3U9PH

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
184
Chain Sequence
EVKLQESLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGQGLEWMGGIWGDGRTDYNSALKSRLSISRDTSKSQVFLKMNSTDDTAIYFCTRCRRDSSYVVDAWGQGASVTVSSAKTTPKLVYPLAPVTLGCLVKGYFPEPVTVTWNSHTFPAVLQSGLYTLTSSVTVTCNVAHPASSTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 184
sequence length 213
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH01
4ZUUB 4F9LC 3N85L 1FAIH 5IG7A 5HVHC 3IU3A 3V79C 2AXGB 1NC4A 3ORJA 1VENA 2WWKO 4OF8A 4POUB 1X4YA 2VQUA 4P23D 1AGCA 4TVPH 3O4OB 4BK4A 1XIWC 4XXDA 4B41A 1B3JA 1JGLL 5I1EL 3V0WH 4N68A 4OQTL 5GS1B 4P5TC 3CFJA 5ACLA 1IEAA 2D3VA 3VRJA 4JFXB 1CK0L 4PY7A 5CD5C 4CN6A 5I16B 5T3ZE 4KUCD 4WU5A 1CGXA 3BEWA 4DKFH 3MV9E 4KK5C 4HUMB 1A6UH 4JZOB 3NCCB 2GT9A 3MOBH 5DWUL 1Q9OA 1UJTA 5EU3A 4X4XB 1OTTC 1FH5H 1JGVL 4X6CB 1LILA 4LFHG 5HYJA 5F8QC 5MEOB 5IMOB 4ELMF 4U6YA 4WW2C 3OGOE 1I9IH 3G08A 1R3LB 1JRHI 3T65A 5EULV 3WE6A 2EXYC 1RZJC 5IQ7H 4OIAA 4M8QB 4G43A 4Z7NE 4LCUA 4LSVH 4RRPA 4M1CC 1P4LB 1U3HB 4HUXB 4NFBA 3N50A 2FIKA 3HZKA 4N9GB 1MLCB 2WBJD 4X98B 4LHJB 1VFUA 4EUPB 4HKBA 1N6UA 1RUKL 2XTJE 2MCG1 5H35A 2Q7YB 3FHAA 4XVUD 4XI5D 5E2WL 5DS8B 1I1FA 1ZWIB 1DVFB 1S5HA 5FUCE 3K2UL 4JFZL 3REWA 3WCYA 3BESR 3WFEH 3PHSA 1MCEA 4R96A 3DBXB 4PGBB 5KSUB 2EYTA 1IGIL 5L0QB 1CXKA 1FZKB 4ZAKC 2JJTC 5FGBC 2AJZB 1YYML 2FZ3A 2XN9D 3BOVA 3CCHA 3QDMA 8CGTA 1QRND 3O3DB 1FJ1B 4ZDHB 3T3MF 4AG4H 2ZOKB 2YS4A 3BGFB 3QULA 1NAKL 2C4XA 4Y4KD 2YMXH 4OV6F 4X5LA 3BQUB 5K9KA 1WIOA 2K7QA 3I9GH 4E41A 3QUZD 5LVEA 4XNXH 4X99A 2BNUB 3UXFA 2F74A 5L7XH 4EN3D 3RAJH 5JA9A 5DVKA 3MBED 1N64H 5DK2A 5I1KL 4L4TD 5D7KE 1XH3B 3T4AB 1LEGB 3NGBB 2I26N 5DMGC 3E8UH 3MJ9H 4TNVF 5IMMA 4OM0H 4NQVA 3RWCB 1X5JA 3IDYC 4HT1H 1QFWI 5I19H 1MIMH 4L5FL 3OV6A 2MKWA 1XEDA 4D8PA 4QHUA 5F89B 4JM2B 4Y4HA 4LSVL 2EDLA 3RBSA 5ADOL 3PE9A 1NBVH 4DJMA 5E2TH 3LV3B 3HE6D 4MB4A 5HI4C 5DJDA 1KF9B 3P4NB 6FABH 3KJ4B 1V3MA 5FGCB 4OQ1A 4B50A 4LSUH 4N8PA 3T1WA 2FBJL 4Y19A 4JN2B 4U1KA 5C0AA 2B4CH 5E70A 4M7JH 3I50L 2WLZA 5FXCH 3F7QA 2CIKA 5AD0A 2AXHA 3VXUD 4M7ZB 3CDGB 1U92B 4P2QB 5DK0B 5IB5A 1PQZB 4AG4L 1ZA3B 3P11H 3P77B 3KDMA 3M1BA 4YQXH 1PLGL 5JHDB 3BRGC 4RWHA 2YMXL 5DJ6B 2X1WL 3OKDB 3RWGA 4Y5YC 1NC2B 4LIQH 1RUQL 5T1DL 4CW1A 4LVNC 3BISA 4AENB 4P5MA 3TJEH 4Y16B 5L7XL 3RAJL 2ZNWA 2JLLA 5JHLH 2XKUA 5E2JA 4I3SL 4KDWA 1J1XH 1INQB 3ULVD 4L3CA 2XZQL 4PRHB 1GGBH 1MAKA 4GG6A 5IB3A 1N3NA 3C6SB 3SE4A 1SM3L 3BH8B 4OM0L 3FB8A 4Q2ZA 4ZSOA 3VXMB 5DVMA 2P7TA 4PRPD 1ZLVH 3KPQB 3QRFM 1MIML 1T04A 3OKOB 2NX5D 5EA0L 5J4MA 5E8OA 5JXEC 4LRNH 1K8DA 4U6XA 1NCTA 4LCCB 2ICEA 4I0PA 1JTTA 2GTWB 2DQIH 4XAWL 1D5XB 3RVTD 1ZHNA 3JV6A 4KPHH 3RVWC 5EUOA 1G0DA 1IAKB 2A9NH 1KEML 5HHQA 1MHCB 4S1RH 4YHZH 4XMPH 4FFWD 4ZFOA 5F21B 2HJFA 4KXZI 5C0ND 2E6QA 5JNYA 3RUGA 3CVIL 3IRPX 4OLYH 3STBA 4WDIB 5IGXH 5ACZB 4MD4B 1T0MB 12E8L 2JELL 2XA8L 4POZC 5CD3B 2NTFA 3F7PC 5T5NG 4NQXA 4Z7NF 1RZ8B 3AUVA 4MA7H 2VDML 1QA9A 1A6WH 1F90H 4NO0D 4GSDH 2IPKA 4JO4H 3VFRB 2BY3A 2ADJB 1UZ8B 4IJ3B 4G80B 4NFDA 3G6DL 3MO1B 2X09A 2FDBP 1M6OB 4K2UL 5GRWA 1OM3L 3BHBA 5DRXB 3TZVB 5B8CC 1CD1B 3RGVC 3ARBD 2A74B 2IFFH 1FO0A 3KPRA 1BM3L 5E6YA 3LRGA 1IGCL 1EERB 1FNEB 2VN4A 1E4KA 3VH8G 1TNNA 1MCPL 1W8NA 5D1XC 4HGWA 2NY2D 1IAMA 5EU7E 5I15L 1LE9B 3P40A 3QFJD 3AREA 1QOKA 1FG9C 3U7YL 2KQMA 5CFHA 5CJXA 1CICD 1VEPA 1A6TB 1WAAE 3BFOA 3S36L 5M94B 3D39A 4ODHH 2DQJL 1JGUH 1DBMH 5KAQG 4I3GA 3MGOA 4EI5A 5IV2A 1CDYA 4C59B 3BIAX 2VXSH 4LRNL 5IVZA 1DQQB 2E9JA 4P49A 2NY6B 4ZUSB 3ZDZE 1S9WA 3BAEL 2DQIL 1G9MC 3IS0X 4KPHL 4QRPE 2DJ4A 2FR4B 5HGHA 2XKNA 2NYYC 3H2WA 3QT2A 5ICYA 4NN5C 1NL0H 4LPTA 3O4LA 4PJIB 3LN5B 3VGFA 4GW5A 5DHVH 5SWSD 1CXFA 5HHOA 4P3DA 1JIBA 5KSVA 1B90A 5LJYH 4ZXBD 4DK6A 3MRBA 4WWID 1AGEA 2AJ3B 1IGTA 4OQTA 4X7DC 3WUWG 5ISZE 1U8HA 1UEMA 4MA7L 2WLYA 1MJ8H 3GSRB 4OB5L 3UZEA 1N7MH 1A6WL 1F90L 1C08A 2DKUA 3SJVB 3FOMB 4XP9H 1LEIB 4JFEA 2A0LC 2CRZA 4HUWA 1IMHC 1OTSC 1TZHA 2P5ED 4R4ND 2HFEA 3HNSH 3HE7D 2IALA 3ALWA 4K9EH 3QQ3A 4GRLA 4I48B 3OGCA 4XCNB 1Q9LB 1FE8L 1QSFD 2CO7B 4NBZB 1YNTB 4ZYKA 3PWVA 1F6AB 2IBBA 3GSXB 3BJ91 4LOUD 4LQ1A 3MRNB 1TVDA 5T1KD 1YY9D 3KVQA 3MRFA 4NQDA 4ODHL 3QSKB 3DMMB 1JGUL 1EHNA 5FO8B 4HIEA 4N8VB 4TUKH 2XPGA 3C2SA 5FECA 3U1SL 1GCFA 4OD3L 4PRAA 1SJEA 1YZZA 4N1EA 1SVZA 5I1IL 4GMTL 1KT2A 4NUJB 3IJYB 4OD2B 4RNRA 5D9SA 4EKXA 3O2DH 1T0PB 4P3WA 4GLRH 5T5NF 4N0YH 1AY1L 5CGYD 5A2LH 1NGWB 4ZTOH 1CCZA 5KS9F 4NRZB 5C6WH 2QADB 4QYOA 3WFBL 5L8LB 1N7ML 4KZEL 1OF2B 1XF4B 3GHEL 2Z4QA 4PJ8A 3IXAB 2B2XL 2WW8A 3LKRB 3TWCL 2BHYA 3QP3A 3RPKA 1L6ZA 2BNRE 1LD9B 4K9EL 1U8IB 1I3UA 4UV4L 4YDVA 4KC3B 3V6BR 1X7QA 4GS7B 3T0DA 2R2EA 3BE1H 3N0PB 5F6HJ 1IEHA 4LKCB 3TO4D 3W81A 2RCSL 5L2KB 1KV3A 2H41A 4ERSH 3QR2A 1PFCA 1U2CA 4AYFA 3SGDI 4ELMB 5LKNA 3BPOB 3U0TA 3V7MA 3O6KH 2GHWB 4P2RE 3HNVH 1CR9H 3MV7A 5D7LD 3WHE1 5I71C 1KCVH 3NIGE 3CX5K 5HYFA 2J1KA 4U3CA 3FCTB 1U6AL 5DVLA 5F9WC 4FQJH 4LLMA 1KBGL 4L8CB 4I1NB 3EDFA 4K7PH 2A6KA 2CLRB 2F58H 1I7RA 4Y4FD 3WDIA 1I75A 3U6RA 4ODTL 4G7YH 1QPPA 4HLJA 3O2DL 1PGRB 1KJMA 