3U9PH

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
184
Chain Sequence
b'EVKLQESLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGQGLEWMGGIWGDGRTDYNSALKSRLSISRDTSKSQVFLKMNSTDDTAIYFCTRCRRDSSYVVDAWGQGASVTVSSAKTTPKLVYPLAPVTLGCLVKGYFPEPVTVTWNSHTFPAVLQSGLYTLTSSVTVTCNVAHPASSTKVDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 184
sequence length 213
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH01
4RWYL 3WLWD 1ONQA 3KPPA 1J9CT 1LHZA 1Q9WA 2ICEA 1LGVA 1U3ZA 2XZQH 2Y7QA 4ZNEE 4M6OH 1FP5A 3HUJF 4F9PA 5I0DA 2LU4A 4JGUA 3VFGL 4F8TA 1FL6B 4ZYKA 2VXSL 4P2RA 1TVBB 4MNHB 1CICA 3IF1A 4HIXL 4M43H 4HXAL 4KROD 4OCNC 5I6XC 5KS9A 4B41A 1MREL 4WUUD 4TTDC 4N0FB 5JLZA 1JN6A 3WNPA 3KPNA 4X7FC 2HJFB 5FB8B 1Q9LB 3V6ZB 4KMTL 2UUDH 4LSPL 3B3IA 4M61B 4F58L 3EUUA 4R4NC 1M1SA 3P4OB 3RGVC 1JZ7A 3ULUL 5DJAB 4X6CA 2HRLA 2NXYD 4GRWH 3SDAB 1P69B 4K7PL 1R3HA 3QAZC 4PJIF 1I8KB 3K80A 5C3TA 4F7MA 4J3TA 5IV2A 4PGCA 3E8UH 5KJRL 2BVPA 1TQCC 2ESVA 4HIXH 4JREC 1QLEL 1MREH 1WIOA 5C09E 3NCJL 3MUY1 4GRLA 1BZ9A 4PJHE 2R23B 2E3VA 4WI8A 4HMCA 3O6KH 4KMTH 3P4NA 5IFAL 1QFWL 3WDJA 4LSPH 2P44B 2GY5A 3LQZA 4JZNA 5GS1A 3KPQB 3QNZB 4L3CA 4FXKA 3UAJD 1WEJL 4WEMB 2YBRB 4PV9A 5JZ7C 4MA8H 5KSAB 5KJRH 1QLEH 2XT1B 3HZKA 1SEBA 3NCJH 5F3HA 3CNKA 3VGFA 2IQAB 1UXSA 1QFWH 3WV0A 4JPIA 1R5IB 3CFJA 4JN1L 4G42B 1F3JA 1KC5H 3QXUA 4M7JL 4X6DA 1D6EA 4RNRA 4WHDA 3OAZK 4XP1L 3ELAT 3QDMD 4HKXA 2WUCL 3NIDF 4U0RB 3LKNA 1WEJH 4ZTPH 4LCYA 4YQXH 4CVZB 3VXTA 3TBWA 2GIYA 2NY2C 4O5LL 4Y7MA 3BUYA 2P42B 3MYZA 4LLQB 3SY0B 3GRWA 4KK9C 1INDL 4G8IA 1CBVL 3GZKA 3UTPD 4YAQB 5IVNA 4X6BA 4EI5A 1T0MB 4JN1H 5GS3A 1CD8A 2DLIA 4YDLB 2XXMB 3GSXA 4M7JH 4P4KB 2DWEB 3ULVC 3MREA 3H9HB 4XBGB 3VE0B 2WUCH 2ITCA 4CW1B 5HGBB 4WGVB 4KKCC 2V7NB 4CMMB 1CVRA 4O5LH 1FGNH 3KHQA 4ONHA 4QHNB 1JV5B 1CXFA 3GMLB 5E8NA 1CLOL 2ED8A 4N0RA 1NDMB 2MQ3A 1R3JB 4P59L 4OFPA 2GEEA 1QR1A 4ZFFB 2ADJB 1AQKH 5TQ0L 1BPVA 2X4SB 4O51B 5F89A 5C09A 3NMEA 4XPGL 2DQGL 4PJHA 3T2NL 2K9UA 5IMKB 4OCMC 2A9NL 1QSFA 2Q8AL 2OYPA 4R97C 4BQBA 1FFRA 2PF6A 3T0EB 1MELA 3L5WB 2AQ1A 1CLOH 4QRRB 4S2SA 1A8JH 4GKNA 3ZSSA 3MV9E 1NBQA 4K71B 4QXTA 1JGEB 2FEEI 1A7QH 1BQSA 2W65B 4LLVB 5IB3A 1V8HA 3TA3A 4PJXB 2QSQA 4P2YA 4V1DA 1OP5H 3EO0B 1AKJA 2UWEA 2A9NH 3FMGL 5MHSD 1NJ9A 2IAMC 4XCYB 4M7KH 4U7MA 3VFUA 1EFXA 1QNZH 4DGYL 1F6AA 1QO3A 3SKMB 5LGJA 4O02L 3FO1A 5GGTH 3O6FD 1EGJL 3QRGH 4K8RL 4LHJB 4XMPL 3QXAB 2NW3A 2EDRA 1S7RA 2BY2A 5CJXC 1YYML 3MOQA 5ALBH 5I1AA 2BVTA 4PRNA 3DXAE 4WO4B 1GGIL 3DOSA 3RP1A 4AEFA 4M1GL 3C5SA 4XNZB 3P73B 2VTFA 1KLUB 5IB4B 2AEWA 4ORGA 4U33A 1FH5L 2APWA 2PO6A 4O02H 4GG6A 4DQOL 1Y6MR 4P3DB 4K8RH 4XMPH 4PJ9A 3DBXA 4N0YL 5B21A 2QR0B 3NFNA 5D2NC 3QXVA 1GYAA 4RSVA 2APFA 3QUXA 3BP4B 4HMEA 5ICZA 2NY1D 3V6BR 3VDBA 1FH5H 3TO2B 3LQAC 4HUUA 5DJ8A 2BVEA 2VXQL 1KT2A 4KTYA 5T3ZL 1JIBA 5CEYB 1BVKB 4N0YH 1Y0LB 2XPGB 4RGMB 5IVXA 3TCXA 4RFEB 2NNAA 4JG0L 2VDNL 4ODWB 1ED3A 4JKPL 3BPNC 1WISA 4XRCA 5I1KH 2ZCHL 4GS7C 3L5IA 5F70A 3QG7L 3QDJD 5JO5A 5M95B 2VXQH 3QCTL 5T3ZH 1GAFH 3IT8D 3U30B 3L1OL 3ZLQC 3WO4B 1G7IB 3S37L 5C6TH 1NC2A 5FGBC 4YBQC 2VDNH 1KPUB 4JKPH 5IF0B 4Y5XC 4Z7QF 2C7UA 2ZCHH 1HHGB 2HKHH 4G9FD 1A4KA 3FO0H 3OKNB 3QG7H 1O7SA 4WENB 1N8ZB 5ICXB 4QWWC 4XVTL 1T1WA 1A6VL 4Y5YA 3QCTH 1I3RA 1RV6X 3WXVH 3L1OH 2A83B 4RDQG 2Z35A 3S37H 4TPRH 2W92A 1MVUB 2BSSB 1U93B 3BZFA 3PL6C 1MFNA 3UBXI 2MQCA 4BFEA 4GKOA 1F11B 3L9RB 4KK6D 4JHZA 1GGCL 3EAKA 2OTWB 3NOIA 3FN3A 5CP7A 1RUML 3C9NA 4XVTH 1A6VH 4IOFC 4JO4L 2YD2A 1WQVT 3IJHB 5DMIH 1DTUA 1MLBB 4OLYH 3E6FA 2KH2B 4EDXB 5IKCB 3JTSB 4LHUA 2H9GB 2PYEB 1AXIB 3UBXB 1DE4A 1ES0A 2GAZA 4XNMB 4LSQL 5I9QC 3FQNA 1NMAL 5BQ7B 3DYOA 2CLVA 4ALAL 4FQXD 1RUMH 3UYRH 4XNQA 2BRRH 4NN6C 4ODTL 3TZVA 4JO4H 2W91A 3KS0J 1K8DB 2E6PA 2Z9TA 3KPMB 4H5SA 4M7ZB 1RJLB 3QUYA 3HNSL 2B4CC 5GGRY 2YPLB 3VXMB 4LF3B 5EZJA 2FATL 1MWAA 3TGXA 3SDXB 4LSQH 3TLRA 4PG9A 1NMAH 4QNPE 1Z2KA 4LVEA 5HHVL 1QKZL 5CGYD 4UOW0 4NO5B 2KPNA 1OM3L 3PHOB 1RIVL 1W0WB 2DQCH 4ALAH 2N7BA 3JZ7A 4ODTH 4NQCA 5DC0A 1VPOL 3RZCB 3HNSH 1IGMH 5EU5B 1B90A 5E99H 4HC1A 1ORSA 5C0CB 3QUZD 1J05A 1UJ3A 1X5YA 4ZAKC 5HHVH 2R8SL 3QZWG 3OQ3B 5SX4I 5IJKC 3WD5L 3L3OA 1ZMYA 4NBZB 1UCBH 1OM3H 1TCMA 4Z7NF 4ENEC 1OVZA 4TVPL 3VCLA 4PY7B 1T04B 3OKYA 4NRZB 3D5OF 3DARA 1YECL 3G5VB 4P46C 5JDJA 1VPOH 3QSKB 1A1OB 1BOYA 1G84A 1X6LA 5KW9L 5I17A 2FO4B 3DIFB 4OCYL 3WYRA 3N1QC 3UO1L 5EUKA 2DKMA 4B53A 3WD5H 4C58B 2GFBA 3HZYB 4WY7H 2ZUSA 4NIKB 4CADB 2O5YH 1K8IB 3I50H 4D3CL 1YECH 1AD0B 4H88L 4QOKB 5E2WH 1MAML 3BQUD 4L3EB 1RK1A 1W72B 4W70A 3V9FA 2YWYA 3ZKXB 4HV8B 4CDGC 4JFFD 4OCYH 3QQ3B 3MFFB 3UO1H 1J8HE 3H3KA 2EIEA 4P5MB 5FXCH 5IBLD 4TVSa 2HT2D 2EXYD 2X6MA 2CDEA 3JXAA 4D3CH 2PNDA 3G04B 4NRXB 5DK3A 2DOCA 4XPTL 1JGLL 5E8PA 2Q86B 1XF4A 4UDUA 5C7XH 1YEGL 4GQPH 1UVQB 2BNQE 3MJ7B 3ULVE 1EFQA 5DD5L 1D5IH 1MCCA 3C2SA 5DZNA 1Q0YH 5DQJA 2Q87A 2FGWL 2DKUA 4WTWA 4YK4C 3OJVC 5HI5D 4PJFA 4KRLB 3QEQE 5EU4B 5HSFA 4YBHA 4NT6A 3GIZL 3OG4B 3TVMA 4ODUB 3RGVA 5DMGC 1T1ZB 2ZWLT 1N5AA 1YEGH 4FXGB 5CLTA 1WBZB 2A6DA 2W1NA 1EUTA 4N1CA 