3U9PH

Crystal structure of murine siderocalin in complex with an fab fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
184
Chain Sequence
EVKLQESLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGQGLEWMGGIWGDGRTDYNSALKSRLSISRDTSKSQVFLKMNSTDDTAIYFCTRCRRDSSYVVDAWGQGASVTVSSAKTTPKLVYPLAPVTLGCLVKGYFPEPVTVTWNSHTFPAVLQSGLYTLTSSVTVTCNVAHPASSTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Neutrophil gelatinase-associated lipocalin
total genus 28
structure length 184
sequence length 213
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9pH01
2AK4D 4YZFF 5DEFA 5JQHC 2FHBA 3FO2B 4QHNA 3SPVA 4Y5XC 3L9RB 2DQUH 3VXSA 5JIIA 5IBTL 2PW2A 3VFTA 3WFDL 1U8OB 2ORBH 4PRPE 3CGTA 2BOBB 5F7EL 4M1CC 2ZP0T 2HTLD 3DROB 5GS1A 1Q9LA 3QDGA 4ODSH 4RIRB 5DK2A 5I8OL 2WBWB 4ZYKB 2DRUA 2EZ0C 5GZNC 1LE5A 4FXKA 1BX2A 1XIWB 2W38A 3V4UL 1BZ7B 5GS1B 2B4CH 4KI5F 1OD9A 5KW9H 4UT7L 1CFQB 1PY9A 5C0NC 5I30L 5TF1H 4P4RB 3VH8G 3AREA 4WV1A 5BXFB 1GHFH 1U91B 3IXTB 5I74C 3GJFK 4G8EB 4KRPD 5IQ7H 2DJ4A 5F7HA 1LDSA 2AJXL 1CDHA 1KULA 1AIFB 3MA9H 5I1EH 3T1FB 1N64L 4G42B 4PJAE 3NIGF 3D25A 4JRYD 4P3WA 3X11A 1BVLB 4P3DB 4QHMA 4LIQH 3DX8B 3TN0D 5IHLB 1VFBB 4OFIA 3UYOD 1XEDA 2IAMC 4CMMB 4FFZL 5IG7B 3MODL 5C0GB 1U2HA 4GKNB 2DYPB 2VZSA 4C55A 1YEDA 3IVKA 1NGWA 1RIHH 1S5HA 5C0GA 4WGVB 1A0QL 4FQLL 5D93B 4OAWA 3RUGF 1FZMA 5ESQA 1QG3A 4KKAD 1MHPL 1SJHB 5D7IA 4RFNC 3H9ZA 1T04A 1NKRA 2WLZA 2FB4L 1H0DA 2BVPA 3CMOH 4U1MA 4YXKL 4J12A 5DUPH 3T65A 2GHWB 1CF8H 3UZQA 1TQCC 4KDVA 4XZUB 1FZMB 1F11A 3UTTD 3BGAA 4JY4A 4R4BA 1FIGH 1HHIA 4DVRH 2VLKD 3MV8B 1DQJA 4ZTOH 4ZUTB 5IHZB 1SBSH 5TFSL 4QHLB 2CMRL 4LRNL 3IF1A 1CIDA 2HMID 3IFNH 5TE7H 2R0LH 4MJ6A 3FQNB 5GGTL 1R5VA 3L3OA 3JWOC 4JZJB 1F6LL 1MIMH 3QUXA 1J8KA 5ETUA 3GSRB 2EIZA 3MV9B 5I17B 2LQRA 3PABA 4NKOB 4MLIA 5ELIA 1QD0A 1ZTXH 3DSFH 3KPMA 43C9B 1VKXA 4CN6A 2Y36H 3LH2H 1LWRA 2FEDD 4QY8B 2HG5B 3WN5A 5TE6L 4AK1A 5GXBB 3N0PB 3CSGA 1XF1A 3MNWB 5ISZE 4HIEA 5HI4D 1DTUA 1SMOA 3BPNB 3O8XD 4LKCB 4FQLH 4PBXA 4BK5A 3CC5B 4QNPE 2VB5A 4LSPH 5C0IB 2AQ3A 4N0YL 5CINH 1X6LA 5E8OA 3THMH 2VE6B 2OX5A 2BRQA 3MSPA 3X3GH 1INEH 4HUVB 1TZIA 3P30H 1T66C 3HC3H 4YHLL 2XXCB 1QNZL 5DD0L 2X7LA 4JCMA 1QFWI 1S9WA 4R2GD 5DUML 3OB8A 4OZIF 5IB2A 3B2VL 1P7KB 5BQ7B 5HGDA 1NUFA 4XX1E 5HVGB 5SX5H 4JFHE 5CEZH 4MQ7B 5D1QC 4RAVB 5MENB 2FO4B 2VDNL 3RX8A 2ZOLB 1I4FB 1KYOJ 5I1HH 2VN4A 1D7FA 1EGJL 5FYLE 2F54B 4KTDH 1QVOB 5F7UA 3KPQA 4L4VE 3ARED 4W68A 2JJWA 3TYFA 1KTLB 3A6BH 1LEGA 5HHMD 4BZ2L 3KXFE 3QO1A 3DBXA 1XGTB 3RY6C 4I8DA 5K93A 3B9KD 3BVNA 1F6FB 4FFVD 4CAGA 1S3KH 3U1SH 2I5YH 1X5YA 5CLWA 3T4YB 5GRXG 4KU1A 2P42B 3AROA 4Z78A 5CBAB 1INEL 2V5SA 3DBXB 2FR4B 1RY7B 2ICCA 3SCMB 3H9HB 5C0CB 2VLLB 4H1LH 3RNQA 1YEHL 1NLBH 3T4YA 1CGUA 1ZV5A 3C2SA 4OD3L 4QCIB 2Q87A 3PE9A 3BPCA 1CK0L 2EH8L 1D5XA 4HKBB 3IYLW 3WIHA 1OPGH 4CL7A 4V1DB 1HHKA 1U2CA 3Q2CA 4NPYB 3NA9L 1HSAA 2BDNH 5IT2L 3X3GL 3HPLA 1FG2A 4JO3H 2I60L 3GJEB 4P5MB 3QFDA 5CILH 1BP3B 5JXAL 4MQ7A 1F00I 4XVTH 5DJ0A 3UBXB 3V6OE 4X6FB 3MV01 4FXLA 5T3ZL 5KBNC 5INDA 2EXWD 1YDPA 4GRWE 4EUPA 3DETD 3DRQA 1RZFH 3K3QA 3H3PL 1FPTH 4LARH 4FXGA 4HLZH 4HIXH 4M6NH 3OJMB 3QI9A 4J8RA 1AO7D 1FJ1B 5GGQL 4JRWA 1Q1JL 4NHUA 4HPYH 1F58H 3O3BB 3BKML 4B7LA 2GUOA 1AXSA 1KCRH 5DJYA 5DD1L 2VDQH 4NZTL 4CVZB 4GLRI 3ULVL 3F62A 1GVIA 3IDNA 5GS0L 4YHNB 5BZWB 1W0YT 2NY1C 3P11H 3SHSA 5IFHL 1T7YA 4MWFB 1GGBL 2ATPA 2SEBB 1KB9K 5I8CA 1FG2B 1D5MA 1R3JB 5HGGS 2IPKA 5DMIH 5B8CA 4LSRL 4NNXA 4MXWL 4X6CE 5C09D 1TETL 1P2CA 3LS5L 4KRLB 4IEFB 5ICZB 2MCPH 2NY0C 1MFBH 1OARL 3QUMH 1XCTB 1IGFH 2ID5A 3OG6B 1T22A 9CGTA 3TP4A 4QRRB 5TE6H 15C8L 1P2CB 2H1PH 3RVVD 5CP7A 1QFOA 5I74B 5J12B 5JHLL 5T3XE 1GZQB 4ORGB 3FMGL 2J7LA 2DIAA 3H9HA 4M93C 4JANA 5C0CA 5CD5D 5DQ9A 4KDTA 2ITDB 1UXSB 5IVXF 4NRZA 3MUZ1 1BD2B 5FUOL 2ZPKH 1O7SA 2OL3B 4QXTA 3TBVB 1P69B 5IKCB 3L1OL 3SQBA 1A6VL 4GRLD 1AXTH 3KPLA 1KJVB 3BESR 4JM4L 3RWIA 4CUCA 4ZNEE 1UZ6F 2WP3O 3IRZA 4UAOB 5BO1H 3H3PH 1K5NB 4S2SA 3SKJH 4IOFD 2IBGA 1E27B 4OM0H 1VHPA 5D6DA 3BT2L 1LE9B 1T2JA 1IEHA 1RFDH 1WEJH 4U1LA 3T0EE 3O4LE 3P0GB 4WCYH 4LK4A 3AB0C 1WIOA 2YZ1A 2IADB 4CMHB 3VRIA 4LVOC 2ZCKH 3KJ6L 4P4RA 5DSCB 1WGOA 4H0IA 2DTML 3IJHA 4NKMB 1RUAL 5BCAA 4XC1L 4IBLT 1W8OA 2A2QT 3OSKA 1S7VB 1QSEE 3CFJB 4XT1C 3MLXL 3U0PB 5JPNA 4PJEE 3RFZC 2K9UA 2VABB 4XC3L 2VDML 1JWMB 3MOBH 3PHQA 2CJUL 4I0PA 3BZ4B 3O0RH 3IJHB 5I0DA 1I1AD 3PP4H 2FRGP 4JLRA 1QKZL 1GXEA 2FGZA 3RWDA 5JPNB 4KKCD 3AXLA 3VFWB 1ZLWH 3CZFA 3RRQA 4K3DH 5DDHA 1HH6B 2P8MA 2CK2A 5FGSA 4XPBH 1OWWA 1HQ4B 1OAZL 3DV4A 5L9DL 2V2WA 2VDRH 4HF5H 2Z8WC 3CK0H 4JGJA 5E7BA 5HHPA 2X44D 5MEPA 1WQVT 1FBIL 5H94B 2GK0A 2AJ3A 5HDOA 4JB9L 4EN3C 1D9KC 4RZCB 1FFOA 2XWTA 3H8NA 2APTA 1OP9A 1AD0A 1YNLL 1IL1A 4P3CL 4JY5L 4PLNC 4YHPB 4PGCB 4NDMB 5C0BB 1A9EA 5CEXB 4L5FH 3EO9L 3V7AG 1BVKA 3PGCA 2NXYD 2IANE 3CDFA 1D6EB 1A9EB 5CEXA 3RIFK 4TTGA 2X1OA 4PJHA 3KLSA 4HMCA 5CSZA 3B4NA 1MJJA 1K4CA 4K55A 4DQOH 1DUYB 3QEQD 3LVEA 5J13B 5L6YH 3HZYA 3WUZA 5TDPA 3QHFL 3H42L 4UDTA 4OZIE 1VFOA 1NAKH 3QB7C 4AM0A 1A21A 1R3KA 4I13B 1VGEL 2R1WB 4M7KL 2EDQA 4GKSB 