1JFQL 3QNXB 1IGMH 3O2VL 1WAAF 4LCWE 4ZTOL 1G9ML 3O9WD 2Q7NA 5GRUH 4ORGB 4IIQA 2JE8A 4F9LA 2Y7QB 2R69L 3MRKB 2NNAB 2QJDA 1AGBB 3ET9F 4FG6C 2Y6SD 5T1LA 3FB5B 2ZSVB 1NSNL 1XCTB 3UMTA 3ZDZF 3N1PC 4JEGB 1XIWA 4E41D 1FCCA 4Y2DB 4BSJA 4OIIH 3MR9A 1EBAA 4OFDA 1JWUB 4QKXB 5E6IB 1B2WH 3RIFF 3A6BL 5MERB 1NFDA 1JUFA 5J6GA 1MVUB 2W9EL 5HHXH 5TDNB 1CDBA 2YEZA 4FHBD 3U30B 1W2KT 4H0GA 4QRQB 2WIIB 1CT8B 4A2LA 5BVJA 2ARJQ 3R0NA 3RWJA 4HKJB 1NFKA 4H25B 3X17A 3ARZA 3DUUB 3T0EB 4WUUA 3UTQA 1KCVL 4X4ZA 1ZANH 3MRDA 3HB3D 4J4PD 4WW2A 3UC0H 3EYSH 3MNWB 3JTSB 4NQEB 4NM4H 4E9LA 4YHNA 3LS4H 1W72L 4K7PL 4PLJC 2Y5EA 2Y07L 2X4SA 2ZCKH 4EQ2A 4YGVB 2RHEA 2KQNA 1FLRH 1FFNA 3CSYA 3KXFD 2F58L 4P2OC 3RX7A 3IJSB 2H32A 5CGMA 1FNSL 4G7YL 1FL5A 3GMRA 4XPTH 1VSCA 2XN9E 4Y7MA 3MRJA 1F4WH 4NKIH 4OGZA 4Q0XL 2BMKB 1IGML 4K94H 3X14B 3RA7H 4XC3H 4JFQB 5I75C 3S5LA 4JRYD 3QDGD 1LDPH 5HYQA 1LNUA 1YEHH 2HA1A 4HV8A 4ZAKA 2JJTA 3DNKA 3IKCA 3LH2H 5FGBA 1MY5A 1S7VA 1IM9D 2EYSA 3MUHL 1XGTA 5FA4A 4F7CA 4WI5A 1J8HD 3F12B 4OIIL 5F9AC 2CUIA 1D5MA 5IBTL 1T21A 1RZGA 1B2WL 4ONOA 4JAMA 1IZJA 3KWWB 5DMYA 4JKWA 5IOPA 2ZSWB 3TBYB 1OY3B 3IDNA 2R2BA 5K9OA 5ILTL 1HILA 2Z91B 3WLWD 5C1MB 4QEGA 1K2DA 4LVOB 4NNPH 4J2XA 1BIIA 1ZHBB 4UB0H 4Y8DC 5DJ0A 1VFMA 2NY0D 2Z8SA 2VYRE 1DLHA 3A67L 3QUXC 3GJFK 3U46B 2R2HA 4IDJH 5ADPH 2FJGB 4CVXA 5JQ6H 4QRTA 5CIPH 4KRMB 4HXAH 4NM4L 5DHYB 5IVXF 3MV9B 4OJFH 3NBNA 1L7IL 2W59A 4LEXL 1JZ5A 3FONB 2VERN 4F7PA 1FLRL 4ISVA 3HI1A 4XMLH 2CRYA 2J3SA 1UM4H 3HRZB 3QCVH 5CP3H 3U7AA 3VXUE 4K94L 3KLHC 3RA7L 4XC3L 3NIGF 3CSPA 4Z5RB 1WEJH 1TVBB 5ECJE 4YO0B 4WU7B 3ZT6A 1BQHB 2AEQH 3H9SD 4C58B 2X4PB 1QSEA 1WBYA 1E6OH 3O3EA 4FXKB 2XTJB 3F58L 3QHFH 1YNLH 2BVPB 3THML 1NCDL 2BVQB 5FO9A 3JZ7A 5DJAB 3AFLA 5A2IH 3ULVE 4KRLB 4OZ4A 3RPIA 3GMPB 4NRYA 3GSUA 4P46D 3DV6A 1T3FA 3ECBB 2J8OA 3U4EA 4PRPE 1HI6A 3IAQA 2QHRH 3LKNB 1KIPB 4AQOA 2R56L 1QLFA 4OI8A 3WL9B 5T3XL 4KUCF 4JFOB 1K8IA 5IMLA 1FZOA 2HVJA 4YHOH 5J9PB 1E6JH 5JMOC 4JVWA 4YZFE 1OP3K 4Q9QL 5GJTL 3IFOB 2B1HL 4YIQB 4HXAL 3VFUB 1RIHL 4OJFL 4U1SA 4BSVA 3GSNH 5FYLH 3MOQA 4UAOC 3O41A 5LCVL 3GMLA 3FQNA 3P0YL 4L8DA 3ARDC 4XPGL 5JXEA 2AK1H 5D8JH 5D96C 2F8XC 2ICCA 1BJ1H 1UM4L 3MYJA 3RTQB 3QCVL 5E8DL 4FMKA 3ZKSD 3OR7B 2QLVB 3ZSTA 1KPVB 3V5DA 4BELD 4JHBA 4KKBC 5DQJA 3AVEA 5I1JL 3MUGB 4OZFH 1U8KB 4JO1H 4C54A 5TF0A 4ONFH 1PYWA 1AFVH 3SY0A 2ADIB 3U2SB 3V6FA 5GGQL 1H3WM 1NAMB 3QHFL 5GS1C 2XZCH 2HFFA 5J12B 1UM5L 4D0CA 2UWEE 2BDNH 1BZ7B 5B8CA 5A2FA 1JWSB 4ORZC 3E3QE 1S8DA 1U42A 5EC1B 1MCWW 4BZ2H 3KYKH 2GAZB 4NOBA 4DAGL 1NANH 5JW5A 4BK5A 5D1XA 2LAGB 2AEIT 3K8KA 3SGKC 4BUHA 3O45A 4CN1A 1YMME 5GZNC 2BNQD 1J1OH 1LO3L 4YHOL 3DVNA 3VXPA 1E6JL 3T8XA 4R9HA 2XT1B 2ZKHL 3H0TB 2BJMH 1U3HC 2VZ1A 5FYLL 4TUOA 4OZIA 4QGYA 2PW2B 3FO1B 4RAVB 2UZIH 5SWSE 5JPNB 1A1MA 5IIEA 4M7KH 5D8JL 4EDWH 4U3XA 1U58A 4ODXB 4YHIB 1XR8A 3O2WL 3FZUC 5GRXG 2R4RH 1NKOA 2ORBH 3F5WB 1OHQA 4NO3A 4J1UA 3LCYA 1A9BB 5L0QC 3MCLL 1ZAGA 1ZSDA 1DN0B 4GKNA 4JO1L 2GUOA 1WCBA 4LLYB 4O2EB 4X0KA 3MRRA 4HQQH 1DDHA 4CMHB 3DX7A 3BGFC 1QSFE 1CLCA 4OLVH 1C12A 3PP3H 5TE7L 3GMQA 1YECL 2G2RA 3BQUC 2QQLL 4PUBL 1TTUA 4N9OB 4X7CC 4GKSB 4QHKI 5BCAA 3C08H 5IT2H 4YE4H 4NJAH 4L3EA 1YY8A 2AV1B 4FZ8H 4M1GL 4WUKH 1TIUA 3HMXH 1J88A 4URTB 5DEZA 2X70A 5GS2D 3EDKA 1BD2B 3DXAD 4KGJA 3AS1A 1J1OL 3ZSSA 5IHLB 4IMLA 4ZS7H 2I60L 1QFUL 1EV2E 3CC5B 1W72A 1A6VL 3VMNA 1J5OL 4NWUH 1ZT7A 4U49A 2ICWB 4JM2C 2YBRB 3VWJB 3FFCD 3ULVF 4S1QH 1C1EH 4OI9A 4OUUB 2Q3AA 1GIGH 4LCIL 1RY7B 5CZKA 2C3VB 5E1AB 4M3KB 5I18H 2UZIL 4LGPB 1WICA 2EZ0C 4RFNC 5IB2A 4KJQD 3V5HB 1NBYA 4FTVA 3KJ4C 3MX0A 3WUWB 3U36B 1KCUL 4M43H 4E42A 1MCOH 1ONQA 3U0PB 3RL2A 4HG4K 1VGKA 2YC1B 3AB0B 4Z0XB 2VAJA 4APQB 4YZFF 4UU9B 5DEGB 4MJ4A 1XIWD 3KYOA 1X5IA 3M17B 1H0DB 4BH8A 1NLBH 2ICWI 3MC0A 4ZNEA 4P5TD 2AKRB 1P69B 2ESVA 4QRPB 4QHNB 5HYJE 2J5LB 5IFHL 1ZXQA 4PRBA 3LS5L 1OPGL 2OTWB 4N90E 1JRHL 4HMDA 4TPRH 3PV6B 4LVHC 3D48R 5D7LE 2D31B 1OTTD 4MDIB 4YE4L 3MCKB 4J3VA 4NJAL 1Z9SA 2E8ZA 2HFGL 4JFFD 4FZ8L 5DI8B 5I1HL 1JPFA 5ISZB 4WUKL 3KPNA 1BX2A 4PJGE 1A7OH 1KENH 5IW1B 2WP3T 5FYJH 5KVDL 2R1WB 4XCEB 2OSLA 3SDYL 3QJHA 1YEGL 4F3FB 2UWEF 3TN0B 5D93B 1GOFA 1K5NA 2KPNA 3LB6C 4NQCD 4S1QL 3RNKB 3DGGB 4W70A 4ENED 5H94B 1GIGL 3W9EB 4M6MH 4P4KB 4HKZB 4LCCC 15C8L 1ADQA 2VO5A 5CMAB 4FQIH 5DC9B 1LVEA 1ZGLB 1GGYA 2V2TA 1HHJA 2GK0A 1PKOA 5C08D 5C0EA 1P2CB 4MQTB 4M43L 3U7WL 1MCOL 2YPKB 4NRXA 1X5XA 4U05A 5E03A 4AMKH 5E5MB 4AM0B 1P53A 2D0FA 4J8RB 4LPXA 1CFTB 2GSIA 3O0RH 3ZKNC 3C2AH 3QI9B 4E41E 2OI9B 1JHKL 4LARL 1ROWA 5D71L 5SWZA 3MPCA 2HVKA 5DEFA 1F8TH 4JPIA 4NFCA 1IQWH 1HHHA 3GUTA 2Y1VA 4WHCA 4U1MB 5DDHB 2VXVH 3G04B 1JNLL 3VRIA 4H0IA 1XGPB 1A3LH 1WK0A 5C7XH 2YSSA 3C60B 3DURB 2PN5A 3L1OH 4PJEE 4WFEE 2FYYA 4GW1B 4X5XB 1PDKA 1T66C 3IDJA 3TYFA 1LEKB 3VXOB 1BZ9A 2WP3O 3T2PA 2VDQH 2VLKA 5FK9A 2JK5B 4NC1C 2AK4D 5I2IB 4K3JH 4NHUA 2Y25A 1YEFL 5D1ZD 4OKDA 5EN2A 5DMGD 4WO4A 3V6ZA 3TYGH 2J8UE 2BNRB 3KXFE 2IQ9H 4RZCA 1ZVYA 1BECA 3ES6B 3LN4A 1MY7A 4Z0BH 1NBQA 4YWGL 3WIIH 1T5XB 3T1FB 4JCMA 3BP7B 4ODSL 5KSAD 4G8IB 