4CU7A 3HI1A 1UKSA 5D7JA 2Y6SC 5DD5H 3ULVH 4DAGH 2OXGA 2HH0L 5ESAB 1U8QB 4ZFGL 4UQ2A 1HSAA 3QH3B 2O93L 4JKLA 1KTDB 1BF2A 1P5UA 2FWOA 1QUNA 2BVYA 3OV6A 5JW4M 3GM8A 2AKRB 2R0LH 3GIZH 4NC2B 1A6WL 1OARH 4YDKL 4AIXA 4HCRA 5KSBB 2C3HA 4ELKB 2PR4L 2MHAA 1X5GA 3C5ZD 1DQML 1II4E 1KJVA 2HH0H 5K93A 4ZFGH 1Q0XL 4XC1L 4EIZC 2X05A 3QT2A 4Y88A 4FABL 1CXHA 1I9IL 3CSYA 4EUPG 1A6WH 4PGJA 4KJQC 1YMMD 2P8LA 5DEFB 4NZJA 4YDKH 4LSVL 3FTGA 1T89A 3WN5C 5CHNB 2P46B 3DMMD 1XR9B 2PR4H 3VFMA 4P99A 1P7QD 3UPAA 1RPQA 2VZ3A 1EA9C 3DSNA 1JBJA 1JHTB 4JN2B 1D5MA 1LO3L 3MRRB 1Q0XH 3TNNB 4XC1H 3VRJA 4BA8A 4M1CC 4JY4B 2EH7H 2V17L 5C0BB 2VYRE 4FABH 1I9IH 3MNZA 4D8PA 4DN3H 1NAKL 5E9DD 5DQ9B 4LSVH 2BNQA 2ZG3A 2EYTB 2GSGA 2D03L 4JDTL 3VWKA 4OIAA 1LE9A 4HS8L 1NCDL 2EIDA 1P53A 1ZTXL 2BNRE 4OZGF 1ZLUK 2I07B 5D71L 4DFHA 3VGGA 3BT2H 1H15B 3MRMA 2IALA 3OBAA 5HVGB 1A7PL 5FCUH 3VXUE 3D1MC 4NQSA 2V17H 3IXAA 2BCKB 5D2NE 1I1CA 1RJCA 4U6VH 1HSBA 1NAKH 1BQLH 3BH9A 3CPLB 4JDTH 1Z5LA 4HS8H 1NCDH 3L3JA 4KI1A 1FE8L 2LE9A 1EAJA 5D71H 3R8QA 1JWSB 1DUYB 1YY8A 3U9PH 3NPSB 4N5UA 5CAYB 4QGYA 1OAUH 2FIRT 4WWKD 3PXHA 3SGJC 1FZMB 2HMID 1XGRB 2I5YL 1ZT7B 3RWCB 3P2TA 3ARFD 4R96B 3VXNB 2ZNWA 3SGKC 3GJFB 1DP0A 3LQAH 3H9YA 4ZXBD 1CGUA 1S7TB 1FE8H 5AUMB 2J8UE 1OAZL 5HHQA 2VXUH 4PJ5E 1OQOA 1J12A 4F9LC 3VXRD 3O9WA 4X4YB 5GRUH 3IFPA 2IAMA 4YFDB 5HGDA 4OLVL 32C2A 4M3JA 2I5YH 1O0VA 2WM0A 2IG2L 3TBYA 1N4XL 3HCVA 4NPYB 3MRBA 5F9JA 4M1DH 2VUYA 3NH7L 3V5KA 5A2IH 1U92A 3WNNA 3RWEA 4G9DB 5J6HA 5FGCE 1NSNL 4H8WL 2DTML 5CJXA 4JZJC 1LP9B 5MEND 2NY3D 1IM9B 4OB5H 4OLVH 2VDQL 3QIBD 4ZUTB 2IG2H 4BK4A 1N4XH 3R06A 3RUGF 1L9NA 3OKMA 1DANU 3MOAL 4PLKD 4PJGE 4PJEB 3FQUA 1DZBA 1KYOJ 3RHWK 1TZHA 3DV4A 1NSNH 4H8WH 2BHZA 1KGCE 1YDPA 3VXUA 2MQ0A 4G43A 5TF1L 1KEGL 3RDTA 2VXVH 5D2NA 4Y1AD 1BFOA 1BWWA 3CLEL 3VJ6B 2XN9A 2APBA 3BDYL 3L3DB 1QPPA 4UILH 1EAPB 4U2YA 5FA4A 2X4PB 3MOAH 1EVTC 3LV3B 4PJDA 1AJ7L 5CWSB 5D9SA 4HLJA 4Y2OA 4O2EB 5IHUL 4XCCL 1U3JA 1OWRM 1IQWH 4XAKE 2XKSA 1MFBL 5TF1H 5EDXA 2VLRE 4Y19D 1KEGH 1IL1A 3BD4A 4NQDA 2LFGA 3ETBF 2F53D 2XFXB 1B0RB 3BDYH 1F4XL 2GJ6D 2ICWJ 5I76A 1UG9A 2Y9RT 1U8PA 4XNXL 4YFLI 4H1LA 5F6IC 2FD6L 3EDKA 3IAPA 3VW3H 4Y8DC 4PJ5A 1AJ7H 3K4DA 2H8PB 1FZOA 4OAWA 5F1KC 1WVZA 1UB6B 5GHWL 1FV1A 3CC5A 3U0TA 1YC7A 3TFKC 5DGRA 2B4CH 3O45A 2CKBH 2AJZB 4MQTB 4QRSA 1QSEA 1CN4A 1X6NA 2DQHH 1PDKA 5DD1L 1T6VN 4HWZA 5KS9F 1KLGB 3MRHA 1SYVA 1PEZA 3IKKA 5GHWH 5DRWA 3OAUH 4EI6B 1UJTA 1QOKA 4KK5C 3PL6A 3T2OA 3MUGB 2JK5B 1A3LH 5JR1H 3WO3B 1IEAB 1U8OB 4X6CF 3IXTA 4UQ3B 3V8OA 4PJGA 4LLYA 1X3DA 2DLGA 4K94L 5FYKU 1DUZA 1OF2A 5D6DA 4X7CC 3PP3K 4N8VB 4QRPD 3GMRB 1Y18B 1LEGA 4UUJB 4OCLC 5ESVA 5GRJL 1JNJA 3OKDA 1AXSB 4XWGL 4JFXB 4OZFH 2EO1A 3EGSA 1UWEL 2GUOA 7FABH 4MB4A 3LSOA 3GSNB 2FJGA 4U6XA 1C5DB 2O5ZL 5DRZA 3UTTA 5D96C 1M7DA 4NN5C 5EO1A 5GRJH 2X4OB 2VLRA 4O9HL 3HI6L 4OI9A 1XGUB 1S7WB 5BO1H 1P4IL 4R7DB 2AAVA 1VERA 4PRIB 3U7YH 4LPXA 1G1YA 2VDOL 1W8OA 3RVUD 3QHZH 5GQBA 2ZUTA 4X6DF 1YEDA 3MV8E 3O3AB 5J1AB 1SHMA 3SE4C 3EKCA 4Z77A 1UM5L 2O5ZH 5D93C 5E4EB 4XP9L 3BXNB 5IVZA 1ZA3B 3H7LA 1HQ4A 5FYJU 2DI9A 1NGXB 4OLZL 1OTSD 1CGXA 4O9HH 5IM7B 2A0LD 5EZIH 2ZZUT 5CIPB 1CD0A 4XXDB 1FN4A 2NPLX 1P4IH 5IP4A 1E4JA 3LKSA 1TZGL 1BREA 1KIRB 3L3GA 2WWKT 5IR1A 3VI4F 4LMQI 3DVNB 4LLWA 3RQ3A 1UM5H 4NJ9H 4GRMA 4NCDA 4OLZH 4P46A 5IG7B 3KJ6H 3FRPG 4LCWE 2DJUA 3DECA 3CFCH 5DQDL 4NKDA 5EO0A 2W0PA 4TSAL 1TZGH 4Y5VA 1JGDB 1U9KA 3ROLB 4HLZH 3B8YA 2BOBA 4R9HA 4LPYA 5IROC 1KYOK 2XWTB 1RMFH 2R2BB 2GHWB 2WP3O 3D0VB 2GYSA 4NP4H 4KDTA 5DHVH 3PWPD 1PKQA 3IDMB 4LP5A 1GHFL 4QTHA 4XHJD 5K9QG 4LVHB 5I8OL 1BD2D 4TOYH 4I0PD 4PRHD 4A6YH 3WIHH 3UPRA 4KJYA 1CU4L 2FYYB 2NMSA 4Z0BL 1ZLSL 4NNXB 1EXUA 3IDJB 5DQDH 1HH9B 1YUHA 3ARZA 1FZJA 3VFNA 1JNNL 2AJXH 1TZIB 1DLHA 3MRPA 2IPTH 2UVEA 3QXTA 4X7DC 3OXRB 4Z7UE 5CEXA 1A2YB 4RGND 1GHFH 1M6OA 3FQRB 4XNYL 2UWEF 2FGZA 1N2RA 4Y4KC 3C6LC 3PHSA 2DYPD 5GGSY 1VGEH 5I8OH 1G1CA 4XH2B 5A40E 5T1MB 5D7IB 1CU4H 1SJHA 3D25A 5JHDD 4ZOEA 3P77A 4OQTL 3IJSB 5I8CB 3FFDA 1QHOA 4MXVF 1JNNH 3RWIB 4IRZL 1IARB 3RVWC 5L8KB 4MD4A 5JPMB 1XIWA 2D2OA 4LEXL 4JFDE 4OD2A 1MHCB 1UXWA 4G8GE 4TUKH 4JG1L 5GJTH 1NEZB 3FCTA 4XNYH 4MJIE 3OGCB 1FNLA 3SKOA 3SQBA 5FF6B 2A77L 4KU1A 3LKPA 5SWQB 1YMHB 4EDWL 1XGTA 2ZOLB 2DLTA 4OQTH 2AABL 4OGZA 2HN7B 4GG6F 1ZWIA 3MLZH 4LVNC 4LEXH 4JFQB 5ID0B 5J89A 1ZHBA 3N0PB 4JG1H 1XR8B 5E5MA 4JCLA 4A6YA 1I8IA 5I1EL 4H25B 1CTOA 4LCWA 2A77H 1LMKA 4N0CD 1PY4A 2V2TA 3AXLB 4EDWH 3GUTA 5F8QC 3L7EB 1AGEA 2QSTA 2AABH 4YDJB 5SWSD 1HCVA 3AS2A 4YDVA 1URLA 3U1SL 3NZHL 3SE9L 3HNVL 5DFWH 4Y4FC 1LNUB 2ITDB 3KR3L 4O00A 5IVXF 5I1EH 3NZ8A 2W0FA 3CFIC 1HIMH 3WKNA 3GMMB 2RBLA 4E41B 4E5XA 5ITBL 1IC1A 1D9KA 1MCRA 5BV7C 1ONQB 4NC0B 4XVUC 3KPPB 5J06A 2ZPKH 1Q9WB 5FA3A 2Y7QB 3U1SH 3NZHH 3SE9H 3FB6A 3HNVH 3I6GA 4WFHE 4M7LL 1OD7A 5L2KA 1FGVL 4YR6A 5CBAA 5BW7C 4ZYKB 1QLRB 1QG3A 5C0IB 4NKOA 1CDYA 3SDYH 2QQNL 5JIHA 1RHHA 3O4OB 5T5NF 3RWHB 2FL5A 3VG9C 4OIBA 4OCSL 5JLZB 5ITBH 1JN6B 1YN6B 3KPNB 5JQ6H 3B3IB 3PWNA 4TSBH 3HI5L 5ALCL 1DVFD 4B0MM 4G8GA 4AIOA 4OUUA 