1DBKL 2YPVH 2NY0D 4GRLA 1NSNH 1BAFH 4Q9CA 1XZ0A 2KDGA 4GO6B 1MOEA 3I84A 2AJVL 2YEZA 2R0ZL 4MDIA 5J11B 1ZWIB 3ARDC 1C5CL 5F7DA 3WN5B 5FV2A 2ILLA 1FAIH 4JM2D 4Y1AA 3A67H 4I77L 4D9LL 3I2CL 3UO1L 1G0YR 1MF2H 3S4SA 2WIIB 5ALCH 4PY7B 3ES6B 3JV0A 3P0VL 1JVKA 5EU7E 4TRPL 1Q0YH 1ZGLA 4JFYB 4JKLA 5L7XH 5JPMA 4Y5YB 4U6TA 2Y23A 3KR3L 3H9SB 1GOHA 5DRWA 1GJIA 3C5ZD 3FQXA 5FYJL 3D85D 5TE4L 4R6UA 5ESVA 1MI5E 4WHTA 3T65B 1GOFA 4NO0B 4NNPL 4XPGH 3GSOA 2QQNL 5EO1A 3MV9D 5E99H 1TPXC 1AGEA 5E8PB 3DETC 3N9GH 1P84K 3CUPA 2VLLA 2C1OA 5LJYH 4H0GA 2FO1A 1TITA 3M17A 2O61A 1GC1H 1RURH 4KC3B 1VEOA 2R56H 1UENA 4JRXA 1R5VB 3L3OB 4F8TA 4OGXL 5AZ2L 3EOTL 4PP2B 4X8JB 2ZOKB 4YXLH 4FZ8L 2YKLL 3BEWA 5IBUB 1F3RB 3DGGA 2HT3C 1J0YA 3FB8A 3L7FB 4JGUA 1XGTA 4J3SA 3SDAD 2O61B 2OK0H 2LFGA 4EI5D 5DC0A 2ITCB 3L3HB 3SO5A 5ALBL 4WFHE 2NW3B 4OB5L 1SM3H 2MFNA 3MCG1 5ID0B 1ITBB 2C7UA 3GUTA 1TCMA 2R69H 3UAJD 4Y5YC 4R2GB 1KXVC 4BFEA 3ROLB 2OL3L 4YLQT 4Z77A 4U6HB 3SCMA 4BH8B 4NHCH 3DVIA 4U7KA 1H9VA 3DXAA 3AS3A 5CJ5A 1EMTH 2B39A 1E4XH 4Y19A 4NNPH 1J0JA 1HSBA 5EU3A 3HI5L 2IAND 5IQ7L 2DOCA 1S7WB 1S9WB 5CJBA 1N8ZA 1JF5A 1OB1A 1HEZA 2VAAB 3T0WA 3TH4T 1AD9A 4JQIL 1EFQA 4UQ2B 1HQRB 1PEZA 1E6JH 1Q9WA 1ZS8A 3NGBC 5DJCA 5DJYB 1X44A 1HKLH 3MZGB 3ZYOA 2BSRA 3PWNA 3RGVD 1QHPA 4HKXB 5IBUG 1HOCA 1MRFL 1BM3L 1T7XA 3DNKA 3KYKL 4M7LL 4P5KB 4U1HB 2VAJA 5HDQH 4O5LH 4LLAA 4G6KH 1DBML 5D5MB 4N90E 3P9MB 3ULUD 1DE4B 2V7NB 4TPRH 4PJ7F 5DHYA 5INDB 1GHFL 4N5UA 2FHCA 3IGAB 2PXYC 3R8BB 5HVWA 3FMGH 3PABB 5D2LF 3HZMA 3STLB 1VEMA 1MY7A 1EJOH 2NX5D 5EBGA 4M5ZL 3VD5A 1XGRB 3BEVB 2E6JA 4CADB 4FZEL 2V2TA 2DQCH 1MCBA 2F58L 5JDSA 3HZMB 3CSBA 1LNUA 4XB7A 2GTZB 3CXDH 1ODAA 1JNJA 1W72B 2YA0A 2IFGA 3EO9H 3TT1L 2EDHA 3OR6A 1OCWH 2VZVA 5E5MA 4PS4H 3BQUB 3RKDC 3RPIA 4YEFA 1UQSB 3ECBB 4N68A 1DBJH 5GRJH 3VXUB 3WHE1 2WWMC 4MCYA 2HG5A 3E3QE 4D9QD 2HA1A 4HJGB 5HI4C 5KSAD 3S8WA 2X9XA 4XNUL 2BY3A 3RGHA 1BIIA 3RZCA 1D9KB 4KKLD 2HKFH 2UVEA 1BFOB 1CG9A 3BZFB 4P23D 1RQ5A 5C9JB 4HJGA 2XA3A 5ITBL 5IKCA 4MCYB 3P4MB 3QISA 1OT1A 2B5IC 3RY5A 5DVLA 2R23A 3GMQB 5HHQA 4IOFC 3EKCA 1JZ8A 1B0GB 4ZFOL 2HMIC 1CG9B 1T83A 1WIPA 3NCJL 1YA5A 5CGYD 2R0LL 3JV6B 5SX4I 4XXDA 4GMTL 4NN5C 2ENYA 5DJDB 3ZKND 3NH7H 2X4PB 4AIZB 4C83B 3C8DA 4Z7UA 3VD9A 4YPGB 2J8UE 4XAWH 1IC4H 1JHKH 3QUMB 4IOSD 3IAQA 5CD5C 5GGSY 3PGFL 5FFLA 2C3VB 4KKAC 3QUXD 4OD2B 3QULA 4Y2OA 3QQ3A 4PGJA 4GKOA 1RUQH 2DQGL 3DX9A 2N56A 5A3IC 4F15B 4CDHA 2G9HA 2PCPA 4OUUA 3V7AE 4JJ5B 3WLBB 1UFUA 3O0RL 3O3DA 3R1GL 5CIPB 4K7PL 4CVWA 5FECA 1P7KA 5BQ7A 5LCVL 3HAEA 4NO3B 1SBSL 5TFSH 2N7BA 4JJ5A 4C56A 4OUUB 4ZO8A 5LG1A 3MRCA 1GAFL 1CICB 5D2LE 3RKPA 4MB5A 2VIRB 1EO8H 3VXOA 4KV5E 4XPAH 4AJ0A 4B50A 3DI3B 3C60B 5EIQA 3IDJA 1PZ5B 4JFEE 3U4BL 4F33A 2Z31A 5D2NC 4OGZA 1I85A 1QSFB 5DWUH 3MLRL 4GQ9H 4Y5VC 1INQA 1DQQB 1MWAA 3DX6B 4BZYA 3EYSH 4U6XA 1WVZA 1MWAL 3WN5C 1L6ZA 2CLZB 4XP6L 1G9NL 3O3EB 1M7DB 2NX5E 4WJ5B 2XT1B 2R2EB 1GC1C 5C08D 3S37H 3LKSB 2PCPB 2P44B 1T5XB 3N1FC 3QXAA 4FNLL 2BC4B 4M62L 4NQEB 5I2IB 3QAZC 3DX7A 1J8HD 1TJHL 1S9XB 3UYRH 4G9FB 4JRYE 1SEBB 1GGYA 4HJJH 2YBRA 2CXKA 3P3YA 3SE3C 1WFNA 3LN9A 1S9VB 2A6DA 3GIZH 4DEPB 1D5XB 3V5KB 4OCNC 3GMMA 3B9KB 1D5ZB 2Q8BL 2OQJB 1PY4A 1L9NA 15C8H 1OAKH 2H1PL 4X0KB 4YDKL 4QXTB 3DO3A 1K3ZA 4RISL 2EDTA 3NZ8B 4H8WL 4DGIH 4NJAH 4XVSL 4JR9H 1P4LA 4GJTB 1UCBL 3O9WA 4NDMA 4O58H 4QT5A 5JOFA 4D0DA 1XGQA 3I6LE 5BRZE 3V4VL 5IEHA 1TVDA 1IC1A 3TPUB 3ZKXB 2FD6H 4PB9H 1PKQE 3KYKH 3U83A 2VITB 5B38G 4K3JL 5SWZE 2ZCLH 2VUOA 5K59E 3DRTA 1PSKL 2X2YA 4LPYA 3H0TB 4XXCC 2NY5L 2MKWA 4WI6A 1Q9OB 5EZIL 4F9PC 2APWA 2ADGB 1H3TA 1KELL 1AE6L 1NEZG 5DD6A 3OAUL 4M4PA 2HLFC 3PWUA 1IEAA 3WIIH 4YR6A 3BUYA 3LN4A 4N9OB 3NZHL 2XZCL 4LLQA 1DZBA 4FFVC 3QWOB 2VXUL 5TF0A 5DDHB 5ICXA 4JDZA 3QIUD 5JNYA 2OZ4A 2ARJQ 1PLGH 5FO8B 4POUB 2NTSP 4M6OL 1ZHKB 1JGUL 1PW3A 1I3GL 2IPUK 4YHKH 4QHKI 5L2JB 3OAYH 3OR7A 1UT9A 2XQBH 4GLRH 2A6JB 2XOTA 1FORH 3DMMA 4XP4H 4Z7UE 3RJQB 2MOVA 4AENA 1ORQB 1OQXA 1RVFH 1JFQL 5D1QA 2NY6B 2HWZL 1G7JB 1ZA3B 4UDTB 3GSQB 1MIEH 2UZIL 4FTVE 3SE8L 2A6JA 4Z7WB 1U3HD 1FNLA 4UNTA 3EYUL 2VLJA 4PR5B 4DWHA 4R2GC 4EXPX 4Y19E 1N3NA 1AC6A 4P46B 3Q48A 4X7CC 4LLUB 4JFEB 4JFPB 1G9ML 2X1WL 2DQUL 2DN7A 1AGBB 4LHUB 5SWSE 3C9NB 3WD5L 3WUWA 5ESAB 1UVQA 2CK0H 3VG9B 5TDNA 4DKEH 3V6ZA 2ITCA 1DQDH 2R4SH 2D4DA 4OV5B 3O8XC 1VEPA 1C8PA 4W4OA 3MRKA 3AC0A 4P2QD 4ZAKA 4WFGD 1NCCL 2FEDC 4ODVL 2ZUXA 3QPQC 2MNUA 4J3XA 3QG7L 5MHSD 2HRLA 3LKQA 4Z5RA 4K94L 5C7XH 3TFKC 1A6TA 4WHYH 3FFDA 4HMDA 1S3KL 2EO9A 4BFIA 3RDTA 3QDME 4PJDE 4LLDB 1QRNE 1NBVH 1QR1B 2VZ1A 3GNMH 4NRZB 5KOMC 2B7DT 3HMXL 5FM5O 3LKQB 2P49B 1YPZA 4LVEA 3RDTC 5CUSL 4RGOL 2Q8AL 1BGXL 1MQKL 1E6JL 3QNXB 3H9SD 3FKUS 2X09A 2R4RH 4OLYH 3QUML 4CJ0A 3KG5A 4CU6A 3W11D 4E5XA 4MMXC 2JB5L 4I4WB 4O2EB 4NYLA 1S7XA 2FL5B 4L4VB 4JN2A 3T3MF 5F1IA 2DWDB 3CDGA 2IAMA 3FZUC 1ZANL 4JREB 5J11C 1MCPH 2Z92A 3FJTA 5DJ6A 2E8ZA 3QDHA 3WSQL 4L9LA 5M7QA 1K6QL 1QA9B 4P2OC 1AIFA 2UWEA 1JPTH 3C5JA 4F7MA 4KTYA 2OSLA 2H8PA 4GRWB 1BBDL 1DANT 4PJIF 5FHBL 3L3JB 4LSSH 3TN0C 1D5BA 4TUJB 3U46B 1B6DA 5B21A 