3U9RB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc), beta subunit
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
536
structure length
536
Chain Sequence
HMAILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLAGPPLVKAATGEVVSAEELGGADVHCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGFMVGQKYEAGGIAKHGAKLVTAVACARVPKFTVLIGGSFGAGNYGMCGRAYDPRFLWMWPNARIGVMGGEQAAGVLAQVKREQAERAGQQLGVEEEAKIKAPILEQYEHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Methylcrotonyl-CoA carboxylase, beta-subunit
total genus 188
structure length 536
sequence length 536
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9rB02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9rB01
4FNBA 3GKBA 4WZ8B 1SG4A 3H02A 5DTPA 3KTKA 2VSSE 1O8UA 4ASIA 3ZWCA 2A81A 2PBPA 4FZWA 4JSBA 3KTHA 3RSTA 5INIA 5MGBA 2UZFA 1XNYA 4ZU2A 1YG8A 4WCZA 3GMAA 5DZKA 1FC9A 4G2RA 4OMRA 3K50A 3RRVA 3I47A 4Q0GA 3TV5A 2VSUF 2Q34A 1UIYA 4ELSA 2W3PA 2CE3A 1XNWA 3L3SA 3P2LA 3QWDA 4JCQA 3KTJA 1WZ8A 5DU8A 3QYRA 5DU4A 4U0HA 3PGQA 1Y7OA 3Q1TA 1Q52A 1X0UA 4ZDEA 5C90A 1ON3A 3OC7A 3LKEA 5IKLB 3U9SB 5DTWA 5DZKH 4FJWD 3RSIA 2F9YB 2PPYA 4KNPA 1VRGA 4L6WA 3ZW8A 2D3TA 4EMMA 4RCNA 1DCIA 5C9GA 4JCSA 5DKPA 3R9QA 2WTBA 4U18A 4JFCA 3G64A 1NZYA 4K2NA 4JYLA 4JJTA 4KD6A 3T8BA 4LK5A 2J5GA 3GLMA 1XX4A 3TLFA 3H0QA 1XO6A 1FCFA 3HRXA 5DL1A 3R6HA 1UYRA 2J5GD 3OMEA 3FDUA 2VSUE 1K32A 1EY3A 2VREA 1MJ3A 3T89A 5INGA 2ZQQA 2VSSA 3KTGA 5KDRA 4EMPA 5CTBA 3HLN1 3P5MA 3QXIA 1UYSA 3IBBA 4JWVA 3QREA 2A7KA 2F9IB 3MOYA 1HZDA 3V5EA 2FZSA 3K8XA 1FC6A 1EF9A 4HNKA 3HE2A 4I52A 4ZDBA 1WDLA 3PEAA 4K3WA 3BPPA 4OLQA 3TT6A 2VX2A 5DUCA 3WG5A 2BZRA 3QKAA 1UYTA 4ZDDA 4QFEA 1RJNA 3PZKA 3R0OA 4L8KA 3TVUA 5JBXA 2VSUA 3SLLA 2IEXA 4ZDCA 1FC7A 3TT7A 4GM2A 3GF7A 5JBWA 4ZDFA 1OD4A 1JXZA 3ISAA 5E0NX 2J5IA 3U9RB 4QIIA 1DUBA 4ELXA 2X24A 3U9TB 1N6FA 3H81A 3NJBA 4FN7A 3T8AA 1XNVA 3MYBA 4KWBA 2J5SA 1WDKA 4DI1A 1HNUA 1TYFA 3ST9A 4YLHA 4WYOB 4B3IA 5KDRB 3DORA 4HC8A 2F6IA 2F6QA 1OD2A 2QQ3A 3P85A 5E0SH 2HW5A 5G1SA 1ON9A 2ZL3A 3PE8A 3M6NA 2DEOA 3R9TA 4OG1A 4I4ZA 1WDMA 4FN8A 3DJAA 3Q0GA 3BF0A 5DU6A 3OT6A 3QK8A 3H0JA 4Z0MA 2ZQRA 4MXIA 4F47A 2F9IA 3V5IA 