3U9RB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc), beta subunit
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
536
structure length
536
Chain Sequence
b'HMAILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLAGPPLVKAATGEVVSAEELGGADVHCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGFMVGQKYEAGGIAKHGAKLVTAVACARVPKFTVLIGGSFGAGNYGMCGRAYDPRFLWMWPNARIGVMGGEQAAGVLAQVKREQAERAGQQLGVEEEAKIKAPILEQYEHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methylcrotonyl-CoA carboxylase, beta-subunit
publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
total genus 188
structure length 536
sequence length 536
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9rB02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9rB01
3IB9A 4KNPA 3FF6A 4ASIA 4OG1A 1FC7A 5DL1A 5DU4A 4EMMA 5DUFA 4MOUA 4EMPA 4FN7A 4ZDBA 1WZ8A 4G2RA 1OD4A 2PPYA 2Q2XA 2HW5A 4MXIA 4B3HA 4ZDDA 1XO6A 2J5GD 1MJ3A 3GF7A 1DUBA 2J5IA 5KDRB 1HNOA 3IBBA 1FCFA 3G64A 2D3TA 3U9RB 3ZW9A 4JCSA 2VSUC 1WDMA 3PGQA 3Q1TA 3U9SB 3MYBA 4L6WA 1WDLA 2PBPA 2DEOA 3KQFA 4KD6A 5DTWA 4RCNA 3GF3A 4JFCA 1NZYB 5DKPA 3TVUA 1DCIA 3BF0A 2FW2A 5FUSA 2F6QA 4KWBA 3ISAA 2ZQRA 5E0SH 1PJHA 4EMLA 1EY3A 3PZKA 3MOYA 4JVTA 2VSSF 4IZCA 3Q0GA 2J5SA 1RJNA 3MFMA 3TZ3A 1ON9A 5E0NX 3V5IA 3TT7A 3P2LA 3ZWCA 3GLMA 3H0UA 1XNYA 2ZQQA 4FNDA 4NEKA 2Q34A 3HE2A 2UZFA 2PG8A 3QK8A 3RSTA 4ZDFA 4U0GH 1UIYA 3IAVA 4JCRA 4FB8A 4K29A 5JBXA 5INGA 3OMEA 4ELSA 4JWVA 3V5EA 4ZDEA 4JCTA 1VRGA 3U9TB 3PEAA 2BZRA 3NJBA 2J5IB 1FC6A 4FNBA 4OLQA 3Q0JA 3P5MA 4U0HA 1OD2A 3K8XA 1WDKA 3STAA 3TV5A 2F9IB 3NJDA 4LK5A 1N6EA 4ZU2A 4GM2A 2CE3A 4K2NA 3R9SA 1TG6A 2VX2A 2F6IA 2F9IA 5KJPA 5MGBA 3TDCA 5DTPA 4QFEA 4B3JA 1Q52A 4F47A 4KPKA 3T88A 3QWDA 3QMJA 3QYRA 3H0QA 3QKAA 1ON3A 1XNWA 4ELWA 5C90A 5E0SA 1UYTA 3R9TA 1N6DA 1PIXA 3H02A 3ZW8A 4HNKA 3GKBA 2Q35A 4U18A 4JSBA 2NP9A 2VSUF 3VIVA 3SWXA 2VSSE 4IZDA 3H81A 3T3WA 3TT6A 1HZDA 5DUCA 3QREA 4U0GA 3ZWAA 3QXZA 2DUBA 1EF8A 3JU1A 3PE8A 4FZWA 3KTIA 3HINA 5CTBA 4FN8A 5G1RA 5DZKH 3KTJA 4QIIA 1Q51A 4ZDCA 2J5II 3TVWA 1YG8A 2ZL3A 1YG6A 4K3WA 2FBMA 3KTKA 4QIJA 3L3SA 4I42A 1RJMA 2X24A 2ZL2A 3Q7HA 3BPPA 4L8KA 2CBYA 3KTHA 2C8TA 