1AP2A 4M6ML 4PRIA 5A1AA 1HH6B 5DVNA 5HI4D 2EC8A 5GISH 4D0BA 1Z6JT 4JRYE 3QDGE 5FV1L 2Q1EA 4P2OA 5I8KH 2HKHL 1U2HA 4P2RB 5GGVH 4OM1H 4YHYB 1S5IH 3QQ9D 5IEKB 2V5MA 3CX5J 3O0RL 3C2AL 4MVBC 1UADC 1EO8H 3ARRA 3B9KC 3IDMB 4Y5XC 2IWGA 5DSCA 5IUSA 2XG5A 4UNUA 2NLJA 1AKJA 5JORA 4QRUB 1S9YA 2Y72A 1CU4L 2F19L 4KK9C 1A3LL 4V1DA 3IFLH 4K3GA 2AV7B 3CXDH 3MJ7B 2VDRH 4N0CC 2IMMA 4P23B 3LQAH 4WTXA 4ZSOE 3SGEI 4LCWB 4X4ME 3DGCR 4M8VA 5FGSA 2NXYC 1Q94B 3SCMC 1GGCH 2XWJB 3RDTD 3VXQA 3AMLA 5C2BL 1FFOA 3FKUS 2VIRB 5DRZB 4U6HB 4HC1L 5F1IA 5CJ8A 3HNTH 3OMZA 5IJKA 2X4TA 4HIIA 5KTEL 3TA3C 2Y36H 1YMHA 3VD7A 2ITDB 5J13B 4Z0BL 4BUGA 3QUXA 2WV3A 4Z7WE 4RSVA 3VFPA 5IBLD 2P8MA 1KTRL 4DGVH 3JVGC 4TVSa 1FC2D 3BEVB 4U33A 2V5RA 5GISL 2ID5A 3FN3A 5GGVL 4OM1L 4PV9A 4BSWA 3VD4A 4PJGF 2UY7A 4QNPE 1AXSB 2VISA 1UQSA 3L3KB 1S9VB 4POYA 2VZVA 3VDCA 2RB8A 1EO8L 4TSAH 3KPRE 4PJAA 1H15B 4OKVA 3FRPG 4JRXD 1HK6A 3BKJH 1DBBH 4FQLH 4HS6B 3U82B 5DD5H 5DC4B 1EEUA 3LKPB 5D2LE 1RURH 3QEUA 3OF6D 1CI5A 3CXDL 1IT9H 5EFIB 2PCPB 2FD6H 3RGVD 2XN9B 3IU4L 3LQAL 1M05A 5I0ZA 2VH5H 4EDXB 1NGYA 2BVEA 1IGJA 3D39E 3H9YA 4GS7C 2FHCA 4XNQB 1X9QA 4I13B 4RMTA 4Y4KB 1HSBB 4HMEA 5EIIB 3HNTL 1OQOA 5HHME 1FORH 2EH7L 4XRCB 3VFSB 3BPOC 3QUZB 4XB8A 1V3JA 1PJ9A 2APFA 4YPJA 2UYLB 4NUGL 1I8KA 5F9OH 2IBZX 4EN3B 2BY1A 2Q20A 2RJMA 3P0VH 2X9YA 3MBEB 1SMAA 2FX9L 3T09A 4PJEF 4XP4H 3L3JB 4ODWB 1FG2B 3WEXB 5HHOE 3SE8L 3O8XC 3HFMH 4YHKL 4M48H 1NBZB 5GRYA 5B21A 3PP4H 4JPKH 4M4PA 5ESVA 1DBAL 5JW3L 4LCYA 3RGHA 3ARDA 4HEME 3DETC 3ZT5A 1I7TA 1U93B 1YUHA 3JWOH 4OCYL 3U9UA 3WD5L 2J4WH 2P5WA 4RGNC 1XCQA 1V3KA 2J8UF 4XGZB 5DJ8B 3DSFH 5HTSA 5CKGA 1U8JA 3PWPA 4WHYG 2A38A 5BJTB 1KB5A 4M5YL 2M1KA 1FN4B 5KZCD 3AAZB 1EBPA 1NDMB 4DN4L 4NNYB 1NUDA 3B83A 4QXUL 3ARFC 1N4XH 5DD5L 3ZL4H 5EDXA 4HCRH 1RURL 3ILQD 4N8CH 3OJDB 4Y2DC 3ARGC 5DTFB 5IHUH 1IT9L 4MAUL 3AC0A 1DQDL 3SDCC 2FD6L 1HH9B 2HT4C 1FPTH 5GS1A 2W9DH 4NQDE 1N59A 1D6EB 1QLRB 4NYLB 5TE4H 2KZWA 2WWMC 3UYRH 3LKSB 3UYOD 1FORL 3LKQB 5D2NC 5GRJH 1MCJA 5MEOA 1RIUH 2CXKA 4QTIL 1KJ2H 3SGKA 1G7PA 4D3CH 1R3LA 2GCYA 4XP4L 4ODVL 3VFMA 3S36X 3HZYA 4LHUB 1F5WA 3WFCH 4PGJA 4IDLA 4EBQL 3MODL 3PP4L 4MNQB 4JY6B 5E8NB 1U3HA 2DQUH 2NXZD 4HUXA 4JPKL 3S34H 3UTTD 2V2XA 4NJ9H 3VXSA 3VXRA 2D7TH 4EUPA 4X6FA 1RVFL 3GZKA 4EZMA 4YDJA 3PGCB 2WQRA 1C7TA 5DS8A 4X7FC 3MXWL 1CGWA 3VFWB 1AI1H 5CINH 2X44D 3SBWC 4Z7WF 4E5XA 2EE3A 3FQWB 1OAKH 1FZKA 1MQKH 1FNGB 3VW3L 5C9KA 5EO9B 2XRAH 1UB5B 4PJ7A 3O3DA 4R4BB 4F7MA 3E6FB 2X1XR 1IGFL 2R39A 3MV7E 5CS7A 5D6CB 2AJXL 1UVQA 3A6CH 3HRPA 4AIZB 3P4MB 4QNPF 4JY4A 1HE7A 2EIZB 3BQUA 3DXAE 1PZ5A 3L5XL 4W4OC 3QUYC 1MJ7H 5I74C 1BP3B 2YUWA 1XGRA 4NM8L 1RAMA 1CFSA 4LVOC 2IMNA 1OAXL 5C0BD 3ARBB 5GRJL 3SKNB 1NLDH 1RIUL 1XH3A 5ID1B 2NY2B 4WEBH 5D2LF 4GW4A 2CKBB 1EAJA 2NY1B 1JNNL 3HI6H 4FN0A 4CVUA 4ETYA 3T0VA 1QLEH 1DQMH 1U95B 3KR3H 3RWCA 4QOKD 3GSOA 2ADGA 4RDQG 1CICB 4G6KH 4LF3A 2DLIA 2EYRB 4XTRC 5F89A 4JM2A 4NKOA 1FFPA 1G7IB 3QIUC 1RSFA 3LV3A 4LAQH 4U3HA 3OXRB 1YMMB 3P4NA 1OCWH 4FABL 5C0GA 4HS8H 1FZJB 5GS0H 1F4AA 2XY1A 1AI1L 2AAVA 5HVGB 2VDPH 1NFDE 2VE6B 3JWNC 4R26H 1MQKL 1P5VA 4U0RC 3ROOB 1I9JL 4L29B 5SWSB 3LPFA 1RJZB 5FUOH 2DM7A 4AT6B 3FT4B 3WNOA 1IJ9A 1BJMA 1MEXL 1U92A 2C9AA 2OLDA 3GBMH 1TPXB 1PQZA 5DZOA 5KOVC 3TP4A 1UJ3C 4G8EB 1CD9B 3P77A 5GIRB 4WUUE 4JFFE 5HY9B 2AQ3A 4PGCA 1YNKH 2P49B 3VFNB 1RMFL 1X4XA 4S11A 4XWGH 3OKDA 1NC2A 4QT5B 1LGVA 2AS5M 2NY5H 2YD9A 1U3JA 2VNCA 4U1LB 5FOJA 2PR4H 3TLRA 2CJUH 3HE7B 4P4RA 2VRAA 4WNQB 2R4SH 3IF1B 1J1PH 3MRHB 1WFOA 4WHTA 1WGOA 1Y0LB 1KC5H 4NQCE 1G7JB 1INQA 1QSFB 4WEBL 4PRHA 5DVOA 1EZVX 3C6SA 1ACYH 5HDOA 3BH8A 3D2UB 1WVZA 4CRPA 2A2QT 4DWHA 3KPQA 4PLJD 5C08E 1AHWB 4CADB 4U7KA 4JQIH 3OAZH 3HCVA 3DO7A 3IVKB 4LCCA 2EIEA 1BOYA 4GAGL 4FS0A 4JDZA 4MJ6A 2EECA 3RTQC 2BXYA 3EO1B 1A3RL 2YD3A 1OCWL 5MEND 1IAKA 1I1YB 3B9VA 5TH2A 1HSAA 2W0LA 5IHBA 3MMEB 1U8PB 3CLFL 2VDNH 4C56D 2HT2C 2X42A 3QAZB 1LO0H 5GGSA 3SHSA 4AIXA 2AERT 4FRWA 4R26L 5IG7B 4WDIA 3OG4B 5ACZA 2X1QA 1KGCE 1NC4B 1I85C 5CD3A 5FUOL 1AGCB 3GBML 5C3LD 2JB6B 3TBSA 5E08H 3QG7H 5SX4I 2P24B 4NIKB 2AK4E 5J12C 3UBXG 3VFRA 1PX4A 1UZ8A 3N1MC 3HPJA 5JUEL 5IB1A 5K9JL 1IEAB 3TZVA 3V4UH 3VRJB 3ZDXE 3WDHA 3DI3B 5DRXA 5GPRA 4LDEB 4XWGL 2H2SC 1V7NH 4PY7B 4JO2H 2A74A 3BEWB 3SQOL 3B43A 4RIRA 5EORH 2FH8A 4LSSL 1Q9OB 4NZUL 4Z7QF 1YC8A 1ZGLM 3UTSD 3HS0B 4PJHE 5HYJB 4G6JL 4RDQF 3ZKMC 4C83A 1OW0C 1MOEA 1ACYL 4U6YB 4IMKA 1T03H 4LLQA 3VWKC 1A6TA 3G08B 3NACH 2A77H 4QHKJ 4NZTH 3WE6B 2R0KH 1NCBH 3SDDC 4S0TD 2X6MA 2VDOH 5D7LB 4KMTL 4LDLB 4F58H 5JZ7C 1BAFH 2FIKB 2WINB 3HZKB 1DQQA 5T3ZL 4K7PX 2XOTA 4HKBB 5ERWA 5H35B 4FXLA 2FR4A 4O2FB 1NCNA 2KDGA 2OXGA 5E24E 4WI9A 4OGYH 5A2KH 2VITA 5LGHH 4WTZG 4PJIA 3LN5A 4WV1B 4NGHH 4O2CA 2EYTB 2XIDA 3BO8B 3FB7B 1P6FA 4HAGA 3S4SA 3ZYOA 3VXNA 4LLWA 5E94B 1RZKL 4HLZG 3B9KA 4CMHC 1IKFL 1QNZL 4Y5XA 5JPMB 3WO4B 3GSRA 3CAFA 5E08L 4KHTH 2N4IA 3SJVA 1T4KA 5TE6L 1DQJA 1MCLA 3QULB 3V4UL 4R0LC 1OGAD 1BMGA 1QVOB 5AZEH 5K9KB 2F54A 1E4WL 3IFNH 4JO2L 4HH8A 5EU4A 4E41B 4OFVA 1T1YB 3VGDA 4XCNA 