3TRRA 4Q1IA 4FNDA 4EMLA 3MT6A 5INFA 4JVTA 3GF3A 3FF6A 2Q2XA 3ZWAA 3HINA 3Q0JA 3ZWBA 1SZOA 2PG8A 1Q51A 5G1RA 5E0SA 1HNOA 5FUSA 4JOTA 4NNQA 2F9YA 4U0GA 3TVWA 1UYVA 3BEZA 1W2XA 4ELWA 4JCTA 4MOUA 4MI2A 1TG6A 1PIXA 4NEKA 4I42A 1K39A 1YG6A 2FBMA 3TZ3A 1RJMA 4IZBA 4RYFA 3R9SA 3QMJA 3STAA 3MFMA 3LAOA 2GTRA 2ZL2A 2C8TA 2J5IB 2ZL0A 2NP9A 4K29A 2VSSF 5FIFA 2FW2A 2EJ5A 4U1AA 4B3JA 3HP0A 4U0GH 2ZL4A 1NZYB 3NJDA 4IZDA 3ZW9A 1N6DA 2X58A 4FZWC 3JU1A 5CTCA 1EF8A 5DUFA 4B3HA 3H0SA 1J7XA 4FB8A 4JYJA 1PJHA 4JCRA 3TDCA 3M6MA 4KPKA 4RYFH 3T3WA 2Q35A 3VIVA 2CBYA 3IAVA 2DUBA 1N6EA 4QIJA 4IZCA 3QXZA 4U19A 5G1QA 2VSUC 3KTIA 5KJPA 3KQFA 2J5II 3Q7HA 2A7SA 3H0UA 3IB9A 3T88A 3SWXA 3N6RB 4GHNA
chains in the Genus database with same CATH superfamily
4FNBA 3GKBA 4WZ8B 1SG4A 3H02A 5DTPA 3KTKA 2VSSE 1O8UA 4ASIA 3ZWCA 2A81A 2PBPA 4FZWA 4JSBA 3KTHA 3RSTA 5INIA 5MGBA 2UZFA 1XNYA 4ZU2A 1YG8A 4WCZA 3GMAA 5DZKA 1FC9A 4G2RA 4OMRA 3K50A 3RRVA 3I47A 4Q0GA 3TV5A 2VSUF 2Q34A 1UIYA 4ELSA 2W3PA 2CE3A 1XNWA 3L3SA 3P2LA 3QWDA 2YJGA 4JCQA 3KTJA 1WZ8A 5DU8A 3QYRA 5DU4A 4U0HA 3PGQA 1Y7OA 3Q1TA 1Q52A 1X0UA 4ZDEA 4NARA 5C90A 1ON3A 3OC7A 3LKEA 5IKLB 3U9SB 5DTWA 5DZKH 4FJWD 3RSIA 2F9YB 3BPTA 2PPYA 4KNPA 1VRGA 4L6WA 3ZW8A 2D3TA 4EMMA 4RCNA 1DCIA 5C9GA 4JCSA 5DKPA 3R9QA 2WTBA 4U18A 4JFCA 3G64A 4J2UA 1NZYA 4K2NA 4JYLA 4JJTA 4KD6A 3T8BA 4LK5A 2J5GA 3GLMA 1XX4A 3TLFA 3H0QA 1XO6A 1FCFA 3HRXA 5DL1A 3R6HA 1UYRA 4HDTA 2J5GD 3OMEA 3FDUA 2VSUE 1K32A 1EY3A 2VREA 1MJ3A 3T89A 5INGA 2ZQQA 2VSSA 3KTGA 5KDRA 4EMPA 5CTBA 3HLN1 3P5MA 3QXIA 1UYSA 5HUQA 3IBBA 4JWVA 3QREA 2A7KA 2F9IB 3MOYA 1HZDA 3V5EA 2FZSA 3K8XA 1FC6A 1EF9A 4HNKA 3HE2A 4I52A 4ZDBA 1WDLA 3PEAA 4K3WA 3BPPA 4OLQA 3TT6A 2VX2A 5DUCA 3WG5A 2BZRA 3QKAA 1UYTA 4ZDDA 4QFEA 1RJNA 3PZKA 3R0OA 4L8KA 3TVUA 5JBXA 2VSUA 3SLLA 2IEXA 4ZDCA 1FC7A 3TT7A 4GM2A 3GF7A 5JBWA 4ZDFA 1OD4A 1JXZA 3ISAA 5E0NX 2J5IA 3U9RB 4QIIA 1DUBA 4ELXA 2X24A 3U9TB 1N6FA 3H81A 3NJBA 4FN7A 3T8AA 1XNVA 3MYBA 4KWBA 2J5SA 1WDKA 4DI1A 1HNUA 1TYFA 3ST9A 4YLHA 4WYOB 4B3IA 5KDRB 3DORA 4HC8A 2F6IA 2F6QA 1OD2A 2QQ3A 3P85A 5E0SH 2HW5A 5G1SA 1ON9A 2ZL3A 3PE8A 3M6NA 2DEOA 3R9TA 4OG1A 4I4ZA 1WDMA 4FN8A 3DJAA 