5INIA 5DU8A 3TRRA 4DI1A 2VREA 5G1SA 3SLLA 4IZBA 3R9QA 1UYVA 3R6HA 2J5GA 1UYSA 5DU6A 5IKLB 2X58A 5JBWA 3BEZA 3HLN1 4MI2A 4GHNA 3H0SA 2ZL0A 3R0OA 4U1AA 5G1QA 3P85A 3LAOA 1JXZA 3MT6A 4OMRA 2EJ5A 1EF9A 1SG4A 5KDRA 3DJAA 5FIFA 3N6RB 4WCZA 3RSIA 3T89A 4FJWD 4FZWC 4JJTA 2ZL4A 4I52A 3OC7A 1J7XA 3T8BA 3M6NA 4NNQA 3GMAA 2FZSA 4Q1IA 3HRXA 1X0UA 4WYOB 2QQ3A 2F9YB 1FC9A 1XNVA 3K50A 1K39A 2IEXA 1O8UA 1N6FA 4I4ZA 1NZYA 1Y7OA 2VSSA 3QXIA 3I47A 1SZOA 4JYLA 3H0JA 1UYRA 4B3IA 1TYFA 2VSUA 2F9YA 4HC8A 3M6MA 3OT6A 2VSUE 1W2XA 2A7SA 4JOTA 4RYFA 3LKEA 4JYJA 1HNUA 3RRVA 5INFA 2GTRA 4RYFH 4YLHA 5DZKA 4U19A 3HP0A 2W3PA 3KTGA 5C9GA 4Z0MA 3T8AA 3WG5A 4Q0GA 3ZWBA 1XX4A 2A7KA 2WTBA 3TLFA 3DORA 4JCQA 2A81A 5CTCA 1K32A 3ST9A 4ELXA 4WZ8B 3FDUA
chains in the Genus database with same CATH superfamily
3IB9A 4KNPA 3FF6A 4ASIA 4OG1A 1FC7A 5DL1A 5DU4A 4EMMA 5DUFA 4MOUA 4EMPA 4FN7A 4ZDBA 1WZ8A 4G2RA 1OD4A 2PPYA 2Q2XA 2HW5A 4MXIA 4B3HA 4ZDDA 1XO6A 2J5GD 1MJ3A 3GF7A 1DUBA 2J5IA 5KDRB 1HNOA 3IBBA 1FCFA 3G64A 2D3TA 3U9RB 3ZW9A 4JCSA 2VSUC 1WDMA 3PGQA 3Q1TA 3U9SB 3MYBA 4L6WA 1WDLA 2PBPA 2DEOA 3KQFA 4KD6A 5DTWA 4RCNA 3GF3A 4JFCA 1NZYB 5DKPA 3TVUA 1DCIA 3BF0A 2FW2A 5FUSA 2F6QA 4KWBA 3ISAA 2ZQRA 5E0SH 1PJHA 4HDTA 4EMLA 1EY3A 3PZKA 3MOYA 4JVTA 2VSSF 4IZCA 3Q0GA 2J5SA 1RJNA 3MFMA 1ON9A 3TZ3A 5E0NX 3V5IA 3TT7A 3P2LA 3ZWCA 3GLMA 3H0UA 1XNYA 2ZQQA 4FNDA 4NEKA 2Q34A 3HE2A 2UZFA 2PG8A 3QK8A 3RSTA 4ZDFA 4U0GH 1UIYA 3IAVA 4JCRA 4FB8A 4K29A 5JBXA 5INGA 3OMEA 4ELSA 4JWVA 3V5EA 4ZDEA 4JCTA 1VRGA 3U9TB 3PEAA 2BZRA 3NJBA 2J5IB 1FC6A 4FNBA 4OLQA 3Q0JA 3P5MA 4U0HA 1OD2A 3K8XA 1WDKA 3STAA 3TV5A 2F9IB 3NJDA 4LK5A 1N6EA 4ZU2A 4GM2A 2CE3A 4K2NA 3R9SA 5HUQA 1TG6A 2VX2A 2F6IA 2F9IA 5KJPA 5MGBA 3TDCA 5DTPA 4QFEA 4B3JA 1Q52A 4F47A 4KPKA 3T88A 3QWDA 3QMJA 3QYRA 3H0QA 3QKAA 1ON3A 4J2UA 1XNWA 4ELWA 5C90A 5E0SA 1UYTA 3R9TA 1N6DA 1PIXA 3H02A 3ZW8A 4HNKA 3GKBA 2Q35A 4U18A 4JSBA 2YJGA 2NP9A 2VSUF 3VIVA 3SWXA 2VSSE 4IZDA 3H81A 3T3WA 3TT6A 1HZDA 5DUCA 3QREA 4U0GA 3ZWAA 3QXZA 2DUBA 1EF8A 3JU1A 3PE8A 4FZWA 3KTIA 3HINA 5CTBA 4FN8A 5G1RA 5DZKH 3KTJA 4QIIA 1Q51A 4NARA 4ZDCA 2J5II 3TVWA 3BPTA 1YG8A 2ZL3A 1YG6A 4K3WA 2FBMA 3KTKA 4QIJA 