4X99B 2ICWJ 1NFDF 5JMRA 5JTWA 5SV4A 2EDBA 3C5ZD 1TZGH 1W0YT 1NGZB 3TA3A 3GSXA 5IMMB 5AZ2L 5HDLA 1LO5B 2A77L 3MRNA 5JIHA 4NZTL 2R0KL 1NCBL 2IFGA 3UAJD 5D1QC 3ZTJG 3V4VH 5ELIA 5FO8A 4N8VA 1N0LA 4D8PB 4QHUB 3BJLA 5EU7C 1IEBB 4Y4HB 7FABH 4W4NA 2YD8A 3JVGA 5L8JB 4NUJA 3IJYA 2J8UB 4OD2A 4FQXD 5BRZD 2QQKL 1WIPA 1SQ2N 2VSCA 4JRXE 1TJHH 2EIBA 5BV7C 4KKCC 3KXFB 5LGHL 1AXTL 3PL6C 3AB0C 3PUCA 3IXTB 2FECI 3EYOA 1U41A 5DJ2B 4MMZC 1ORSA 4YEEA 3QUKA 4Y19B 4U1KB 5C0AB 3GMNA 3UEZA 3ESUF 4N0UE 2F5AH 1EO5A 4HJ0C 4L1HA 4NRZA 4FOMA 1K4CB 3WN5C 2CIKB 3IFPA 5AD0B 3FAXA 4JRYB 3P2TA 3QDGB 2J5LC 5IB5B 5C92A 2Y06L 4KY1H 3EKCA 1QYGH 2VLLB 3SEPA 3LKRA 1IM9B 1I3GH 1PY4A 4KHXH 2GTZA 4MXQD 1LD9A 1B0RB 4GBXD 4KV5E 2MOVA 1L0YA 5I9QB 5TPWL 1U8IA 1NAML 4PS4H 1W0VA 3VFTB 2O93L 5HXMA 2ZJSH 2OMNA 3ZHDA 1NMBH 1HIMH 2IH1B 3CFIC 2B8OT 3FMGL 4LNVA 4LLVA 4MNHA 4OCXH 1DEDA 3BX7C 5L2KA 2FX7H 2VUOA 5HGDA 1TZGL 5FYKH 4ELMA 3I3EA 3R06A 4DZ8A 1L6XA 1NMCB 3FB8B 4Q2ZB 1EZVY 4UTBH 4ZSOB 4KVCL 2X1OA 3V4VL 3TN0C 5F96H 3ZDXF 1ZTXH 1XFPA 3WNKA 2IH3B 1UKSA 4YHPA 3NZHH 4K55A 3FL7A 4ZTPH 2P43B 3O8XA 4V2BA 5E8OB 1K8DB 2DLFH 2C3WA 4LASL 2ICEB 1YEKL 4DGYL 4IRJC 7CGTA 1RIVH 5FCUH 4PJHF 3SQBA 5HHQB 4IEFB 4DTGH 1O5DT 4YDIH 5CBAA 2HJFB 1BIHA 3EYQD 3QI9C 2OI9C 1WQVT 5IHZB 2VABB 3RUGB 3BWUC 3NFNB 4NN7B 2F5AL 1LO4H 4LL9A 2Y7QA 4S1DC 4PYGA 2NTFB 4NQXB 1J8KA 1AGBA 4D9LH 3BP6B 3ARFA 1QA9B 3FB5A 3C60C 3ZKQD 3ZYZA 1QYGL 2IPKB 2ZSVA 4R2GC 1XCTA 3ZZ1A 4YDKH 1OSPH 4Y2DA 3ARGA 2OTUA 1A2YA 3MNVA 1I3GL 3SDCA 3BHBB 3GJFA 1JWUA 4D9QE 2VLRD 2D0HA 1FO0B 1OTUD 3KPRB 5ALCL 4H1LG 4X80H 5I8CA 1I9EA 2HWZH 5HBBA 4HGWB 5TDNA 5IEHA 4DFHA 3HTLX 4QRQA 1ZKAA 2FX7L 2WIIA 1GC1H 1CT8A 5D2LB 4MB3A 3AREB 4H25A 4P46B 3EJYC 5JIPA 3T0EA 4ZS6C 4DFIA 1TNMA 4UTBL 2H1PH 1T83C 3D39B 5F96L 3MNWA 1T6VN 1DUZB 3JTSA 1PX3A 4NQEA 3KYMA 4ZTPL 2DD8L 3MGOB 2NY3B 2PNDA 3DV4A 1H3UA 5HHMB 4YGVA 2BHZA 3WIHH 5I1LA 1KG0A 1S9WB 3IJSA 3VI3E 4JDVB 5BOPA 5ETUA 1RIVL 1RZFH 4JHZA 3TFKD 3QXAB 5ICYB 4OT1H 4XMKH 4YDIL 5IMKA 4FFZL 1TMCB 4JREB 3U9PH 2DLEA 1WCQA 3LVEA 1F11B 2DQCH 2ATPB 5HHOB 4P3DB 4H8WL 1Q1JH 1JPTH 3SBWA 3CU7A 1AGEB 3JXAA 4NBYB 1IGTB 1VGEH 2XXMB 2EDYA 4U1NB 2E7HA 3H3KA 1FGNL 2CMRH 3RKPA 3KYNA 4PBWD 3F12A 4JO3L 4U4BA 5C0BE 1TZHB 2HFEB 1CLOH 3LIZH 4I0CC 3QQ3B 1A4KB 1AE6H 3GSWB 4GRLB 1YQVL 4YUEL 4X80L 5SWQA 1R24B 3UTZA 5J1SC 1EH9A 3GM8A 4W4OA 1CLZL 5CEZE 1F4HA 3QUYA 3D87B 1GC1L 1KLUA 5GGRA 5TDOB 1A1OA 4ZYKB 4Z78B 2LU4A 3OJ2C 5EG6C 3X12A 1IGYA 5J13C 2I5YH 3U46A 4NQDB 4HIEB 5E2UL 2XPGB 2F5BL 4U1HA 4KV5F 5DHYA 2NW3B 5FECB 3MV9A 2R0WL 3SKMB 4NQUA 4N0FB 1S7TB 4PRAB 4YAQA 1JGDB 2C26A 3FONA 5C0JB 3KJ6L 4OSUH 1DL7L 3QIUA 2F53D 4RNRB 3RVVC 1UWGL 5D9SB 2WBJC 4OZGF 4TVPD 5KVMC 1EPFA 4OT1L 4NHCL 5GQBA 3MUJA 4IHOB 2AJYH 3CDFA 5DJCA 5F3BA 1AO7D 4XVUC 1RZ7L 2YXMA 1M1SA 4RMSA 4GAFB 1JPTL 2VLKE 4OFYA 5C0RL 1TVBA 5FKAB 1RV6X 2W0FB 1VGEL 4XP6H 4PYHA 2CMRL 3OKMA 1J18A 4HJJH 2MCPL 4FXKA 5F1OB 5EBWB 1Q0XL 2Z4QB 4JHAL 4PJ8B 4XZUA 5C0IB 4Z7VE 1JHLH 1UJ3A 5EBLA 3JUYA 1MFDL 4AEIH 1MFEL 5MI0B 1KNOA 5DJAA 3ALXA 4RQQA 2O5XH 2DLGA 4Y4KC 4AL8L 5HJ3A 3F6IA 3GMPA 4D9RD 4AY0A 1MFAH 1TJGL 1TETL 3ECBA 3UO1L 1AQKH 4NKMB 3LKNA 4FQCL 4WW1B 5L6YH 4EN3C 3MV7B 3MBEC 4MQXC 4LP4A 1DBKH 1V5JA 4YPGA 1Q8MA 1KXTB 3C09B 3CSGA 3DXAB 3C5SA 2HLAB 3IFOA 4MWFA 3VFUA 5MENE 3UYPA 3HR5B 3NPSB 1SVCP 1MLBB 1N8ZB 2YUVA 1ZV5A 4AEHH 2R1YA 4JLRB 4BA8A 4XH2A 2FSEB 2DBLH 1I7RB 3HA0A 4JKMA 3KG5A 5F44A 1AGDB 1DCLA 3OJMB 5ANMA 4JVUA 3RTQA 3HE6C 4K7FB 1N0XL 4F80A 2IAND 4OCLC 3BIKB 4MAYD 1B0GA 2RQ8A 4ZO6A 3WXVL 2B7DT 2MJWA 2AJSH 3OR7A 1RD6A 2IG2L 2G9HB 3MUGA 5KW9H 2PYED 1I85A 2ADIA 3ZTNH 3EBAA 3GRWL 1XIWB 1KIRB 3MR9B 3VI3F 3S88H 5KJRH 1BZQK 5C0CA 5CGTA 3SCMD 3UTSE 3NTCL 3BPLC 3EOTL 3ARWA 4P5TB 1FYTD 5BZDA 4ZOAA 1NFDB 1JUFB 2CR3A 5J6GB 3VFVB 4DK3A 1F3DJ 1WZ1L 4FMFA 1MFAL 2GAZA 2YEZB 1AQKL 1G6RH 3ARTA 5AYUL 3Q5OA 2ZCHH 3TVMD 1F3RB 1A22B 4MLIA 1T2JA 4WUUB 3UTQB 1DBKL 1OW0A 1Z9LA 3MRDB 4AZ8A 3ULVC 5DQ9B 3GO1H 5CSZA 3VWKA 1G9NL 3Q5YA 1F4YL 1XF5B 2X2YA 3VI4E 4PJAE 2H3NA 1C7SA 2X4SB 2YA1A 2PW2A 5JPNA 3CSYB 1FFNB 2H32B 4NQCB 4XVJH 2CQVA 2QSCL 3CFKA 4F9PC 1FL5B 4YHIA 4ZO8A 3GMRB 1BFSA 3MRJB 1FNLA 4K3HA 5GSRB 1JK8B 3FO0L 5SX5K 3W39B 3H42L 2B0SL 2XFXB 5KS9A 5TGBB 5C08B 2COQA 5ITBL 2CH8A 4HPOH 4QRSA 5HYQB 5C0NC 3GK8H 3HAEG 3OKKA 1JBJA 4O2EA 2K9UA 1OGAE 4HV8B 3GMOA 2VL4A 2OJZH 4JHWH 1FCGA 1XGTB 1LK2A 3Q6GH 3QWRD 4E0RB 3VH8A 4NZDA 3FO9B 1QSVA 3AMKA 3S88L 1D5MB 1T21B 2CPCA 2MTPA 3HI5H 2X9XA 4JAMB 3BH9A 5EZLB 4R0LA 5ITFB 4PP1D 3P73B 5IOPB 1WBZB 1ZK9A 3RY6C 3IDNB 3MBXL 2ED7A 2J6EL 5K9OB 3ARBC 4PV8A 2HRLA 4HKXB 1HKLH 3UBXI 2R15A 4WWKD 2ICES 2IPUG 4MJID 3BPCB 2IPTH 2AK4B 2B20A 5D1ZB 4FNLL 2P5WE 3ZO0A 4KKAD 2PYFB 4O02H 4Z7VF 3GO1L 3CC5A 2R2HB 3E3QC 3PWPE 3RI5F 5BRZE 1CICC 4UIMA 4L3AA 5D1QA 3IDYB 4K3EH 3MRLA 4OUUA 4QTHA 1B4RA 5E1AA 2D0GA 4F7PB 4K8RH 1Z2KA 1P4BL 4IRSD 4BJLA 4RGND 5CEYB 3HI1B 2EDWA 4PJHB 1GGIH 3V5HA 4UINL 5J1TC 4M6OH 4Y1AD 4DKAA 4JR9L 3WUWA 2AJVH 4WENB 3OAUH 2R0LH 3ULUH 3U0PA 2YC1A 3PL6A 4PGEA 3AS3A 1K3ZA 