3JWOH 3BHBB 1QFWH 5C6TL 4W70A 5IVNA 6FABH 1IM3B 3WFCL 3MLPA 1ADQH 4OD1L 3QFJE 4LRNH 4YXHL 4PY7A 1RZJC 2I26N 2JELH 4UNVA 1QLFB 4PJ5B 4WUUE 1D5BB 5C09A 1CD1A 3B9DA 4PRID 3GHEL 2CKBB 3E0GA 2MSPA 1T89C 4H8WH 4PRDB 1XF5B 3JUYA 2VXQL 4OM1L 2DKSA 4JFFE 1RHHB 2VR5A 4LNRB 3Q5TA 5MERA 1I9RL 3DLQR 4U1IA 1P7QD 3JTTA 2ZSWA 3H3BC 2BNQD 1ZLSL 3OKMA 1Z0NA 3VE0B 4JN2B 4ODSL 4R7NB 4U1HA 1RIVL 2BNRE 3UXFA 1JP5A 5F6IB 1MVFA 5I0ZA 3PGCB 1E4KC 1BEYL 1YEKH 4M62H 1AP2B 2ERJC 4P9HC 1KSRA 1XF4A 5CSGA 5CJXA 4LCCB 1MREL 4H88H 5GPRA 3W0WA 5I6XB 3MJ8B 4UV7H 2RIKA 3QDJA 1M7IA 1U8JA 5DD5H 2WP3T 5IVXE 3JSSA 3QHZH 1T21A 2DI9A 1F97A 5E6ZA 5JXEC 5KANI 1KIQA 2NNAB 3P4NA 4N0UE 4Y4HD 2DTSA 3VWKC 3FONA 1RUMH 3CJJA 3C8KB 3GMOB 1A7QL 4R4ND 3MLVH 3VFOA 4UTBL 2ICWJ 1DCLA 4HIIA 4PJIB 5IWLC 2NXZB 3FQXB 3S5LG 4Z7WE 4LF3B 5D1XC 1G7HB 3BJ91 4IRJB 4PYGA 3OJVC 3WUWG 1JGVH 3KPRB 3IFLH 2FJGA 1C1EH 1OPGL 3FB8B 3L7FA 3DVGB 4YGVA 3RTQB 5KSVB 1A5FH 1R6VA 1MIEL 1WWCA 3QDMD 5EA0H 1WTGT 5FF6B 3RUGB 5BVPH 3RNKA 3TZVC 4RAVA 1KBGL 4YAQA 2WIMA 4Y5XB 4E0RB 4QTHA 3D87B 3S35X 3KPQB 4M00A 1UG9A 1YN7A 2AXHA 3VXUA 3QFDB 1JL8A 2ERJB 1ETZB 3F58H 1KACB 4RAUB 2Q6WA 1RZIA 3MRQB 2VC2H 1IQWH 2H2PC 5BJTB 3G5ZB 4BK4A 3NPSB 3DRQB 4ZFZB 5JW3L 3IXAA 3TCLB 1MEXL 2ZUSA 3SOBH 1LNUB 1I8IA 5DRXA 4FXGB 1QFUH 5TGBA 5HYSB 4N0YH 5M94B 1MCEA 4HIEB 3IFPB 4P46C 1FLRL 4K3JH 4ZNEA 4ODWB 4X4YB 5EZLA 1JHTA 3FTGB 3ME0A 1XH3A 4UINL 5ACZB 3OG4B 3OKLB 1NAMA 4HJ0D 3LKOA 3C5ZB 4NZRL 5HGAA 3G6JA 2VAAA 1QO3A 4X6EA 4PRIE 3NZ8A 3IDXH 1U8NA 3DUSB 1CFSA 3WFEL 4YFLI 4JRXD 2BSRB 2C7UB 4HV8A 3BH9B 1LHZA 2ZSVB 1SY6L 5AEAA 4NKOA 4R3SA 2VITA 4IOIA 3JWDH 2H3NA 1K2DA 3QIBB 4JDTH 1NFDF 3QJFA 1IQWL 4OQTH 1N5AB 3O4LB 4QTIL 1S9XA 3EDEA 4H8WC 2XFXB 1KLGB 3C09C 5HD8C 2Z0BA 5TPWL 5JHLH 1CT8B 1BFVH 3L3HA 4ONGL 1CGWA 4KUZL 4K23L 1G6VK 4L8BB 1Q38A 4UT6H 4IRZL 1S7UA 4TQEL 1HWGB 1W0VB 3OKDA 3UJIL 3QDJE 4Y16D 5FUOH 4B41A 4Y88A 2ESVE 1XIWC 1IGTA 4MXWH 1XR9A 1KEGH 2NY2C 1IAIM 4MS8C 3BW9B 2JCCE 3RPIB 4JM2A 2UZXB 1YECL 4Y1AD 5FB8B 3TT3L 3MODH 4TOYL 4CNIB 1JRHH 4F7EB 3QIWB 1W72L 3JTSA 3MFGB 3C8HA 3PQYA 2A38A 5T1LD 3K80A 4GW4A 4FFWC 4HHAA 3WNLA 1I3RB 1DBJL 5GRJL 2FIKB 4IS6A 5SWZA 3TV3L 1NMCC 3IU3B 3RVUD 4YC2B 1A1MA 2EH8H 5KANG 3ZE1F 4P9ML 3OKLA 1X5ZA 5EN2B 5IQ9B 3ROOB 3L5WB 5I6XC 5KSBA 2E7LC 5FHAH 3HR5B 1INDL 3VMNA 1EMTL 1DE4A 1CD9B 4F33B 5DJZA 1NFIA 1A4JA 3W0WE 5BO1L 2GITB 5DFWH 3TGXA 5KG9B 2X4SB 5KZCB 4JVPA 5FCUL 2P5ED 1OCWL 4TTDC 5IB5B 2NX5B 1I1RA 4I3RL 4ZOBA 3GSQA 1IGIL 3VGFA 3LKNA 2Z91B 4KAQL 5IBTH 3QBTB 2X4OA 1EXUA 2CH8A 2PW1A 1TJIL 2DQEH 4DN3L 3MJ9A 2VWEE 1OHQA 4TYUA 1XF3B 2DM7A 1P84J 4M9OA 2YOCA 5GS2D 4L3EA 3KPSD 4PJ9A 1EEZA 3V6FA 1FO0A 4D9RD 1MI5D 4Q9QL 1P4BH 5GJTH 3P40A 4ZAKC 3KYOA 3KYNA 3IFLL 1BVKB 2EE3A 1C5DB 2DQTL 3QIWA 2DBLL 1XT5A 3LQZB 3OAZH 1ROWA 1WAAA 2FJFB 4HKBA 2DKUA 1FFPA 1RUKH 4EIZC 1I7TB 3SDXA 1C5DA 3TZVA 5F7KC 3KYNB 4PRHA 5CMAB 4F57L 1EFXA 1N2RA 5DMKB 3GMPB 2BVYA 4MSWB 2AK4A 2WINA 2EDNA 3D0LB 1IKFL 4Y2DB 3ZT5A 2X41A 1CLOH 4BSWA 3WYRA 2X70B 2VDRL 3GRWL 3WJJC 5K9KB 4FG6D 3GSWB 4YK4C 3QUYD 4YIQB 4Y4FD 3ARZA 5F1NB 1E4WH 4N0CC 4LBEB 5BS0B 1KGCE 3QUYC 3TIDA 1S7RB 1CLCA 3EYFB 5IOPA 1SYSB 1HN1A 5AZEL 3BOVA 4J4PA 3QUYA 3X13B 4X83A 2I5YL 4X6DE 1LP9E 3PWLB 3ARYA 2GUOB 2AK1H 2P8MB 2JTDA 5K9QI 3AXLB 1CU4L 3CU1A 5FYLH 1J0KA 1CXLA 2GT9B 3U6RA 1NUGA 4E9LA 2Q3ZA 3BH8B 4LKXA 1NC4A 4F2MA 2DLEA 4UTAH 1B6UA 5T3ZD 2AABH 3UBXA 3VXTB 5DHXB 4EI6A 3O3UN 4KJPD 1PZUB 5DD3L 5JW3H 3B43A 3VRJB 3U0PA 2CKBL 2GY5A 4OCRH 3O6FA 4J2XA 4JFEA 1WEJL 1FVDB 1DBMH 1UKQA 2WUBH 4LLVB 4YDVA 3LPGA 3TBTA 2FLRT 4N90D 1KPUA 3ULUE 4Q9QH 2D03L 4XVSH 3TYGH 3MLUH 1NC2A 2JIXD 1FLRH 4HFWA 1IBGL 3MA7A 1UZ8B 2Z93B 4P2CG 3B5GA 3DWTA 1U8PB 1IT9L 2OSLB 4RX4D 2UVFA 1BOGA 4Z18A 5TF1L 2GIYA 3SKNA 3QUKB 3W9DA 1YQVL 2UWEE 4Z0BL 3MRRB 5I76B 1KIPA 4JO2L 2YSSB 5E0QA 1MCNA 3MOAL 1BHGA 2V5YA 1ZHKA 1JF6A 1XGQB 3QFJB 4NRYB 2VZ3A 1RFDL 4MA3B 3PWVA 5MI0C 1OAZH 3CNKA 4D0BB 5KJRL 2FJHB 2R4RL 4OLYL 2ZUWA 4P2OB 5HGHA 5FA3B 3KLHC 3WFDH 4XMKH 3RPKA 2FECL 2JJVA 4XMPL 4GQ9L 4NT6B 5AYUH 4RMQA 3RVUC 4OJFL 5BRZA 4ETQB 3DPBA 4U6HA 4D9RE 5I1HL 2YD2A 3FAWA 2Y7QB 3D2UA 1MCCA 4FFWD 1OP3K 1CTNA 3DGGB 4Y5VA 5CP7B 2A6KA 1QQDA 5ANMB 2EIDA 3TBWA 2DQFA 1A22B 4U0QB 1JTPA 3MBED 4XPTH 4UU9B 1IGMH 2O5YL 3WO3B 4PD4J 2LVCA 5AUMB 3HC3L 4YHLH 3RIAF 1RURL 1A9BB 3VH8A 2EDBA 1DLFL 3GK8L 4NN6C 4TTDD 4G8GD 3TBWB 3TA3D 4UQ3B 2UUDK 5E2JA 2PYEE 1OARH 3VXUE 2C9AA 4X99A 2FDBP 4Y7MA 2D7QA 5INCA 5E6IA 4Y0GA 5DGRA 3FHQA 4PIRF 4XCCH 2YUXA 3BMWA 2AV1A 3HNTH 1UWEH 4DEPC 3GBNH 1UB6B 3W39A 2XKUA 5KW9L 1JPTL 3MUHL 3VW3H 2W9EL 4ODHL 4QTIH 4H5SB 3E2HC 5J7CC 3PV7A 3TESA 4HKXA 2ZKHL 3QUZA 4QTHB 2F8XC 3FQUA 4NKMA 3SE8H 2FBJL 5EBMB 1F5WA 4HFUH 1MCKA 5C1MB 5D6CB 3QDAA 4ZTOL 2BDNL 2HN7A 2F53A 4XC3H 2XACC 3QG6A 1RZ8B 2BXYA 1Q0XL 2J4WH 1BF2A 4DKFH 5D8JH 5F7FA 2J8UB 4NO5B 1JZ2A 1FRGL 12E8L 4Y4KD 3QDMB 5CHNB 5JZ7D 1RZFL 2HFEA 2FH8A 5J8OA 2F53D 1QSEB 5F1IB 4LLWA 2IC2A 1LGVA 1NMBH 3I2CH 3UO1H 5B39G 1ETZA 5FYLD 4HKJB 5DXWA 5F7EH 3PWNB 1JI1A 4IMKC 4L9LB 4ELME 2C3GA 3SKOA 4LCWA 