3OKEB 3WLWC 3D3VE 5EU3B 1WFOA 1KTKE 2O61B 3NVQA 1OAQH 1R3HB 1ZK9A 3GB7A 4HF5L 4HW6A 1U8NA 4PGCB 2BVPB 2ESVB 1FNGA 4HGMA 3QCUH 1ULVA 4OCSH 3DETD 4GRLB 1BZ9B 5BVPL 1P1ZB 1FFOA 4G8EB 3P4NB 4N5EC 4KROC 5EU6E 4FZEL 4F3FB 1Z9MA 3LQZB 4Z7OF 1MRDL 5GS1B 3SGJA 2YPKA 3UEZA 2NX5B 3P9LA 4MCZB 3F7PC 3LEVL 4MAUH 4L3CB 5BS0A 4OV5A 5F7MC 4HF5H 2NY0B 2NXYC 3OTTA 1UZ6E 1FNHA 3NGBC 2PETA 4JFED 3HZKB 1G9MC 4ETQA 4TSCL 4WFFD 3LDBB 5F3HB 3C2AL 5HDQL 1L0QA 1UENA 1UXSB 1MFAL 5A2JH 4PJBF 4F9LA 4JPIB 4FZEH 1IFHL 5ERWA 1MRDH 4ETYA 1F3JB 4RNRB 4BQ9A 3Q0HA 3T3ME 3V5DB 2PXYD 4XBPA 3N9GL 3TC9A 3LKNB 4QHMA 2FJHA 4S1DD 4LVOC 3TBWB 3GRWL 4I4WA 4PJ7E 1TNNA 3UAJC 1MCWM 4G8IB 3FFCD 4JZJA 5IEKA 4HUNB 3TYGH 5EOQH 4X6BB 4EI5B 1IFHH 5HHOE 6FABL 4M8QB 3J8F7 5TPWL 4Q9RL 4MJ5A 1S7UA 3LMJL 3MREB 2VXTH 3N9GH 2ITCB 2DAVA 1JYVA 4BUGA 3VFPA 3C09C 1QPXA 1K6QL 4OF6A 4NOBA 4PV8A 5IHLB 1T7VA 3BGAA 5D7SH 3QQ9C 5GS2H 1CXIA 4XCNA 3D3VA 4MMZC 5TPWH 5HHNA 35C8L 4C57C 4D0BA 4MA3A 1HHJA 1OAXL 5MEQB 1QR1B 5CLWA 2VKWA 4LCCC 8FABA 1S7QB 3BH8B 1CVSC 5F89B 3QIWC 5C09B 1K6QH 4PJHB 4G7YL 5EU6A 2OTUA 3QIUA 4QKXB 5FIEA 4LKXA 1CE1H 2XZAH 4S2SB 4FFYH 2YD7A 4GKNB 1UH4A 3STLA 1EZVY 43C9A 3BZDA 1FNSL 5CEZE 1WIPA 3O8XB 2EYSB 3I6KA 3QDGD 3MGOA 5IB3B 3DRQA 1HE7A 1RU9L 1T5XA 12E8L 2UY6A 3IFNH 4HULB 3UTSA 1YQ2A 1P6AB 3FL7A 3I6LD 2P5EA 4YNYA 1AKJB 2UWEB 3VFSB 3C60D 4P3CH 2X89A 4F80A 3DX6A 3VFUB 4OZ4A 4YX2L 5B8CB 5FYKE 3EO1B 1F6AB 1QO3B 5LGJB 2D7TL 3FO1B 1JWMB 2Y4SA 3G6AA 3WBDA 5CEZH 1KCRL 3K0WA 2OJEA 12E8H 1S7RB 5I1AB 4DUXA 1SYSB 5BRZE 3AB0C 4PRNB 3C5SB 5CUSL 3T3PE 1IKFH 3BMWA 3F12A 3FT3B 4FG6D 3SDCD 4PJFF 1AGFA 4ORGB 4PTTA 5FYKH 1WWAX 4F2MA 5E6IB 5DK2A 4YWGL 1CZ8L 1CFSB 5DD6A 4PP2B 4HJJL 3O6FC 2IF7A 3RTQB 1M7XA 1R0AH 3QUXB 5L2JA 3JTTB 4JCMA 1S7XB 5IMLA 3IFLL 2YC1A 4MS8D 1J1PH 4PJ8B 4CNIA 4HUUB 3S3SA 1CZ8H 2WANA 5LBSL 3TPUA 2VDLH 3EYSL 1NKRA 1A6ZA 3AY4C 3D87B 3TT1L 3R0MA 1KIUA 1T0NA 4NSKB 2K7PA 2DQDL 3GNML 2PN5A 5E2UH 3W0WE 4OI8A 1TJIL 4MHHG 4MLIA 3D2UB 4NZTH 4LAQL 1ED3B 3QO1A 3MV9B 3IFLH 1P4BL 3DURA 1QFOA 1ZLWH 4FQCL 4OCRL 3AM8C 4LKCB 3C5JA 5JO5B 4Z7VE 3SE4A 3D39D 1G9NC 3TT1H 2JE8A 4Q6IC 5JDSB 2DQDH 3GNMH 3GDBA 1N0XL 1NC2B 1NGZA 1XF3A 3ARGC 1TJIH 2RFXA 4LAQH 1EBPA 3AGVA 2X09A 3FHAA 3LQMA 3WE6A 2C7UB 3P0VH 3W11D 2P5WA 5LWYL 4LGRB 1Q9OA 1AQDA 4ZD3L 4FQCH 4OCRH 3UXFA 5I71B 4L4VE 2OQJA 1T1WB 4Y5YB 4EN3D 2HAZA 1I3RB 4MVBC 4CAGA 2C1OA 2CMRL 3MPCA 4HIIB 4JFHE 3FN0H 2Z35B 1XGYL 2J4WH 5EIQA 3HE7D 1RJZB 1CFQA 4K23L 3BZFB 2J7LA 2GTWB 2E5EA 2EDEA 3INUL 1A4JB 1I9EA 1YEEH 1DQTA 5LWYH 5FYLE 2B1HH 4Y4HB 4AMKL 2AVGA 3KPSD 3QUMA 2WK2A 5CZKA 3VXQA 4ZD3H 5EIVA 5ESQA 2WW8A 5FDWA 3E1F1 2DMKA 5IROA 2UZIL 2YS4A 1YN7B 4LGPB 3E6FB 5FM5M 2K1MA 2OI9C 3Q6FB 1A6TA 4LHUB 5GGRA 5L88L 5GZOD 4GBXA 1MI5E 2OXHA 2GAZB 3U0WL 5C8JA 3FQNB 2BC4A 2W9DL 4M9OA 5FYLH 2CLVB 4AMKH 2EDBA 2FECL 4D0DB 4CRPA 1F5WA 2E9IA 3TZVB 1FJ1A 3BE1L 2H45A 4X80H 4YO0B 4H5SB 3W0WA 2UZIH 1V7NL 1MWAL 1RK0A 4RISL 3BPLC 5E03A 4CU8A 3C6LA 5E2JA 4PG9B 4YXHL 5TFSL 3S98A 1S7SA 4O58H 2W9DH 4U1NA 2NTFB 2NXZB 1A14L 3NFSL 4WDIA 5D7KE 4FP8L 4HIEA 3SGDH 4HC1L 2XKNA 2V2XA 1AXTL 2WSKA 5BV7H 4ELME 5B3JE 3IU3B 2HLFD 1UADC 3QZWA 4RISH 1ORSB 5DS8A 5GRYA 4U31A 3N85L 5GPRA 4YXHH 1X5KA 4G6JL 1R3KA 3HAEG 5TFSH 3ARRA 5E94A 5DURD 4L4VA 4NHUB 1J0HA 4EKXA 3H3PH 4NNPL 2X1OA 3NFSH 3Q48A 3VCLB 1CDBA 5HVFB 2VC2L 4YPJA 1LO5A 1T83C 5CGYC 3OF6A 1VHPA 4ZUVA 1G7QA 5E5RB 5KAQF 4HX1A 3GSOA 1H3GA 2MJWA 2KZWA 3MCLL 1CD1A 5IIEA 1I85C 3HE6A 4G6JH 1QEWA 5DRNB 1HHIA 3BW9A 3ULUD 5IFJA 4NNPH 3CSPA 3CUPA 3B9KB 3QI9D 4L1DA 1MSPA 1G6VK 3JBG7 3W5NA 4PJDF 1MI5A 4ZQKA 3X11A 4GMSL 1RK1B 4Y4FA 3RY4A 2VAAA 4WFGD 1FYTD 2VR9A 2I9TA 4KI5F 4X4XA 4XWOD 4KJWC 4FA8A 2NTSP 1MJJB 3BGFC 4QF1A 4KRNA 4UDTA 5KSAD 4LSSH 4EUPH 4EIGB 2CDEB 3F5WA 4CN1A 4LDLB 5LJYH 4UNTA 3MRKA 4UV4H 2HJKA 1A5FL 1XF4B 4Z95L 4H0GA 2F8XC 1B3JA 2XXCB 2XZCL 5BW7A 2FLRT 3BWUC 4DKEL 4DK6A 4JO2L 3WFCL 5DQJB 2IGFL 1D6VH 4JGMA 5I6XB 1FVDA 5F7DA 4U1JA 3BIKB 5DF0A 2VSDA 4JM2D 4PJFB 5T33L 4YHIA 2YSSB 5J6GB 5D2LF 3ECBA 3ARBC 2YMXL 2IPKA 3VH8G 2F15A 3RGVB 1A5FH 4U0QB 4Z95H 1NMBL 2BJML 2NY7H 3DO7A 2A6DB 3KNBB 2XZCH 4J23A 3QAZB 3HI1B 4LPVA 4DKEH 2GCYB 3MUZ1 1I3GL 4Y2DD 5E8DL 1T03L 1QA9A 1TQCB 4JREB 3RU8L 1BBJA 1M4KA 4YZFF 1I7ZB 1XAUA 1HSAB 1G6RH 3GKZA 3ET9F 2FWOB 3G6DH 1MCIA 5HGAA 1AHWC 5DVLA 5HI5C 4OGYL 2BJMH 1WCBB 5IHZB 5F9DC 2ERJC 1KJVB 1VGKA 1I3GH 5E8DH 1A1NA 1T03H 4EUPA 3RU8H 4X0KB 4JFPA 1HKLH 4HIHA 3SE8H 4PD4J 2DIBA 1E28A 5KVGL 4HWEL 2ICES 3DYPA 2HA1A 1GGUA 1L4IA 1DLFH 3CSYB 2E7LC 1MCPL 3T0ED 1A7OH 4DK3A 1F90L 5H94A 4JO3H 5MEOA 5E56A 3ZT5A 2Q7YB 4LFHG 4PJAA 1J8HB 4HEPG 3H9SD 5F7HA 1MIEL 1D5MB 3WL9A 2NY2B 5IB5A 1CFVL 2CUHA 4R2GC 5KVGH 3C5ZC 4HWEH 4JQVC 4EEEA 3S4SG 5FO7A 1JHLL 1MCOL 4JQXA 1F90H 1C7TA 2AK4E 2BNQB 2Z0BA 4WW2C 1IAMA 4ZTOL 3B5TA 4YUEL 1G6RA 4NZUL 2OSLA 4OF5A 4ZFOA 3SQOL 4NHCH 3QEQB 1CFVH 2Q76A 4O4YH 1PYWA 1JHLH 4P3WA 4U1SA 4IHOA 3QQ4B 4F7TA 2N4IA 3BH9B 2VZVA 4N8PA 5EFIB 1GCFA 3L3JB 4IBLT 3EYFA 4ZTOH 4YUEH 3MRCA 1TTUA 4YHKH 5TE7L 3QIWA 5DTFA 