1TXKA 4Z0XA 1GHFL 4HBQA 4APQA 4LSQL 5DJXB 3GK8L 1T1ZA 2YD1A 1Z9MA 5DEGA 3ZHLA 4AK1A 2OJZL 3M17A 1W8OA 3QPXL 1H0DA 1WBYB 4ZXBC 5F7WC 3WN5A 2OXHA 2PTTB 3L3DB 3O3EB 3Q6GL 5C9JA 2AKRA 3MLWH 2MQ0A 4QRPA 2FO4B 1TITA 1PVHA 3LDBC 3HG1D 4OD1H 1ZE3C 2OTWA 1ZLUH 2BRRL 1R5VA 4XVSL 3FTGA 3KNBA 3PV6A 5DO2D 2Z35B 2NMSA 1PKQE 3U0WH 1BF8A 3RWFA 1HYRC 5GJSH 5B4MD 3WO3B 4Y5YB 2D31A 3HE7C 5F7DA 3GSUB 4MDIA 1YPZE 3DV6B 3MCKA 1T3FB 3WSQH 4D2NA 1CS6A 2OS7A 1CFNB 2NPLX 1QLFB 3VXRE 3RDTB 2FJHA 5AG9A 1BREA 4DQOL 1K8IB 2A6IB 4XCEA 4KRPC 4DN3L 2P8PB 2DQDH 1NGXA 1OAYH 1UA6H 2WAHA 1HINL 4LOUC 5CSGA 3TN0A 3SDXE 5K59F 3RNKA 4BSVB 1NPUA 4JM4H 5H94A 3O41B 3NCJH 4X7SH 2EEDA 3GMLB 3FQNB 2E6JA 3ULVL 4L8DB 3PGDB 5CMAA 8FABB 1C8PA 1UENA 1KN2L 1ZGLA 1ETZA 4ELKB 1P2CA 2VDLL 4IRJA 2NY7H 1YEDA 1R3HA 2H8PB 2YPKA 3H3PH 3D3VD 3OXSA 5F9JA 4RMQA 5DR5L 5GGTA 5E5MA 1U3YA 5E99H 3TNMB 1QSZA 3V5DB 2PW1A 4LSPL 3QI9A 3MRMB 5DQJB 1N2RA 4DZBB 1JZ7A 5CGYC 1L0XA 4PJAF 4IS6A 4PG2C 1PYWB 4PJDE 4XBGB 5IESL 2VLRE 2UUDH 4HIJA 2I07A 2YD6A 3NFPA 1DLFH 1T7ZA 5J1AA 3C60A 2HFFB 5C07D 1J10A 2CK2A 4BFIB 5H2BB 5JQHC 4D0CB 3L9RB 4X5XA 5B8CB 2OR7A 4XBPB 5GJSL 1LEKA 5HI3D 3VXOA 5FCSH 1F4XL 3QRGH 3RGVB 4N0UB 1RU9L 2JK5A 5D7SH 1EEYA 5I2IA 3DVGB 5JW5B 3EZJB 4HH9B 5D1XB 3DROB 2Z8RA 3TO4C 1JNHB 2GI7A 1IC5H 5EBMB 5FDYA 4LPUA 3OJVC 2DQDL 5DJYA 2APTA 2DDQL 3DVNB 2BFVH 5IVXA 3T8XB 4WTWA 4MD0A 1T83A 5TQ0L 1T5XA 2CKBL 1IFHH 3BP7A 3INUH 4G8IA 1XGYH 4X7SL 1FNAA 5HVWA 3HZMB 1LK3L 5IIEB 2Z93B 2XWTA 1U58B 5EOCL 4IOSD 4KQ4H 5ABDE 2OR9H 2OTPA 2YPLA 4Y4FC 1YEIH 4CVZB 2G75B 4WV1C 4NO3B 2FJFB 4OUOA 5B39G 5ESQB 2VC2L 1ZSDB 4PB9L 1UWXH 1U8LB 3GMMA 3IDMA 3QWQB 1WCBB 4X0KB 4FFYH 3GRWA 3O9WC 1KB9J 2CD0A 3SDAD 4OZHF 1HYSD 2DM2A 1BFVH 1DDHB 2W0PA 5DUMH 4H1LB 3PXJA 3DX7B 3CFBB 1MFCH 5DMKB 1MIEH 2XV6B 1C12B 2Y6SC 4L8BA 3GMQB 4P23A 2G2RB 1OP5K 5BVPL 3QB7C 5IM7A 1GPOH 1Q94A 3QRGL 3HMXA 5EOQL 4R4FH 2XWJA 3TC9A 5D7SL 2EDHA 4TSCH 4U6HA 2DWDB 4YR6A 1P84J 3K4AA 2X70B 3B8SA 3O6FC 4Z8FH 1HWHB 1A6AB 3W9DB 3LZFL 5F7NC 4GQ9H 2DYPD 2ITDA 2PXYD 5AEAA 2F53E 2KL6A 1K3IA 2Z0BA 1REIA 5B38G 1OLZA 1JMZA 3X11B 1JCKA 4TVPE 4J4PC 3CMGA 3PDOA 4LMQE 4PREB 4X5WA 1AO7E 3BEVA 4H88H 2QBWA 1YPZF 3AXLA 5IR1A 2OP4H 5IB2B 3F7VA 1QPXA 3RZCD 4KVNL 4RMUA 4OF6A 2NXZB 2ZUYA 1YEIL 1NCWL 2WBJA 1AXSA 3NFSH 3ZKXC 4CKVX 1ONQB 3AM8C 3L3KA 3MGTB 1BQSA 1VGKB 4Z77A 1KPUA 5IQ9B 1DN2A 3BKCH 1IC1A 1H15A 1ZOXA 1HQ4A 1C16B 3SDXF 3EZ8A 3CMOL 3KYOB 3LY6A 5DA4A 4NC1E 1VPOH 4HS6A 3G6JE 3QCUH 5DUML 2DI8A 3GBNL 2KKQA 3LKPA 1FIGH 1MFCL 4D9RE 4PRBB 4YXLH 4Q74A 5GGSY 1CTOA 2D7MA 2NZ9D 1FLTX 4MA8H 2XN9A 4G8GD 2HRPH 5I9QC 2VR4A 1QRNA 4LPCA 4RGOH 2XI9A 3BMVA 1GPOL 1AD0A 3KPSD 3OKNA 4XNQA 4R4FL 2D7PA 1QKZH 4HFUL 4XNZB 1KFAH 2GIYA 4TSCL 4A6YB 4Y4KA 1HSBA 1U8OB 5A3ID 3UCRA 1MNUH 1JPFB 3T0AA 3KPNB 4XRCA 2Z31D 3VFSA 3QUZA 3BYTA 2UYLA 4PJDF 3WLWC 3MFFA 3M8OH 3UPCA 1VB9A 3KAAA 3SDDD 3IGAA 4EN3A 4YGAB 2OSLB 4CUCA 3QJHB 3MBEA 5FHBH 2NY0C 5I71B 2C5DC 3SE9H 4L4TA 1EHLL 4ODWA 3MA7B 4JVPA 5F1KC 2AABL 3WEXA 1K5NB 3V5KB 5LWYL 2X4NB 4KJWD 2ZNXA 3K4ZA 5F9WB 2O5ZL 5INDA 1NBZA 4FZEH 2FEEL 1H9VA 4WEMB 1KJVA 1CIUA 1H3VA 4LU5H 1Q72H 5DRNA 2V2TB 1HHJB 5EU6D 1U93A 1MF2L 3ILPB 2PYEE 1A7NL 3GJEB 4PRNB 3HE6A 1CDGA 1FYHB 3ARSA 4JG0H 2F54E 5BJTA 1JF1B 2QV2A 1FN4A 1N5YL 3AAZA 1NDMA 1HHHB 4NNYA 1FIGL 3QHZH 2V9RA 3HPLB 2A9ML 4MA8L 4NO2A 5GSVB 2HRPL 3TBWB 3IYLW 2Z92A 1NGQH 3VXUA 3BT2H 1D5IL 1D6EA 1QLRA 3TYFB 3IDJB 3CIQA 2VLKB 4G42A 5TF1H 1KFAL 5HHNB 2Q6WB 4D94A 4U6VH 3JWDH 3LKSA 1MNUL 1NEZG 4JKPL 4XPFH 4P46C 5HD8D 3C8DA 3V6ZB 4PJXE 2VSDA 1S7RA 3M8OL 3RL1A 4Z7VB 3VGAB 1X5GA 5C71A 1A64A 2YN3A 3WFDH 3RU8L 2FECL 1RFDL 1DZBA 1UGNA 4OLWH 3AU1B 4OLXH 5C0DA 1EX0A 3MRGA 4XWOD 1AP2B 3IDGA 4PRPA 1QP1A 1UEYA 4J3WA 1A21A 1INEL 1DANT 4HULB 5F7HA 3CFDA 3H8NA 3PL6D 2NX5A 1DE4B 2VQ1B 4LIQE 4G7VL 3G5ZA 4F9PA 4X4YB 4UV7L 1Z5LB 2BVYA 2I9LB 4JREC 4RAUA 3WJJC 1DUYB 4I2XE 4JG0L 5B22A 3VFWA 5MENB 2YR3A 4DKEL 1YC7A 1XF2A 2DMKA 4WY7L 1OP9A 4KUZL 5EO9A 2NLJB 1AKJB 1BBJA 3G6AB 1DQTA 1UB5A 3BI9X 4R4BA 1BLNA 2VWEC 4K23H 1TZIA 3E6FA 4QRRD 3LAFA 5CUSH 3MLPA 3QEQD 2NY4D 4ODBD 4Y5VB 4M61B 4NO0A 4XPAL 3CXHJ 3GHBL 1TQCC 2EIZA 5KVEH 2O61B 1I9RH 5LBSH 3DVIA 1K4DB 1FFOB 4OLZH 2XQBH 2ZUUA 3I3DA 3RY6A 3ARBA 4XNUH 2X4TB 4HIIB 5FYLD 5IFJB 4P2YA 3I02B 3V4PH 3G6JF 4KROD 4DCQA 5DD1H 2CKBA 1B4JH 1CLYH 2NW2A 5I73B 1EGJA 4RGNE 2UWEA 3QFJA 4OLXL 3QUXB 2H2PD 2WSKA 4Y1AE 4M4RA 4BQ8A 2EDDA 4YX2H 1CICA 2E9BA 2EYRA 2YZ1A 5C3TA 1G7IA 4XC1L 4KTEH 4PBXA 5I8EB 3AROA 3D85D 1DQLH 3Q5TA 4GH7B 5T5FH 1DR9A 3HAEB 4Y0GA 1PSKH 4KTDH 3OXRA 4PV9B 4MD5A 3NIDE 2B39A 2VAAA 2VISB 3RI5K 2W1NA 1UQSB 2Z8WC 4RWYL 1GYAA 4J6RL 1NGPL 3T0XA 2VXUH 5LGJA 2FB4L 2VE6A 4PJAB 3HG1E 3MLSL 1KELH 4OKVB 4PJ5D 1U8NB 4NWTL 1OD7A 4L29A 1U9KA 3NPZB 5SWSA 4ALAH 2ED8A 2CDGA 4ZQKA 4Q97A 4AIOA 1RJZA 5D2NE 4ZXBA 4P9HC 4Q6YA 3TPUA 3CJJA 1A7PL 4K23L 1PG7L 4G8EA 5I1EH 4LKXA 5CUSL 5GIRA 3K1KC 3SPVA 3NCYS 5TDPA 4OQTH 4TTDD 1IM3A 5E9DD 3VFNA 1CDHA 4WRLA 2WK2A 4A2MA 5KVEL 1MCSA 1I9RL 5LBSL 3MLXH 1X6LA 4WI2A 