3Q0GA 3BF0A 5DU6A 3OT6A 3QK8A 3H0JA 4Z0MA 2ZQRA 4MXIA 4F47A 2F9IA 3V5IA 3TRRA 4Q1IA 4FNDA 4EMLA 3MT6A 5INFA 4JVTA 3GF3A 3FF6A 2Q2XA 3ZWAA 3HINA 3Q0JA 3ZWBA 1SZOA 2PG8A 1Q51A 5G1RA 5E0SA 1HNOA 5FUSA 4JOTA 4NNQA 2F9YA 4U0GA 3TVWA 1UYVA 3BEZA 1W2XA 4ELWA 4JCTA 4MOUA 4MI2A 1TG6A 1PIXA 4NEKA 4I42A 1K39A 1YG6A 2FBMA 3TZ3A 1RJMA 4IZBA 4RYFA 3R9SA 3QMJA 3STAA 3MFMA 3LAOA 2GTRA 2ZL2A 2C8TA 2J5IB 2ZL0A 2NP9A 4K29A 2VSSF 5FIFA 2FW2A 2EJ5A 4U1AA 4B3JA 3HP0A 4U0GH 2ZL4A 1NZYB 3NJDA 4IZDA 3ZW9A 1N6DA 2X58A 4FZWC 3JU1A 5CTCA 1EF8A 5DUFA 4B3HA 3H0SA 1J7XA 4FB8A 4JYJA 1PJHA 4JCRA 3TDCA 3M6MA 4KPKA 4RYFH 3T3WA 2Q35A 3VIVA 2CBYA 3IAVA 2DUBA 1N6EA 4QIJA 4IZCA 3QXZA 4U19A 5G1QA 2VSUC 3KTIA 5KJPA 3KQFA 2J5II 3Q7HA 2A7SA 3H0UA 3IB9A 3T88A 3SWXA 3N6RB 4GHNA
chains in the Genus database with same CATH topology
4FNBA 3GKBA 4WZ8B 1SG4A 3H02A 5DTPA 3KTKA 2VSSE 1O8UA 4ASIA 3ZWCA 2A81A 2PBPA 4FZWA 4JSBA 3KTHA 3RSTA 5INIA 5MGBA 2UZFA 1XNYA 4ZU2A 1YG8A 4WCZA 3GMAA 5DZKA 1FC9A 4G2RA 4OMRA 3K50A 3RRVA 3I47A 4Q0GA 3TV5A 2VSUF 2Q34A 1UIYA 4ELSA 2W3PA 2CE3A 1XNWA 3L3SA 3P2LA 3QWDA 2YJGA 4JCQA 3KTJA 1WZ8A 5DU8A 3QYRA 5DU4A 4U0HA 3PGQA 1Y7OA 3Q1TA 1Q52A 1X0UA 4ZDEA 4NARA 5C90A 1ON3A 3OC7A 3LKEA 5IKLB 3U9SB 5DTWA 5DZKH 4FJWD 3RSIA 2F9YB 3BPTA 2PPYA 4KNPA 1VRGA 4L6WA 3ZW8A 2D3TA 4EMMA 4RCNA 1DCIA 5C9GA 4JCSA 5DKPA 3R9QA 2WTBA 4U18A 4JFCA 3G64A 4J2UA 1NZYA 4K2NA 4JYLA 4JJTA 4KD6A 3T8BA 4LK5A 2J5GA 3GLMA 1XX4A 3TLFA 3H0QA 1XO6A 1FCFA 3HRXA 5DL1A 3R6HA 1UYRA 4HDTA 2J5GD 3OMEA 3FDUA 2VSUE 1K32A 1EY3A 2VREA 1MJ3A 3T89A 5INGA 2ZQQA 2VSSA 3KTGA 5KDRA 4EMPA 5CTBA 3HLN1 3P5MA 3QXIA 1UYSA 5HUQA 3IBBA 4JWVA 3QREA 2A7KA 2F9IB 3MOYA 1HZDA 3V5EA 2FZSA 3K8XA 1FC6A 1EF9A 4HNKA 3HE2A 4I52A 4ZDBA 1WDLA 3PEAA 4K3WA 3BPPA 4OLQA 3TT6A 2VX2A 5DUCA 3WG5A 2BZRA 3QKAA 1UYTA 4ZDDA 4QFEA 1RJNA 3PZKA 3R0OA 4L8KA 3TVUA 5JBXA 2VSUA 3SLLA 2IEXA 4ZDCA 1FC7A 3TT7A 4GM2A 3GF7A 5JBWA 4ZDFA 1OD4A 1JXZA 3ISAA 5E0NX 2J5IA 3U9RB 4QIIA 1DUBA 4ELXA 2X24A 3U9TB 1N6FA 3H81A 3NJBA 4FN7A 3T8AA 1XNVA 3MYBA 4KWBA 2J5SA 1WDKA 4DI1A 1HNUA 1TYFA 3ST9A 4YLHA 4WYOB 4B3IA 5KDRB 3DORA 4HC8A 2F6IA 2F6QA 1OD2A 2QQ3A 3P85A 5E0SH 2HW5A 5G1SA 