1A7QH 43CAB 4IIQB 3CLFL 1T21B 5CSZB 3F7PC 5IJKA 2OP4H 3GI9L 4HUWA 1N8ZB 3RNKB 4DJMA 2BZDA 5I18L 5D4QA 1IBGH 4DKAA 1V7ML 3N1PC 5FYLL 1QRNA 2FLBT 1PG7L 1YUHB 1A3QA 3O3AB 1K2DB 3V0WH 1FIEA 4PGCA 1MCOL 4OFKA 4NUGL 4P2RA 3KPNB 2EXYD 4DZBA 1AGFA 1L6XA 3GUTB 4KJQC 2NY3B 4M4RA 3DUSA 3NAAL 3MUGB 5L88H 5D1ZD 1UQSA 1UKSA 4OZHF 3Q6FA 2HFEB 5CEZL 1KIUA 4WV1B 3CLEH 4Y5YA 3SJVD 1OAXL 1N0LA 1BM3H 1X5HA 1I9RH 5IFJA 2XICA 3VWKD 5CIPH 3PV6A 3S7GA 2R1YB 3S4SB 2FGWL 3GSXA 3UJJH 3H9YA 3D3VB 3BPOC 1P9MC 4PBWD 3FO0H 4RIRA 4G9FE 2AW2A 4JRYB 3SKMB 1IZJA 3TH2T 3NA9H 4G6ML 3KDMA 2NX5A 2J8UF 4N8CH 2JELL 1BJMA 1RZJH 1KPVB 4UIKL 2I07B 4X9IA 3MRBA 4YDLB 3QZWA 4NGHL 4Q6IC 3CC5A 4HQQL 3V0WL 4CVZA 2OBGA 1EBPA 2F19L 1EAPA 3MCLH 3P9LA 1QFWM 5EOTA 1KCSH 1AO7B 3MRPB 1WCBB 1T5WA 4GMSL 3QPXH 3R4DA 1SVZA 4NCC2 3U0TB 5DJ0B 5DRZB 2DMCA 1HHJB 4DN4L 2CKBA 3IB4A 4H1LB 2OM5A 2PO6D 1P4IL 5D1XD 2ZNWA 2GCYA 3VD4A 1FL3B 1R3HB 1C16A 4FTVD 3G5VA 1HHJA 4P4KB 1DN2A 5FF6A 1FQ9C 4ODHH 2BVQA 1LP9A 3GSVB 3BDXA 4V1DE 1JZ4A 2LAGB 3QCUL 5AAWA 5JXED 2E7MA 4HWEL 2PXYB 2PR4H 2R0KH 4KUCD 2FH6A 3ULSA 2GFBA 1YEGL 3MJ7B 5GISL 5DJAB 3T8XA 1WLHA 3OZ9H 3MROB 1MREH 2VXVL 3HAEB 2LTQC 1NBVL 2XNAA 1S5IH 2CRIA 1JPST 3S35L 1RMFL 4EEEA 4LSTL 1AFVH 3I6KB 4MJ5B 1MIML 4YFDB 3RI5F 1MJUL 1MPAL 1S7UB 4HAGA 5D9SA 4EVNA 4Z0XB 3T2OA 1IM9D 2LTQB 2R23B 2VL5A 5T5NF 5JW4M 4MVBC 4NRXA 4RISH 5KZCD 1DUZB 3DURB 1ZAGA 4MAYD 1PG7X 1NH6A 2DLFH 1ZLWK 3BGMB 1G6RH 1H3UA 5T1DH 3U2SA 3U7WL 3JUZA 4M8QB 3TVMB 3TEUA 2A1WH 3W11C 1KB5H 1MCWW 3A6CL 4P59L 4UDUA 4JY5H 3FAXA 3KPOB 1FRGH 3BPLC 4FRWA 3CVHB 3INUL 4PLKD 2P5EA 1QVOA 3UPRA 3MNZA 4PB0H 4LFHG 1DQQA 1C12A 3C6SB 4YDVB 3C08L 3IETB 3MBXH 2F54D 4LIQL 3BKJL 1I7ZB 5HYSA 2IBZY 4YDLC 3BN9D 3SJVE 3VMPA 1J05B 4QXUL 2E8YA 3OX8B 3AS0A 3QPQD 2YPLD 4JQVC 1ZOXA 1QLEH 3A6BL 4P0DA 4TVPD 2E9BA 4PJDA 3O45A 4QEGA 2J5LB 5I1KL 2GT9A 4L4TD 5KVDL 4JFDE 4XNMA 4GW1A 1WF5A 3EAKA 3RWDB 4GG6E 2XN9E 5KVGL 1KXTB 1WWBX 2YN3A 3MUJA 3U0TA 3WXWL 1MLBA 3B5TA 6CGTA 4QXWA 3VXPA 2V6HA 5HJ3B 5DHYB 3GRWA 5DQDL 4BQ8A 1Q8MA 3QUYB 2IH1B 1MHHB 2XZCH 5CIPA 3B5HA 5IW1B 3SCMD 5EN2A 1NGXB 1BZ9B 1SEQH 3CX5K 3GKZA 3SGJC 3MV7B 2WWKT 5GGRY 2XWJA 4HXBH 5FYJD 5GGVL 4A2MA 2YD6A 1T1ZA 1WIUA 3MACL 3P73B 3NAAH 5ADPH 3TPKA 5LKNA 4LKXB 4ZS6C 3IDXL 1ZT4B 5BMFL 2BFVL 3MUY1 3TPUA 1MEXH 2YA1A 5MP6H 4PJCF 3QPXL 1KIRB 1A6AB 1IGYA 1FCCA 4WGWB 2BNRD 2BERA 3STZB 2DQFB 3QO0A 5GJTL 1U8QB 1R5IA 2HTKD 4O58L 5FYKH 3CLEL 3LRSA 4BFIB 3IJYB 2HT2C 4JO4L 3MR9B 4NZUH 1AR2A 3RVXC 2QKIA 3V5KA 5EBLA 4S0SD 2VOTA 5IVZB 3UJIH 5LWYL 3QEUA 2C4FU 1JE6A 1KTDA 4OAWB 4APQB 2XA8H 1AXTL 4JM4H 2VLJE 3ZE0E 1AJ7H 2HKHL 3RAJH 1G9MH 2DQJL 2HFFA 3WKML 5I2IA 4ISVA 3IFNL 5TE7L 4Y4KA 3EYQD 4EKXA 4HX1B 5KS9A 2XZAL 4APQA 5E2VH 5CKAA 1A14H 2X5PA 2WBJD 1M6OB 3S35H 4I2XB 2R9HC 3WHE0 4C57C 1IEBB 1YYMH 3L5HA 2E7HA 2EC9U 3AAZA 1H8OA 3WUWB 5GGTA 2EDRA 1W0WA 5E2TL 1K4DB 3NCBB 2VXTH 2X10A 1UKTA 4FQCH 3PL6C 2ICWI 2NY7L 4NQCB 3IDGB 4AEIL 3S6CA 1AH1A 3RY6A 3V95A 3MA7B 3QEQB 4NM4H 5T1LB 2W0LA 1NDGA 1OP3H 1A0QH 4RNRA 1OM3L 1ED3B 3ZDXE 3BX7C 3E2HB 2YMXL 3UTSE 4AL8H 3U7WH 1NGQH 5E94A 3NN8A 3JV5A 4S0TD 3OHXA 4C4KO 5IB4B 5I18H 3VRJA 3QIUC 4N9GB 1OTSC 2YUWA 5IEKA 1CDBA 1PFCA 1Q9LB 3QDGB 5DK2B 5TDNB 3OR7B 1AE6H 3SGKA 3NIDE 4KJWC 1D6VL 1YPZE 1ZMYA 4HG4J 1BX2B 1XIWA 4LSUH 4WUUA 5GS0D 4JO1H 1N64H 2OTUB 4TSAH 3OJ2C 5FXCH 3PHSA 1OD7A 5JW4Q 4QHNB 3VXSB 2Z93A 1FAIL 4OZGB 4M7LT 2AAVA 3C08H 5BOPA 1I9IH 3X14A 5HY9B 3I6GA 2ZWLT 5ITFA 4IJ3B 5ECJE 2HWZH 2WBKA 2QHLA 4R7DB 4ZUSB 2QSQA 4I1NB 4JG1L 4POZD 1VFAA 1I8LA 3K4AA 4A6YA 1CDUA 3HE7B 2YPVL 4XHJC 4GRLB 2X4UB 2JB6B 4QOKD 4PJCE 3LCYA 4M7KH 4PJXA 5IB3A 3HC4L 5D7JD 5EIIA 4QHLA 3OAZK 5LGJA 1ZWIA 4NWUL 4NFCA 5BS0E 1ZEAH 5SX4H 4U6YB 2OMNA 3MOBL 4O2EA 4K7PY 3FQNA 4ORGA 3NCFB 32C2B 5GZOD 3RJDA 2FX7L 4FFZH 5MI0B 1ZHNB 1P6FA 4PRHD 1X5AA 2MCG1 2FX9L 4PRNB 3OKYA 5K59F 1MFNA 1BWWA 1RJCA 3CDYA 2R4SL 2B2XH 2XWBA 1U8JB 4GXUN 4PUBL 5E2WH 2DWEB 3F6LA 4X8JA 1NCAL 2APFA 4HXAH 3T09A 3OKMB 1M6OA 5C2BH 1BZQK 1VENA 2M2DA 1RIUL 1VPOH 5EZJA 2JIXA 3ZKNC 2M1KA 2X05A 4RGNE 5HHOB 1HCVA 5B8CC 3LKRB 1J12A 1J8HA 3CZJA 5IM7A 4Z8FL 4U0RC 1F3DH 1KC5H 4HFUL 4CW1B 1TJGH 3K8LA 4GH7B 1FZJA 4OZGF 4JFQA 4RAHA 4OZFH 1Z0MA 4HZAA 4KTEH 4FZ8H 4OLEA 3WJLA 5IMOA 1NC2D 5DD3H 5CWSA 1EZVX 1Q72H 1QPPA 4K8RL 2APBA 3E6FB 5FOJA 1L7TH 2FYYB 1BJ1H 1YYLH 3FN3A 3PJSA 3ESUF 4KKLC 4YHKL 3QG6B 5ILTH 4PJAF 5FYKE 2ZUUA 4JPWL 4RMVA 2BX5A 3HC0A 1ZSDB 3KNBB 1P53A 3PGFH 5CJXC 1HWHB 5EIIB 4XP1L 4EOWL 2W65B 1C1EL 1NMCB 4HEME 2R2CA 4WI7A 1T03H 2YWYA 43C9A 1MCIA 2E7BA 2WWMD 3TBTB 1NAKL 1NFKA 4QYOA 3PXHA 1G7IA 1RVFL 3HC0B 2AXJA 1UA6H 1CD1B 3GIVA 3RKDD 1S8DA 1EAPB 3P9LB 4XX1G 4AENB 5IMKB 3D2UD 2R1YA 3V9FA 2PYFA 5J1TC 1DVFD 3MRGB 3NCJH 4WWKD 5D7SL 1FAKT 4WVRA 2A74A 4B5EA 1NSNL 1FNSH 5D6DC 5E8OB 5HGBA 2VLJB 1DUYA 1TNMA 3QNXA 2Y5TA 2EE2A 3S5LA 2AJZB 1PLGL 1U3ZA 2EYSB 3REVA 1EFXD 4M1DL 1X5JA 1E4XI 2OTPA 4PJIA 4MNGE 5IFAL 1H15B 4NYLB 4EQ2A 4U1MB 1ZGLM 5GHWL 3WIFB 1F02I 1WWWX 1FORL 3W5MA 5GGSA 2IG2L 4LVOB 2B1HH 4OF6A 4Z7VA 5IHBA 3N85H 5IGXH 