2P5EA 4OLZL 3ESVF 2DI9A 2XQBL 4U1LA 1OGAB 3HE7A 4G9FD 3MRHA 4X83A 3ARUA 4LPVA 1QACA 3QHTC 1FO0L 4ZS6D 5C6PB 4DVBA 1Y0LA 3V4PL 4UQ2A 5MP6H 1LMKA 1CL7I 1QSFA 5DD1L 1II4E 1I8KB 1RUPL 1B4JL 4GRWB 5C6TL 3C09C 4R7DB 1S7QB 3C5ZB 4MMXC 5T33L 4UDTB 2QQQA 1IC7L 3OAYH 5T1KA 4CADA 2A6JB 3DTXB 3AS2A 3T2QA 5I6XB 4O9HL 5T5FL 1TTFA 4XPHL 5KANI 3ARDB 4KTDL 1RUKH 4LQFL 3DIFB 5D96B 3BRFA 3U9UB 1SY6A 2P5WB 1XCQB 4PJXF 6CGTA 2R9HD 4KJQC 3C8HA 4S10A 3NABH 3PWPB 5IKCA 2VXUL 3CVHB 4KJPD 2CR6A 1JHTA 1KB5B 3SO3C 1U0QA 5C07E 4C4KT 1IGIH 2Q8AH 1KELL 4KI1A 4KDVA 2OL3A 4ALAL 3B2UC 1YYMH 1JPSH 2Q76B 4PG2A 3LOWA 2JB6A 5J11B 5JOFA 1IAII 4HWBA 2P24A 1ND0A 2BVOA 2D2OA 5MHSD 4BZ1H 3WS6C 3WFZA 2MPAH 4GRMB 1NAKH 2X41A 1N59B 1WIUA 2OX5A 4YBLC 2E7MA 5DF0A 5IF0A 2GJZA 5I66A 3ZYIA 4HHAA 4P9ML 3MLXL 4M93C 4YLQT 1IL1B 2V6HA 2B5IC 4M6NH 4GBXB 2BOCB 2BSTA 1I1AD 2VXQH 1XMWA 4KK6D 2YA2A 2GQHA 5IP4A 5MP6L 1RHHB 1P9MC 3HS0A 3TJHC 5INCA 1QBBA 2GSGB 5I1KH 5F70A 2YHGA 4RFOH 3TO4A 4OAWB 1G7PB 4I77L 1D5ZB 2IPUK 5FM8A 2GCYB 3MV11 3VFMB 2YKLL 1GAFL 2OR8A 2Q87A 4L5FH 5D7LA 5GGRY 3HZYB 3CX2A 4PTTB 1YPZB 4YJZL 2VB5A 1FBIH 1HEZB 3N1GC 5ADOH 2WINA 2V2XB 3RVVD 1DVFD 5LAXB 3OB0K 4LRIC 3VXRB 3VXSB 4ENEC 4C4KO 4PJGA 4X6FB 4S2SA 3ROLA 2EO9A 3S37H 4J12A 4YDJB 4O2FA 3KLDA 1QFHA 3UTPD 1ZLWH 1CFVL 3S97C 5HDQL 4Y4FA 3NABL 2ERJB 5J6HB 4WV1A 1OT1A 3SDXB 2FBJH 2Q8AL 4E5XB 3BO8A 1KIQB 4JN1L 3FB7A 3I50H 1VESA 5E94A 5JIKA 4P57B 5F7EL 1JPSL 1MWAB 1F00I 1KUMA 3O9WA 4PJ7B 5JPMA 3PHOB 1JE6A 2K1MA 1GOGA 4F7MB 1MREH 2LU7A 4BZ1L 1PLGH 1UVQB 5F1NB 2MPAL 3NIDF 4JY4B 5FYJD 5AAWA 1QVOA 1PZ5B 2FX8L 5T1DH 1RUQH 4P9HL 1T1YA 4UOJA 4O58L 1BBDL 3L3IB 4M6NL 1XGRB 1CFSB 4YFDB 2VXQL 3C8KB 5DJZB 4PJDB 3D0LA 1LP9A 2VLRB 3DHJA 5D7JD 4MQXD 5D1ZC 4I3SH 5ANME 1RPQA 1E0OB 4RFOL 1NGZA 4GW4B 2XZQH 4HDIB 2D4DA 4PJEA 3BZDA 1SM3H 2Y4SA 1LO5A 1CXHA 1QBLL 2ED9A 2R0ZH 1CGUA 3L7EA 3VJ6B 3GSOB 2ADGB 4JDTL 1F45A 4LF3B 5FB8A 1B0WA 1IEBA 4J4PA 5EA0H 1FBIL 1FFPB 4NKOB 3VCLA 1R3IL 5KSAC 3DX9A 3S37L 4RFNB 1IZKA 2J8UA 4J3XA 4XAWH 5C0GB 5C09A 1KEMH 3KXFA 3QXDA 5C0CE 3IXTA 1CGYA 2LV4A 5DJ2A 3QQ9C 2G5BA 3AM8A 4ZODA 4BKLB 2CDFB 2FLBT 4JKKA 3CVIH 4G8GE 3R8BB 3P4LA 4NT6B 3WFHA 12E8H 1K4CA 2JELH 2XA8H 5JHDD 3KPSE 2VLJD 4JRYA 3QDGA 1FVEB 4J3UA 5E0QA 2VDMH 1EEQA 2VLLA 1MREL 4JPVL 3BDXA 3CSBA 2PO6D 4BQBA 1OAZL 4PGCB 2FRGP 3G6DH 4P5KB 4MNGE 4BH7A 1IM9A 4G6FB 4IOFD 4K2UH 4Y16D 2DQTL 1B0RA 2J88L 1J87A 4Z9KB 1OM3H 3QH3B 1J8HA 4KMQA 3VFTA 1OSZB 4LVHB 3WIFA 2YWZA 1BM3H 1IGCH 2IH1A 2WUCL 3Q48A 1MCPH 4P4RB 3RDTC 3JTTA 1TTGA 4WHTB 5I15H 5EC2A 1FFQA 3VXMD 1UH3A 1HWGB 3FQTA 1IAOA 4YC2C 3L5IA 3U7YH 5H37H 3QYCA 2R0ZL 3B3IA 4X4MA 3S36H 3MNZA 5KS9E 2DQJH 1WZKA 5EU6E 4OFIA 2IH3A 1YEJL 1M7DA 3STLB 1EVTC 3MV01 3HCVB 3BD5A 1KCKA 5IBLC 3DO7B 4MGXA 4MCYB 1MSPA 3P0GB 5JOPE 3MJ8A 1RZJL 4O5LL 4UTAL 3BAEH 4JDZB 4MJ6B 5C8JA 5D7IA 3LEVL 4XCCL 1OAUH 5DRWA 1S7UB 5TH2B 3IAPA 1HSAB 4C57C 4MHHG 3UJTL 2F53B 4MA1C 2X1PA 4Z7WA 4UQ3A 5GGSB 1P1ZA 1G7LA 5IHZA 2FL5A 2VABA 5I1CH 3QXUA 3NFNA 2ZG1A 1UCBH 1AO7B 4I18C 3TBSB 3BP6A 4OB5H 4BZYA 2WM0A 1MAML 1K9TA 3IT8D 3H9SA 3HPJB 3GKZA 3S96B 5IB1B 4M9OA 1N6QL 1Q9WB 1KYOK 1HDMA 2NR6D 3MLTA 3K1DA 4H5SA 1BWWA 1KJ3L 5E4IA 4PGZA 4RIRB 1YJDC 1FE8H 1WT5A 3G6JB 3CFEB 2YWYA 1VEMA 5D2LA 4DGIH 3H3BC 4LMQI 4P46A 5I1AB 1AD9B 1MPAL 1TCMA 4C83B 3DRQB 4LLQB 5DFVD 3OR6B 5FHAL 5T1MB 5HHVL 3MLVL 1DUZA 1MFBL 2NY6D 1T7XA 2CUHA 2JCCE 3U1SH 43CAB 4OD3H 3MLZL 3QIBD 3L3HB 4G9DB 4H26A 5B3JE 3CFCH 3EOBB 4WCYL 5I1IH 3SE3C 4GMTH 2CGRL 1T22A 3MUZ1 1OAUL 2J8HA 4JDVA 5ERWB 2YA0A 3QXAA 3PWNB 5DD0H 4Z76A 2VITB 1EUUA 1UKQA 1FAKT 1HXMA 4LLDA 3WJJA 5M95B 1F11A 3BVNA 1AY1H 2ATPA 4O2CB 3I85A 5I1CL 2IADB 4QRRE 5E2VL 3S4SB 1UCBL 4MAYB 3VXNB 4LLWB 3WBDA 1J0HA 2YRLA 3B9KB 3CDYA 5I1GH 3CZFB 4U1NA 1JJUA 2M2DA 4Y5XB 5LQBH 3WFBH 1UACH 4KZEH 1X5ZA 3GHEH 1T4KB 5IBUG 3P4OB 4PJCE 4WIQA 1DQJB 1JYVA 1BQLL 2B2XH 2PYEB 3E2HB 3TWCH 1B9ZA 3ILQC 4RMWA 2F54B 4LPWA 5EU4B 1A4KA 4UV4H 2CRIA 3GSWA 2NXYB 5J7CC 3SCMB 1R24A 2DIBA 3GGWA 1FDLH 2V5YA 3BKMH 2RCSH 4OF3A 1FVDA 5TDOA 4DGIL 5I8OL 2ZZUT 4KRPD 3DMMD 4Z78A 2AGJL 3L3GB 3BKYH 1UCTA 3TA3B 1AR1D 4LNRB 4X9HA 3K0WA 1WZLA 4K8RC 3LKOA 1EK3A 4GXVL 3TVMB 3EFDH 1RUML 1H8OA 1U6AH 3TT1H 2BNQA 3VD5A 2VL5B 2NW3A 1KBGH 3SKMA 2MNUA 1S7TA 4N0FA 4NKDB 3ULUC 1JGDA 5C0JA 3CFCL 4HPYH 1WSST 1UWEL 5DMIL 1EXUB 1HHIB 4PJXB 2NXZC 4ODTH 1VFAB 4TQEH 5CWSB 4H0HB 3N9GL 5DD0L 4PRDA 5KVGL 3PF2A 1JFQH 4IHOA 1AC0A 3EYOB 5KBNC 1T7WA 2DWEA 3QDAA 2QADD 1MHPH 3O2VH 3SOBL 1ORSB 1UH2A 3QUKB 1G9MH 3GMNB 3RX5A 3VG9C 2X9WA 5CKAA 5FKAA 1L4IA 4CL7A 2OZ4L 2W0FA 1TDQA 4LBEA 1HHGB 2R69H 5CZVH 5FO7B 5I1GL 4UOW0 5LXGL 5LQBL 3IFPB 1G84A 4OZFG 1UACL 1Z3GH 3MROB 4KKLD 5EBWA 5C0IA 1NSNH 4HWEH 2GTZB 2HLFD 2C7UA 4I2XB 4F15C 5I0DA 5IVXE 3MV8D 2EE2A 1W0VB 4XNZC 3A6BH 3EYUL 1UB6A 3TNNA 4RGMB 1A14L 2W9EH 4LLVB 4MNHB 1FDLL 1UZ6E 2H9GA 5CLTA 3BKML 4NKMA 2EC9T 5HGDB 4M3JA 3VXTA 5JIIA 5I76A 4WW1A 2D03L 3BKYL 2P4AB 4P3CL 1MCCA 1CN4A 1CDUA 3V2AR 5KAQF 2YPLE 3R06B 1YJDL 4I9WD 4DZ8B 4QXGH 1AXIB 3EFDL 3HKFA 1DTUA 