4NZUH 2JB5H 2BVQB 1D5ZA 4R97B 4NCC1 3BESR 1RD6A 1OPGH 4OZIA 1W2KT 3BSZL 3H0TA 1JPTL 3JWNC 4J3OC 4PREA 2XY1A 1J0IA 1S7VA 3UYOD 4G5ZL 5EO9B 5D5ME 1RHFA 2GITA 5TE7H 2CGRH 4H26A 3T4AA 1OP3K 2G9HB 4UV7L 2AI0L 3IFPB 3N1GC 2IAMB 5HGDB 3NA9H 32C2B 3V7AG 4MAYA 3BSZH 3HMWL 5F7FA 5GXBB 3RHWF 3HCVB 1AY1L 1YY9D 1MNUL 3MRBB 3KPRD 3V5KB 1U92B 5I0ZA 5DXWA 4D9QE 3RWEB 3ARFC 4G5ZH 4PJCA 2QHRL 5SV4A 4BSJA 1UYWL 1T2JA 2UZXB 1JUFA 3EYOB 2X9WA 4HUXB 4ZXBC 4WU7A 3TV3H 1RULL 5DJ0A 3REVA 3EW3B 3DVGA 3HMWH 4NO0B 2AK4A 5I1CL 3R06B 4U3CA 1MNUH 1I1AA 3OKMB 3V7MA 2BNRB 2Q6WB 3BHBA 1TZHB 2QHRH 1DFBL 2BERA 1AC0A 1BFTA 1UYWH 1BLNB 5FUOL 3VXPA 3RX7A 4G9FE 3VXUB 2BZDA 4G43B 3JVGC 4XHQA 5D2NB 3L5XH 1UM6H 3OAYK 3LRSB 3RVVC 1YC8A 1JYNA 2FNBA 1ZEAH 5I1CH 2FCBA 43CAA 2NY3C 4R0LA 5FA4B 1J0KA 5JIPA 4TNVK 3QIBC 1OAKH 1DFBH 2MOVA 4N8CL 1DN0A 3AAZA 2I27N 4PLKC 5E0QA 2ARJQ 1ZGLA 2XI9A 1IL1B 4IM8A 2A1WL 1MAKA 3BPNB 3LKRA 4GS7B 2PYED 1I1RA 3EJYD 4NQXA 5I76B 1U8PB 3AM8A 4H1LB 2WZPD 2O26U 5EIIA 2J8UB 2X9XA 4P57A 4HT1L 4PJ5B 4ZODA 5HVHC 4PD4K 4OAWB 1ZT1A 4UB0H 1T7YA 4Q6IA 3CC5B 5JW4N 1G7PA 3ARGA 4P9HC 3O45B 3F7YA 3DYMA 3T8XA 1ZS8A 4NBYB 4Y5XB 3FRUA 4JPKL 3VXMD 4BKLB 4QRSB 1P6FA 2F58H 5F1IA 5FGCB 3RX5A 3STZA 3L3KB 3WFHA 4HWZB 1FORL 3QUKA 5CD5D 4HT1H 3HPJB 1IGTA 1V3MA 3OKOA 2FSEA 3MRHB 1AP2A 2CD0A 1Z6JT 3F8UB 4WTZA 3PGFL 5DRWB 5A2KH 1CDIA 1OW0C 5KSUB 2PTUA 2APVA 3EJJX 3RZCD 3PL6B 5DEGA 1X5IA 5CZXD 4FQLL 5DMKA 1CDUA 1X9QA 3IXTB 4CMHC 2ADFL 5C0CD 4PJGB 3MLTA 4LLYB 3B5HA 5AZEL 3UX9B 1OF2B 5HPMA 4KY1L 1FORH 5ESVB 1LEGB 5DO2C 2AV1A 4K3GA 4RA0C 4NKMA 1BFVL 1LK3L 3GSVA 3PGFH 4OFYA 3T2PA 3FKUS 4TVPD 3EZ8A 4QO1A 4LLMA 3EGSB 3BP5B 4O2FA 5I9QB 2ZJSL 2MCG1 4DN4L 3EOTH 1TVBA 1WIUA 2FJGB 1U8HA 4KZDH 2MWCA 1INEL 2YXFA 5DRZB 2DQIL 2EDQA 5FB8A 1XCQA 4NN6B 3UTTB 1M7DB 4M61A 4WI7A 1BFVH 1RI8A 1LK3H 2VLRB 3KS0H 4ZO6A 2CKBB 3SDAA 3UZQA 2BSRB 3VWJD 5E1HB 3B2VL 4MX7A 1T21B 2YZ8A 5E2TH 5IUSA 1BOGB 3O4LD 1HI6B 1INEH 2DQIH 5IVZB 1HQ4B 4Q2ZB 4NRYA 4JFFE 4AM0B 4EOWH 5E6YA 5L9DL 1B88A 3T2QA 2EDNA 2HP4A 3DUUB 3J7HA 3EOBA 3MLXH 4Z0XA 3DUHA 4WVRA 1E6OL 4QTIH 2DMCA 2WLYA 2DKSA 5GGVY 3B2VH 4ZAKB 1S78D 3L3GB 4GQ9L 2R29L 5IR1B 4GXVL 2A6IA 5C08E 4POZD 3V4PL 1F58L 4PPTA 2ZOKA 3FRPA 4YLQT 4GRMB 4JY5L 2Z8WC 4TRPH 5T1DH 3IDYC 1FZKB 3PP4L 4P46B 4OZFB 1IQDB 1OY3B 4G42A 3M8OH 3WHXA 3ZDZE 1A9BA 1E6OH 1GGTA 3FB5B 1OTSC 2P1YA 3WFZA 1VFBA 4CVZA 4GQ9H 1TJHL 5H35A 2BOBB 4XBEL 4LLQA 2NR6D 3SY0A 4LIQE 2VLKE 3OWEA 1T3FB 1K9TA 4QTHB 3PP4H 3VDCA 1T0MA 5F7KC 4LPUA 2AEPL 1FVCB 4P4KA 3UPRB 2J2ZA 3H9HA 4L4TE 4CVWA 4XBGA 4AY0A 3VE0A 4CW1A 5EZOL 3C08H 1YUHB 1RZJL 4MQXD 5HGBA 1FZJB 4UTBL 1HEZA 2V7NA 3GO1L 1FL3A 2VIRB 1S8DA 3MRPB 3S3JA 1F4HA 3PWUA 1JV5A 2F5BL 4PS4L 4LIQH 1L7IH 1JWUA 2X7LA 3GSUA 1JK8B 1UFUA 1Z9SA 1R3IL 2VAJA 4NWUL 4IS6B 2MFNA 3GSRA 5A3ID 4X4ME 1RURH 3O3EA 2ADJA 4ZFFA 1SJHB 2X4SA 3P77B 4XHJC 4XPAL 2VDMH 3FFDB 1JMZA 4QRQA 3QHFH 2V2WB 1YMME 4YK4B 4OT1H 3RZWA 3BAEL 4JFFA 4OD2B 1U8KA 3TBVB 1ZHNB 1LO0H 4PS4H 1CWVA 4IRSC 1UXWB 3BZ4A 3H8NA 3ARBA 4K7PY 3FCTB 4QRRA 4KZEL 3OR6A 4NWUH 3SKOB 5C0BD 1EEZB 3LKPB 4XPFL 3CVHA 1XGTB 4KKAD 4RGNC 2M1KA 4XMKH 4GW5B 2NY5L 4LLVA 4KJPD 4JRXD 5C08A 2EC8A 5GIRB 1IC5L 3NBNA 4GKZA 3NCCB 3BAEH 4XCYA 1GGBL 3GM0A 2BDNH 1HYSD 1ZHBB 2RHEA 5I1JH 1OT2A 4LBEA 1WBXA 5E5MB 5HI4D 5I30L 4A6YB 1NCUA 1I8IB 5MI0C 4KZEH 4LCWB 2X40A 3GHEL 5ADPL 2V2TB 4XPFH 4CBPA 3GUTB 2NY5H 1AGEB 1X5AA 4ODVL 1QBML 3VFVA 5EBWA 3ZDYF 3BD3A 2VLKA 4PRDB 1GGBH 5IB4A 4RFOH 4C56D 5I30H 1HNFA 2ED7A 4IIQC 4XPHL 3NZ8B 4DZBA 5ADPH 2XA8H 1A64A 2W0FB 4L4TA 5F72S 2HTLD 3WN5B 5KZCB 4Q9CA 1E0OB 3TT3H 3BEWA 3W9DA 1EO8L 1Z9OA 4E5XB 1TPXC 3LH2L 1VACB 1QBMH 4K7FA 4N0CC 3CZFA 4FMFA 4M9PA 1PW3A 2BRQA 5FA3B 4FQHB 3FB6B 5CP3H 3ZE0F 3Q5TA 2EKJA 4I77H 4POYA 5CBAB 5MP6L 3C8DA 5EBMB 1CIUA 4X4MA 2Y07L 4XPHH 3KYAA 2Y72A 1JVKA 3VXRE 5JMOC 1RHHB 1QSZA 2FL5B 4PGDB 4BFBD 1EO8H 1U8LB 1G0DA 3PWNB 4JFDB 4WI6A 1DBAL 5D1ZC 4G8GB 1MRFH 4OUUB 1SMOA 4WTXA 1BX2B 2HWZL 4HPYH 1BF8A 1E4WH 5HGGS 1IM9D 3TWCL 3GB7B 1ZLVK 1U8NB 4CN4A 1K4DA 1CDJA 4J1UA 2HTKC 3CIQA 3QWOA 5FECA 1UKTA 3JV0A 2BY0A 3QNYB 4KWUA 5IB1B 1NGQL 4FQ2H 4WCYL 1FBIH 4U1LB 5DHYA 1QYGL 1AR2A 1MJUL 1UEMA 5EA0L 5E95B 1WFNA 3Q6GL 2YPKB 1KPUA 5E7BA 3P9LB 3VFWB 5BS0B 4ZPTA 4HUVA 4OV5B 3TWCH 4FTVE 4I3SH 2YA1A 5IW1A 4JO1L 5ICXA 1NCTA 1N5YL 2ADIA 4ETQB 1BZQK 1NCNA 5T1KA 2A83A 4WCYH 1QYGH 2Q1EA 4BUHA 1MJUH 2BSSA 5ERWB 3PV7A 3UJTH 3SKJH 5GGQL 2J5LC 5JA8B 4HKJB 4M02A 5F7LB 5EG6C 1G7HA 1NGYB 3MRDA 4NQVA 3L9RA 4QHMB 2R2EB 2GK0B 2FJHB 5EC2A 3ZYOA 1AE6L 3QO0A 1YEIL 5J57B 1N5YH 1MFCL 1MCQA 2F54E 4KGJA 4U6HB 2F53E 4LLUA 5IHBA 4JZJB 3QQNA 3VMPA 2F8OA 2GJ6E 4FFZL 1JI1A 2XQYK 3LY6A 4EDXA 3JTSA 1WZ1L 5IKCA 5I18L 5B4MD 1MJ7L 1JTPA 4MJ5B 1S7UB 5GGQH 3VXRA 3BGMA 1GRWA 2AXFB 3P4MA 4CUCA 5L7XL 4X7EC 4TUJA 4PV8B 4M93C 2PXYC 1UB5A 5J13C 1TFHA 1K8DA 4X9IA 3HMXL 4S1DC 4FFZH 5D1QD 3JVGA 1RIHL 2YPLA 1WZ1H 3D3VB 3GGWA 5I18H 1J18A 3VI3E 4D0BB 4MA3B 1HHJB 3SDXA 3UJIL 2CJUH 1IKNC 4HWBL 5L7XH 4E9LA 2VERN 3SOBL 3HMXH 1EEQA 5EU6B 2OTUB 