1ON9A 2ZL3A 3PE8A 3M6NA 2DEOA 3R9TA 4OG1A 4I4ZA 1WDMA 4FN8A 3DJAA 3Q0GA 3BF0A 5DU6A 3OT6A 3QK8A 3H0JA 4Z0MA 2ZQRA 4MXIA 4F47A 2F9IA 3V5IA 3TRRA 4Q1IA 4FNDA 4EMLA 3MT6A 5INFA 4JVTA 3GF3A 3FF6A 2Q2XA 3ZWAA 3HINA 3Q0JA 3ZWBA 1SZOA 2PG8A 1Q51A 5G1RA 5E0SA 1HNOA 5FUSA 4JOTA 4NNQA 2F9YA 4U0GA 3TVWA 1UYVA 3BEZA 1W2XA 4ELWA 4JCTA 4MOUA 4MI2A 1TG6A 1PIXA 4NEKA 4I42A 1K39A 1YG6A 2FBMA 3TZ3A 1RJMA 4IZBA 4RYFA 3R9SA 3QMJA 3STAA 3MFMA 3LAOA 2GTRA 2ZL2A 2C8TA 2J5IB 2ZL0A 2NP9A 4K29A 2VSSF 5FIFA 2FW2A 2EJ5A 4U1AA 4B3JA 3HP0A 4U0GH 2ZL4A 1NZYB 3NJDA 4IZDA 3ZW9A 1N6DA 2X58A 4FZWC 3JU1A 5CTCA 1EF8A 5DUFA 4B3HA 3H0SA 1J7XA 4FB8A 4JYJA 1PJHA 4JCRA 3TDCA 3M6MA 4KPKA 4RYFH 3T3WA 2Q35A 3VIVA 2CBYA 3IAVA 2DUBA 1N6EA 4QIJA 4IZCA 3QXZA 4U19A 5G1QA 2VSUC 3KTIA 5KJPA 3KQFA 2J5II 3Q7HA 2A7SA 3H0UA 3IB9A 3T88A 3SWXA 3N6RB 4GHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FNB A;  3GKB A;  4WZ8 B;  1SG4 A;  3H02 A;  5DTP A;  3KTK A;  2VSS E;  1O8U A;  4ASI A;  3ZWC A;  2A81 A;  2PBP A;  4FZW A;  4JSB A;  3KTH A;  3RST A;  5INI A;  5MGB A;  2UZF A;  1XNY A;  4ZU2 A;  1YG8 A;  4WCZ A;  3GMA A;  5DZK A;  1FC9 A;  4G2R A;  4OMR A;  3K50 A;  3RRV A;  3I47 A;  4Q0G A;  3TV5 A;  2VSU F;  2Q34 A;  1UIY A;  4ELS A;  2W3P A;  2CE3 A;  1XNW A;  3L3S A;  3P2L A;  3QWD A;  4JCQ A;  3KTJ A;  1WZ8 A;  5DU8 A;  3QYR A;  5DU4 A;  4U0H A;  3PGQ A;  1Y7O A;  3Q1T A;  1Q52 A;  1X0U A;  4ZDE A;  5C90 A;  1ON3 A;  3OC7 A;  3LKE A;  5IKL B;  3U9S B;  5DTW A;  5DZK H;  4FJW D;  3RSI A;  2F9Y B;  2PPY A;  4KNP A;  1VRG A;  4L6W A;  3ZW8 A;  2D3T A;  4EMM A;  4RCN A;  1DCI A;  5C9G A;  4JCS A;  5DKP A;  3R9Q A;  2WTB A;  4U18 A;  4JFC A;  3G64 A;  1NZY A;  4K2N A;  4JYL A;  4JJT A;  4KD6 A;  3T8B A;  4LK5 A;  2J5G A;  3GLM A;  1XX4 A;  3TLF A;  3H0Q A;  1XO6 A;  1FCF A;  3HRX A;  5DL1 A;  3R6H A;  1UYR A;  2J5G D;  3OME A;  3FDU A;  2VSU E;  1K32 A;  1EY3 A;  2VRE A;  1MJ3 A;  3T89 A;  5ING A;  2ZQQ A;  2VSS A;  3KTG A;  5KDR A;  4EMP A;  5CTB A;  3HLN 1;  3P5M A;  3QXI A;  1UYS A;  3IBB A;  4JWV A;  3QRE A;  2A7K A;  2F9I B;  3MOY A;  1HZD A;  3V5E A;  2FZS A;  3K8X A;  1FC6 A;  1EF9 A;  4HNK