3L3SA 4I42A 1RJMA 2X24A 2ZL2A 3Q7HA 3BPPA 4L8KA 2CBYA 3KTHA 2C8TA 5INIA 5DU8A 3TRRA 4DI1A 2VREA 5G1SA 3SLLA 4IZBA 3R9QA 1UYVA 3R6HA 2J5GA 1UYSA 5DU6A 5IKLB 2X58A 5JBWA 3BEZA 3HLN1 4MI2A 4GHNA 3H0SA 2ZL0A 3R0OA 4U1AA 5G1QA 3P85A 3LAOA 1JXZA 3MT6A 4OMRA 2EJ5A 1EF9A 1SG4A 5KDRA 3DJAA 5FIFA 3N6RB 4WCZA 3RSIA 3T89A 4FJWD 4FZWC 4JJTA 2ZL4A 4I52A 3OC7A 1J7XA 3T8BA 3M6NA 4NNQA 3GMAA 2FZSA 4Q1IA 3HRXA 1X0UA 4WYOB 2QQ3A 2F9YB 1FC9A 1XNVA 3K50A 1K39A 2IEXA 1O8UA 1N6FA 4I4ZA 1NZYA 1Y7OA 2VSSA 3QXIA 3I47A 1SZOA 4JYLA 3H0JA 1UYRA 4B3IA 1TYFA 2VSUA 2F9YA 4HC8A 3M6MA 3OT6A 2VSUE 1W2XA 2A7SA 4JOTA 4RYFA 3LKEA 4JYJA 1HNUA 3RRVA 5INFA 2GTRA 4RYFH 4YLHA 5DZKA 4U19A 3HP0A 2W3PA 3KTGA 5C9GA 4Z0MA 3T8AA 3WG5A 4Q0GA 3ZWBA 1XX4A 2A7KA 2WTBA 3TLFA 3DORA 4JCQA 2A81A 5CTCA 1K32A 3ST9A 4ELXA 4WZ8B 3FDUA
chains in the Genus database with same CATH topology
3IB9A 4KNPA 3FF6A 4ASIA 4OG1A 1FC7A 5DL1A 5DU4A 4EMMA 5DUFA 4MOUA 4EMPA 4FN7A 4ZDBA 1WZ8A 4G2RA 1OD4A 2PPYA 2Q2XA 2HW5A 4MXIA 4B3HA 4ZDDA 1XO6A 2J5GD 1MJ3A 3GF7A 1DUBA 2J5IA 5KDRB 1HNOA 3IBBA 1FCFA 3G64A 2D3TA 3U9RB 3ZW9A 4JCSA 2VSUC 1WDMA 3PGQA 3Q1TA 3U9SB 3MYBA 4L6WA 1WDLA 2PBPA 2DEOA 3KQFA 4KD6A 5DTWA 4RCNA 3GF3A 4JFCA 1NZYB 5DKPA 3TVUA 1DCIA 3BF0A 2FW2A 5FUSA 2F6QA 4KWBA 3ISAA 2ZQRA 5E0SH 1PJHA 4HDTA 4EMLA 1EY3A 3PZKA 3MOYA 4JVTA 2VSSF 4IZCA 3Q0GA 2J5SA 1RJNA 3MFMA 1ON9A 3TZ3A 5E0NX 3V5IA 3TT7A 3P2LA 3ZWCA 3GLMA 3H0UA 1XNYA 2ZQQA 4FNDA 4NEKA 2Q34A 3HE2A 2UZFA 2PG8A 3QK8A 3RSTA 4ZDFA 4U0GH 1UIYA 3IAVA 4JCRA 4FB8A 4K29A 5JBXA 5INGA 3OMEA 4ELSA 4JWVA 3V5EA 4ZDEA 4JCTA 1VRGA 3U9TB 3PEAA 2BZRA 3NJBA 2J5IB 1FC6A 4FNBA 4OLQA 3Q0JA 3P5MA 4U0HA 1OD2A 3K8XA 1WDKA 3STAA 3TV5A 2F9IB 3NJDA 4LK5A 1N6EA 4ZU2A 4GM2A 2CE3A 4K2NA 3R9SA 5HUQA 1TG6A 2VX2A 2F6IA 2F9IA 5KJPA 5MGBA 3TDCA 5DTPA 4QFEA 4B3JA 1Q52A 4F47A 4KPKA 3T88A 3QWDA 3QMJA 3QYRA 3H0QA 3QKAA 1ON3A 4J2UA 1XNWA 4ELWA 5C90A 5E0SA 1UYTA 3R9TA 1N6DA 1PIXA 3H02A 3ZW8A 4HNKA 3GKBA 2Q35A 4U18A 4JSBA 2YJGA 2NP9A 2VSUF 3VIVA 3SWXA 2VSSE 4IZDA 3H81A 3T3WA 3TT6A 1HZDA 5DUCA 3QREA 4U0GA 3ZWAA 3QXZA 2DUBA 1EF8A 3JU1A 3PE8A 4FZWA 3KTIA 3HINA 5CTBA 4FN8A 5G1RA 5DZKH 3KTJA 4QIIA 1Q51A 4NARA 4ZDCA 