5AZ2L 4MGXA 3W9EB 3GJFK 4LKXB 1RIHH 3T0BA 2X4NB 2PKDA 2H2PD 2EH8H 4H0IA 4YHMH 43C9B 3UJIH 1KUMA 4FTVA 4BZYA 1AR1D 5D1XC 5J4MA 3MGOB 3DRQB 5D4QA 1T5XB 3VGBA 5GZND 4HWBH 1HINH 5F6IB 2Z8VC 4RMTA 1MCJA 5DHXB 2X42A 5ILTL 5C2BL 3WCYA 5KANG 5FUZH 3DJ9A 1RZ8B 3JWOL 3G6AB 3DIFA 5TDPB 3MNWB 1Q38A 1FO0A 4XZUA 1B6UA 2OJEB 4PRID 4Q58C 3HZYA 2VWEC 2F54A 4PJ7B 4GW4A 4OBSA 2F53A 5JXAL 1ADQH 3BWAA 1T80A 4G6AC 1K8IA 2HRPL 1HHKA 1ZGLM 3QEGL 2GJ6A 1PG7X 3FQWB 5HHOB 5C2BH 3TPKA 3EFFA 2OL3H 1YEHH 1AGFB 1OW0A 1H8NA 1LE5B 4L3EA 4D2NA 4F2MB 1MVFA 4HV8A 4UT6H 1T5WB 1ZHKB 5C70A 1FSKC 1DL7H 1Z0NA 4QXGL 5DA4A 5JXAH 2DI7A 5KOMC 3NCFB 3QEGH 5SWZD 3DRTB 5C0JA 2X4UB 1R5WA 5HI3D 4CNIB 5GS0C 4Z7WE 3TPUB 4FG6C 4MA7H 3SDCC 1NCBL 2GW5A 5DRXB 4ZUUB 4YHOL 1X5FA 1T0NB 2LVEA 4QXGH 2W9EL 5D96B 4NN5B 2AJSH 2GQHA 4ONGH 4ODUA 3WUWG 5EBLA 5EORL 4FXGA 1WBZA 3NACH 3DURB 3KPLB 4U1IB 3PWPE 1BEYH 3PE9A 4FRWA 5I8KL 3V6OE 4N90D 4MS8C 2A6JB 2GJZA 3QNXB 4WV1C 4PRHE 1MCEA 5D93B 5HJ3B 2R4SH 4PJAF 1NGZB 1X7QA 3V4UL 4UT9L 2RFXB 2AKRA 1IZJA 5F8RC 2AGJH 3WE6B 4I3GA 2HFFA 2VISB 2P5WB 1Q9OB 4RGNE 1T66C 3KLSA 2AEQL 4V2BA 3GIVB 4I9WD 3TN0C 3TM6A 2J6EL 5I8KH 5K9OA 5BRZB 1H3XA 2C1OB 5HHMD 2B2XL 3M45A 5JHDE 2YOCA 1HH6A 3ARUA 3RVTC 4UT9H 3V4UH 3HAEH 5J1SC 3QFDA 1XH3A 3KPOB 4BFIA 1HQRA 3P0GB 5CHNA 2DD8L 1XR9A 3I85A 3K2MC 3QUMB 1LDPL 5HHPB 3VXQB 5JXED 5ESQB 3SBWA 5JOEA 3W11C 2J6EH 5FDWB 3EFDH 4AZ8A 2DBJA 3BPCA 1NDGA 2B2XH 3X14A 1MIML 1DSFL 1ACYL 3WIIH 2JCCE 3MOBH 4EN3C 1A6TB 5FYJL 5GGRB 2YHGA 1RQ5A 4GBXB 4ZOAA 3Q2CA 3MSPA 3HC4L 5C8JB 2VLJE 3G5XA 2BC4B 4GJTB 4YHNB 4OM1L 1SJXA 3HE7C 4Z7WA 4N1EA 2ILLA 3ZKNC 2RB8A 3MJ9A 1LDPH 3ZHLA 5TE4H 3AREC 2UV3A 4OZIF 1IAIH 1YPZF 2VITA 4X83A 2CLZA 2I07A 2LU7A 4WGWB 5DT1H 1FJ1B 3RX8A 1H15A 4Y16D 3MLYL 1BQHG 3W0WB 4OI7A 1DSFH 1ACYH 2AV7A 2Y06L 4XXCA 1XCTA 1RK0B 4UIKH 5SWSE 5CSGA 3HC4H 3C6LB 2A6KB 1NAML 2FR4A 1S7SB 3CPLA 3HS0A 1CL7L 1NFDE 2H32H 3CU1A 4U1NB 3SJVA 4WFED 5GZOC 4YH6A 5GISL 4Z7VB 4WDIB 1JPSL 5ISZD 1DUYA 4OZHF 4U7SA 2XKNB 2V2XB 1FIGL 3MLYH 1ZGLP 1EHXA 4P0DA 5TDNB 4PJCF 4AL8L 1HK6A 4FQ1H 2Y06H 1DQLL 2DQJL 2FH8A 2IMNA 3QZWB 1FZMA 3MV01 4IRSA 5DS8B 1CT8B 3PGCA 1ZT7A 3NCEB 3RWCA 1RZKC 1N6UA 3MNVA 1NAMH 2NY6B 3GJFA 1R3KB 2IEPA 4P4RA 2VR4A 1CL7H 1UH2A 4L4VB 2H41A 4P2RD 5GISH 3MA9L 1CICD 1KSRA 4JM4L 3U6RB 1U3HD 1JPSH 3NIFE 2R9HD 3NABL 4X4YA 5CJ5A 4LVNB 4HK0A 3PV6B 4ZUVB 1G7QB 1DQLH 5F21B 2NY4C 1KN2L 3ZMRA 3MLRL 2EO9A 1CD1B 4U05A 5IIEB 4NPYA 2XV6B 1QEWB 1HHIB 1T4KB 2AQ2A 5IFJB 1JPST 5HD8C 2ESVD 2X9YA 4LCUB 3SGDI 1LP9A 3ZKQD 2HFGL 3NABH 1SVCP 4GRLD 2JCCA 5M7QA 1J5OH 3QPQD 1SM3L 1MI5B 3I2CL 4ZQKB 3X11B 2VLJA 3FB8A 4Y4FB 3MLRH 2VAAB 4NBXB 3U7WH 4IIQA 3WNLA 2I9TB 2Z31A 4PJEA 3V5HB 4QF1B 3PHQA 2NY0D 5BV7B 4ZSOE 4CKVX 3F5WB 2HFGH 4AENA 4GAGL 3ULUC 3MRKB 1ZHLB 3HB3D 1BAFL 5SWSA 3QI9C 2HJKB 5E5UB 3OR7A 1X5HA 4XB7A 3I2CH 4JFEE 1FPTL 4LASH 4GAJL 4FFVD 2OJZL 3L3DA 1Z9LA 4LNRA 2X4PA 2Y36L 2JIXB 3QEHB 3KLHD 1FVDB 3VH8A 2I26N 5F7DB 3VG9B 3G6JE 3GHBH 2HT4D 2X4TB 5CWSA 5LXGL 4ELMB 4NDMA 3SCMC 4ZDHB 4MCYA 2IPKB 5D1ZA 5KVFL 1KTRL 4HPOH 4EQ2A 1FPTH 4EI5D 4LSUH 3DO7B 4MZ2A 3U46A 2DLFL 5FFLA 1B0RA 4RRPG 3D85A 2OJZH 4L1HA 4KKLC 1QA9B 1BBJB 4XPBH 5ANMA 1EMTL 5BVJB 5KN5B 4ZS7H 2H8PA 2CO7B 2VL4A 4KROB 5KVFH 5HGAB 2WV3A 1GC1L 4BM7A 1KB5H 4JM2C 1SMAA 3NIGF 5BZWA 2AJZA 1CGSH 2DLFH 2J1KA 2IPUG 5A2FA 1VGKB 3TH4T 1A1NB 4EUPB 2NXYB 3BDXA 4HIHB 3NGBB 5IW3A 3V7AE 1EEUA 1A02N 3HRZB 4HDIA 5C09D 1KLGA 4Y2DC 5KG9B 3ZYJA 1QSFD 3MX0A 3SN6N 4JHAH 3AU1B 3MBEC 2IFGA 1GC1H 2Q7NA 1WC7B 1J11A 1J0ZA 3EYVA 5H94B 5MEOB 1TIUA 1IEBB 5FGSA 5C0FA 2DN7A 2YUXA 3BJ91 4UQ3A 3S4SA 4LLAA 4WU5B 4LVOB 1EX0A 2VWEE 3TA3D 3GMRA 1Y18A 5IB5B 4JEGB 4V1DD 3QDGE 2WP3T 3FJTA 1AKJD 3CK0L 1P7KA 1AXSA 4JFXA 1EFXD 1OQXA 3IU4L 3LRGA 2QSVA 4ONFL 3GSNA 4ZFOL 4WI9A 1UM4L 3C09B 3GBNH 1G6RB 4G6ML 1WAAE 3OMZA 3VMOA 1J88A 2XYCA 2C9AA 4ERSL 1N64H 2LVCA 3CK0H 4ZS6C 5B38G 1N6VA 1B9ZA 1PYWB 3CCHB 2DM3A 4K3EH 4U1SB 1EIBA 1XGUA 1S7WA 4IHOB 3UTOA 4R7DA 3G5YB 3IU4H 3O2WL 3O6LH 4LCCB 4X8XA 5D7LE 3RIAK 3WJJC 4YIQA 2ED9A 2PO6D 1IKNA 1F4WH 1SY6L 3MRCB 1KJ2A 3FOLA 4RQQB 4A2LA 3VRLE 2Z4QA 3QIWB 1RZGB 5DTFB 3TJHD 2CQVA 1GOGA 5DUBA 1ZA3A 2FJFA 4R26L 3VGEA 1WWCA 1NLBH 5F7NC 4NM8L 4ERSH 4PJ9D 1GPOH 4XMLL 3DTXA 5IM7A 1JF5A 2R0KL 4X7SL 3H0TB 2GTZA 3QUXD 5FHAL 3V0WL 3WNMA 4K8RC 3O2WH 4DCQB 1KIRA 4L8DA 1SY6H 5D1XA 6CGTA 3P9MA 3KGRA 2D9QB 5HYJA 1KPVA 1ZXQA 1NBYA 4H26B 3T4AB 3U82B 4R26H 3KHOA 1LWRA 4PRBA 5EH1A 4K07A 5IG7A 1INQA 1OGAE 4F33A 1L6XA 1BMGA 2R0KH 4X7SH 3QFJD 5DYOB 5T3XL 3SE3C 5FHAH 3V0WH 1OB1B 2OZ4H 2P45B 4F7CB 2UUDK 5F1OB 4DKDC 1DBMH 1JGDA 3ZE1E 3S35X 1JUFB 1X5ZA 4URTB 4C4KO 3A6OA 3D0VA 4NO2B 3QDGA 3QB7C 4WU7B 3RA7H 3IDMA 1IGJA 4GFTB 3P3YA 5GRXG 2B5IC 5DJ0B 3IYLW 1NC2D 3D39E 1AGCB 4TNVF 2C3VB 2AK4B 2P8PB 2IBZY 4KC3B 2FYYA 1I1AB 3S8WA 3BP7A 4EXPX 2IQ9H 1HH9A 3IDXL 2CKNA 4HFUH 1B6DA 4PYHA 3SHSA 5GJSL 3TO4C 1TZIA 2DBLH 3VGDA 3O6FB 4PJXF 2Y5TA 2H2SD 1A2YA 3FQRA 3FT4A 4K9EL 3F7RA 2R69L 4KV5E 3NTCL 2Z93A 4S0SD 4Q9QL 4HIJB 1DEEA 43CAB 3EHBD 5D7LA 