A;  3HE2 A;  4I52 A;  4ZDB A;  1WDL A;  3PEA A;  4K3W A;  3BPP A;  4OLQ A;  3TT6 A;  2VX2 A;  5DUC A;  3WG5 A;  2BZR A;  3QKA A;  1UYT A;  4ZDD A;  4QFE A;  1RJN A;  3PZK A;  3R0O A;  4L8K A;  3TVU A;  5JBX A;  2VSU A;  3SLL A;  2IEX A;  4ZDC A;  1FC7 A;  3TT7 A;  4GM2 A;  3GF7 A;  5JBW A;  4ZDF A;  1OD4 A;  1JXZ A;  3ISA A;  5E0N X;  2J5I A;  3U9R B;  4QII A;  1DUB A;  4ELX A;  2X24 A;  3U9T B;  1N6F A;  3H81 A;  3NJB A;  4FN7 A;  3T8A A;  1XNV A;  3MYB A;  4KWB A;  2J5S A;  1WDK A;  4DI1 A;  1HNU A;  1TYF A;  3ST9 A;  4YLH A;  4WYO B;  4B3I A;  5KDR B;  3DOR A;  4HC8 A;  2F6I A;  2F6Q A;  1OD2 A;  2QQ3 A;  3P85 A;  5E0S H;  2HW5 A;  5G1S A;  1ON9 A;  2ZL3 A;  3PE8 A;  3M6N A;  2DEO A;  3R9T A;  4OG1 A;  4I4Z A;  1WDM A;  4FN8 A;  3DJA A;  3Q0G A;  3BF0 A;  5DU6 A;  3OT6 A;  3QK8 A;  3H0J A;  4Z0M A;  2ZQR A;  4MXI A;  4F47 A;  2F9I A;  3V5I A;  3TRR A;  4Q1I A;  4FND A;  4EML A;  3MT6 A;  5INF A;  4JVT A;  3GF3 A;  3FF6 A;  2Q2X A;  3ZWA A;  3HIN A;  3Q0J A;  3ZWB A;  1SZO A;  2PG8 A;  1Q51 A;  5G1R A;  5E0S A;  1HNO A;  5FUS A;  4JOT A;  4NNQ A;  2F9Y A;  4U0G A;  3TVW A;  1UYV A;  3BEZ A;  1W2X A;  4ELW A;  4JCT A;  4MOU A;  4MI2 A;  1TG6 A;  1PIX A;  4NEK A;  4I42 A;  1K39 A;  1YG6 A;  2FBM A;  3TZ3 A;  1RJM A;  4IZB A;  4RYF A;  3R9S A;  3QMJ A;  3STA A;  3MFM A;  3LAO A;  2GTR A;  2ZL2 A;  2C8T A;  2J5I B;  2ZL0 A;  2NP9 A;  4K29 A;  2VSS F;  5FIF A;  2FW2 A;  2EJ5 A;  4U1A A;  4B3J A;  3HP0 A;  4U0G H;  2ZL4 A;  1NZY B;  3NJD A;  4IZD A;  3ZW9 A;  1N6D A;  2X58 A;  4FZW C;  3JU1 A;  5CTC A;  1EF8 A;  5DUF A;  4B3H A;  3H0S A;  1J7X A;  4FB8 A;  4JYJ A;  1PJH A;  4JCR A;  3TDC A;  3M6M A;  4KPK A;  4RYF H;  3T3W A;  2Q35 A;  3VIV A;  2CBY A;  3IAV A;  2DUB A;  1N6E A;  4QIJ A;  4IZC A;  3QXZ A;  4U19 A;  5G1Q A;  2VSU C;  3KTI A;  5KJP A;  3KQF A;  2J5I I;  3Q7H A;  2A7S A;  3H0U A;  3IB9 A;  3T88 A;  3SWX A;  3N6R B;  4GHN A; 
#chains in the Genus database with same CATH topology
