3U9SB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
537
structure length
537
Chain Sequence
SHMAILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLAGPPLVKAATGEVVSAEELGGADVHCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGFMVGQKYEAGGIAKHGAKLVTAVACARVPKFTVLIGGSFGAGNYGMCGRAYDPRFLWMWPNARIGVMGGEQAAGVLAQVKREQAERAGQQLGVEEEAKIKAPILEQYEHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Methylcrotonyl-CoA carboxylase, alpha-subunit
total genus 171
structure length 537
sequence length 537
chains with identical sequence D, F, H, J, L
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9sB02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9sB01
2VSUF 4U18A 1HNUA 3KQFA 5DTPA 2C8TA 3T89A 3JU1A 4ZDFA 3SLLA 3NJDA 2VSSF 1UYTA 1XO6A 3QKAA 1RJMA 1UYSA 2IEXA 3QREA 3T88A 2Q2XA 1PJHA 2FBMA 1K39A 3MT6A 3V5EA 3TRRA 2ZL4A 3RSIA 3IB9A 3MOYA 3OT6A 5C90A 5G1QA 5KJPA 3PE8A 4JCSA 1XNYA 2W3PA 3R6HA 2J5IA 3ST9A 5FIFA 4ELSA 3T3WA 3PEAA 3MYBA 1X0UA 4JCQA 2A7KA 1DCIA 3IBBA 4Q0GA 2EJ5A 2X58A 4FB8A 2PBPA 4I4ZA 3P85A 1PIXA 2VSSA 5DL1A 3TV5A 3DORA 4KNPA 3KTKA 1SG4A 3BPPA 3P2LA 2D3TA 4JFCA 1N6DA 3R9SA 3NJBA 1SZOA 4KPKA 2FW2A 2VSSE 4JSBA 4RYFH 4OLQA 3IAVA 1XX4A 4F47A 4WCZA 2A81A 4WYOB 3R9TA 4RYFA 2F6QA 4K2NA 1EY3A 3TT6A 1FC6A 1ON3A 4K29A 1N6FA 2J5SA 3QMJA 3ZWCA 4JOTA 3TT7A 4GM2A 2X24A 4QFEA 3QXZA 2F9YB 2DUBA 3OC7A 1VRGA 4JWVA 4Z0MA 3QXIA 1DUBA 4FN7A 4IZDA 1TG6A 3RSTA 3H81A 4KWBA 1Y7OA 2ZQQA 3FF6A 4GHNA 3I47A 2FZSA 3HRXA 3TLFA 3T8AA 4ELXA 4I52A 4B3IA 1YG8A 2VX2A 3OMEA 3TDCA 3PGQA 3SWXA 4NNQA 4IZCA 4ZDCA 3FDUA 5JBWA 5CTCA 4ZU2A 3TZ3A 3MFMA 4IZBA 1OD4A 4ZDBA 1EF8A 3H02A 3HLN1 3U9TB 4JCRA 3U9RB 3H0SA 2A7SA 1RJNA 3H0JA 2WTBA 1Q51A 2VSUA 3K8XA 3HE2A 3R9QA 3WG5A 3ISAA 3TVWA 3GKBA 3GF3A 1NZYA 3GF7A 4I42A 2F9IB 5DU4A 3ZWBA 2ZQRA 3LAOA 1UIYA 5IKLB 4HC8A 4B3JA 4ELWA 2DEOA 3PZKA 1K32A 1HZDA 3R0OA 1YG6A 5INFA 1Q52A 5E0SH 3KTIA 1OD2A 3DJAA 4JVTA 5MGBA 4U19A 4RCNA 4DI1A 4EMMA 3QK8A 2F9IA 3RRVA 2J5GD 5FUSA 1FCFA 5INIA 4FN8A 4ASIA 5JBXA 