2CRMA 3T0AA 1QBBA 4WEBL 3SEPA 4PUBL 4MDIA 1T22A 5GJSH 2DL2A 4I0KA 4I2XE 4JHBA 3V6FB 4X99A 2R69H 3NTCH 5FF6A 4LPCA 4LHUD 1YMHA 2P47B 4NQXB 1KXVC 1OSZB 3G5ZB 1YNLL 1J8KA 1KCKA 4WEBH 3RWFB 2ZUUA 3DSFL 4WV1A 1ZT1B 3ARTA 4Q6IB 3TZVD 4HLZG 3CSGA 3VA6A 2JJSC 1AFVH 1G7PB 3ARGB 5DZLA 4JGJA 4D9LL 1IGFL 1OGAA 3QUYD 4L8CB 3VG0L 2FX7H 3F7YB 5GRZA 3ZL4L 1ZS8B 4NQTA 2D0HA 2Z91B 3FRUB 1KELL 3AXLA 4OTXL 2D7PA 2AXGA 3P11L 1RUAH 1YNLH 5F1IB 5GGVH 1IEHA 1UWGL 3TN0A 3CLFL 4TQEH 4ZPVA 2MCPL 4XI5D 1IGTB 4W4OC 1NCWL 3DSFH 1QFUH 2FSEB 5DFVC 4NQCD 4S1RL 4HH9A 2LTQC 3ZL4H 1I8MA 4NC1C 1S3KH 4LQFL 1ZA6A 4OM0L 5DMKB 1N7ML 3V52L 3S5LG 3MLTB 3PNWB 4E41A 2EDTA 3GBLA 4O2CA 5HPMB 4QRTB 4GH7B 2X4RA 3LS4H 4XNUL 1TTFA 2MCPH 2AV1B 1NCWH 1F97A 5IT2L 4NKMB 4KMQA 3BOVA 3GSVB 3MRGB 3QCVH 4GRWE 4HUMB 3ARDC 5CD5C 2OI9B 5E08L 4X5LA 5INDA 1T0PB 2YKLL 3OKLA 1IM3B 3UC0H 1JZ6A 1QLRA 4LLMB 4O2FB 3RVXC 5CSBA 2VDRL 4LQFH 4OM0H 5C0IA 3F7QA 3L5JA 4F8QA 5DMYA 3BYTA 4HJ0D 3HE7A 1U8HB 3OZ9L 3RWHA 3AREA 5CJOL 4RWYH 1YN6A 5CZXC 1XCQB 3ABZA 4XNUH 4I2XA 5IT2H 2Z8SA 4S1QL 3ULUE 5EUOA 3OKEA 5EU3A 3BPLB 5E08H 3VFGH 4P23C 3RNQB 2O61A 4UBDD 2DQFA 4U1GC 2VDRH 2VXSH 4MX7B 4HXAH 3E2HC 1P1ZA 4G8EA 4MNQE 4WFGE 1FYTE 4NRYB 4F58H 4F3FA 1OP9A 2CSPA 3EOBB 3ULUH 4Z0XB 2NX5A 4MCZA 3MACL 4OJFL 4K7PH 4LQ1A 1JYXA 1VKXB 3LPWA 3RPIB 2A6IB 2XNAA 2ZOKB 4M6AA 3VWJC 5TGBA 2I9LB 1BM3L 4HD9A 5IFAH 1EPFA 4JRWA 1E4KC 2YWZA 3WHXB 3M17B 3R0NA 3MACH 1A9BB 4OJFH 1JF1B 3TVMD 5C0GB 3V5DA 4DUWA 3RGVD 3IB4A 1A7BA 1ZAGA 1VFBB 4KQ3L 5H35B 3SDXF 2ATPA 5D7JD 1U91B 1TQBC 2R2CA 5K59E 1S78C 4ZNEA 2H6PA 5ETUA 4TNWK 4M8QA 4HBQA 5JOFA 1MFDL 2VOTA 2ZCKL 5GGSB 4GXUN 1KIQA 4HWUA 4XP1H 2D4DA 4UNVA 1Q94A 4NWTL 1HEZB 1FL3B 1QP1A 1S8DB 3BGFB 3PWUB 1INDH 3H3BC 1CBVH 1JWUB 2X7LB 3WFEL 3GSUB 4AQOA 4MSWA 2E9JA 4X8JB 4NFCA 3GSRB 2NR6C 4RGOL 1MFDH 5MEQA 3O3EB 1S7QA 1VEMA 3BH8A 1TTGA 3TESA 5FKAB 5C9KA 4QRQB 2OMNA 1JRHI 4PGZA 2BMKA 4MNQA 4JFFB 1C7SA 1U8KB 5ECJE 3SCMA 4MQXC 3BZ4B 3ULSA 3WFEH 3ARBB 1FG2B 5AG8A 3H9SE 3OR6B 2EDYA 4KK9D 1WJ3A 4NZRL 1T2QL 4PP1D 4P59H 4XX1G 3CVHB 5TQ0H 2WQ8A 1A7NL 2EYSA 3O8XA 2K3TA 2BNQD 5C08B 5A3IC 3VWKD 4XPGH 2DQGH 1H3UA 3T2NH 4GKZB 2PCPB 2Q8AH 3VFSA 2X41A 1F2QA 2AXHA 2BFVL 5LQBL 4KKCD 2OMBA 1C12A 2FEEL 5B8CA 4LBEB 1WBXB 1Q1JL 3EO1A 1AHWB 4NZRH 1JWMA 1CDHA 4OFKA 1RIUL 4UTAL 5JW5A 3AS0A 5FM5O 2ERJB 3VFVB 5EBWB 1KTLA 1SYSA 1UH3A 4J3XA 2BY3A 2VLKB 3FMGH 4OCXL 4KJPC 1UWXK 5E1AA 5LQBH 3FT3A 4MB3A 2DRUA 1HWHB 3CDGA 3MMEB 5DWUL 3ESVF 4DGYH 1X4YA 3MJ8B 3MBEA 4E42B 4DZBB 5E6IA 3KDMA 4L4TB 2V9QA 2AK1L 3MROA 1HYSC 5JOPD 2R39A 3BEWB 1EGJH 4U6TA 1U8JA 3W9DB 5ID1A 1DDHA 1CFSA 4K7FB 1WT5A 5T5FL 4PP2A 1YYMH 3CZFB 4CU6A 3RTQA 2CRYA 1GGIH 2HG5B 4M1GH 4OCXH 3JV6A 4R2GB 4HGWA 3C5ZB 3L6FA 3O9WD 3JTTA 4S11A 1S7XA 3V0VA 5I66A 2IAMD 1SQ2N 4PJ8A 2AK1H 4DQOH 3ZDXF 1PVHA 3OJDA 1OSPL 4WW2B 5T3ZE 5KSBF 4AG4L 4F7EA 1YMMB 2VZOA 2UYLB 4NSKA 3PGDA 5FO8B 3KPRE 3D2UA 4L8SC 1P7QB 1CGTA 3WMSA 3FT2B 4JANB 3MV9A 2DI8A 1EVUA 4MQSB 5GGTA 2LU3A 4J3WA 3TCLB 4R4BA 3HUJE 1K4DB 4LKCA 1I9RL 4J1UB 1G7MA 1HDMA 3QWOB 5FECB 4AG4H 1NLDL 5IBUG 3G9VA 4EJ1C 5JDSA 5DHYB 3X13A 2APTA 4NQED 1GL4B 1KEML 4F57L 5HYSA 4JG0H 5JMRA 5F96L 3RDTD 3BPOC 1UZ8A 4ZPTB 3CDCA 4HUVB 1MJ8L 1EGJA 1VADB 2FEDC 4WHTA 2XN9D 5IW1B 4H8WC 1Z3GL 5I1DA 2ADIB 3BVNB 1NLDH 4PJIE 5BCAA 4HIIA 3DXAA 5T1KB 1JZ8A 5IQ7L 1GIGL 2CIKA 2UVFA 4FN0A 3T08A 1RJZA 1IC4L 2EE9A 5F96H 5CKAA 2GTWA 2HVKA 1QVOA 4NQDD 1IAOA 1A4JA 4KI5D 4P5TD 4L9LC 1G7HB 3MRDB 4NQVB 3O2DL 4Y4HA 1WWWX 5EC2B 3QO0B 5ELIA 4JPWL 4N0UE 3ARFB 2HFEB 4LLUB 2XTJD 2V6HA 2PYEE 5IQ7H 1YN7A 4PJ5D 2BP3A 4ZXBB 3RRQA 3Q6FA 1R5VB 1UC6A 1IC4H 2IH1A 1NANI 4AT6A 1LO4L 2ENYA 3S3PA 3VXRB 3BGMB 4HKBA 4I48A 4NC1E 3P4MB 2I25N 3O2DH 4WW1A 1GGCH 3AFLA 5IMOB 4TUJB 4D0DA 1QSED 2FIKA 4JPWH 2WIIB 1U6AL 1UB5B 3NIDE 3KJ4C 4YO0A 3TO4A 2EYRB 4GMTL 5DR5L 1D3CA 1FCCA 4ACPA 5H2BA 3GGWB 5CGTA 3WFBL 4JVUA 3Q1SL 2X1PA 3V95A 4XCEA 4WHYH 4DVRL 5LCVL 3TEUA 1KV3A 4KMLB 3MQIA 3PL6D 5B4MC 2NTFA 1PSKL 2NY3B 3MA7A 2ARJA 4KQ4L 3QIBB 2X70A 1U6AH 2OTPA 2FBJL 3IU3A 5DR5H 2QQKL 5C0CE 4IOFD 2EXWC 1KGCD 2HKFL 3CFEB 5AD0A 3WFBH 1LP9F 4B7LA 2FATH 4N9OB 4NOFA 5T5NG 5LCVH 4FTVB 4OCWL 1KNOB 1QKZH 2YD1A 1PEWA 4IMLA 5D1QC 4CN6A 5LVEA 4ODBD 3HFML 4NHUA 2NYYD 4KQ4H 1RIVH 1AIFA 4TVPE 4PJIA 1SBSL 4L29A 1PG7L 3MYJA 3S37X 5HVHB 5EB9A 2P4AB 4PJEF 4DEPC 2FBJH 5IMMB 3UTTD 2VUOA 3TF7C 4ODHL 2VLRD 3EJZD 5CFHA 3ARQA 4JRYE 1A0QL 4NKIL 4K94C 2R8SH 1FO0B 2DDQL 2KKQA 1PLGL 4XVSL 4XZUB 5DRNA 1VFUA 3GBML 5AYUL 3B9KA 2F54B 4TN9A 4GW4B 4TVPH 2F53B 4R3SA 5L6YL 3BWAB 4Y0GA 2L7JA 1HHKB 2GJ6B 1FFNB 3DHMA 4M62L 5C9JA 2OBGA 1W72L 2L7UA 3EFFB 4AEIL 3O4LE 5SX4H 4FQPA 4YXLL 4ODHH 4LHUG 4PYGA 5KW9H 5BOPA 2X1XR 3JV5A 1HZHL 2C1PB 4I3RL 1A0QH 1VDGA 4NGHL 4NKIH 5EWIL 2DDQH 2OK0L 4XVSH 4CMHB 2X10A 3BZEA 1MJJA 2H3NA 1CTNA 2X2YA 2WUBL 5L6YH 3S34L 1RZFL 5GSVB 1VB9A 2V5YA 5C0JB 3MXWL 4H88H 3VFOB 4AEIH 2AERT 1R5WB 4HMDA 1MAMH 3ARDA 4P46D 5D70L 3DVIA 3QULA 1W0YT 5DSCA 4JPVL 3TNMB 3LHPL 3QWRA 1JGVL 1HZHH 4I3RH 1C16B 4F7PB 1C08B 3BIKA 