 4FNB A;  3GKB A;  4WZ8 B;  1SG4 A;  3H02 A;  5DTP A;  3KTK A;  2VSS E;  1O8U A;  4ASI A;  3ZWC A;  2A81 A;  2PBP A;  4FZW A;  4JSB A;  3KTH A;  3RST A;  5INI A;  5MGB A;  2UZF A;  1XNY A;  4ZU2 A;  1YG8 A;  4WCZ A;  3GMA A;  5DZK A;  1FC9 A;  4G2R A;  4OMR A;  3K50 A;  3RRV A;  3I47 A;  4Q0G A;  3TV5 A;  2VSU F;  2Q34 A;  1UIY A;  4ELS A;  2W3P A;  2CE3 A;  1XNW A;  3L3S A;  3P2L A;  3QWD A;  2YJG A;  4JCQ A;  3KTJ A;  1WZ8 A;  5DU8 A;  3QYR A;  5DU4 A;  4U0H A;  3PGQ A;  1Y7O A;  3Q1T A;  1Q52 A;  1X0U A;  4ZDE A;  4NAR A;  5C90 A;  1ON3 A;  3OC7 A;  3LKE A;  5IKL B;  3U9S B;  5DTW A;  5DZK H;  4FJW D;  3RSI A;  2F9Y B;  3BPT A;  2PPY A;  4KNP A;  1VRG A;  4L6W A;  3ZW8 A;  2D3T A;  4EMM A;  4RCN A;  1DCI A;  5C9G A;  4JCS A;  5DKP A;  3R9Q A;  2WTB A;  4U18 A;  4JFC A;  3G64 A;  4J2U A;  1NZY A;  4K2N A;  4JYL A;  4JJT A;  4KD6 A;  3T8B A;  4LK5 A;  2J5G A;  3GLM A;  1XX4 A;  3TLF A;  3H0Q A;  1XO6 A;  1FCF A;  3HRX A;  5DL1 A;  3R6H A;  1UYR A;  4HDT A;  2J5G D;  3OME A;  3FDU A;  2VSU E;  1K32 A;  1EY3 A;  2VRE A;  1MJ3 A;  3T89 A;  5ING A;  2ZQQ A;  2VSS A;  3KTG A;  5KDR A;  4EMP A;  5CTB A;  3HLN 1;  3P5M A;  3QXI A;  1UYS A;  5HUQ A;  3IBB A;  4JWV A;  3QRE A;  2A7K A;  2F9I B;  3MOY A;  1HZD A;  3V5E A;  2FZS A;  3K8X A;  1FC6 A;  1EF9 A;  4HNK A;  3HE2 A;  4I52 A;  4ZDB A;  1WDL A;  3PEA A;  4K3W A;  3BPP A;  4OLQ A;  3TT6 A;  2VX2 A;  5DUC A;  3WG5 A;  2BZR A;  3QKA A;  1UYT A;  4ZDD A;  4QFE A;  1RJN A;  3PZK A;  3R0O A;  4L8K A;  3TVU A;  5JBX A;  2VSU A;  3SLL A;  2IEX A;  4ZDC A;  1FC7 A;  3TT7 A;  4GM2 A;  3GF7 A;  5JBW A;  4ZDF A;  1OD4 A;  1JXZ A;  3ISA A;  5E0N X;  2J5I A;  3U9R B;  4QII A;  1DUB A;  4ELX A;  2X24 A;  3U9T B;  1N6F A;  3H81 A;  3NJB A;  4FN7 A;  3T8A A;  1XNV A;  3MYB A;  4KWB A;  2J5S A;  1WDK A;  4DI1 A;  1HNU A;  1TYF A;  3ST9 A;  4YLH A;  4WYO B;  4B3I A;  5KDR B;  3DOR A;  4HC8 A;  2F6I A;  2F6Q A;  1OD2 A;  2QQ3 A;  3P85 A;  5E0S H;  2HW5 A;  5G1S A;  1ON9 A;  2ZL3 A;  3PE8 A;  3M6N A;  2DEO A;  3R9T A;  4OG1 A;  4I4Z A;  1WDM A;  4FN8 A;  3DJA A;  3Q0G A;  3BF0 A;  5DU6 A;  3OT6 A;  3QK8 A;  3H0J A;  4Z0M A;  2ZQR A;  4MXI A;  4F47 A;  2F9I A;  3V5I A;  3TRR A;  4Q1I A;  4FND A;  4EML A;  3MT6 A;  5INF A;  4JVT A;  3GF3 A;  3FF6 A;  2Q2X A;  3ZWA A;  