1UYRA 2Q34A 1EF9A 3QYRA 2J5II 3V5IA 3KTHA 1WDMA 1N6EA 3HINA 4EMLA 5DZKA 3HP0A 4U0GH 3T8BA 2NP9A 5DUFA 2ZL2A 3QWDA 3TVUA 4U0GA 2QQ3A 1ON9A 4NEKA 5E0NX 3BEZA 2CE3A 3P5MA 5DKPA 4FNDA 4QIJA 4HNKA 3H0UA 2VSUE 4FZWA 3GLMA 3Q1TA 3LKEA 3GMAA 5INGA 5DTWA 4MOUA 1JXZA 5DU6A 4LK5A 3KTGA 5DZKH 4G2RA 1J7XA 5CTBA 2F6IA 4L8KA 4FNBA 1XNWA 2PG8A 2HW5A 5KDRB 4EMPA 4B3HA 4FZWC 3STAA 4JCTA 1FC7A 4ZDEA 3ZW9A 3BF0A 3ZW8A 2J5GA 4U0HA 4Q1IA 1MJ3A 2PPYA 1WDLA 3L3SA 4U1AA 2GTRA 3M6NA 2UZFA 3Q0GA 4JJTA 1W2XA 5DU8A 4L6WA 3ZWAA 1NZYB 4KD6A 2BZRA 2ZL0A 3N6RB 3U9SB 1FC9A 4OG1A 1XNVA 3Q7HA 4YLHA 2J5IB 4QIIA 5DUCA 5G1RA 2VREA 4JYLA 3G64A 1WZ8A 2ZL3A 3Q0JA 1TYFA 3K50A 4K3WA 3VIVA 4ZDDA 4OMRA 2F9YA 4JYJA 2Q35A 4WZ8B 3M6MA 3KTJA 1O8UA 2VSUC 5C9GA 1UYVA 4MXIA 1WDKA 3H0QA 4FJWD 5KDRA 2CBYA 1HNOA 4MI2A 5G1SA 5E0SA
chains in the Genus database with same CATH superfamily
2VSUF 4U18A 1HNUA 3KQFA 5DTPA 2C8TA 3T89A 3JU1A 4ZDFA 3SLLA 3NJDA 2VSSF 1UYTA 1XO6A 3QKAA 1RJMA 1UYSA 2IEXA 3QREA 3T88A 2Q2XA 1PJHA 2FBMA 1K39A 3MT6A 3V5EA 3TRRA 2ZL4A 3RSIA 3IB9A 3MOYA 3OT6A 5C90A 5G1QA 5KJPA 3PE8A 4JCSA 1XNYA 2W3PA 3R6HA 2J5IA 3ST9A 5FIFA 4ELSA 3T3WA 3PEAA 3MYBA 1X0UA 4JCQA 2A7KA 1DCIA 3IBBA 4Q0GA 2EJ5A 2X58A 4FB8A 2PBPA 4I4ZA 3P85A 1PIXA 2VSSA 5DL1A 3TV5A 3DORA 4KNPA 3KTKA 1SG4A 3BPPA 3P2LA 2D3TA 4JFCA 1N6DA 3R9SA 3NJBA 1SZOA 4KPKA 2FW2A 2VSSE 4JSBA 4RYFH 4OLQA 3IAVA 1XX4A 4F47A 4WCZA 2A81A 4WYOB 3R9TA 4RYFA 2F6QA 4K2NA 1EY3A 3TT6A 1FC6A 1ON3A 4K29A 4J2UA 1N6FA 2J5SA 3QMJA 3ZWCA 4JOTA 3TT7A 4GM2A 2X24A 4QFEA 3QXZA 2F9YB 2DUBA 3OC7A 1VRGA 4JWVA 4Z0MA 3QXIA 1DUBA 4FN7A 4IZDA 1TG6A 3RSTA 3H81A 4KWBA 1Y7OA 2ZQQA 3FF6A 4GHNA 3I47A 2FZSA 3HRXA 3TLFA 3T8AA 4ELXA 4I52A 4B3IA 1YG8A 2VX2A 3OMEA 3TDCA 3PGQA 3SWXA 4NNQA 4IZCA 4ZDCA 3FDUA 5JBWA 5CTCA 4ZU2A 3TZ3A 3MFMA 4IZBA 1OD4A 4ZDBA 1EF8A 3H02A 3HLN1 3U9TB 4JCRA 3U9RB 3H0SA 2A7SA 1RJNA 3H0JA 2WTBA 1Q51A 2VSUA 3K8XA 3HE2A 3R9QA 3WG5A 3ISAA 3TVWA 3GKBA 3GF3A 1NZYA 3GF7A 4I42A 2F9IB 5DU4A 3ZWBA 2ZQRA 3LAOA 1UIYA 5IKLB 