1HE7A 4TNVK 4PV8B 4M43L 3PL6A 4HWNA 4PGDB 3NABH 2AV7B 4WO4B 1CBVL 4MJ6B 1HXYA 3C5SB 4F80A 1JV5A 4P5TC 1MI5A 4IDLA 1UM6L 4PGDA 2E7CA 1MCFA 2Y7QA 5D9SB 4XBGB 4EVNB 1MAJA 1CZ8H 5JMOC 1B9ZA 1OL0A 4Z5RB 1HYSC 2I60H 3VFOB 2G60H 4FZEH 1NEZB 2Z4QB 4GW5B 3AS1A 1KOAA 4GG6F 3EJZD 3CX2A 3UTPE 4X6DF 2R2HB 3REVB 4NWTH 4UNUA 1R3LB 5GJSL 1J7VR 3EGSB 5AWNH 4KKBD 4FS0A 1JPSH 3SJVA 3DOSA 4HWBH 2QV2A 4ODXA 4TUKL 4P2YA 3SDCB 3V5DA 5EU6E 1KGCD 4XPBL 2HKFL 2PYFB 5EC1B 1Z5LB 5DVNA 1A02N 1S7TB 3HCVB 3QIBA 1G9NH 2BOCA 2V5MA 4LOUD 4NUJB 3V2AR 4EI5C 4YO0A 1RZKC 3CUPB 4PJHF 3T2QA 5CZXC 4K9EH 1MHHA 3VA6A 2CUHA 4F58H 5FHAL 1X4YA 1VADB 4RMSA 5DJAA 3EBAA 4J1UA 3D18B 1PGRB 4XCFH 4HUUA 4ZFFA 1YEIH 4LKCA 4LCYA 5DD5L 1E4XL 1QFPA 2CDFB 4NSKB 1ZT4A 3BYYA 2JK5A 4GXVH 3OZ9L 4X6FA 2EH7H 4ORZC 3CXHJ 1A4JB 1LO3H 3DTXB 3MRMA 3O4OC 1AD9B 1H3WM 3TIEB 5EFIB 5KVEL 5DFTA 2XYCA 5E2WL 4A2LA 1R24A 3OPZH 3ZE2F 5IR1A 4OZFA 1NCBL 2ED7A 3JWNC 4IRJC 4KHTH 4L3AA 4HH8A 5HHNA 2B20A 3LIZH 1N5YL 1IC5L 1WV7T 2QR0B 1N6QH 1UADC 4XGZB 4IRSC 2A6IA 1L0XA 3KS0H 3LPFA 4R96B 3ZKXC 5I16B 1QSED 4HGKC 4JY4B 3V8OA 2AERT 3SDAC 1MVUA 1Y6MR 2P8LB 1DBAL 1YY9D 1GGBH 3ETBF 2HT3D 2IGFL 3TA3A 4JM2C 4NO3A 4C56B 2OP4L 3GI9H 1J8HE 4GG6B 4L1HA 3GM8A 1EX0A 3RL2A 1X5KA 3JTSB 3PWPD 1YEJL 4Q0XH 3C6LD 2ZPKL 3F65A 1NQBA 3KWWA 3OKEA 2DDQL 5DJXA 2QQKL 1E6OH 5KS9E 2J8OA 1I3RA 2C4FT 4L4TB 3IETA 3OF6D 2F74B 3A6OA 5IFJB 2NY7H 4GRMB 5I66A 3MLSH 4QRUA 1RHFA 3V79C 1NL0H 1I7TA 2DQGH 3QEQA 5K9JL 4RGMB 1EO5A 4PJHB 1F13A 2GKIA 1S9VA 1KT2A 2A6DB 1V7NH 1U93B 3BO8B 4WRLA 3CK0L 4UB0L 3LIZL 1OAXH 1UM4L 5D1ZB 5J89A 4H0HB 1U93A 3WHXB 3BZFA 2FIRT 3JXAA 1CBVH 1EBAA 3QG7H 1LDPL 2DQCL 5IW6B 1F4WL 5HYEA 2V17L 5C07D 4HT1H 1V3KA 4G9FA 3SDDB 1RZGA 2NXYC 4MHHG 5E03A 1JHLL 4G6JL 4OFPA 4YWGL 2Q1EA 3BMVA 2FEEL 4GXVL 4YE4L 2PR4L 2R0KL 3HS0B 5D93C 1G1CA 2KUTA 2RCSH 1ZE3C 2Z91A 3VXUD 1DEEB 3ILQC 4W4NA 1F4XH 3NTCH 4LSQL 4HPOL 1T80A 2FBOJ 1E6OL 4M1DH 3TN0B 5J4MA 1XH3B 1G84A 3TYFB 2KZWA 5GRVL 1MELA 2E27L 5EWIL 4A6YB 5DRNB 4LCYB 2P24B 3E8UH 3MRQA 3DHJA 1BZ9A 1CGSL 1INDH 1WFTA 5GRZA 3MLYL 1PAMA 3ESVF 5HDBF 4WW2B 4ALAH 4HWBA 2NR6C 4X7TB 5CJOH 2PO6B 3ROOA 3T0EC 5D1XB 4Q0XL 4FMFA 3KJ4B 5IOPB 1GOGA 2L7JA 4AMKL 2NY6D 4BQBA 3MA9L 4KV5F 1HK6A 4UIKH 4NHCL 4HC1A 5AD0B 2EDXA 4HCRH 1RMFH 4LHUD 3SN6N 1I1AC 1DSFL 1HIML 2HT4D 4X7TA 1A6VH 1AR1D 1TNNA 2X42A 5B38A 5HVHC 5E5UB 3D69A 3ULUF 2VDPL 3QQ3B 1YC7A 1MLBB 3VFUA 3U6RB 1WZ1H 1MCOH 3U7YL 3WE6A 3IKCB 4Z78B 1IMHC 1BWMA 5E24E 2VH5H 3S97C 4PY8I 5F7LB 5HPOA 3DYOA 5D1ZA 3BXNA 2CIKA 5SV4A 1EHXA 3T2NL 4U7MA 3EDKA 2BCKB 3QDGD 1DQJB 4ZUTA 4GKSA 3JV6A 2K1MA 1CXFA 2DM3A 5DS8A 2P43B 4C83A 4HX1A 1MFAH 3W5NA 3DURA 5I66B 1AJ7L 1U42A 2DBLH 1F4AA 3LQAC 5J6GB 4ZOCA 4ACPA 4RWYL 3MO1B 5F71A 1CICD 3CFDA 4JPIB 3U2SB 3BQUC 5BZDA 4PFEA 2HT4C 1GIGH 4O51A 5LGJB 1A1NA 1JGDB 3HE6C 1DLFH 3GK8H 4WV1C 1YMHB 1NLDH 2E5EA 4G8IA 1HKLL 3GB7A 1XCQA 3T0ED 4NP4L 4LSVL 2PKDA 2W9DH 3L5XL 2X1XR 4M6MH 4NFBA 4YHZL 5BW7A 4PRNA 1JNNH 2PO6A 1MF2L 1H3PH 2AXGB 4LHJB 1BQLH 1N4XL 1KB5A 5L0QB 4WW2F 1ZVHA 3VXPB 4Z7WA 3HI1B 4NHUB 3RVVC 4LCIL 4NJ9H 4EJ1C 3FHAA 4F7TA 1JF1A 4J3VA 2HN7B 4XCNA 4WUUB 5FIEA 2VERN 4GAYB 3LDBC 4U3XA 4KK9C 2X40A 2Y1VA 2YSSA 5FKPA 4P2RE 1T0NA 4X4XA 1VFMA 5F9OL 2VDKL 5JQ6L 4RX4A 5KAQF 2C3WA 3ZSTA 5CS7A 1QKZH 5DHVB 1H15A 4F7TB 3D48R 4ZUUB 3LRHA 1NFIB 4FQXA 1N3NB 3QT2A 5BXFA 4HGWB 3ARDA 4FFYL 3VFGH 1T1WB 4E41E 2NTFB 5DD0H 1U8IB 1X5XA 3WLWD 1B2WL 5C0JA 1IGJA 4MA7L 2DWDA 2UYLB 2WLYA 5A2IH 4MGXA 3R0MA 4ODVH 2ZUTA 4JG1H 1JZ6A 2OTWA 1QA9A 4TUKH 2VR9A 2MTPA 1OAQL 2V7HB 3REWB 5FOBB 5I8EA 3GSNA 5E8DH 4XPGL 4DW2H 3L7EA 1FGVL 1CFVL 2H2SD 3MV8D 4OCWL 4AZ8A 1VSCA 4UBDD 3BEWB 1FFQA 4ZO7A 4U1NB 1TVBA 4AEHH 2DQIH 1IT9H 2ZG2A 1MQKH 3IDIA 3PP3K 3QRFM 2FX7H 3ZE2E 1CWVA 3EGSA 3C6LC 5DS8B 3U1SL 1A6TB 1J9CT 3NMEA 3QCTL 4HBCL 2FJFA 2HH0H 1EEYA 1TPXB 3K46A 5HSFA 1KCVH 1CGXA 4IDJL 4Y4HB 5BV7B 4Y4FA 2CK0L 4XVUC 2ICEA 4H25A 4OSUL 1ZLSH 3LEXA 4FOMA 3WNMA 1KENH 1BQHG 2E7LA 3G5YB 1C5BL 5I1JL 1ZHLA 4XMPH 3BKMH 4OFYD 2O5ZL 3G9VA 1FNEB 1YEFL 5E4IA 1NGYB 5T1KA 4IRJD 5DR5L 4AYFA 3MREA 2DMBA 3ARSA 1NJ9A 5F9WB 4LCWB 4XVJL 7FABL 4HDIA 5IJVB 4OZGE 4WO4A 2VZOA 4BYHA 1ZA6B 3GMNA 1WBXA 5TJWK 1NMAL 4LDOB 1UEYA 2VMFA 4PP1D 4JZOB 1QBBA 3H7BB 1UH3A 4LMQI 4XBGA 4KK5D 4ZXBC 3S5LB 5DMGC 4G6FD 4CVUA 3IXAB 4JQIH 5C0BE 1T5WB 3X14B 3MMEA 3GHEH 1R0AH 3ECBA 5D5MA 1BZ7A 2RFXB 3K2UH 4GUPA 5JA8B 2QSCH 3N1GC 4OI8A 5JW4R 5LQBL 1GSMA 3AREB 4X5LA 1QZ1A 1KIPB 5E6ID 2BOBA 1TTGA 3NPZB 4MNHB 2X7LB 1NAMH 5BVJB 5JDSB 5EOTB 1TCRA 2W1NA 5KVGH 1RZIB 3HA0A 2JJTC 3PL6D 1FSKB 2NLJB 2WZPD 1QFUL 4G7YH 4ZFZA 2D7OA 2ZCLL 3QCVL 1AKJD 1LO2L 4TN9A 3ZZ1A 2XTJB 2DI7A 4ODUA 4PJBA 3F7VA 4NQXA 4HBCH 3LSOB 4AIXA 1F2QA 5JQ6H 3OXRA 5GSRA 4TSAL 3QXUA 4H1LG 1A6WH 5F9JA 1CFTB 5EORL 1BD2E 4GMTH 1NL0L 3GJFA 5H2BB 2BHUA 2OJEB 5GRVK 1FL5A 3ILPB 4P5TD 4QHKJ 2AEQH 1VB9A 2COQA 5CBAA 1EIBA 3HAEG 2XKSA 2Z8RA 3QEGH 5HHQB 4KVNH 4PRBB 2W0PA 5EU3B 4X0KA 4NC1E 3G9AB 4K9EC 1CLZH 5D71L 1EERB 3MV8A 1VGKB 2ADFL 5D7IE 4MJIE 5DJXB 2X4TA 3P4NB 3UZVB 1AXIB 3ARPA 