3HIN A;  3Q0J A;  3ZWB A;  1SZO A;  2PG8 A;  1Q51 A;  5G1R A;  5E0S A;  1HNO A;  5FUS A;  4JOT A;  4NNQ A;  2F9Y A;  4U0G A;  3TVW A;  1UYV A;  3BEZ A;  1W2X A;  4ELW A;  4JCT A;  4MOU A;  4MI2 A;  1TG6 A;  1PIX A;  4NEK A;  4I42 A;  1K39 A;  1YG6 A;  2FBM A;  3TZ3 A;  1RJM A;  4IZB A;  4RYF A;  3R9S A;  3QMJ A;  3STA A;  3MFM A;  3LAO A;  2GTR A;  2ZL2 A;  2C8T A;  2J5I B;  2ZL0 A;  2NP9 A;  4K29 A;  2VSS F;  5FIF A;  2FW2 A;  2EJ5 A;  4U1A A;  4B3J A;  3HP0 A;  4U0G H;  2ZL4 A;  1NZY B;  3NJD A;  4IZD A;  3ZW9 A;  1N6D A;  2X58 A;  4FZW C;  3JU1 A;  5CTC A;  1EF8 A;  5DUF A;  4B3H A;  3H0S A;  1J7X A;  4FB8 A;  4JYJ A;  1PJH A;  4JCR A;  3TDC A;  3M6M A;  4KPK A;  4RYF H;  3T3W A;  2Q35 A;  3VIV A;  2CBY A;  3IAV A;  2DUB A;  1N6E A;  4QIJ A;  4IZC A;  3QXZ A;  4U19 A;  5G1Q A;  2VSU C;  3KTI A;  5KJP A;  3KQF A;  2J5I I;  3Q7H A;  2A7S A;  3H0U A;  3IB9 A;  3T88 A;  3SWX A;  3N6R B;  4GHN A; 
#chains in the Genus database with same CATH homology
 4FNB A;  3GKB A;  4WZ8 B;  1SG4 A;  3H02 A;  5DTP A;  3KTK A;  2VSS E;  1O8U A;  4ASI A;  3ZWC A;  2A81 A;  2PBP A;  4FZW A;  4JSB A;  3KTH A;  3RST A;  5INI A;  5MGB A;  2UZF A;  1XNY A;  4ZU2 A;  1YG8 A;  4WCZ A;  3GMA A;  5DZK A;  1FC9 A;  4G2R A;  4OMR A;  3K50 A;  3RRV A;  3I47 A;  4Q0G A;  3TV5 A;  2VSU F;  2Q34 A;  1UIY A;  4ELS A;  2W3P A;  2CE3 A;  1XNW A;  3L3S A;  3P2L A;  3QWD A;  2YJG A;  4JCQ A;  3KTJ A;  1WZ8 A;  5DU8 A;  3QYR A;  5DU4 A;  4U0H A;  3PGQ A;  1Y7O A;  3Q1T A;  1Q52 A;  1X0U A;  4ZDE A;  4NAR A;  5C90 A;  1ON3 A;  3OC7 A;  3LKE A;  5IKL B;  3U9S B;  5DTW A;  5DZK H;  4FJW D;  3RSI A;  2F9Y B;  3BPT A;  2PPY A;  4KNP A;  1VRG A;  4L6W A;  3ZW8 A;  2D3T A;  4EMM A;  4RCN A;  1DCI A;  5C9G A;  4JCS A;  5DKP A;  3R9Q A;  2WTB A;  4U18 A;  4JFC A;  3G64 A;  4J2U A;  1NZY A;  4K2N A;  4JYL A;  4JJT A;  4KD6 A;  3T8B A;  4LK5 A;  2J5G A;  3GLM A;  1XX4 A;  3TLF A;  3H0Q A;  1XO6 A;  1FCF A;  3HRX A;  5DL1 A;  3R6H A;  1UYR A;  4HDT A;  2J5G D;  3OME A;  3FDU A;  2VSU E;  1K32 A;  1EY3 A;  2VRE A;  1MJ3 A;  3T89 A;  5ING A;  2ZQQ A;  2VSS A;  3KTG A;  5KDR A;  4EMP A;  5CTB