4HC8A 4B3JA 4ELWA 2DEOA 3PZKA 1K32A 1HZDA 3R0OA 1YG6A 5INFA 1Q52A 5E0SH 3KTIA 1OD2A 3DJAA 4JVTA 5MGBA 4U19A 4RCNA 4DI1A 4EMMA 3QK8A 2YJGA 2F9IA 3RRVA 2J5GD 5FUSA 1FCFA 5INIA 4FN8A 4ASIA 5JBXA 1UYRA 2Q34A 1EF9A 3QYRA 2J5II 3V5IA 3KTHA 1WDMA 1N6EA 3HINA 4EMLA 5DZKA 3HP0A 4U0GH 3T8BA 2NP9A 5DUFA 2ZL2A 3QWDA 3TVUA 4U0GA 2QQ3A 1ON9A 4NEKA 5E0NX 3BEZA 2CE3A 3P5MA 5DKPA 4FNDA 4QIJA 4HNKA 3H0UA 2VSUE 4FZWA 3GLMA 3Q1TA 3LKEA 3GMAA 5INGA 5DTWA 4MOUA 1JXZA 5DU6A 4LK5A 3KTGA 5DZKH 4G2RA 1J7XA 5CTBA 2F6IA 4L8KA 4FNBA 1XNWA 2PG8A 2HW5A 5KDRB 4EMPA 4B3HA 4FZWC 3STAA 4JCTA 1FC7A 4ZDEA 3ZW9A 3BF0A 3ZW8A 2J5GA 4U0HA 4Q1IA 1MJ3A 2PPYA 1WDLA 3L3SA 4U1AA 2GTRA 3M6NA 2UZFA 3Q0GA 4JJTA 1W2XA 5DU8A 4L6WA 3ZWAA 1NZYB 4KD6A 5HUQA 2BZRA 2ZL0A 3N6RB 3U9SB 1FC9A 4OG1A 1XNVA 3Q7HA 4YLHA 2J5IB 4QIIA 5DUCA 5G1RA 2VREA 4JYLA 3G64A 1WZ8A 2ZL3A 3Q0JA 1TYFA 3K50A 4K3WA 3VIVA 4ZDDA 4OMRA 2F9YA 4JYJA 2Q35A 4WZ8B 3M6MA 3KTJA 3BPTA 1O8UA 2VSUC 5C9GA 4HDTA 1UYVA 4MXIA 1WDKA 3H0QA 4FJWD 5KDRA 2CBYA 1HNOA 4NARA 4MI2A 5G1SA 5E0SA
chains in the Genus database with same CATH topology
2VSUF 4U18A 1HNUA 3KQFA 5DTPA 2C8TA 3T89A 3JU1A 4ZDFA 3SLLA 3NJDA 2VSSF 1UYTA 1XO6A 3QKAA 1RJMA 1UYSA 2IEXA 3QREA 3T88A 2Q2XA 1PJHA 2FBMA 1K39A 3MT6A 3V5EA 3TRRA 2ZL4A 3RSIA 3IB9A 3MOYA 3OT6A 5C90A 5G1QA 5KJPA 3PE8A 4JCSA 1XNYA 2W3PA 3R6HA 2J5IA 3ST9A 5FIFA 4ELSA 3T3WA 3PEAA 3MYBA 1X0UA 4JCQA 2A7KA 1DCIA 3IBBA 4Q0GA 2EJ5A 2X58A 4FB8A 2PBPA 4I4ZA 3P85A 1PIXA 2VSSA 5DL1A 3TV5A 3DORA 4KNPA 3KTKA 1SG4A 3BPPA 3P2LA 2D3TA 4JFCA 1N6DA 3R9SA 3NJBA 1SZOA 4KPKA 2FW2A 2VSSE 4JSBA 4RYFH 4OLQA 3IAVA 1XX4A 4F47A 4WCZA 2A81A 4WYOB 3R9TA 4RYFA 2F6QA 4K2NA 1EY3A 3TT6A 1FC6A 1ON3A 4K29A 4J2UA 1N6FA 2J5SA 3QMJA 3ZWCA 4JOTA 3TT7A 4GM2A 2X24A 4QFEA 3QXZA 2F9YB 2DUBA 3OC7A 1VRGA 4JWVA 4Z0MA 3QXIA 1DUBA 4FN7A 4IZDA 1TG6A 3RSTA 3H81A 4KWBA 1Y7OA 2ZQQA 3FF6A 4GHNA 3I47A 2FZSA 3HRXA 3TLFA 3T8AA 4ELXA 4I52A 4B3IA 1YG8A 2VX2A 3OMEA 3TDCA 3PGQA 3SWXA 4NNQA 4IZCA 4ZDCA 3FDUA 5JBWA 5CTCA 4ZU2A 3TZ3A 