5K93A 5I17B 3DXAA 2HLAA 3TT1L 5HYEA 4YHPB 1IARB 5F7KC 3HR5A 4KK8D 5EO1B 2XACC 1MLBA 1N8ZA 3O8XB 1W72H 2Y07H 4JLRA 2FSEA 4HPYL 3NIFE 2BRQA 32C2A 3FFCA 1AGDA 2G5RA 1MHEB 1FNSH 1UG9A 4TQEL 4ZFZA 4M6AA 1QZ1A 1T1XB 2V9TA 3EO9H 1CXEA 3HC4L 4K7FA 4IRSB 4MCZB 5CBAB 4RGNB 3BIKA 4Q0XH 4DW2L 3BSZH 1MHPL 5TFSH 1L9NA 4Y1AB 2VXTL 5ICXB 4PD4K 2G9HA 2JCCF 5CZVL 1VFBA 2PTVA 4K71C 3UZVB 2LTQB 3UPRB 1S3KL 3DUHA 2DQHL 1HN1A 3ARFB 1Z3GL 2Q3ZA 5B3JF 1TCRB 1ZT4A 1L7TL 4M7LL 1KIRA 4HWEL 3ARGB 2OTUB 1A2YB 1CGSL 3BN9C 2DS4A 3MNVB 3SDCB 3D9AL 3C6LD 5IBTH 5HPOA 3GJFB 3M07A 4P5TA 4G5ZL 1WTGT 2BSED 3MRQA 3WYRA 3HG1B 3VFVA 5I8CB 3MGAA 4ONGH 4XCYB 5IEHB 3HMWL 3O6FD 9CGTA 5ILTH 1LQSR 3W0WD 1G6VK 1NH6A 3P30H 1MRCL 5D2NB 3D6GA 3OPZL 2PETA 1BVLB 3VGAC 1P9MA 2V17L 2WMPA 3IB4A 4JFFA 3A67H 4PJCF 4QXGL 3F65A 1OVZA 3C9NB 2R8SL 5DQ9A 2WANA 1P4IH 5DGQA 3NCYP 2JKXA 5GS0D 3KYMB 2YN5A 5KN5A 2YD2A 1XF5A 4O51A 3UTPE 2ZG3A 2DMCA 1GVIA 1L7IH 3DV4B 3H7LA 4LEXH 4O00A 1URLA 1MCIA 1S7XB 5C09D 5I1LB 1KG0B 1FRGL 5F7MC 4KI5D 1ZLVK 2ATKB 4NQCA 4LRIA 2QSVA 1RK1B 1F2QA 1C5DA 3EOAA 5ETUB 5CEZH 3EO9L 1GRWA 4J3TA 3HLAB 1ADQH 5IMKB 5GSRA 1JK8A 1QRNE 3BSZL 3W39A 5TFSL 2XFXA 4LSRL 4Q6IB 5TGBA 3UBXA 3C5JB 5C08A 1BOGA 4UT9H 3FQXB 1T6WA 2BSSA 5JA8B 4HFWA 5FYJE 3CDCA 1GJIA 4HJGB 5FKPB 1ZLSL 2AI0L 3KYNB 4E0RA 3F58H 1OWWA 2DBJA 3FO9A 4OCSL 4Y5VC 3THMH 1NCDH 3U4BL 2ZPKH 4L4TE 1HXYB 5EZLA 5ITFA 4OI7A 4UIKH 3TESA 4I8DA 5SWQB 3P73A 3UTZB 1WBZA 4ONGL 2P8LA 3QUYB 2EDQA 4QCIA 5I74B 1JPST 4HKXA 1KLUB 3P30L 5GGRB 4PG9A 1A1OB 2R56H 4LSTL 3BPCA 2EDTA 1FL6B 5CJOL 5T3XH 2AK4A 3X12B 4A6YL 5D1ZA 5I73C 1IGYB 2PYFA 5FGCE 1KCRL 1P4IL 2ITCB 2AEPL 2QKIB 3IDIA 4Q9QH 4U1HB 5GJTH 2B1HH 5D4QA 1UT9A 1RIHH 4WTZA 4YAQB 1PEZA 5LCVH 4J7RA 4M1DL 3P0YH 1UZ6F 1WJ3A 3QIUB 1QFWM 3QPQD 4XPGH 5CEYA 5BXFB 4PJHA 3GIVB 5KSAA 4GAJL 4MZ2A 2RFXB 4RAHA 5CEZL 1H3TA 2IEPA 1ADQL 4IOIA 5JHDE 5E8DH 2VLJE 5DJCB 5F3BB 3I2CH 3O3UN 2R29L 2C1PB 1VACB 3DPBA 4UT9L 4I5BA 3PGFL 4AJ0A 4BM7A 1FSKC 4HX1A 2V7NA 5DJXA 2XTJD 3X13A 3OSKA 5I1JH 3RKDD 4PPTA 5IB4B 1M4KA 4U0RB 3OKMB 3Q6FA 1NUNB 4HUUB 2PTTA 3L3DA 3B5GA 3V8CA 1OARL 1XR9A 4XZUB 2BZDA 5GGQH 3NIFF 2FO4A 2UZXB 2CK0H 1UJ3B 5EBLB 5FAAA 4OFKA 4GLRI 4L9LB 4BQCA 1KNOB 1UM5H 3VXME 2Z35A 2ZPKL 4QY8B 1AGFA 1MRFL 1A7RL 4RQQB 4UIKL 4KFZC 4Y5YA 5HJ3B 4TYUA 1PBYA 1I3RB 4DAGH 4IM8A 1EAPA 1CFNA 1QQDB 3RDTA 3BGAA 1CD0A 2NX5E 4Q9BA 3S35L 3LEYL 2A6IA 3C5ZC 1LO3H 3PQYD 4RBPH 4YPGB 3V7AE 2P8PA 3TO2B 3C5SB 1G9EA 4MWFB 2ZKHH 2DYPB 3UAJC 1ZHLA 5D7KD 4QF1A 5I6XC 2R1YB 1GZQA 4XH2B 3QXVA 3PGDA 1LHZA 3NZ8B 4HZLB 8FABA 4CVWA 3HZVA 4EIZC 5ANMB 4CDHA 5HHPA 4YK4C 3O2WH 4ELKA 1Y18B 5HYSG 3LHPL 2H8PA 1B0GB 3I2CL 4FQXC 2OZ4A 3AGVA 3HC0A 3MCLH 3TNMA 1WUNT 1E27B 3MLYH 3MRMA 4RA3A 1OOAA 2N1KA 4ZPTB 4DZBA 3TF7C 2VZ3A 4XBGA 3V7AG 5J11C 4I18A 2E27L 4L4JA 1EFXD 2CK0L 4JRXA 3MYZA 5C0CB 5TE7H 3V6OE 4BFIA 5H2BA 1QBML 1YECH 3L9RA 4KZDL 3QFJE 2QQLH 5BZDB 1JTOA 2GYSA 4PUBH 3OF6A 3T77A 4XBPA 1UXWB 1SYVA 4MXQC 3RGVA 4D0DA 4GBXC 4G8GB 4N0UA 3Q1SH 3DSNA 4R8WH 2WBKA 3DVGA 3V0VB 3H6JA 1TLKA 4HH9A 2LVCA 3DROA 2HTLD 4M1GH 5HDBE 4DVRH 1JNHA 5EBMA 3PWLA 1CE1L 4XHJD 4MNGB 4Q9CA 1A7QL 1XAUA 2Z31B 4G8FB 2I60H 1QFUH 5KVFL 2RIKA 5CSZB 5DUBB 1A6VH 4JZNB 3VWKB 1KPRA 1J5OH 2GJ6D 3SDDB 1JF5A 4GRWH 3RP1A 2H3NB 5I30L 2XWBB 1U8MB 3QDJA 4LCIH 3TM6A 2W65B 3HZMA 2Z93A 4OZGA 5D5MA 2OBGA 3CFKB 3SE3A 4JQXC 2CLZB 1IC4H 1KCUH 2ERJC 4YBHA 3VGHA 2G75A 3MRPB 4CVZA 3MLUL 1BGXL 2FJFA 5KS9B 5ESQA 5EU6B 2PKDA 1G0YR 3MLYL 4OTXH 4W68A 4QRSB 3EYQC 5ESAB 1FGVL 4JJ5B 1U8LA 2P5EE 3OKKB 1G1CA 3GMOB 3WNNA 4RISL 3L6FB 1LK2B 5F6HI 4Z7OE 4QWWD 4H1LA 3VH8B 3CFBA 2HT3D 4ODUB 5DMKA 5IFHH 1H3PL 4O4YH 3LS5H 5FYKD 2APXA 1OPGH 4IRZH 3D0VB 2ADFH 1JRHH 3GEWB 5JLZB 3I3BA 3BH9B 4R0LB 1VERA 2OJEA 3QO0A 5DLML 3Q1SL 3WKML 1BD2D 4R8WL 5EZJA 4PV8B 1OTUC 2DWDA 2HFGH 5I1HH 4DVRL 3MOAH 4TOYH 3PWJA 2ZUSA 4GOSA 1MI5D 3SKUD 4FQ1L 1A6AA 1R3KB 1OD9A 3W9DA 3VWJD 4OCWH 3HUJA 3QIWD 5KVDH 4L1DA 3SDYH 1T5WB 3GM0A 3MJGX 1YEGH 4JPWH 3PDGA 1RI8A 4HGMA 4UIMB 5D1QB 3X11A 3MRCB 5BS0D 4FQPA 3MRLB 4QTHB 4PREA 1YQ2A 2DTMH 15C8H 3GSQA 3QUMA 2X89D 3UTTA 3F6LA 1IC4L 5BV7B 3U7WH 3D25B 4EUPH 3G5VB 2LE9A 3MGTA 3DARA 3PL6B 3TFKC 4PGEB 5IQ9A 4OTXL 2GEEA 3B2UD 2W60B 3FN0H 1JHKH 4LARH 5J56B 5D71H 1BFTA 1T1ZB 1C16A 1RULH 3GKWL 5KG9A 1EJOL 3MV8E 3MRIA 3CVHL 3WN5B 1KB5L 3LD8B 1A0QL 1JNLH 5C9JB 1XF3B 2X4UA 1EEZB 3EGSA 1QHOA 1HHKA 2HKFH 4O4YL 4IRZL 1R5VB 2ADFL 2P44B 2ZUWA 3FTGB 3KNBB 1PG7X 2DIJA 3IDUA 1JL8A 2RR3A 3RWFB 4QHLB 3RRQA 5L9DL 1AJ7L 3O6LH 5ISZD 4NCC2 1QFWH 4QRRB 4ZD3L 1SJXA 4I9WE 4PFEA 5F7DB 2NY4B 1WWBX 2A6DA 4A6YA 1F3JB 1J0YA 1NKRA 3MSPA 3TJHD 1U8OA 1YEFH 4UILL 3MOAL 2LVEA 4K07A 4TOYL 2FJHB 2VZUA 3RWDA 4WFFD 1MAJA 1P7KA 4TULH 4OCWL 1NMAL 5C0BA 3ZE1E 3GSNB 4QXTB 3QQ4B 2W92A 3B5HA 4X6DA 1NGXB 4P4KD 5CP7A 4NC2B 4UNTA 1T1WA 4JPWL 2A1WL 3K7UA 1CG9B 4YWGH 3MA7A 4LAJH 3V5KA 2X4NA 3WXWL 4ODSH 4HD9A 3EW3B 4HIHB 2DTML 5DMJB 4TSBL 1QFOA 5DD6B 5D6DC 5D70L 2XZAL 1S78C 2JJSC 4QOKA 3FRUB 3BGMB 1TJIH 2HKHH 5HDBF 4B5EA 1ETZB 2X5PA 