2J5II 3TVWA 3BPTA 1YG8A 2ZL3A 1YG6A 4K3WA 2FBMA 3KTKA 4QIJA 3L3SA 4I42A 1RJMA 2X24A 2ZL2A 3Q7HA 3BPPA 4L8KA 2CBYA 3KTHA 2C8TA 5INIA 5DU8A 3TRRA 4DI1A 2VREA 5G1SA 3SLLA 4IZBA 3R9QA 1UYVA 3R6HA 2J5GA 1UYSA 5DU6A 5IKLB 2X58A 5JBWA 3BEZA 3HLN1 4MI2A 4GHNA 3H0SA 2ZL0A 3R0OA 4U1AA 5G1QA 3P85A 3LAOA 1JXZA 3MT6A 4OMRA 2EJ5A 1EF9A 1SG4A 5KDRA 3DJAA 5FIFA 3N6RB 4WCZA 3RSIA 3T89A 4FJWD 4FZWC 4JJTA 2ZL4A 4I52A 3OC7A 1J7XA 3T8BA 3M6NA 4NNQA 3GMAA 2FZSA 4Q1IA 3HRXA 1X0UA 4WYOB 2QQ3A 2F9YB 1FC9A 1XNVA 3K50A 1K39A 2IEXA 1O8UA 1N6FA 4I4ZA 1NZYA 1Y7OA 2VSSA 3QXIA 3I47A 1SZOA 4JYLA 3H0JA 1UYRA 4B3IA 1TYFA 2VSUA 2F9YA 4HC8A 3M6MA 3OT6A 2VSUE 1W2XA 2A7SA 4JOTA 4RYFA 3LKEA 4JYJA 1HNUA 3RRVA 5INFA 2GTRA 4RYFH 4YLHA 5DZKA 4U19A 3HP0A 2W3PA 3KTGA 5C9GA 4Z0MA 3T8AA 3WG5A 4Q0GA 3ZWBA 1XX4A 2A7KA 2WTBA 3TLFA 3DORA 4JCQA 2A81A 5CTCA 1K32A 3ST9A 4ELXA 4WZ8B 3FDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IB9 A;  4KNP A;  3FF6 A;  4ASI A;  4OG1 A;  1FC7 A;  5DL1 A;  5DU4 A;  4EMM A;  5DUF A;  4MOU A;  4EMP A;  4FN7 A;  4ZDB A;  1WZ8 A;  4G2R A;  1OD4 A;  2PPY A;  2Q2X A;  2HW5 A;  4MXI A;  4B3H A;  4ZDD A;  1XO6 A;  2J5G D;  1MJ3 A;  3GF7 A;  1DUB A;  2J5I A;  5KDR B;  1HNO A;  3IBB A;  1FCF A;  3G64 A;  2D3T A;  3U9R B;  3ZW9 A;  4JCS A;  2VSU C;  1WDM A;  3PGQ A;  3Q1T A;  3U9S B;  3MYB A;  4L6W A;  1WDL A;  2PBP A;  2DEO A;  3KQF A;  4KD6 A;  5DTW A;  4RCN A;  3GF3 A;  4JFC A;  1NZY B;  5DKP A;  3TVU A;  1DCI A;  3BF0 A;  2FW2 A;  5FUS A;  2F6Q A;  4KWB A;  3ISA A;  2ZQR A;  5E0S H;  1PJH A;  4EML A;  1EY3 A;  3PZK A;  3MOY A;  4JVT A;  2VSS F;  4IZC A;  3Q0G A;  2J5S A;  1RJN A;  3MFM A;  3TZ3 A;  1ON9 A;  5E0N X;  3V5I A;  3TT7 A;  3P2L A;  3ZWC A;  3GLM A;  3H0U A;  1XNY A;  2ZQQ A;  4FND A;  4NEK A;  2Q34 A;  3HE2 A;  2UZF A;  2PG8 A;  3QK8 A;  3RST A;  4ZDF A;  4U0G H;  1UIY A;  3IAV A;  4JCR A;  4FB8 A;  4K29 A;  5JBX A;  5ING A;  3OME A;  4ELS A;  4JWV A;  3V5E A;  4ZDE A;  4JCT A;  1VRG A;  3U9T B;  3PEA A;  2BZR A;  3NJB A;  2J5I B;  1FC6 A;  4FNB A;  4OLQ A;  3Q0J A;  3P5M A;  4U0H A;  1OD2 A;  3K8X A;  1WDK A;  3STA A;  3TV5 A;  2F9I B;  3NJD A;  4LK5 A;  