1IC7L 4YFLF 2HFTA 3S34H 1A7RL 3PQYE 2YSSA 1I3UA 4MA1C 5J6GA 3LKOB 3P9WB 4LRNL 5JIIA 4U49A 4XPTH 1JGLH 3UMTA 3ALWA 5EBLB 3IAGC 4Q9BA 4P23A 3KNBA 3EDDA 1UEYA 3JUZA 4IDLA 1FRGL 2GCYA 1H8OA 4LNVA 4OQ1A 2FGWH 3C8HA 5HI3C 2GJZB 1I7ZA 4S0TD 5KVDL 5DJ6B 2EIZA 1A7RH 1X7QB 1QHPA 5J12C 2YK1L 1F4YL 3D18A 3NN8A 2OL3B 2VZSA 4LRNH 2WBJD 3EDJA 2HFFB 4DKFL 4JRYA 1WCBA 2G2RA 3EIFA 3GK8L 1I7UB 3O0RL 5IHZA 1ZLVH 4RX4A 5K9OB 2DJSA 4X0KA 2ICCA 5KVDH 2VKXA 1HH6B 2YK1H 1F4YH 1XIWD 3IDYB 3S97C 3O4LA 5KVEL 3A0OA 1E4KA 3QFDB 1XH3B 2D0FA 3A67L 4DKFH 4BFIB 1HQRB 3UTZA 1S5IL 2E6QA 2Q7YA 3RWDA 4LEOA 2RAMA 1IVLA 1DQMH 1J8HA 1NGPL 4Z7QE 1I7RB 4LHQB 3H6JA 3BPCB 2Y6SD 1NDGB 1R24B 4CVXA 4DKAA 2XWBA 3X14B 1GGYA 4ZOBA 5HGHA 2YR3A 4LU5L 5FO9A 1QACA 3V79C 1ZSDA 4JRXE 5DMJB 4M03A 1KOAA 3G5XB 4GG8B 3VD7A 3IDNA 1S5IH 1BQHA 2O5XL 4Z7WB 4NKQB 1HHHB 1FIEA 2VITB 2CLZB 2VNCA 3NCBB 1LO3H 3QEQA 2NZIA 5IESL 3PQYA 5JXEC 3ARXA 2BOCB 2AV7B 1XCTB 4LU5H 4I13B 2W38A 4JY6B 5DJYA 3PDDA 4C59B 2E9BA 3QQ4A 2COQA 2FR4B 3X3FL 3BRDA 3K4AA 3VD3A 3HS0B 3PWPB 3IETB 4OD3L 2D03H 3SJVB 5EFIA 3E6HB 1J1OL 1ZTXH 5KZCD 1VEPA 4C56E 1X4XA 3BIBX 2HYMA 4PRHB 1S9YB 3VRIB 2BVQA 1D9KD 1MHEB 1A7PH 3PDOB 5IESH 3HAEB 3U4AA 2DQUL 2EDXA 4IRSB 2MNUA 2D7MA 3PGCB 4NYLA 4M1CD 4FNLL 4Y16C 4Z78A 2BVOA 3MNVB 5L2KD 4RIRB 3X3FH 2UY7A 4P4RB 3B9AA 1IT9L 4RGNB 4OD3H 4Z18A 1LEIA 4HS3B 2JELL 2YRPA 4OLUL 1IAII 5EO9A 1T6WA 2DYPB 3LN9A 5CS7A 1VFMA 5I1GL 4U1HA 2G9HA 4HK0B 4UOJA 1OL0A 2ZNXA 1BFSA 2VL5B 2PTTA 1OWWA 4FNLH 3SPVB 4G8GD 2CH8A 5MI0B 5DUML 3TBTB 1K5NA 4APQC 4YHLL 1UQSA 1WGOA 3CSBA 1OAZH 1A9EA 5D7IF 2EEBA 3EYOA 2DB8A 5I1GH 4NCC2 4HUXA 5HDBF 3ZHDA 2JCCB 2FB4L 1CICC 3C8KA 4Z7NE 1U3HC 3U36B 2VLJB 3FB8B 4KDVA 4NO0A 4IIQB 4YHLH 3FZUD 1ODAA 3NH7H 5JORB 5BS0D 3O11A 2BNRA 2Q6WA 2Z31B 4K3JL 4CL7A 1TPXB 3PHQB 2DTMH 3T0VA 1BLNA 4W68A 1G7LB 2QJDA 4AENB 3EDEA 4J3UA 5SWSB 2E8ZA 3OR7B 3SKNA 2ZG2A 3LRSA 5I1HL 2VDQH 2RIKA 2A9ML 1OTTC 3QPQC 2DQTL 1NFDB 4LNRB 3UPCA 4BZ2L 4M8VA 5FOBA 4ZO7A 3VH8B 3BJLA 4K3JH 2D31A 2FX9L 4J3VA 5AYQA 1QD0A 2WBWB 4NDMB 4RRPA 1KBGL 5ENWA 4MCYB 3UYPA 5D1ZB 4JFZL 1J87A 2J88L 3CLEH 1NUGA 5I1HH 1HOCB 2APXA 3U46B 4I18C 2H1PL 3ZO0A 3D85B 3HB3C 2EEDA 1NEUA 2J8UA 4XTRD 3ISWA 4NM4L 5ANMB 5CCKL 1FHGA 4FFVC 4OLXL 5IHUH 5K9JL 1H9VA 2QQQA 3LCYA 1KF9B 1KBGH 4XCCH 3KLHC 1MFBH 1Q72L 3LAFA 5FGBA 2J88H 1I8LC 3CMOL 5BZWB 4Y5XA 3D3VD 4HAFA 4BKLA 2H1PH 3SKUD 1MH5B 1F4XH 2W0LA 3THML 4XNXH 2E7MA 1BVZA 2FD6H 3HHRB 3L3KA 3LB6D 4L8BB 1U95A 3HPJA 4RAUB 4HDIB 4OLXH 5F9OL 3K46A 5EPMA 1PZ5B 5EU6D 5KSUA 5LKNA 2PW1A 3QIUD 3EYVB 2EDJA 2J5LB 3HC3L 3FAWA 5EUOF 3WDHA 5C0FB 3S4SB 5F9WC 3THMH 5DD1H 4ZSOB 4J6RL 3KLAB 4EBQL 5KAQG 3UTSD 2P5ED 5F9OH 4HK3J 3I3DA 1P7KB 2IFFL 3M07A 3RIAF 2X89D 3DPBA 1FL5A 1DR9A 2GKIA 3GSNL 3BP5A 3QYCA 3HC3H 4HZLB 1MY5A 3TFKD 2GT9B 1HCFX 4K94H 1T1XA 3G6JB 3TP4A 1V7ML 1P2CB 4M93B 4XVJL 1KULA 2PXYB 5J13B 2ZCLL 5F1SA 3S36X 3U83A 5JW3L 1KB5B 5E4IA 4TTGA 4XWGH 2CKBA 2IADA 3TA3C 5EC1B 3WKML 3RWJA 1X5JA 3D9AL 1UWEH 2BSRA 4L5FL 3KYOA 1U36A 3T4YA 1T21A 4YIQB 3JWDL 1BOGA 1KJ2B 3FOLB 3U4EB 2Z4QB 1HI6A 3ES6A 1V7MH 4XVJH 5DUBB 2FJFB 4Q2ZA 2BX5A 4AM0A 3WS6C 4OZGE 3DUUA 3LVEA 5JW3H 4FFWC 2OLDA 3DTXB 3HI6H 2GTZB 1FLTX 3MO1A 2ENSA 3W2DL 2F5AL 4L5FH 3RWGA 2VDOH 2E7BA 4ZAKA 5D1QA 5SWZE 3S35L 4L8DB 3JWDH 5D1XB 3P9MB 5IJKA 1GSMA 5HYJB 1KPVB 4OF8A 1NBYB 3UZVB 1K4CA 4XP9H 4UIMA 3BP6A 3FO9A 2BSED 2PO6C 1RY7B 1N6QL 3CDFA 1FZKA 4PRBB 5CIPH 4OZFA 1IQDA 4U2ZA 1INQB 1XZ0B 4W6XB 3TJHC 3MV7E 4F33B 5HYFA 4OIIL 3AS1A 3MJ6A 3FB5A 1MRCL 4JKMA 4PJ9C 3S9DB 5IVOA 1KXQE 3K8KA 4P49A 1F02I 4WHCA 4TUOB 2EE6A 2CK0L 5IK3A 2AJVL 3QDGB 4XP6L 1B2WL 1T3FA 1N6QH 1IGJB 5SX5H 4P2QE 4PJHF 1S9KC 4N90E 5C3LD 1CE6B 1FVCA 3FOMA 3QDAA 5IGXL 1MRCH 4XGZA 1CFTA 3BP7B 2P5WD 4TSAH 1JPFA 4YHPB 1F3RB 4BH7B 3WSQL 2RQ8A 4AK1A 2VIRA 1YYLL 3WEXA 1FSKB 2CK0H 2Y5TB 1B2WH 5L0QC 1JK8A 3EO9L 1PX4A 2QTEA 3KYMB 3FT4B 4I9WE 4QRUB 1JGUL 3DV6A 4IS6A 2Z93B 2OP4L 1F3DH 5HHME 5J9PA 1DEEB 5IGXH 3EOYG 1FQ9C 4Z0BH 5D7LB 1ZLSH 3RPKA 1PX3A 1CXKA 3MV8A 3REWA 1MFEL 3SDCB 1DBBL 3WHE1 4QHUB 4YXKL 2V2WA 4HKZB 4MDIB 1T22B 3RUGE 3OSKA 3MLVL 1YYLH 2CUIA 3TBVA 1ZHNA 4OZGA 1XT5A 2GI7A 4LSRL 3WNOA 4QHKJ 4X99B 5E8EA 2KL6A 4LCIL 4LDOB 1EEZA 4POUB 1VESA 2ZP0T 1L6ZA 4JFOA 2H2SC 4GBXD 3AROA 4GW5A 4I5BA 4DUVA 4ZMAT 1U0QA 5FYJD 1MFEH 2ZUXA 1DBBH 2QADD 1H0DA 4RCAA 5GIRA 4YXKH 4IRZH 2ATKA 3EHBC 1MCKA 5DHVA 3MLVH 4WV1B 5C0ND 3P40A 3MV7A 4NN7C 1OGAB 4HJGB 5BJTA 4UAOC 1TJGL 3WIHA 4LCIH 2Y5EA 1V05A 3HG1D 1H5BC 3GMQA 2AXGB 3FB7A 3C6LD 4J4PC 3QR2A 4I8DA 1ITBB 1S9WB 2DMBA 3TN0B 4ZPVB 4XT1C 2YRLA 25C8L 5E2VL 3L3HB 3O2VL 4PRDA 4P2QA 4WFEE 3RVWD 5C0DB 3S5LA 2YZ1A 4HH9B 4K3DL 2B0SL 3D39B 5DZOA 1I8MB 3G9AB 3GMNA 5ISZE 1XF1A 1ZA6B 4P2OC 3WN5A 3KYKL 1OD9A 3QUYC 5DVNA 2NY6D 4O2CB 1VACA 3DUSA 4L4VD 3HZMA 2X4RB 2AEIT 2YEZB 1E4XI 4Z7UA 25C8H 5AWNL 3F6LA 4FQHA 4P2RE 4EN3B 3OF6D 2LABA 5INDB 2MTPA 3OKLB 3KR3H 5EBMA 5KS9E 5FUCC 5CD3A 4OQTA 4TULL 3HE7B 2E7HA 3HE6D 4PGDA 3AREB 4PLJC 2HT3C 2CLRA 1U8LA 4NNYB 1JZ3A 4I2XB 4X6CE 4JFDA 