3BW9A 3QIBD 4NN7C 4RFEA 4ETQA 43CAA 2DLFL 1KLUB 3MXWH 4H25B 5LGHH 4HAFA 4AIZA 4ZS6D 5KSAA 2K7QA 2BSTB 3EW3B 4PG9B 5KAQG 2B1AH 4Y5VB 1CXHA 1YEKL 2K3TA 3RL1A 1Y18A 1TMCB 3BGMA 2PXYA 4KI5E 1M05B 1TZHB 2GW5A 4KQ3L 4BQ6A 1T66D 4M61A 4L8BA 1IGIH 5J3HD 1CFNB 5DZNA 1J87A 1ZGLB 1H8NA 4Y16B 3QIUA 1P7QB 4ELMA 5F9JB 2F74A 3RU8L 3O2DH 4KFZC 5KSUB 4C56D 1GPOH 1UACH 4JPWH 1MHEA 2J12B 4Z0XA 5LAXB 1FL5B 3I6LD 1BIHA 4HIXL 4PREB 5BRZD 5TGBB 3VFRB 1T4KB 1YPZF 2CLZA 1L7TL 1HKFA 4XCCL 1U8HB 5TPWH 2A9ML 1I9IL 3KYMB 1VERA 4DUVA 5I8OH 5EU4B 1YMMB 3MFFA 3TBSA 1KFAH 5T5FH 4NSKA 1N6QL 1HH6A 1NCDL 2ICES 4PRDA 3DVFA 3ULUL 2J8HA 2CSPA 3QXWA 2KQMA 1QSEA 3BP6B 1FYTE 4PJGF 4XP9L 3I75B 3FO1B 3ET9F 2YPLA 1FH5H 4DVRL 2MMXA 4MNHA 2UUDH 5EU4A 3VWJC 4PRAA 2W0FB 1MH5A 2YS4A 4I0PC 4QRPB 4S1RL 3OKKB 2NXYB 3ELAT 3EYVA 3FOMA 2J6EH 5CCKH 1XGRA 3TJHC 4WU7B 1WBZB 1AGCA 1G7PA 3BSZH 2P5EB 1KJ2B 3HRZA 1HHKB 4KVNL 1FC1A 1KJ3L 5BMFH 2XKNB 5HBBA 2M26A 1A4KA 5GZND 3VGBA 4MA1B 4PREA 3T77B 2P24A 2L0DA 4NOFA 5L2KE 2B5IB 3HB3C 2X4PA 4UOW1 4PD4K 1EA9C 3VDCA 4WDIB 4C54A 2EKSB 4OIBA 4OF3A 1OY3B 3RNQB 1G6RB 1A1NB 2EIZB 4QRQA 4YFLF 4YPGA 1UM6H 5HI3D 1MCSA 1CD8A 3AM8C 1RZKL 4G80A 3T08A 1OOAA 3NCMA 2QHRH 1XCQB 3FQWB 4LSTH 5F1NA 4GKZA 1EGJA 4RGNC 2WUCH 3AM8A 5C09E 2WM0A 5DF0A 3V5HB 3WXVL 4LMQE 1GZPA 1CGTA 4RRPA 4S1QL 1JGLH 1LD9B 5A40E 5JTWA 1NCWH 1LP9F 5IW6A 1YPZB 2F8OA 3MZTA 5CEZE 1QR4A 1OGTA 2VSDA 3BKJH 3L3KA 4NJ9L 2CIKB 1OQOA 4E42A 3W82A 1MRFH 1T0MB 4Q2ZB 5CEYB 4ZOEA 4I2XA 3J7HA 1A6AA 4LFHD 1RIHL 1UYWL 2EZ0D 4YBQD 4ZPTB 3L3GB 3LRSB 2B0SH 3GMQA 5D2NA 4HWZB 2J88H 1QUNA 4YEEA 3RA7H 4Z7QF 5I73B 1QRND 4YQXH 3I3EA 4S10A 1P5UA 1WZMA 5FO7B 3VD7A 1BVZA 3CDCA 2NZ9D 5DRXB 3I6KA 4FFYH 4K8RD 1OTSD 1J1XL 1TVHB 4X6BA 1MJUH 4I77H 1KTLA 4D9LH 3IDYC 1MWAB 3DX6A 2Q86B 4FQ2L 2VR4A 4NO0A 1YYLL 3WXVH 3I75A 2JJSC 3O4LD 4IMLA 4Z7OF 1BQUA 1T7ZA 5D1XA 2AABL 3CFBA 4MJ2A 1YJDL 3H3KA 4U1SB 1U8KB 5EOQL 4D0CB 4OCYL 2Q86A 4CVXA 5IJKC 3O3BA 2OK0L 5JMRA 1SYSA 4WU7A 1ORQA 4JFDA 3NIDF 3O45B 1S7SB 2AK1L 5FDWA 3RWIB 1MJ7L 1I8MA 1KCLA 2VZUA 2ZJSH 1GCFA 1RJYA 2NQCA 1DR9A 1UWXH 1RUKL 2F9BT 4M7JL 4O2FA 5A16A 3PQYB 2YC1B 3D39D 4Q9BA 3VXRA 5C3TA 1CE6B 5JOFB 5F7WC 2P8PA 1I1FB 1IRAY 1SEQL 1C12B 5FGCB 1OTTC 4QO1A 1GZQA 1KCVL 2OR7A 2BHYA 3H0TA 2XZQH 4Y89A 3C6LB 3G5XB 4XXDB 2WUBL 4J3WA 3U48A 5DD6B 1T1YA 4C59B 5DI8B 3T4AA 4UUJA 1GGUA 2YD5A 3D5OF 3LAFA 1FO0L 3GMRA 4KPHL 2MKLC 3FQTB 1ZANH 3ULVD 5IV2B 3V6FB 3RWHB 2Y4SA 3CCHB 5GGRA 5HYSG 3F5WB 2ATPB 4LF3A 4QT5B 1PQZA 6FABL 5DZOA 3EFFA 3MLTA 1H3GA 4PJFE 1M71B 4LRIA 3FB7A 4HUKB 5C86A 2ICEB 3QI9D 4Z7UF 5EC2A 2ZNXA 3GGWA 3ZYJA 2FWOA 2PYED 3IDNB 1D5ZA 4WW1A 2F5BL 5IHUH 5HYFA 5DLMH 3WE6B 1PQZB 1HIMH 5F70A 3HR6A 4KTEL 1IAMA 4JHBA 1CL7L 5HJ3A 4EQ3A 5HVFB 1Y6KR 5TDOA 1S78C 5IK3B 2P48B 2DM4A 2GK0B 3FCTB 5DT1H 3ULVC 2XY2A 1JWUA 1HYRC 5AYUL 2OXGA 3IDJB 2CR6A 2MQCA 4JE4B 2HVKA 4N0UA 4ZUWB 1Z9OA 4CDGC 1RUAH 4MAYA 1LK3L 3DUUB 4PLKC 4OCWH 2YHGA 4RMWA 4GW1B 2ENSA 4ZMAT 1YNKH 5F96L 3SDCC 4LNRA 4S1SL 3LQAL 5B4MD 4LSUL 2BXZA 2HJKB 5D7SH 3AU1A 4TSCL 5F7NC 5FO9B 3GFUA 4K3EH 5GRUL 2F53E 7CGTA 4XHQA 1CLYH 3CFCH 3TIDB 5F8QC 3MBEC 3QHZL 3O11A 1N7ML 4P2QE 5I1IH 1W72H 3VXTA 3RWJA 3HUJE 4EOWH 1CCZA 2XV6B 3KPTA 2YZ8A 4G6FB 4H20H 4P5MA 1PDKA 3WFBH 2ZKHH 5AZEH 4RBPK 3N85L 2VDQL 5IGXL 5H37H 1EJOL 3VXQB 4Z7UB 3VW3L 1L0QA 1F4HA 1JBJA 1YMHA 4G8IB 3BWUC 3D39A 1K4CB 5DI8A 3T4AB 3EJJX 3PP4L 1NGZB 5EA0L 2IAMB 2JF1A 3X11B 2JKXA 3G6DL 3SE9H 3ZL4L 4GAJL 1B0WA 4M3JA 4XXCA 3S3PA 3WFHB 3FT2B 4ODXB 4PJEF 1KUMA 3EFFB 1G9MC 4JPKH 4L4JA 5H2BA 1S9YB 2XTJD 5FGBC 4DUXA 3O6FD 3RWJB 1LK2B 5F1SA 3C8KA 3FB5A 1OF2A 3U79A 1O0VA 4JFPA 4AT6A 4K7PH 1B0RA 2X4TB 3C60A 5F21B 3CX5J 4X5XB 4RMUA 1KYOK 4YWGH 5HY9A 1CIUA 3PNWA 3T0DA 1NCTA 1QSFE 1IKNC 3QFJD 3UPCA 4BKLB 1JTOA 4NQED 4YBLB 4R7NA 4NUGH 4YGAB 4ZG1A 1WBZA 2YR3A 2L7UA 4NKDA 3BQUA 4MDJB 2ZSWB 3QDMA 4YFEA 1MRCL 2CUIA 3PQYE 2QHRL 4KI5C 2UY7A 4Z95H 1YYML 5JPMB 3N1QC 3B9VA 3K0WA 5ENWB 1FNHA 1C5CH 4Q7DA 3MJ9H 3DIFB 3QA3A 4P23B 3VFPA 3IFPA 1U8OA 1ZLVH 3VFMB 2ORBL 3VFWA 1SVCP 2BNQE 4YDKH 1B4JH 4ZFGL 2FYYA 4XC1H 4FTVB 5C2BL 5ISZA 1MHPH 3OJDB 4NC1C 2B1HL 1UA6L 3KPSA 4YUEL 5D1ZC 3DXAB 1Z9MA 4O4YL 1EHAA 3U46A 4FTVA 1CDCA 4KQ4L 5DEGB 3A6CH 2I9TB 3UZEA 2UV3A 5DEFB 3DYPA 3W0WD 2AKRA 3SDYL 1HZHH 1KPVA 2GYSA 4P4KD 2EKJA 3MLXH 4MD5A 3FONB 4DZBB 4XNQA 1RD6A 3CSPA 2VISA 1KELH 5D7IB 2VL4A 4JVUA 3VXMD 5HHVH 1YMMD 3KPRA 3QUXB 2BP3A 4XWOD 1YQ2A 5KSUA 1R0AL 2GTWA 4UU9A 4HXBL 3K1DA 5EULV 1IM9B 5CMAA 3MJ8A 2IANA 4N0RA 3QDGE 4YXLL 3OKNA 3V4VH 25C8H 2AEPH 2IH3B 4LCCC 4F8QA 4OBRA 2KZ1B 2W9EH 3ZDYE 1FFNB 2DAVA 1JCKA 4UT9H 2XY1A 1OVZA 5ADOH 1XR9B 5BW7C 5EBWB 1EV2E 4R8WL 1AGDB 1QEWA 4OF0A 5DA0B 4YDJA 5E5RB 4K7FA 1HXYB 1QBMH 3C5SA 4Y16A 1KT2B 1P1ZB 1I8KB 1FFNA 3EOYG 4OUOA 1A3LH 3CU7A 5F3HA 4IJ3C 4PV9B 4Z7VF 3UDWC 1JYNA 5SWQB 3JWOL 2ICWB 4I3RH 5JR1H 4GKNA 4NOBA 2VLRD 3ALXA 4OZ4A 2XRAL 5TQ0H 1FIGL 5LQBH 5D5ME 2VLRA 3ILPA 1IAKA 4OI9A 2Y72A 2Y06H 4M3KB 4ZODA 3RZCB 1ES0B 5F88B 5HPMB 5IUSA 8FABA 4KK6C 2XTJE 5GRUH 2A0LC 3HUJA 5CBEB 4JFFA 3QIBC 