A;  3HLN 1;  3P5M A;  3QXI A;  1UYS A;  5HUQ A;  3IBB A;  4JWV A;  3QRE A;  2A7K A;  2F9I B;  3MOY A;  1HZD A;  3V5E A;  2FZS A;  3K8X A;  1FC6 A;  1EF9 A;  4HNK A;  3HE2 A;  4I52 A;  4ZDB A;  1WDL A;  3PEA A;  4K3W A;  3BPP A;  4OLQ A;  3TT6 A;  2VX2 A;  5DUC A;  3WG5 A;  2BZR A;  3QKA A;  1UYT A;  4ZDD A;  4QFE A;  1RJN A;  3PZK A;  3R0O A;  4L8K A;  3TVU A;  5JBX A;  2VSU A;  3SLL A;  2IEX A;  4ZDC A;  1FC7 A;  3TT7 A;  4GM2 A;  3GF7 A;  5JBW A;  4ZDF A;  1OD4 A;  1JXZ A;  3ISA A;  5E0N X;  2J5I A;  3U9R B;  4QII A;  1DUB A;  4ELX A;  2X24 A;  3U9T B;  1N6F A;  3H81 A;  3NJB A;  4FN7 A;  3T8A A;  1XNV A;  3MYB A;  4KWB A;  2J5S A;  1WDK A;  4DI1 A;  1HNU A;  1TYF A;  3ST9 A;  4YLH A;  4WYO B;  4B3I A;  5KDR B;  3DOR A;  4HC8 A;  2F6I A;  2F6Q A;  1OD2 A;  2QQ3 A;  3P85 A;  5E0S H;  2HW5 A;  5G1S A;  1ON9 A;  2ZL3 A;  3PE8 A;  3M6N A;  2DEO A;  3R9T A;  4OG1 A;  4I4Z A;  1WDM A;  4FN8 A;  3DJA A;  3Q0G A;  3BF0 A;  5DU6 A;  3OT6 A;  3QK8 A;  3H0J A;  4Z0M A;  2ZQR A;  4MXI A;  4F47 A;  2F9I A;  3V5I A;  3TRR A;  4Q1I A;  4FND A;  4EML A;  3MT6 A;  5INF A;  4JVT A;  3GF3 A;  3FF6 A;  2Q2X A;  3ZWA A;  3HIN A;  3Q0J A;  3ZWB A;  1SZO A;  2PG8 A;  1Q51 A;  5G1R A;  5E0S A;  1HNO A;  5FUS A;  4JOT A;  4NNQ A;  2F9Y A;  4U0G A;  3TVW A;  1UYV A;  3BEZ A;  1W2X A;  4ELW A;  4JCT A;  4MOU A;  4MI2 A;  1TG6 A;  1PIX A;  4NEK A;  4I42 A;  1K39 A;  1YG6 A;  2FBM A;  3TZ3 A;  1RJM A;  4IZB A;  4RYF A;  3R9S A;  3QMJ A;  3STA A;  3MFM A;  3LAO A;  2GTR A;  2ZL2 A;  2C8T A;  2J5I B;  2ZL0 A;  2NP9 A;  4K29 A;  2VSS F;  5FIF A;  2FW2 A;  2EJ5 A;  4U1A A;  4B3J A;  3HP0 A;  4U0G H;  2ZL4 A;  1NZY B;  3NJD A;  4IZD A;  3ZW9 A;  1N6D A;  2X58 A;  4FZW C;  3JU1 A;  5CTC A;  1EF8 A;  5DUF A;  4B3H A;  3H0S A;  1J7X A;  4FB8 A;  4JYJ A;  1PJH A;  4JCR A;  3TDC A;  3M6M A;  4KPK A;  4RYF H;  3T3W A;  2Q35 A;  3VIV A;  2CBY A;  3IAV A;  2DUB A;  1N6E A;  4QIJ A;  4IZC A;  3QXZ A;  4U19 A;  5G1Q A;  2VSU C;  3KTI A;  5KJP A;  3KQF A;  2J5I I;  3Q7H A;  2A7S A;  3H0U A;  3IB9 A;  3T88 A;  3SWX A;  3N6R B;  4GHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...