1N6E A;  4ZU2 A;  4GM2 A;  2CE3 A;  4K2N A;  3R9S A;  1TG6 A;  2VX2 A;  2F6I A;  2F9I A;  5KJP A;  5MGB A;  3TDC A;  5DTP A;  4QFE A;  4B3J A;  1Q52 A;  4F47 A;  4KPK A;  3T88 A;  3QWD A;  3QMJ A;  3QYR A;  3H0Q A;  3QKA A;  1ON3 A;  1XNW A;  4ELW A;  5C90 A;  5E0S A;  1UYT A;  3R9T A;  1N6D A;  1PIX A;  3H02 A;  3ZW8 A;  4HNK A;  3GKB A;  2Q35 A;  4U18 A;  4JSB A;  2NP9 A;  2VSU F;  3VIV A;  3SWX A;  2VSS E;  4IZD A;  3H81 A;  3T3W A;  3TT6 A;  1HZD A;  5DUC A;  3QRE A;  4U0G A;  3ZWA A;  3QXZ A;  2DUB A;  1EF8 A;  3JU1 A;  3PE8 A;  4FZW A;  3KTI A;  3HIN A;  5CTB A;  4FN8 A;  5G1R A;  5DZK H;  3KTJ A;  4QII A;  1Q51 A;  4ZDC A;  2J5I I;  3TVW A;  1YG8 A;  2ZL3 A;  1YG6 A;  4K3W A;  2FBM A;  3KTK A;  4QIJ A;  3L3S A;  4I42 A;  1RJM A;  2X24 A;  2ZL2 A;  3Q7H A;  3BPP A;  4L8K A;  2CBY A;  3KTH A;  2C8T A;  5INI A;  5DU8 A;  3TRR A;  4DI1 A;  2VRE A;  5G1S A;  3SLL A;  4IZB A;  3R9Q A;  1UYV A;  3R6H A;  2J5G A;  1UYS A;  5DU6 A;  5IKL B;  2X58 A;  5JBW A;  3BEZ A;  3HLN 1;  4MI2 A;  4GHN A;  3H0S A;  2ZL0 A;  3R0O A;  4U1A A;  5G1Q A;  3P85 A;  3LAO A;  1JXZ A;  3MT6 A;  4OMR A;  2EJ5 A;  1EF9 A;  1SG4 A;  5KDR A;  3DJA A;  5FIF A;  3N6R B;  4WCZ A;  3RSI A;  3T89 A;  4FJW D;  4FZW C;  4JJT A;  2ZL4 A;  4I52 A;  3OC7 A;  1J7X A;  3T8B A;  3M6N A;  4NNQ A;  3GMA A;  2FZS A;  4Q1I A;  3HRX A;  1X0U A;  4WYO B;  2QQ3 A;  2F9Y B;  1FC9 A;  1XNV A;  3K50 A;  1K39 A;  2IEX A;  1O8U A;  1N6F A;  4I4Z A;  1NZY A;  1Y7O A;  2VSS A;  3QXI A;  3I47 A;  1SZO A;  4JYL A;  3H0J A;  1UYR A;  4B3I A;  1TYF A;  2VSU A;  2F9Y A;  4HC8 A;  3M6M A;  3OT6 A;  2VSU E;  1W2X A;  2A7S A;  4JOT A;  4RYF A;  3LKE A;  4JYJ A;  1HNU A;  3RRV A;  5INF A;  2GTR A;  4RYF H;  4YLH A;  5DZK A;  4U19 A;  3HP0 A;  2W3P A;  3KTG A;  5C9G A;  4Z0M A;  3T8A A;  3WG5 A;  4Q0G A;  3ZWB A;  1XX4 A;  2A7K A;  2WTB A;  3TLF A;  3DOR A;  4JCQ A;  2A81 A;  5CTC A;  1K32 A;  3ST9 A;  4ELX A;  4WZ8 B;  3FDU A; 
#chains in the Genus database with same CATH topology