4N9GA 1UJ3C 5DJ2B 5JXEA 5AWNH 2CRIA 5EUOB 3SDDD 4M5ZL 4M7LH 1FGVH 5C07E 4MJIA 2Q8BL 1BX2A 5FKPB 2DQFB 2QKIB 4LP4A 4L3AA 3ZT6A 1NC4A 2KZ1B 2QQNH 2VN4A 4Y4FD 4TULH 1ERNA 1FFQA 1PJ9A 3U0PA 5IWLC 1A22B 1BJ8A 3QNYA 4X9FA 5IB1A 4U1LA 3VFTA 4XX1E 4M7LT 3HI5H 5ALCH 2V9TA 2WINA 1KPRA 1X44A 1FC2D 2Q8BH 3VFWA 2ADGB 3RL2A 3SGKA 5DC9B 3PF2A 2XNAB 4M6OL 4TNWF 3O3BB 5TGBB 5BVPH 3PWLA 4QGTA 2FRGP 4X6DE 2DS4A 3MRFB 1VEOA 2G60L 3IJYA 4MD5B 1IAKA 3GEWB 4M43L 2NY4B 2VE6B 4MJ6B 3LEVH 3TH3T 4HKJA 1NGYA 4J12A 1VFAB 2R2EA 4D9RD 4APQA 2GK0A 5J8OA 1WUNT 2ATPB 2R1XB 4U6HA 2IH3A 3CFDB 1AH1A 4TSCH 1YJDL 3C2AH 5HDQH 3HA0A 4WRLA 2OS7A 1MFAH 2H6PB 5DURB 3NPZB 5ETUB 2PYFA 1ZLWK 3RFZC 3VI4E 2EE2A 2G60H 4GRWB 2BSTB 4N5ED 3E8UL 5JOFB 1U3HA 1KIQB 3I75B 4RAVB 2JB6A 2AXFA 4ORZC 3OB0H 3O6KL 1BGXL 3PXJA 1Q94B 2JJTC 3GRWH 3TVMC 1MCSA 1YJDH 3ILPA 3QISA 3S6CA 1QFWI 4MB5A 1H3WM 5D7JC 6FABH 5GRWA 4MSWB 4PY8I 5C07A 4MA8L 3QI9B 4Q9RH 2E9WA 2IANE 3LMJH 2JF1A 3WUZA 4F15C 1QSFE 4DVBA 1T1YA 1BGXH 5DD0L 1IGCL 2BMKB 1BJMA 4PIRF 1QFHA 4MNQB 1KC5L 1FYTB 2XG5A 3UDWC 2WMPA 2CIIB 1U8MA 2JJVA 3SCMB 3W9EA 3ULSB 4KUCF 3R1GL 2FZ3A 5E00A 2X4NA 1PGRB 4ZTPL 5F71A 4YQXL 3IDIA 3VXSD 35C8H 1T20A 4NQUA 1OAXH 3FQTB 2G5RA 4I18A 4V1DE 4I1NB 4S10A 2UWEE 4JDVB 2V7HA 5DD0H 3IFOA 1IGCH 4NFBA 4IRJD 4J8RB 2F19L 1T7ZA 4G7YH 1T89C 3LEYL 5DUPL 1X4ZA 2X1WL 4MXVE 1C12B 3R1GH 1WFUA 3QQ9D 3QPXL 4PGEA 1QRNE 4JM2B 3RBSA 1RZ8A 4KK8D 1I8LA 5TDPA 3W81A 3MNWA 1FNSH 5BZDA 1NL0L 1FGNL 2OR7A 1JZ5A 5JW5B 1RU9H 1WTGT 4KRPD 4QNPF 1AO7D 2CDGB 2K7QA 4PP1C 4PJ7A 1KTLB 1F6FB 2F19H 4IMKC 1HKFA 3VD5A 3QIWD 3LEYH 5E1AB 5DUPH 3FQWA 5HHOA 1AQKL 4Y2DB 4GG6E 3VWKC 4YX2H 3CDGB 3QPXH 2J8OA 3MBEB 1LE5A 2D7TH 4U6YB 3KDMB 3MROB 1NL0H 1U8JB 1T5WA 1KCRH 5ID1B 3IKCA 1ZHKA 3BISA 1DDHB 1EO5A 2KQNA 5E6ZA 4XP4L 3DWTA 5JPNB 4Z76A 5CUSH 3JV6B 4HGWB 3KXFE 1S9VA 3L95A 3L6FB 2P49B 3DRTA 2X4UA 1A7QL 3V0VB 5I66B 3IGAA 3B6SA 2IANA 1I3VA 4YWGH 4MAYD 4UNUA 3OJDB 2NCMA 1RVFL 4GLRH 5DRXA 5IVXE 4ZUUA 4M7KL 4F7EB 4OFDA 1K85A 1QNZL 5T3XD 3QFJE 4HJJH 2YD4A 3PGDB 4XP4H 2XKUA 4QXWA 5GGTL 3H9SB 1HWGB 3QRGL 3KAAA 5HYEA 4HAGA 3OX8B 4YPGB 5ALBL 3KPLA 4U1IA 4R4BB 5A1AA 4RMWA 3O9WC 3LPFA 5LBSH 1G7MB 3EYSH 1HDMB 2AK4D 1RVFH 2NY1C 1I1AD 4LPWA 3CH8A 2A6JA 3QNXA 1LVEA 5I73C 1QTYT 5HJ3A 3X13B 2P24B 3WS6A 5HYSB 1OT1A 4X4ZA 1QRNA 2VISA 2FO1A 1UZ8B 5EOTA 1P4BH 1XFPA 1G0YR 3O3DA 4WHTB 5C0AD 4ZNCD 3HPLA 3ZE2F 1ETZB 3I02A 3GIVA 3GSQA 5I1DB 15C8L 3ULVF 4PRPE 5BRZA 3DXAB 5C71A 5TH2A 4OGXL 2CIKB 5H37G 1WSST 1N0XH 1RAMA 1C5CL 2LQRA 3DX9A 1MHPL 4KHTL 3ROOA 2HVKB 1QVOB 1XEDA 1IAOB 3KPOA 4Z7OE 3T1WA 1RUKL 2FH6A 5HHPA 2P7TB 3LN4A 5A43C 2XOTA 3DNKA 3RDTC 3RNKB 15C8H 2CMRH 3C6SA 4OGXH 5I1KL 1XGYH 3KXFA 1C5CH 4U4BA 3VFRB 4K23H 2IH1B 1MHPH 2B5IB 3D69A 4KHTH 4AT6B 3MRIA 3ARGD 1U58A 4PJBE 3INUH 4YHNA 1GAFL 4HKBB 4I48B 5EU7C 3OAZH 1RUKH 4WW1B 5IB2A 5C6TL 2FIKB 1TLKA 2CDFA 4KI5C 3QFJA 4P5TC 4D9QD 4KK6C 3TO4B 3KPRB 3PWVB 2HKHL 5H2BB 4MVBD 1Z0MA 3FO0L 5L88H 2XTJC 4BZ1L 5CGMA 4Y4KA 3U0WH 4XCEB 1KB9J 2A6KA 1JHKL 4LLDA 2V5MA 5FUCE 3HUJB 3WXVL 3WDIA 4NQCE 3MA7B 2ARJB 4Z7VA 4TPRL 1FVEA 2X70B 5C6WH 5LG1A 5KANI 4BH8A 3BE1H 2DM2A 5FGRA 1VSCA 5D6CB 5TDNA 1V7NH 1IRAY 1MWAH 4FQXC 2A73A 5AD0B 1CT8A 1SVZA 1JI2A 1BIHA 2R2HA 4BZ1H 5FV1L 4OFYD 1JHKH 4IMLB 5C86A 3V2AR 4HS6A 4JZOB 2VR5A 1TXKA 5DMIL 1A14H 1AIFB 4OLYL 2KDGA 4PJIB 2VJXA 4PRPA 3U6RA 4L29B 3D0LA 2ZUVA 3MYJB 4FP8H 1U2HA 4HC1H 1AXTH 1FYHB 5CBEB 4JJ5B 3PV6A 5FEBA 4UU9A 2IWGA 1YNTA 4WUUE 2NZ9D 1H3TA 3T65B 4I0CC 2R1WB 3N85H 3MRNB 5D6DC 3UYRL 2BRRL 1MCWW 3SDAD 1H5BA 1T4KA 5T1LA 4J4PA 4N0UB 3QUZC 4R3SB 4LCUA 2VC2H 3C87A 5KSVA 2VH5L 1EEYB 5C9JB 2NYYC 1P9MC 5DK0B 2LTQB 1B0WA 4P48A 3MCLH 4PJBA 2DQCL 3HZVA 5DC4B 4P2OA 5K9KA 4IDJL 1JYWA 2V5SA 1RZ7L 3BZEB 1IGML 2H3NB 3EJZC 5E99L 3V5HA 2OCFD 4U1MA 4AH2A 2VH5H 2J8UF 1ZHLA 1UWXH 2EZ0D 3SGEH 1JMXA 3AC0A 3ARDB 4GMSH 3QULB 1X5XA 4KGLA 1UCBL 4P5KB 5DSCB 4GKSB 5F1NA 4PJFE 4IDJH 2JIXA 3BQUC 3QEHA 4FQIL 4MJ2A 1RZ7H 1TMCB 2YD5A 3WUWB 2X4TA 4JDZA 2JLLA 4ELMA 3QDME 4OFIA 1CQKA 5F97E 3PABA 4ZDHA 5AAMA 4NO3B 4XCFL 3TYFA 2C4FT 2RJMA 5IBLC 3BO8A 2HT2C 1MCBA 2EXYC 4P23B 4WY7L 1P4LA 4U1GB 1BVLB 1CD9B 2O5YL 4JO2H 4P4KD 3UTPE 1TITA 4HUWB 3EYQD 3I50L 3WFCH 3N1PC 1XF5B 2IGFH 5DJDB 1OTUD 4FQIH 2EICA 3E2HB 4JFYA 5BVJA 4KJWD 5KN5A 5E2WL 5IWLA 2EIZB 5T33H 4PJGF 1QBLL 3WS3A 5JNYA 2CXKA 3D18B 3NN8B 2VN7A 4HCRL 4X6EA 4WUUA 4XCFH 2YMXH 4Y5VC 3TIEB 4BSVB 1NMBH 4JRYB 5F88A 2G2RB 4M4PA 3MGTB 4U1KA 4BELD 4MNGE 4PTUA 4QEGA 4KDTC 3HRPA 2WBKA 3HRZA 3VWJB 1D5XB 3F7VA 5C7XL 1MCNA 1QBLH 5KG9A 4HCRH 3QXDB 3O4LB 1D5IL 3AU1A 4R6UA 5ICYA 5J56B 1Q0YL 1WC7A 4OGYH 4JKWA 3BD5A 3ARBD 3UTZB 4QRRD 1RZJC 1IEBA 3RWDB 5F7YC 2WBJC 4LEOB 2YD6A 1JF6A 3EDFA 1NPUA 4WU5A 1GZPB 4CVXB 5C08D 2XWBB 1TQBB 5HGHB 3ZE2E 4C4KT 5FO9B 4HGKC 5IQ9A 1QRKA 1ZSDB 1MHHB 2D7QA 1MCPH 3ULVL 1WWBX 4DAGL 5IW6A 3F62A 3HR6A 1KB9K 3IDNB 2WNGA 2FDBP 4HZAA 1BQHB 1XIWC 5C92A 1CIDA 5MHSE 5B39G 1NBVL 2E6JA 2ZSVB 2JJTA 1MIEH 2R0LL 5TDOA 1OARL 3DMMC 3PQYB 3QDMA 3NFPA 1TVHA 4WO4D 2MKWA 2VLKD