B 3O8XA 1ACYL 2DJUA 2PW2A 4CW1B 4G6FB 2V17H 3QULB 1Q72L 3U1SH 5J9PB 4HKBA 5EBLB 4WFED 2E27H 1WISA 4WFHD 4GRLB 4PB9H 3VXRE 4LEOA 4PTTB 2HJFA 1VESA 5ITFB 1EUUA 1CL7L 3WFZA 5BVPH 5I15H 4NO0B 3REVB 4X4ZA 3EAKA 2UUDK 3ULUE 4OTXH 3VXNA 2MHAB 3VXMB 3QDJD 1FSKB 3MUGB 1JGUH 1H8OA 3QRFM 1QBMH 1AR2A 4H0GA 3PWNA 4HF5L 4AEIL 1W72L 4TN9A 4M7LT 4HUUB 3DV6A 3PGFH 5IW6A 1AKJA 4YHZL 4DK6A 2VUOA 5FB8B 4XMLL 3RWEA 4NQVA 1A7PH 5TDPA 3VW3H 4JRWA 3GHEH 1T20B 5JQHC 1G7JB 3ZKMD 2FJHB 2EDWA 4NN5C 3VFPA 3T65A 3VRJA 4QGTA 4QTHA 2GKIA 5EC2B 4M1CD 3LDBB 2GSIB 2XYCA 4BH7B 2EXWC 2R1YA 4KI5D 2FR4B 1I4FA 3L9RA 4TTGA 3B2UC 3D9AH 3O2WH 5BRZA 4QYOA 1BLNB 1YNKH 1JF1B 4FP8L 4N0FA 2FO4B 1JBJA 1DQQA 3KJ6L 1YN7B 2R0KH 2Y5TB 4OT1L 3B9KB 4HH8A 1OM3H 2YXFA 3UBXB 2UZYB 4CVZB 4GW5A 5CBAB 1NEZB 4ZAKD 1JHTB 4N5EC 4PRPA 2YMXL 1YDPA 1DP0A 5CJQH 4F37K 4Z8FH 3RWDB 3D3VE 2AJXH 4J3OC 1JFQL 3P9LA 4NQEE 3ZYOA 3WJJC 2DQHL 4JFDE 3VCLB 5AWNL 3T0EB 2X4RB 2KKQA 1ACYH 4BJLA 3DXAD 3IS1X 2YPKB 4EDXA 4ZAKB 1NCAL 1A4KA 1OAQH 3TZVB 3H8NA 2P5EE 3NIDE 4LSVH 4D3CL 2R0LH 5DEGB 1V7ML 4NQSA 4LRIC 3BKCL 1JHLH 3SGKC 2DBLL 2NX5B 4H20L 4F80A 3KJ4B 4HULB 1ZS8A 4OUOA 4C4KO 2X09A 4KVNH 1DUZA 1A02N 4GAJH 4F15B 5JHDD 2G9HB 4GAGH 3E8UL 4YXLL 4OFYA 1T4KA 1HIML 2WBJC 4Y16B 3G6JE 2QADC 2EYSA 4S2SA 4ZO7A 3O4LD 1M7DA 4A6YH 3MRBA 1CE6B 1N59B 5EU5A 5FYKH 1HHKB 4L3EB 1GZPA 5HHPB 5F3HA 5KTEL 3RX7A 3MRFB 4JO4H 5GGTL 1PEWA 3QH3B 3VFSA 4YEFA 4OUUB 5HYSG 1QQDB 5FO7B 2VDKL 3WFEH 2BOCA 4KMQA 4CVWA 2OK0L 4BQCA 2A0LD 3HC0B 3GFUA 3QCUL 3VFNB 1XZ0B 2MQ3A 3QEQB 4N1EA 5D1QA 3EYVA 1JUFB 2ZJSH 2AV1A 3V6FB 3T2NH 2AK4E 5KVEL 1F4YH 5DEFA 2HAZA 3OGCA 4O2CB 2B5IB 1I1YB 3FOMB 5CLTA 4G80B 1QRND 1R5VB 3FKUS 1CLYL 5ICXB 2VLKA 3OPZL 1QBAA 3L6FB 3OR6B 4TULL 5F6HJ 1F97A 5JPNA 4Y5YA 5T1KA 5DGRA 4MCYB 3TJHC 4CN1A 3S36L 43CAA 2HN7A 3BSZL 4FTVB 2SEBA 1MEXH 3QUYD 1N64H 3JV4A 4PJXA 4PLNC 7FABL 3MV7D 3RTQA 3SN6N 2WP3O 1E4JA 4UUJA 3FTGB 5F9WC 2WUBL 4PJIE 5I2IB 4KZDL 3HI1B 1VA9A 1QFWI 4XNMA 1FDLH 3VFRB 2P8LA 2B2XH 3Q5OA 4X6DA 2VC2H 4YIQA 1INQB 2XZZA 2ICWB 4G6JL 3VJ6B 2W0FB 4GSDL 5HYEA 3IDIB 4P9ML 3PWJB 1QLEH 4G6KH 4XH2B 2CK0H 1M7XA 1N3NB 2J8HA 4ODTL 4K9EC 3JWOH 3VXSB 4MD5B 3EO1A 3P9MA 2EYTA 5IFAH 4KHTL 5EOQH 2DB8A 1FO0H 2PYEB 3G08A 4PLJD 1QSFB 3O6FC 4DFHA 5IV2B 1I1CA 3MZTA 1CIUA 4JPKH 1RIUH 1SJHA 4NQXA 4HLZH 4UT6H 5JR1H 1MCFA 1YNLH 1Q9WB