 3IB9 A;  4KNP A;  3FF6 A;  4ASI A;  4OG1 A;  1FC7 A;  5DL1 A;  5DU4 A;  4EMM A;  5DUF A;  4MOU A;  4EMP A;  4FN7 A;  4ZDB A;  1WZ8 A;  4G2R A;  1OD4 A;  2PPY A;  2Q2X A;  2HW5 A;  4MXI A;  4B3H A;  4ZDD A;  1XO6 A;  2J5G D;  1MJ3 A;  3GF7 A;  1DUB A;  2J5I A;  5KDR B;  1HNO A;  3IBB A;  1FCF A;  3G64 A;  2D3T A;  3U9R B;  3ZW9 A;  4JCS A;  2VSU C;  1WDM A;  3PGQ A;  3Q1T A;  3U9S B;  3MYB A;  4L6W A;  1WDL A;  2PBP A;  2DEO A;  3KQF A;  4KD6 A;  5DTW A;  4RCN A;  3GF3 A;  4JFC A;  1NZY B;  5DKP A;  3TVU A;  1DCI A;  3BF0 A;  2FW2 A;  5FUS A;  2F6Q A;  4KWB A;  3ISA A;  2ZQR A;  5E0S H;  1PJH A;  4HDT A;  4EML A;  1EY3 A;  3PZK A;  3MOY A;  4JVT A;  2VSS F;  4IZC A;  3Q0G A;  2J5S A;  1RJN A;  3MFM A;  1ON9 A;  3TZ3 A;  5E0N X;  3V5I A;  3TT7 A;  3P2L A;  3ZWC A;  3GLM A;  3H0U A;  1XNY A;  2ZQQ A;  4FND A;  4NEK A;  2Q34 A;  3HE2 A;  2UZF A;  2PG8 A;  3QK8 A;  3RST A;  4ZDF A;  4U0G H;  1UIY A;  3IAV A;  4JCR A;  4FB8 A;  4K29 A;  5JBX A;  5ING A;  3OME A;  4ELS A;  4JWV A;  3V5E A;  4ZDE A;  4JCT A;  1VRG A;  3U9T B;  3PEA A;  2BZR A;  3NJB A;  2J5I B;  1FC6 A;  4FNB A;  4OLQ A;  3Q0J A;  3P5M A;  4U0H A;  1OD2 A;  3K8X A;  1WDK A;  3STA A;  3TV5 A;  2F9I B;  3NJD A;  4LK5 A;  1N6E A;  4ZU2 A;  4GM2 A;  2CE3 A;  4K2N A;  3R9S A;  5HUQ A;  1TG6 A;  2VX2 A;  2F6I A;  2F9I A;  5KJP A;  5MGB A;  3TDC A;  5DTP A;  4QFE A;  4B3J A;  1Q52 A;  4F47 A;  4KPK A;  3T88 A;  3QWD A;  3QMJ A;  3QYR A;  3H0Q A;  3QKA A;  1ON3 A;  4J2U A;  1XNW A;  4ELW A;  5C90 A;  5E0S A;  1UYT A;  3R9T A;  1N6D A;  1PIX A;  3H02 A;  3ZW8 A;  4HNK A;  3GKB A;  2Q35 A;  4U18 A;  4JSB A;  2YJG A;  2NP9 A;  2VSU F;  3VIV A;  3SWX A;  2VSS E;  4IZD A;  3H81 A;  3T3W A;  3TT6 A;  1HZD A;  5DUC A;  3QRE A;  4U0G A;  3ZWA A;  3QXZ A;  2DUB A;  1EF8 A;  3JU1 A;  3PE8 A;  4FZW A;  3KTI A;  3HIN A;  5CTB A;  4FN8 A;  5G1R A;  5DZK H;  3KTJ A;  4QII A;  1Q51 A;  4NAR A;  4ZDC A;  2J5I I;  3TVW A;  3BPT A;  1YG8 A;  2ZL3 A;  1YG6 A;  4K3W A;  2FBM A;  3KTK A;  4QIJ A;  3L3S A;  4I42 A;  1RJM A;  2X24 A;  2ZL2 A;  3Q7H A;  3BPP A;  4L8K A;  2CBY A;  3KTH A;  2C8T A;  5INI A;  5DU8 A;  3TRR A;  4DI1 A;  2VRE A;  5G1S A;  3SLL A;  4IZB A;  3R9Q A;  1UYV A;  3R6H A;  2J5G A;  1UYS A;  5DU6 A;  5IKL B;  2X58 A;  5JBW A;  