3MFMA 4IZBA 1OD4A 4ZDBA 1EF8A 3H02A 3HLN1 3U9TB 4JCRA 3U9RB 3H0SA 2A7SA 1RJNA 3H0JA 2WTBA 1Q51A 2VSUA 3K8XA 3HE2A 3R9QA 3WG5A 3ISAA 3TVWA 3GKBA 3GF3A 1NZYA 3GF7A 4I42A 2F9IB 5DU4A 3ZWBA 2ZQRA 3LAOA 1UIYA 5IKLB 4HC8A 4B3JA 4ELWA 2DEOA 3PZKA 1K32A 1HZDA 3R0OA 1YG6A 5INFA 1Q52A 5E0SH 3KTIA 1OD2A 3DJAA 4JVTA 5MGBA 4U19A 4RCNA 4DI1A 4EMMA 3QK8A 2YJGA 2F9IA 3RRVA 2J5GD 5FUSA 1FCFA 5INIA 4FN8A 4ASIA 5JBXA 1UYRA 2Q34A 1EF9A 3QYRA 2J5II 3V5IA 3KTHA 1WDMA 1N6EA 3HINA 4EMLA 5DZKA 3HP0A 4U0GH 3T8BA 2NP9A 5DUFA 2ZL2A 3QWDA 3TVUA 4U0GA 2QQ3A 1ON9A 4NEKA 5E0NX 3BEZA 2CE3A 3P5MA 5DKPA 4FNDA 4QIJA 4HNKA 3H0UA 2VSUE 4FZWA 3GLMA 3Q1TA 3LKEA 3GMAA 5INGA 5DTWA 4MOUA 1JXZA 5DU6A 4LK5A 3KTGA 5DZKH 4G2RA 1J7XA 5CTBA 2F6IA 4L8KA 4FNBA 1XNWA 2PG8A 2HW5A 5KDRB 4EMPA 4B3HA 4FZWC 3STAA 4JCTA 1FC7A 4ZDEA 3ZW9A 3BF0A 3ZW8A 2J5GA 4U0HA 4Q1IA 1MJ3A 2PPYA 1WDLA 3L3SA 4U1AA 2GTRA 3M6NA 2UZFA 3Q0GA 4JJTA 1W2XA 5DU8A 4L6WA 3ZWAA 1NZYB 4KD6A 5HUQA 2BZRA 2ZL0A 3N6RB 3U9SB 1FC9A 4OG1A 1XNVA 3Q7HA 4YLHA 2J5IB 4QIIA 5DUCA 5G1RA 2VREA 4JYLA 3G64A 1WZ8A 2ZL3A 3Q0JA 1TYFA 3K50A 4K3WA 3VIVA 4ZDDA 4OMRA 2F9YA 4JYJA 2Q35A 4WZ8B 3M6MA 3KTJA 3BPTA 1O8UA 2VSUC 5C9GA 4HDTA 1UYVA 4MXIA 1WDKA 3H0QA 4FJWD 5KDRA 2CBYA 1HNOA 4NARA 4MI2A 5G1SA 5E0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSU F;  4U18 A;  1HNU A;  3KQF A;  5DTP A;  2C8T A;  3T89 A;  3JU1 A;  4ZDF A;  3SLL A;  3NJD A;  2VSS F;  1UYT A;  1XO6 A;  3QKA A;  1RJM A;  1UYS A;  2IEX A;  3QRE A;  3T88 A;  2Q2X A;  1PJH A;  2FBM A;  1K39 A;  3MT6 A;  3V5E A;  3TRR A;  2ZL4 A;  3RSI A;  3IB9 A;  3MOY A;  3OT6 A;  5C90 A;  5G1Q A;  5KJP A;  3PE8 A;  4JCS A;  1XNY A;  2W3P A;  3R6H A;  2J5I A;  3ST9 A;  5FIF A;  4ELS A;  3T3W A;  3PEA A;  3MYB A;  1X0U A;  4JCQ A;  2A7K A;  1DCI A;  3IBB A;  4Q0G A;  2EJ5 A;  2X58 A;  4FB8 A;  2PBP A;  4I4Z A;  3P85 A;  1PIX A;  2VSS A;  5DL1 A;  3TV5 A;  3DOR A;  4KNP A;  3KTK A;  1SG4 A;  3BPP A;  3P2L A;  2D3T A;  4JFC A;  1N6D A;  3R9S A;  3NJB A;  1SZO