1DQDL 3LEVH 4R26H 3GRWH 3ZDZF 5IW3A 2YPLB 1AO7A 3MRPA 4GAGH 2OS7A 2GITA 3JWDL 4KHTL 1QO3B 2FZ3B 2A1WL 3UBXI 1JIBA 4B7IA 4FMKA 4OCSL 3MNWA 5EZIH 1OAQH 5BVJA 3QA3B 3KR3H 1KJ2A 4F7PA 1T3FB 4X80H 5KSBB 4JN1L 4KUZH 2W60B 4EDXB 3SE3A 5E08L 1AHWA 1FVEA 4GSDH 4ZD3L 3MOAH 3VD3A 4OGAD 2VYRE 2W60A 1OTUC 4EDXA 4ZO9A 3MNZB 1QSZA 5T3ZE 1T3FA 5MEQB 4Y16C 3EO0A 4LU5H 2G5BB 5HYJD 4NM8H 1MRCH 5D2LA 4Z95L 3VGAC 4PJFF 4POYA 1G7HA 4IRJA 4MD0A 3VFRA 5LBSH 3EOTH 4ELKB 4IMLB 3CFKB 4K7FB 3VG0L 2F5AL 1S7TA 3WNOA 4HIHA 5ADOL 1NEZA 2Z4QA 3EYSL 3ZTNL 4D8PB 4JFFB 2JCCF 3NFPA 5I1DA 1U58A 3KDMB 1UWEL 2YUZA 3KPNA 4P5TB 1MUJB 1UH2A 2ADGA 4YHOL 5HHME 2NW2B 5C08E 3U9UA 3GJEA 3VFVA 2QQNH 4QCIA 4QHUB 1OAUL 4XBPA 4XWOC 4HHAB 4X4ME 4MXVE 3QIUB 2A6KB 3P30L 1LK3H 2DYPD 1JTTA 4YGVB 1D6VH 1A7OH 5GGVH 4HUMB 5K9OB 3QYCA 3IDGA 1F42A 3GSNL 5IVZA 5HI5C 3BE1H 4KK5C 4ZXBD 4MA8L 5DMIL 4XH2A 5GGVY 1A1OB 3ARGA 2HFFB 4HKZA 4QRRA 2G75A 4LASL 4ONFH 3B2VH 5F1OB 4JJHA 3IKCA 4LPXA 3LKSA 4M43H 4ZFOA 5IF0A 1ZT7B 5DJ2B 2R69L 3RZWA 4X7EC 1HDMB 4OBSA 2BNQB 1Y6NR 5I30H 4J3UA 3DARA 2EO1A 2V9QA 3P4MA 4NQCD 5LXGH 3IT8D 4XI5C 3WFBL 3LMJH 5FYKL 4TPRL 2ESVA 4FXKB 4GBXC 3CZFB 2VRAA 1RULL 1SMAA 3DMMB 5AG8A 1J5OH 4GSDL 4ZD3H 4EI6B 4PJXE 4U6VH 2VQTA 3P4OB 5FCUH 4BZ2H 3Q6GL 1JZ3A 1J86A 3HFMH 4BUHA 2WQ8A 3V0VA 4JO3L 1CF8L 4H88L 3FO1A 3CFKA 4WFEE 3NIFF 4P9HH 2UYLA 1EEZB 1MFBL 4R97C 1IC4L 3TZVD 3VXSD 3PUCA 2WW8A 4HFWB 1RJZB 4R0LB 1AY1H 4E41A 2E6PA 4R4FL 4UBDC 1L7IH 4GFTB 1W72A 4MAYB 4XBEH 4O2FB 4OLXL 1A7BA 1NCUA 2A9NH 3KXFB 3P73A 3QI9B 5EZOH 5DSCA 5HXMA 4FQXB 4X98A 1A1MB 4N0CD 1SYVB 4DZ8B 4RA0C 3O6FC 2X1QA 2CLVA 2DKMA 2XTJC 4OZIA 3I50H 1AC0A 4R4NC 2OL3A 3QUZD 3LB6C 4FQJH 2HVKB 2GJ6B 4N0UB 4ZUWA 2GJZA 1IEAB 1HINL 1B3JA 2AJUL 2IMNA 4PG2A 1JZ5A 3UBXG 1A6UL 1U6AH 3ZL4H 4WTXA 4OI7A 1WC7A 3QQ4A 2ZCHH 3O6LL 2IEPA 4BH7B 1LO3L 1KLFA 3TN0A 1F11B 4OF8A 3WLBA 1K85A 2Y07H 2LABA 1A47A 5D7LD 1T1XB 2V2XB 2W59A 3LQZA 4XMKL 3JBG7 3HLAA 3RWHA 1DEDA 3FQRB 1ACZA 1EO7A 4KWUA 4WFGE 4JQXC 2APVA 1X5LA 3GI8H 5HHOA 4KUCF 2RQ8A 1NJ9B 5DO2C 4PRHB 5SWSB 5H94A 3IJSB 5IVOA 3WDJA 2SEBA 4D0DB 5JOEA 3Q6FB 1KTKE 1QBLH 5FOBA 2B1AL 1JUFA 4WEMB 1HILB 2G5RA 5GS1C 1KEML 3BVNB 4PJ9C 5HHOD 4FQJL 1X5GA 1AGBA 2EIEA 3EZ8A 4LHUA 5GRWA 3CPLB 2Z31B 4OLUL 5LVEA 2Y25A 5DJ8B 4WWID 1K8IB 3HNVL 1PG7H 3MACH 4JHAL 4U1GC 3SQOH 5F96H 2Y6SD 4MNQE 1J0ZA 1NC2B 3BD3A 1CL7H 2VLME 4BUGA 4DOHB 4WFFD 2CKBH 2CLVB 1GRWA 4NNYB 4PG2C 5C9JA 2X9WA 1S8DB 1UCBH 4TSBH 1T1XA 2V2XA 1KN2L 3DUUA 1RUQL 3L7EB 1R3IH 5A2JH 1NUDA 2GJZB 4MJ4A 3GSNB 3UP1A 3RBGA 3IDYB 4JHZA 5E8NA 3I50L 2IWGA 3W9DB 5D70H 3ARBB 3UTQB 1KCUL 1F4YH 1U8NB 3FZUD 4H26A 3VG9C 4PGBA 3X17A 1ERNA 3UCRA 5MERB 1MJ8H 3PG2A 1S7QA 1ED3A 5ITFB 1YQVH 2NTFA 2JLLA 2AP2A 2QQLL 2WMPA 5C6WH 4X9FA 3O6MH 2YPKA 3MCKB 3GIVB 4HCRL 4K3GA 4N8VG 5J6HB 4I4WA 4MMZC 4WWKB 2IQAB 2E9JA 1BD2A 1H3VA 4Z7VE 4MA8H 3L3DA 1NGYA 3TFKD 2GAZA 3BYTA 2D7PA 1MAML 3L3JA 1RPQA 3ZTJG 4ETYA 3MQIA 2QSTA 2H8PB 4M7ZC 1U92B 3T0VA 3UEZA 4MLSA 2DI8A 3FRUB 4ZSOB 1A2YB 5F1KC 2HVJB 2OJZH 2XWBB 3SDXF 3L6FB 1FBIH 5IMLB 2DQTH 5ESQB 4MQXC 5E8DL 4PTUB 1ZHBA 5FYJH 1S7RA 4NZRH 5JDJA 1CFBA 1CXKA 4HZLA 1WUNT 4OZ4B 4F15C 1L4IA 1RJLA 2VUYA 1LK2A 4TNWK 1KEGL 4YBHA 4HQQH 1C08B 4U49A 3V7MA 5C0FB 4OLZH 3SO3B 1FNFA 2OI9C 3DVGA 4PBVC 5EU6B 4HJ0C 1NCWL 3EHBC 5D7LE 2J4WL 3ZHDA 3EDJA 5BZDB 2KL6A 4K7PX 2YUVA 5IVXA 1Q1JH 2BNUB 1BGXH 2LU3A 3K2MC 4OSUH 4JZNA 1D6EA 3AS2A 3RL1B 1CFTA 4YDJB 5C0FA 4NM8L 5DUBA 2BVEA 2EDWA 3BEVA 4LP4A 1U8PA 2JJUA 5ESVB 2VLKB 3HI6H 4J7RA 4WFHD 5D7JB 2Q20A 3ZTNH 5CGTA 3R0NA 1U3HA 5T1KD 3NABL 5D7KD 3G6AA 4OZGA 3F8UB 4U1NA 4WNQA 4DOHE 4WWKA 1TDQA 4MA3A 4X6EB 5IESH 4HJJL 3QAZB 3NBNA 2G5BA 3ARBA 3UTQA 1WFOA 4NC2B 4UOW0 5C6TH 5I8KH 2P45B 5HHNB 3EOAA 2VXSH 4LNVA 4EBQH 1LEKA 4N0FB 3BGFC 4X6CA 4LSVH 3HKFA 3NCYP 4I0CC 1EJ6A 4DQOL 4JGMA 2BY0A 3D18A 2RFXA 2XQYG 4L9LC 5HHXH 5FO9A 4LSDA 1YY9C 3MLUL 5DJ6B 2FJGB 1I1AB 2V7NA 3V6BR 1KJ3H 3ARFA 4WU5B 4K94C 1T7WA 4FQHA 4QXUH 3ULUH 2GJJA 5F9WC 1OT2A 2P5WE 4AEIH 5ACMA 1T03L 1JFQH 4MB4A 5F89B 4M7JH 4OZHE 4S1DC 4OT1H 4UI2A 1IM3A 2NW3A 4L1DA 5MEND 1JHLH 4G6JH 5SWQA 4HBQA 4EUPG 4L3CA 4G7YL 4KMTH 5FUCE 1UXSA 35C8L 1FGNH 3ROLA 1SBBA 3HG1E 4HIIB 2AI0H 4YJZL 2UWEB 1TZGL 5FM8A 4PJIE 5GGTH 1WFUA 3UYPA 4O9HH 4WI2A 4PJXF 4BA8A 4PLJD 1JYVA 4HK3J 4AT6B 5JHDE 5IBLD 3NFSL 4JKKA 3E6HA 3HB3D 5HHXL 3MNVB 5C0AD 4KDTC 3ARGC 1MWAH 1AGFB 4RZCA 4N8PA 3KLAB 1S9YA 2CRMA 1I1CA 1DVFB 5KOVC 3VJ6B 1I3VA 5D71H 1VGKA 4QF1B 1XF4B 1B0GA 1IGCL 1CDJA 5DVOA 1G0DA 3D6GA 5JXAH 5C07B 3TJHD 3GO1H 5ESAA 1RZJL 3I02B 4XNQB 4PP2A 4FQXC 4QXGL 1NMAH 3BIBX 4XBPB 4I0PD 1Z9LA 2PNDA 4HIJA 2AJUH 1C16B 2NY4B 3EJZC 4OV5A 4LDEB 2CUMA 2D0FA 2EH7L 1YEGH 3MRMB 5EORH 4G8EA 2X4RA 3STLA 2VLKE 3SDDD 3RU8H 4U1SA 1BMGA 5KG9A 4O9HL 2PW2B 3VFTB 5FM4A 2GFBB 3TO4D 4JCLA 4P2OD 3VGDA 4PJBB 1T5XA 5GJSH 1JGEA 2Q6WB 4XNUH 2OTUA 2DM2A 4OGYL 5JIPA 3VFPB 2CR3A 3GI8L 4PRAB 1K9TA 5LWYH 4ZXBB 4U1KA 5B3JE 1LDPH 4XNYL 5LGHL 3U0WL 4OT1L 4XNXL 1HI6A 1F6AA 3LOWA 1UM4H 1II4E 5HVHB 1RI8A 4X4ZA 2C4XA 1GGTA 1I1AA 3MRBB 