3BEZ A;  3HLN 1;  4MI2 A;  4GHN A;  3H0S A;  2ZL0 A;  3R0O A;  4U1A A;  5G1Q A;  3P85 A;  3LAO A;  1JXZ A;  3MT6 A;  4OMR A;  2EJ5 A;  1EF9 A;  1SG4 A;  5KDR A;  3DJA A;  5FIF A;  3N6R B;  4WCZ A;  3RSI A;  3T89 A;  4FJW D;  4FZW C;  4JJT A;  2ZL4 A;  4I52 A;  3OC7 A;  1J7X A;  3T8B A;  3M6N A;  4NNQ A;  3GMA A;  2FZS A;  4Q1I A;  3HRX A;  1X0U A;  4WYO B;  2QQ3 A;  2F9Y B;  1FC9 A;  1XNV A;  3K50 A;  1K39 A;  2IEX A;  1O8U A;  1N6F A;  4I4Z A;  1NZY A;  1Y7O A;  2VSS A;  3QXI A;  3I47 A;  1SZO A;  4JYL A;  3H0J A;  1UYR A;  4B3I A;  1TYF A;  2VSU A;  2F9Y A;  4HC8 A;  3M6M A;  3OT6 A;  2VSU E;  1W2X A;  2A7S A;  4JOT A;  4RYF A;  3LKE A;  4JYJ A;  1HNU A;  3RRV A;  5INF A;  2GTR A;  4RYF H;  4YLH A;  5DZK A;  4U19 A;  3HP0 A;  2W3P A;  3KTG A;  5C9G A;  4Z0M A;  3T8A A;  3WG5 A;  4Q0G A;  3ZWB A;  1XX4 A;  2A7K A;  2WTB A;  3TLF A;  3DOR A;  4JCQ A;  2A81 A;  5CTC A;  1K32 A;  3ST9 A;  4ELX A;  4WZ8 B;  3FDU A; 
#chains in the Genus database with same CATH homology
 3IB9 A;  4KNP A;  3FF6 A;  4ASI A;  4OG1 A;  1FC7 A;  5DL1 A;  5DU4 A;  4EMM A;  5DUF A;  4MOU A;  4EMP A;  4FN7 A;  4ZDB A;  1WZ8 A;  4G2R A;  1OD4 A;  2PPY A;  2Q2X A;  2HW5 A;  4MXI A;  4B3H A;  4ZDD A;  1XO6 A;  2J5G D;  1MJ3 A;  3GF7 A;  1DUB A;  2J5I A;  5KDR B;  1HNO A;  3IBB A;  1FCF A;  3G64 A;  2D3T A;  3U9R B;  3ZW9 A;  4JCS A;  2VSU C;  1WDM A;  3PGQ A;  3Q1T A;  3U9S B;  3MYB A;  4L6W A;  1WDL A;  2PBP A;  2DEO A;  3KQF A;  4KD6 A;  5DTW A;  4RCN A;  3GF3 A;  4JFC A;  1NZY B;  5DKP A;  3TVU A;  1DCI A;  3BF0 A;  2FW2 A;  5FUS A;  2F6Q A;  4KWB A;  3ISA A;  2ZQR A;  5E0S H;  1PJH A;  4HDT A;  4EML A;  1EY3 A;  3PZK A;  3MOY A;  4JVT A;  2VSS F;  4IZC A;  3Q0G A;  2J5S A;  1RJN A;  3MFM A;  1ON9 A;  3TZ3 A;  5E0N X;  3V5I A;  3TT7 A;  3P2L A;  3ZWC A;  3GLM A;  3H0U A;  1XNY A;  2ZQQ A;  4FND A;  4NEK A;  2Q34 A;  3HE2 A;  2UZF A;  2PG8 A;  3QK8 A;  3RST A;  4ZDF A;  4U0G H;  1UIY A;  3IAV A;  4JCR A;  4FB8 A;  4K29 A;  5JBX A;  5ING A;  3OME A;  4ELS A;  4JWV A;  3V5E A;  4ZDE A;  4JCT A;  1VRG A;  3U9T B;  3PEA A;  2BZR A;  3NJB A;  2J5I B;  1FC6 A;  4FNB A;  4OLQ A;  3Q0J A;  