A;  4KPK A;  2FW2 A;  2VSS E;  4JSB A;  4RYF H;  4OLQ A;  3IAV A;  1XX4 A;  4F47 A;  4WCZ A;  2A81 A;  4WYO B;  3R9T A;  4RYF A;  2F6Q A;  4K2N A;  1EY3 A;  3TT6 A;  1FC6 A;  1ON3 A;  4K29 A;  1N6F A;  2J5S A;  3QMJ A;  3ZWC A;  4JOT A;  3TT7 A;  4GM2 A;  2X24 A;  4QFE A;  3QXZ A;  2F9Y B;  2DUB A;  3OC7 A;  1VRG A;  4JWV A;  4Z0M A;  3QXI A;  1DUB A;  4FN7 A;  4IZD A;  1TG6 A;  3RST A;  3H81 A;  4KWB A;  1Y7O A;  2ZQQ A;  3FF6 A;  4GHN A;  3I47 A;  2FZS A;  3HRX A;  3TLF A;  3T8A A;  4ELX A;  4I52 A;  4B3I A;  1YG8 A;  2VX2 A;  3OME A;  3TDC A;  3PGQ A;  3SWX A;  4NNQ A;  4IZC A;  4ZDC A;  3FDU A;  5JBW A;  5CTC A;  4ZU2 A;  3TZ3 A;  3MFM A;  4IZB A;  1OD4 A;  4ZDB A;  1EF8 A;  3H02 A;  3HLN 1;  3U9T B;  4JCR A;  3U9R B;  3H0S A;  2A7S A;  1RJN A;  3H0J A;  2WTB A;  1Q51 A;  2VSU A;  3K8X A;  3HE2 A;  3R9Q A;  3WG5 A;  3ISA A;  3TVW A;  3GKB A;  3GF3 A;  1NZY A;  3GF7 A;  4I42 A;  2F9I B;  5DU4 A;  3ZWB A;  2ZQR A;  3LAO A;  1UIY A;  5IKL B;  4HC8 A;  4B3J A;  4ELW A;  2DEO A;  3PZK A;  1K32 A;  1HZD A;  3R0O A;  1YG6 A;  5INF A;  1Q52 A;  5E0S H;  3KTI A;  1OD2 A;  3DJA A;  4JVT A;  5MGB A;  4U19 A;  4RCN A;  4DI1 A;  4EMM A;  3QK8 A;  2F9I A;  3RRV A;  2J5G D;  5FUS A;  1FCF A;  5INI A;  4FN8 A;  4ASI A;  5JBX A;  1UYR A;  2Q34 A;  1EF9 A;  3QYR A;  2J5I I;  3V5I A;  3KTH A;  1WDM A;  1N6E A;  3HIN A;  4EML A;  5DZK A;  3HP0 A;  4U0G H;  3T8B A;  2NP9 A;  5DUF A;  2ZL2 A;  3QWD A;  3TVU A;  4U0G A;  2QQ3 A;  1ON9 A;  4NEK A;  5E0N X;  3BEZ A;  2CE3 A;  3P5M A;  5DKP A;  4FND A;  4QIJ A;  4HNK A;  3H0U A;  2VSU E;  4FZW A;  3GLM A;  3Q1T A;  3LKE A;  3GMA A;  5ING A;  5DTW A;  4MOU A;  1JXZ A;  5DU6 A;  4LK5 A;  3KTG A;  5DZK H;  4G2R A;  1J7X A;  5CTB A;  2F6I A;  4L8K A;  4FNB A;  1XNW A;  2PG8 A;  2HW5 A;  5KDR B;  4EMP A;  4B3H A;  4FZW C;  3STA A;  4JCT A;  1FC7 A;  4ZDE A;  3ZW9 A;  3BF0 A;  3ZW8 A;  2J5G A;  4U0H A;  4Q1I A;  1MJ3 A;  2PPY A;  1WDL A;  3L3S A;  4U1A A;  2GTR A;  3M6N A;  2UZF