2V9RA 1N0XH 4L8CB 1J0IA 2DLIA 5CKGA 2QSCL 4LGPB 3WJJA 1IVLA 3U36A 5F6HI 2XG5A 3QUMA 5J1AB 1BF8A 4Z77B 1T0MA 4Q2ZA 3L5XH 1GAFH 4JFOA 3V8CA 3L3KB 1JI2A 5EUOA 2VQ1A 3TO2B 1DDHA 4D9QE 2DQDL 5EG6C 1NAML 4JFHD 1U8HA 5C0AA 2FATL 3VH8B 4G6KL 4KRNA 1YY8B 3EYFA 2ATKB 4P23C 2FR4A 4M61B 4NQTA 5T1DL 2W9LA 1NPUA 5KSAC 2WINB 3D0LA 1S5HB 3LH2L 2ADIA 1Z6JT 4ELMB 4HS6A 1A7PH 4IIQC 2R2BA 3L5JA 4DGVL 5MENE 1IJ9A 4HWUA 5AG9A 1FH5L 2XXMB 3Q5OA 4OD2A 5F9OH 2E3VA 1T2QH 3SE4C 3MC0A 1FV1B 3QEUB 3KXFD 4LLYA 2C1OB 3LEYH 1MJ8L 1H5BB 4GAJH 3TT1H 4BQCA 4LGRB 2EDFA 3T04D 2DIJA 1VACA 1UJTA 4JHWH 4NQDB 1H5BA 1MCDA 1NC4D 3CVHL 4PTTB 3U30C 2CXGA 4MJIB 4L3EB 4PJ9B 5JHDD 5KS9B 3MLVL 1GGIL 1P4LB 2IBZX 3O9WB 5C0AE 3VXNB 1Q94B 1QACA 4U6XB 2MCPL 5I1DB 1A6PA 2XFXA 1MCLA 3G04A 4RGMC 5LBSL 3T0EB 1T6VN 1HH9B 1U8MB 2ADJA 3WS6C 3S88H 1ZVYA 3VDAA 3VFVB 1FVEB 2ATKA 1A5FL 2EEDA 3H6JA 3VI4F 4AL8L 1OSZA 3RGVC 1EAJA 4E41B 2R0WH 1FNSL 3C2AH 4KVCL 3K81A 1WT5C 4DKFL 2VABA 4OV6F 2RR3A 3T3PE 5IMKA 5DMGD 3EYOB 3O3EA 3IKKA 1ZEAL 4S1SH 5ACZA 2N4IA 5L0QC 1IFHL 3MGAA 1TVHA 2ED9A 2OMBA 4TUOA 1IQDA 1NMBL 4KGLA 4LEXL 1S7SA 4HD9A 5ERWB 5F8RC 5DHVA 2R39A 12E8H 3BT2H 1EDQA 2DMKA 3CFCL 5A2KH 5I9QB 3UAJC 5HYJB 1IGFL 2LV4A 4HEPG 5IB1A 2W07A 3I6GB 3TH3T 2F5AH 4F7CA 1T1WA 5JO5B 1RJZA 4R0LA 3X13A 4LVNB 4DGVH 4JVWA 1FHGA 1OW0C 5E9DE 4JAMA 4GRWH 4WW1B 4H26B 3MUGA 3X3FL 3CPLA 4GW4B 4R0LC 1A6UH 4LPUA 4X8XA 4V1DA 3QULB 1W0WB 1LMKA 3KPMB 1VKXB 5GS0C 3NZHH 4Y19D 3BO8A 5A2LH 3VXRE 4NZJA 5IVXB 1UGNA 4DAGH 1IAII 4CMHC 1U95B 1AHWC 1XGPA 2ITDA 4G43A 3W9EA 1MCHA 2Q7YB 2D0GA 4M02A 3TC9A 5IP4A 1QP1A 1A7OL 5KJRH 3MO1A 1J1OL 4RNRB 2VN7A 2Z35A 3EIFA 2RGSA 3A67L 3F5WA 1NGPL 4F7EA 4G43B 2X70A 2C1PA 2R2HA 3C5ZC 5E00B 3HMWL 3SDAA 3NIGE 2RBLA 5FAAA 3EOBA 4HLZG 1F58L 3DI2B 3BPCB 1P4BL 4IHOA 3E3QC 4MNGB 4O02L 1ZTXL 3DSFL 4OIAA 4XNXH 3SGDI 4TRPH 3SY0A 4LVNC 1RUPL 3FFDB 5I15L 4J6RH 3MRDA 3QWRD 1REIA 3BISA 2IFFL 2FECI 1PKOA 3QFJA 4NRYA 4Q6YA 4OLVH 4HK3N 5T33L 2R9HD 1ZT1B 2GSGB 4UV7L 4XRCB 2DS4A 2NZIA 4G6AD 4YHML 1IAIH 3LEYL 4I18A 3ARDD 2H26A 1WZ1L 1XGPB 2CO7B 2W0KA 5C0DB 1S5IL 3GDBA 4KK9D 1MNUL 1YDPB 4HS3B 2BJML 4DTGH 4LAQL 5IB5A 4FQ2H 3CVHH 4XPFL 3PGDB 2XPGA 1T1ZB 3O2DA 4DVBB 3M8OH 4LP5A 3WS3B 3T8XB 3RWEA 2YXMA 3DUHA 4DFHA 4XB8A 2P8PB 2I9TA 4M03A 5D72L 2B4CC 4F7MB 4JFZL 3VFUB 2Y5TB 4OCYH 1U8IA 3WS3A 4AIOA 4P23A 1WSST 5FM5M 1W2KT 4QLRA 1I9EA 3PHQB 4OQ1A 3GZKA 5IEKB 1V3MA 3TM6A 2VDOH 3B9AA 1N0XL 4TNVF 2DL9A 4YK4B 1NBZA 2AQ1A 5EOCJ 3HZYB 1NBYB 1T20A 4BKLA 3TNMA 3TT3H 5KVFH 5DJCB 1W8NA 2V9TA 3SCMC 3VRIB 4NIKB 3O2VH 3EJYC 5AYQA 1XR8B 1DL7H 1ZK9A 4JPIA 3FCTA 2YWZA 1NLBL 5AAMA 2A9MH 1CS6A 1MCPL 1HILA 2HP4A 4HZLB 4EN3D 3D3VD 3AAZB 4JB9H 4U31A 2EYTB 1BJ8A 2VQUA 4WCYL 3GSWA 4G5ZH 4JEGB 5DHVH 1KCUH 3OWEA 3IJSA 3BN9C 1RZ7H 4LL9A 4YZFE 3P0YL 3RZCC 3FQTA 4WI4A 3SDDC 5B39A 1X5IA 3SDAB 3HHRB 4U0RB 1OSPH 3TBYA 4TSCH 2XI9A 3OR6B 1YNTA 3WL9A 1AQDB 1JPFA 5E99L 5FUZH 3H9SE 3WFEH 3L6FA 4L29A 3IS0X 2IQAA 5D96C 4M6OH 1NBYA 1T20B 2BSTA 4LASH 4ONFL 2QQKH 4HKJA 4LQ1A 1BBJB 3MX0A 3RWCB 2P7TB 2VZTA 3VE0A 3O4OB 5IFAH 1XR8A 5BRZB 3MBXL 3ARFB 3AUVA 1Q0YL 1SJEB 4R96A 4WU5A 4KXZI 5I16A 2QQQA 1AD0B 2IANB 1MAKA 1NANH 5C9KA 5ALBH 1FVDA 4LLVA 4U6YA 1FYTD 4LCCA 4K07A 3FOMB 2FO4A 1AHWB 1MLCB 3QNZB 3THML 4H1LA 1TJHH 1RZ7L 3ILQD 4WW2A 4ONHA 2R56L 4JG0H 5E56A 1SJVA 1KV3A 2HRPL 4ZFFB 4Q9RL 4MD0B 1F45A 3N1MC 3VXSE 4WNQB 3HMXH 2OXHA 4GRLC 2A6IB 5L2KB 3MMEB 5D8JL 3OQ3B 4PJ7A 3PDOA 3SBWA 3MGTB 4MQSB 5BJTA 4NQVB 4KY1H 1RSFA 1TQCB 3J8F7 3QUZC 3TIEA 3EYVB 4D3CH 1OF2B 4GRWF 2YRZA 3FT3A 3HNSL 1UM5H 2W92A 3ZT7A 5GRYA 4FP8H 5FECB 3K8KA 5KTEH 3MRJB 3P11L 1CDIA 1ITCA 2DD8H 4CNIA 4HWEH 4AM0B 3MLZL 3JVGC 3N9GL 4GRMA 4G8FB 4WEUD 3R1GH 1YC8A 2BVOB 3FN0L 1A3LL 5KSAB 4I3GA 5CILL 3Q1SL 8FABB 1EHLL 4BH8A 5A2FA 2BSSA 4Z7QE 2IF7A 5CGMA 4NBYB 2LU7A 4A6YH 4JZJC 5D7IF 3VI3F 3VFNA 1HH9A 1I9JL 2R2BB 4UQ3A 1X5FA 4K2UH 2CGRH 3T3PF 3MYJA 5EU6D 4QNPF 1IC7H 5C70A 1KPRB 1JPFB 4LLYB 3PL6B 3LZFH 4MXVF 5F3HB 3U30B 2BVQB 2EDDA 4KQ4H 1AKJB 4QHMB 4Y8DC 4GAFB 2DIBA 2EKSA 2G75B 1GGCL 2KH2B 3ARUA 2IQ9L 3H7LA 5IESL 4OLVL 3RDTB 5GSRB 3RVWD 4QOKB 3F7YB 2HLAB 5FEBA 3MV7A 3EHBD 3D9AH 2FGWH 5JLZA 3MXWL 4OZFG 1I8IB 2EXYC 4Q97A 1A6WL 5HI5D 4U3HA 5D2LB 4AEHL 2CJUH 4PR5A 5EO1B 4YH6A 3CSYA 4HIHB 2ESVD 4OZHB 4LLUA 1KIRA 4Q6IB 4JFDB 2D7NA 3OKKA 3LKOB 1MUJA 4KGJA 1YY8A 1LEKB 4L8SC 5CZXD 4NO5A 2W0FA 4ONOA 3KJ6H 5EU7C 3HZKA 2W9DL 4P49A 4KROB 2JK5B 1MHCB 4RCAA 3MRNA 2ZG1A 4TNWF 3QWRA 3HMWH 1ULVA 4GAGL 1U8MA 1P6AB 2UY6A 3TLRA 3U36B 1TENA 3MRFA 2EC9T 4P2RD 1VADA 1RK0A 3CVHA 3MV9E 3VCLB 1U8KA 5JZ7C 3LN4B 4O4YH 3O9WD 4MNQA 4XVJH 4Y4KC 4LEOA 1C7TA 5INCB 1FVCB 4PJ5E 3U82B 5JNYB 4GBXA 5I1GH 5TQ0L 5DLML 5KSBF 4X5WA 1YECH 1OSPL 3WNKA 5T3XH 4OGAC 5A1AA 1J11A 4M48L 4X9GA 1HYSD 1XGYH 1H0DB 2BVPB 1NFDA 4L9DA 3UPAA 1VESA 3P9WB 3BPNC 2VXUH 2VC2L 3VXNA 4RGNB 5DK0B 2RAMA 1ZT7A 5DJ2A 4DGYH 3PDGA 4LAJH 1LD9A 4CU7A 2JE8A 1F3JA 3LV3A 3LPWA 4LPVA 1KXQE 2H6PB 4PJFB 4RDQG 1D3CA 2VL5B 1JNNL 4NQDE 1RUPH 3O8XA 5ANME 1VPOL 2LAAA 3MLRH 2Q7YA 4Z7NE 1ES0A 2BY1A