3EO0A 4N0RA 5HGAB 3ILPA 1PD6A 3D85B 4HW6A 1YEDB 1R3HB 3DECA 4IRJB 4OZFB 3OXSB 5F9JB 3GJEA 4PRNA 4KH2A 5CAYB 2OMBA 4PLOB 2PW1B 1JF1A 2EDJA 3FN0L 1IBGH 2EXWD 1N2RB 1Z9OA 1RULL 4PJ9D 3R8QA 1WV7T 2BX5A 2ZUQC 4IS6B 2YRZA 1LP9E 2R2CA 3RJQB 3FO2A 4HIJB 2I07B 2K7PA 3NFPB 1CU4H 2F19H 4JB9L 5AG8A 5J1AB 3HPLA 2HKFL 3IDXH 2D9QB 4R2GB 5GSVA 3MFGB 3W0WE 1MWAL 3TBWA 1JYWA 2XQYG 3B9DA 3DUSB 3F62A 4B53A 1EUTA 2WWKT 4Q9RL 3O6LL 1G7QA 1QFWL 2DQFA 4FXGA 1I3VA 4PJBE 5ENWB 4W81A 5C2BH 1EEYB 5CILL 5HHNA 1EJ6A 2Q6WA 5MEPA 2EEBA 4XNYL 4HC1H 2BNRD 5CCKH 1CGTA 5F88A 3OHXB 4X6BA 5KTEH 4M7LT 4Z7VA 4TULL 4Z7OF 5C09E 4M5ZH 3NCFB 2DOCA 4JFHD 5DJYB 5IVXB 4U2YA 4NCC1 3AU1A 4MD0B 4KXZH 3ZE0E 2CDEA 4U2ZA 4KU1A 4FP8L 4P2RD 1NANI 4RBPK 3S8WA 1YEEH 4OV5B 2XWTB 5CJQH 1TJIL 4OIBA 1DE4A 2VQ1A 5GGUA 1YYLL 2YPLB 4HXBH 4X4YA 1Z5LA 2I9LA 1DUYA 4YDLB 5HI5C 1J8HE 5MENA 3L5WB 4IIQC 1IBGL 4MAYC 3GMMB 1QR1B 1FL3A 1UYWL 5BZWB 3OKLA 1M71B 4C56A 3VD9A 1MJUL 4Q7DA 3G6AA 3MACL 1E28A 2E7CA 4LCWD 5I1DA 3IDXL 43C9A 3OZ9H 3E2HC 2VKWA 4L8BB 1I8MB 3IU4H 1A02N 4Y5VA 4M61A 5IM7B 4MDJB 2O61A 1K4DA 4PD4J 4YR6B 2G60L 3BZ4A 5CCKL 4AH2B 2EH7H 5IFJA 3I02A 5D7IE 4XP1L 1I1AB 2YXFA 4NUGH 4M5ZL 3TVMC 3UTSA 2N7BA 2FX9H 3CUPA 1R0AH 4NQSB 1ZA6A 3VA2C 3SE8H 3K74B 1T2QL 3PDOB 4X5WB 4NO5B 4YHKH 3NA4A 4P0DA 3LMJH 4FFVD 3BZEA 3AXLB 2WUBH 5I8EA 5IR1B 1DBAH 1YEEL 5JW3H 3F7VB 1XT5A 5CJQL 1NJ9B 4CN4A 3HAEA 3BD3A 2B4CC 3HC3L 2JIXD 4HXBL 5E7FA 4OCYH 3WD5H 2WBJB 3H9SE 3S37X 1BFOB 1GGUA 3QWOB 5IW3A 3DHMA 4Z77B 1KPUB 5IVOA 3ZE1F 3VGEA 3LN9A 1XGUA 1CD8A 5E00B 5CSBA 2Y9RT 1FAIL 4M5YH 1D9KD 1U91A 2AQ1A 4CU6A 1HQ4B 1U8NA 4DN4H 4QXUH 4TVPL 3PV7A 3V0WL 3OZ9L 3SO5A 4MAUH 1DQDH 2DM3A 1WITA 3BN3B 1YN6A 1QRNB 4KJYA 1V8HA 1ULVA 3WHXB 1AD0B 1BQHG 1CTNA 1YN7A 2AP2A 1JWMA 3OKNB 3N1FC 4CU8A 1EO7A 4RGMC 4DKFL 3BUYA 1P7QD 3LQZB 4PGDB 1A6UL 3PQYE 3MOBL 1OGAA 3PP3K 4PP1C 1FH5L 4P59H 1CXLA 3UROR 3KPOA 1LP9F 3MFFB 3IGAB 4WWKC 4QTIH 5A2JH 1I9IL 1JYXA 4R7DA 5D7JB 4WI7A 4CJ1A 1C5BH 4NN6C 1S7QA 3C5ZA 1S7WA 3EJZD 3QDJD 2FBOJ 4L4TB 1Q0YH 5IQ7L 4X9IA 4ODVH 5F1SA 4KKAC 1R0AL 4UDTA 3U4AA 5DFWH 2LQRA 1I7ZA 4X6EB 3TBVA 3J7HA 5INDB 2A6JA 3WLBA 1UH4A 3DTXA 4EBQH 4PJBF 3MODH 3LMJL 1CGVA 3WMSA 5L8KB 1R5IA 2WUBL 4M00A 1KJVB 5F3HB 2QQNH 4U7SA 5DRNB 2HG5B 5E4EC 1RVFH 2W9LA 4OLUH 4YBQD 1AIFA 3DIFA 3QZWG 4IRSC 4X9FA 2VWEE 3HE6B 3WFEL 1KLGB 3MXWH 4XXCC 4U1GB 1WWAX 4FQXA 5BRZA 3CVHA 3QEHA 4KI5F 1O7VA 3GSVA 3ZE0F 4OZHA 1HNGA 2LTQC 2HJKA 1ES0A 4KGLA 1WBXA 2CIIB 3VW3H 5DXWA 2Q76A 2X7LB 3CH1A 3SGDH 4ZNCD 4NO2B 1IGFH 2HJLA 2VLJB 2Z92B 1NCAH 2AJXH 3VXUB 1QTYT 4GRMA 2R1XB 1ORQA 1R6VA 3BPLB 4PLKC 2FGZA 3I9GL 2BNQE 3L5XH 2PO6B 2QTEA 1IL1A 4G42B 3K4DA 4XNXL 5DO2C 4GBXA 1CXIA 2BOCA 4NM8H 5B4MC 4P59L 1N5AA 2VZSA 3GFUA 1OAXH 1J9CT 1N64L 2X4OB 2GJ6E 1RHHA 1DJSA 1S7RB 3RL1B 4K8RD 2GSGA 5JW4R 3REVB 3MZGB 3E8UL 3MJ9L 4OAWA 4N5ED 4QHMA 1JNNH 3UJIH 4LHUD 2RAMA 1D5ZA 3ULSA 1C5BL 1PKQA 4MNQD 3S9DB 1Q0YL 4HT1L 5I19L 5C0DB 3MRGB 3G5XA 3ULUD 4ZUWA 5HYSB 2UV3A 1KXVC 4PTTA 3VRLE 1ED3A 1YPZA 3NOIA 4FQHB 3IDGB 4PP2B 1HEZA 4PRPB 1NBVL 3STZA 5E2TL 5LAXA 5DD3H 2QQNL 3CFDB 3DYPA 4GG8A 2NX5B 1T0NB 4OLUL 6FABL 3G5ZB 5D7IF 4FABH 3RWHA 4RAUB 4WVRA 4Q6IC 5JDSB 4MXVE 4JQXA 4LSUL 2HMID 1IE5A 5J6HA 3BD4A 1MCQA 5A43C 3SDXA 1KIQA 3FT2A 4Z7QE 2B4CL 5FYKE 4M7JL 1XF2B 1I9JH 1BBJB 4P57A 4YH6A 2ZP0T 1MWAA 4K9EC 1MCFA 1B88A 1MEXH 2D9CA 3PHOA 3P11L 1BD2E 1BLNB 2L0DA 1TZIB 4YQXL 5GZOD 3QEGH 2MHAA 1NCAL 5F1NA 1VKXA 4NO0B 1RMFH 1OGTA 4LIQL 1MI5E 3UTOA 2C1OA 3UJJH 3UZQA 3L3IA 3TJEL 4G6AD 3GJFH 3EFFB 5HI3C 3BRDA 1XZ0B 3C8KA 2NY1D 5DJZA 1BQUA 4PJDA 5JHLL 5DURD 2VLRA 1SJHA 1J1XL 4BQ6A 3FFCE 5BS0E 4DCQB 1GGBL 4UDUB 3GI9H 4HDIA 3UJIL 1X5FA 2NW2B 1Y6KR 2UWEB 3QFJB 2QHLA 4J3OC 4EI6A 5EUKA 3VJ6A 2IQAB 2P42B 1D6VH 1KCSH 1YMMD 2MQCA 4I4WB 5B39A 2DL2A 5KSBE 5DD3L 3QCTH 4GAGH 4Y8AA 3QIBB 2A9NL 4MD5B 1JI1A 1A3RH 3VGBA 4S1RL 4YHZL 4XMPL 3MQIA 2VAAB 3IJHA 3CLFH 5ICZA 4ZUTA 2X40A 3O6MH 3UX9B 1AQDB 5LGJB 1HKFA 2CDFA 4OLYL 4BKLA 3BP5B 5IGXL 1Z0NA 5CJ5A 2VMFA 4NT6A 3VMPA 1U36A 2CDGB 4ZQKB 1RJLB 3LSOB 5ID0B 3BN9D 4GSDL 1FVEA 2EDEA 4FA8A 4ZXBB 4JO4L 5L88H 3TPUB 3OWEA 3SDAC 2X10A 4LKXB 1HYSC 3SPVB 4L9LC 3QEGL 5TDPB 3PWUB 1CFQB 5JUEH 4P5KA 1IM3B 3T2NH 5K9JH 3LDBB 3NH7H 4CDGC 1FNFA 2GY5A 3QH3A 4WFFE 1MCWM 2IFFL 3MJ6A 4PIRF 3PNWA 3UJJL 1OSZA 3P9LA 5DYOB 3SQOH 2P5EB 3ZDYE 3RFZC 2UZYB 4LSSH 5B38A 4NZUH 3EYVA 3W2DH 1OP3H 4ESKA 3D2UD 4DVBB 1I7UB 4UQ2B 1HOCB 3VFGH 4G6JH 1R5WA 3HN3A 2IAMD 3GI9L 1UFUA 4L4VD 3PABA 5J0BA 1UXSB 2DTSA 4KRPB 2XG4A 3RWIA 1DBML 1G1YA 2EDOA 2C3XA 2DL9A 2PXYC 1D6VL 4HWUA 3STLA 4ZFFB 1KCSL 4KMTH 5T1KB 3CD4A 2VXSL 5FYJU 3QA3B 4EOWH 2VJXA 4MCYA 4KWUA 3S98A 5T3ZH 3QCTL 5D6DA 2JJSA 4HK3J 3VG0H 1S7UA 1NL0L 5FDWA 3RZCC 4LVEA 2F53A 1NC4D 3O6ML 5IKCB 4EIGB 1JHTB 1QG3A 5EWIH 3QJFA 5K33A 1AO7A 3CH8A 2OL3B 1RZKH 3VRLF 4JRWA 1IKFH 1MJ8L 1QNZH 2W38A 3MA9H 5L88L 4XP9L 4MQSB 1J05B 5CLWA 5JOFB 4G3YH 1ND0B 2AW2A 2BVOB 3KPLA 5TE6H 5IVNA 2GITB 3S96A 3T2NL 4LEOB 3NH7L 5JW4N 3HNSL 1Q9WA 2NZ9C 5IF0B 2GJZB 5I66B 5DT1H 2VLMD