A;  3Q0G A;  4JJT A;  1W2X A;  5DU8 A;  4L6W A;  3ZWA A;  1NZY B;  4KD6 A;  2BZR A;  2ZL0 A;  3N6R B;  3U9S B;  1FC9 A;  4OG1 A;  1XNV A;  3Q7H A;  4YLH A;  2J5I B;  4QII A;  5DUC A;  5G1R A;  2VRE A;  4JYL A;  3G64 A;  1WZ8 A;  2ZL3 A;  3Q0J A;  1TYF A;  3K50 A;  4K3W A;  3VIV A;  4ZDD A;  4OMR A;  2F9Y A;  4JYJ A;  2Q35 A;  4WZ8 B;  3M6M A;  3KTJ A;  1O8U A;  2VSU C;  5C9G A;  1UYV A;  4MXI A;  1WDK A;  3H0Q A;  4FJW D;  5KDR A;  2CBY A;  1HNO A;  4MI2 A;  5G1S A;  5E0S A; 
#chains in the Genus database with same CATH topology
 2VSU F;  4U18 A;  1HNU A;  3KQF A;  5DTP A;  2C8T A;  3T89 A;  3JU1 A;  4ZDF A;  3SLL A;  3NJD A;  2VSS F;  1UYT A;  1XO6 A;  3QKA A;  1RJM A;  1UYS A;  2IEX A;  3QRE A;  3T88 A;  2Q2X A;  1PJH A;  2FBM A;  1K39 A;  3MT6 A;  3V5E A;  3TRR A;  2ZL4 A;  3RSI A;  3IB9 A;  3MOY A;  3OT6 A;  5C90 A;  5G1Q A;  5KJP A;  3PE8 A;  4JCS A;  1XNY A;  2W3P A;  3R6H A;  2J5I A;  3ST9 A;  5FIF A;  4ELS A;  3T3W A;  3PEA A;  3MYB A;  1X0U A;  4JCQ A;  2A7K A;  1DCI A;  3IBB A;  4Q0G A;  2EJ5 A;  2X58 A;  4FB8 A;  2PBP A;  4I4Z A;  3P85 A;  1PIX A;  2VSS A;  5DL1 A;  3TV5 A;  3DOR A;  4KNP A;  3KTK A;  1SG4 A;  3BPP A;  3P2L A;  2D3T A;  4JFC A;  1N6D A;  3R9S A;  3NJB A;  1SZO A;  4KPK A;  2FW2 A;  2VSS E;  4JSB A;  4RYF H;  4OLQ A;  3IAV A;  1XX4 A;  4F47 A;  4WCZ A;  2A81 A;  4WYO B;  3R9T A;  4RYF A;  2F6Q A;  4K2N A;  1EY3 A;  3TT6 A;  1FC6 A;  1ON3 A;  4K29 A;  4J2U A;  1N6F A;  2J5S A;  3QMJ A;  3ZWC A;  4JOT A;  3TT7 A;  4GM2 A;  2X24 A;  4QFE A;  3QXZ A;  2F9Y B;  2DUB A;  3OC7 A;  1VRG A;  4JWV A;  4Z0M A;  3QXI A;  1DUB A;  4FN7 A;  4IZD A;  1TG6 A;  3RST A;  3H81 A;  4KWB A;  1Y7O A;  2ZQQ A;  3FF6 A;  4GHN A;  3I47 A;  2FZS A;  3HRX A;  3TLF A;  3T8A A;  4ELX A;  4I52 A;  4B3I A;  1YG8 A;  2VX2 A;  3OME A;  3TDC A;  3PGQ A;  3SWX A;  4NNQ A;  4IZC A;  4ZDC A;  3FDU A;  5JBW A;  5CTC A;  4ZU2 A;  3TZ3 A;  3MFM A;  4IZB A;  1OD4 A;  4ZDB A;  1EF8 A;  3H02 A;  3HLN 1;  3U9T B;  4JCR