3P5M A;  4U0H A;  1OD2 A;  3K8X A;  1WDK A;  3STA A;  3TV5 A;  2F9I B;  3NJD A;  4LK5 A;  1N6E A;  4ZU2 A;  4GM2 A;  2CE3 A;  4K2N A;  3R9S A;  5HUQ A;  1TG6 A;  2VX2 A;  2F6I A;  2F9I A;  5KJP A;  5MGB A;  3TDC A;  5DTP A;  4QFE A;  4B3J A;  1Q52 A;  4F47 A;  4KPK A;  3T88 A;  3QWD A;  3QMJ A;  3QYR A;  3H0Q A;  3QKA A;  1ON3 A;  4J2U A;  1XNW A;  4ELW A;  5C90 A;  5E0S A;  1UYT A;  3R9T A;  1N6D A;  1PIX A;  3H02 A;  3ZW8 A;  4HNK A;  3GKB A;  2Q35 A;  4U18 A;  4JSB A;  2YJG A;  2NP9 A;  2VSU F;  3VIV A;  3SWX A;  2VSS E;  4IZD A;  3H81 A;  3T3W A;  3TT6 A;  1HZD A;  5DUC A;  3QRE A;  4U0G A;  3ZWA A;  3QXZ A;  2DUB A;  1EF8 A;  3JU1 A;  3PE8 A;  4FZW A;  3KTI A;  3HIN A;  5CTB A;  4FN8 A;  5G1R A;  5DZK H;  3KTJ A;  4QII A;  1Q51 A;  4NAR A;  4ZDC A;  2J5I I;  3TVW A;  3BPT A;  1YG8 A;  2ZL3 A;  1YG6 A;  4K3W A;  2FBM A;  3KTK A;  4QIJ A;  3L3S A;  4I42 A;  1RJM A;  2X24 A;  2ZL2 A;  3Q7H A;  3BPP A;  4L8K A;  2CBY A;  3KTH A;  2C8T A;  5INI A;  5DU8 A;  3TRR A;  4DI1 A;  2VRE A;  5G1S A;  3SLL A;  4IZB A;  3R9Q A;  1UYV A;  3R6H A;  2J5G A;  1UYS A;  5DU6 A;  5IKL B;  2X58 A;  5JBW A;  3BEZ A;  3HLN 1;  4MI2 A;  4GHN A;  3H0S A;  2ZL0 A;  3R0O A;  4U1A A;  5G1Q A;  3P85 A;  3LAO A;  1JXZ A;  3MT6 A;  4OMR A;  2EJ5 A;  1EF9 A;  1SG4 A;  5KDR A;  3DJA A;  5FIF A;  3N6R B;  4WCZ A;  3RSI A;  3T89 A;  4FJW D;  4FZW C;  4JJT A;  2ZL4 A;  4I52 A;  3OC7 A;  1J7X A;  3T8B A;  3M6N A;  4NNQ A;  3GMA A;  2FZS A;  4Q1I A;  3HRX A;  1X0U A;  4WYO B;  2QQ3 A;  2F9Y B;  1FC9 A;  1XNV A;  3K50 A;  1K39 A;  2IEX A;  1O8U A;  1N6F A;  4I4Z A;  1NZY A;  1Y7O A;  2VSS A;  3QXI A;  3I47 A;  1SZO A;  4JYL A;  3H0J A;  1UYR A;  4B3I A;  1TYF A;  2VSU A;  2F9Y A;  4HC8 A;  3M6M A;  3OT6 A;  2VSU E;  1W2X A;  2A7S A;  4JOT A;  4RYF A;  3LKE A;  4JYJ A;  1HNU A;  3RRV A;  5INF A;  2GTR A;  4RYF H;  4YLH A;  5DZK A;  4U19 A;  3HP0 A;  2W3P A;  3KTG A;  5C9G A;  4Z0M A;  3T8A A;  3WG5 A;  4Q0G A;  3ZWB A;  1XX4 A;  2A7K A;  2WTB A;  3TLF A;  3DOR A;  4JCQ A;  2A81 A;  5CTC A;  1K32 A;  3ST9 A;  4ELX A;  4WZ8 B;  3FDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...