A;  3U9R B;  3H0S A;  2A7S A;  1RJN A;  3H0J A;  2WTB A;  1Q51 A;  2VSU A;  3K8X A;  3HE2 A;  3R9Q A;  3WG5 A;  3ISA A;  3TVW A;  3GKB A;  3GF3 A;  1NZY A;  3GF7 A;  4I42 A;  2F9I B;  5DU4 A;  3ZWB A;  2ZQR A;  3LAO A;  1UIY A;  5IKL B;  4HC8 A;  4B3J A;  4ELW A;  2DEO A;  3PZK A;  1K32 A;  1HZD A;  3R0O A;  1YG6 A;  5INF A;  1Q52 A;  5E0S H;  3KTI A;  1OD2 A;  3DJA A;  4JVT A;  5MGB A;  4U19 A;  4RCN A;  4DI1 A;  4EMM A;  3QK8 A;  2YJG A;  2F9I A;  3RRV A;  2J5G D;  5FUS A;  1FCF A;  5INI A;  4FN8 A;  4ASI A;  5JBX A;  1UYR A;  2Q34 A;  1EF9 A;  3QYR A;  2J5I I;  3V5I A;  3KTH A;  1WDM A;  1N6E A;  3HIN A;  4EML A;  5DZK A;  3HP0 A;  4U0G H;  3T8B A;  2NP9 A;  5DUF A;  2ZL2 A;  3QWD A;  3TVU A;  4U0G A;  2QQ3 A;  1ON9 A;  4NEK A;  5E0N X;  3BEZ A;  2CE3 A;  3P5M A;  5DKP A;  4FND A;  4QIJ A;  4HNK A;  3H0U A;  2VSU E;  4FZW A;  3GLM A;  3Q1T A;  3LKE A;  3GMA A;  5ING A;  5DTW A;  4MOU A;  1JXZ A;  5DU6 A;  4LK5 A;  3KTG A;  5DZK H;  4G2R A;  1J7X A;  5CTB A;  2F6I A;  4L8K A;  4FNB A;  1XNW A;  2PG8 A;  2HW5 A;  5KDR B;  4EMP A;  4B3H A;  4FZW C;  3STA A;  4JCT A;  1FC7 A;  4ZDE A;  3ZW9 A;  3BF0 A;  3ZW8 A;  2J5G A;  4U0H A;  4Q1I A;  1MJ3 A;  2PPY A;  1WDL A;  3L3S A;  4U1A A;  2GTR A;  3M6N A;  2UZF A;  3Q0G A;  4JJT A;  1W2X A;  5DU8 A;  4L6W A;  3ZWA A;  1NZY B;  4KD6 A;  5HUQ A;  2BZR A;  2ZL0 A;  3N6R B;  3U9S B;  1FC9 A;  4OG1 A;  1XNV A;  3Q7H A;  4YLH A;  2J5I B;  4QII A;  5DUC A;  5G1R A;  2VRE A;  4JYL A;  3G64 A;  1WZ8 A;  2ZL3 A;  3Q0J A;  1TYF A;  3K50 A;  4K3W A;  3VIV A;  4ZDD A;  4OMR A;  2F9Y A;  4JYJ A;  2Q35 A;  4WZ8 B;  3M6M A;  3KTJ A;  3BPT A;  1O8U A;  2VSU C;  5C9G A;  4HDT A;  1UYV A;  4MXI A;  1WDK A;  3H0Q A;  4FJW D;  5KDR A;  2CBY A;  1HNO A;  4NAR A;  4MI2 A;  5G1S A;  5E0S A; 
#chains in the Genus database with same CATH homology
 2VSU F;  4U18 A;  1HNU A;  3KQF A;  5DTP A;  2C8T A;  3T89 A;  3JU1 A;  4ZDF A;  3SLL A;  3NJD A;  2VSS F;  1UYT A;  1XO6 A;  3QKA A;  1RJM A;  1UYS A;  2IEX A;  3QRE A;  3T88 A;  2Q2X A;  1PJH A;  2FBM A;  1K39 A;  3MT6 A;  3V5E A;  3TRR A;  2ZL4 A;  3RSI A;  3IB9 A;  3MOY A;  3OT6 A;  5C90 A;  5G1Q A;  5KJP A;  3PE8 A;  4JCS A;  1XNY A;  2W3P A;  3R6H A;  2J5I A;  3ST9 A;  5FIF A;  4ELS A;  3T3W A;  3PEA A;  3MYB A;  1X0U A;  4JCQ A;  2A7K A;  1DCI A;  3IBB A;  4Q0G A;  2EJ5 A;  2X58 A;  4FB8 A;  2PBP A;  4I4Z A;  3P85 A;  1PIX A;  2VSS A;  5DL1 A;  3TV5 A;  3DOR A;  4KNP A;  3KTK A;  1SG4 A;  3BPP A;  3P2L A;  2D3T A;  4JFC A;  1N6D A;  3R9S A;  3NJB A;  1SZO A;  4KPK A;  2FW2 A;  2VSS E;  4JSB A;  4RYF H;  4OLQ A;  3IAV A;  1XX4 A;  4F47 A;  4WCZ A;  2A81 A;  4WYO B;  3R9T A;  4RYF A;  2F6Q A;  4K2N A;  1EY3 A;  3TT6 A;  1FC6 A;  1ON3 A;  4K29 A;  4J2U A;  1N6F A;  2J5S A;  3QMJ A;  3ZWC A;  4JOT A;  3TT7 A;  4GM2 A;  2X24 A;  4QFE A;  3QXZ A;  2F9Y B;  2DUB A;  3OC7 A;  1VRG A;  4JWV A;  4Z0M A;  3QXI A;  1DUB A;  4FN7 A;  4IZD A;  1TG6 A;  3RST A;  3H81 A;  4KWB A;  1Y7O A;  2ZQQ A;  3FF6 A;  4GHN A;  3I47 A;  2FZS A;  3HRX A;  3TLF A;  3T8A A;  4ELX A;  4I52 A;  4B3I A;  1YG8 A;  2VX2 A;  3OME A;  3TDC A;  3PGQ A;  3SWX A;  4NNQ A;  4IZC A;  4ZDC A;  3FDU A;  5JBW A;  5CTC A;  4ZU2 A;  3TZ3 A;  3MFM A;  4IZB A;  1OD4 A;  4ZDB A;  1EF8 A;  3H02 A;  3HLN 1;  3U9T B;  4JCR A;  3U9R B;  3H0S A;  2A7S A;  1RJN A;  3H0J A;  2WTB A;  1Q51 A;  2VSU A;  3K8X A;  3HE2 A;  3R9Q A;  3WG5 A;  3ISA A;  3TVW A;  3GKB A;  3GF3 A;  1NZY A;  3GF7 A;  4I42 A;  2F9I B;  5DU4 A;  3ZWB A;  2ZQR A;  3LAO A;  1UIY A;  5IKL B;  4HC8 A;  4B3J A;  4ELW A;  2DEO A;  3PZK A;  1K32 A;  1HZD A;  3R0O A;  1YG6 A;  5INF A;  1Q52 A;  5E0S H;  3KTI A;  1OD2 A;  3DJA A;  4JVT A;  5MGB A;  4U19 A;  4RCN A;  4DI1 A;  4EMM A;  3QK8 A;  2YJG A;  2F9I A;  3RRV A;  2J5G D;  5FUS A;  1FCF A;  5INI A;  4FN8 A;  4ASI A;  5JBX A;  1UYR A;  2Q34 A;  1EF9 A;  3QYR A;  2J5I I;  3V5I A;  3KTH A;  1WDM A;  1N6E A;  3HIN A;  4EML A;  5DZK A;  3HP0 A;  4U0G H;  3T8B A;  2NP9 A;  5DUF A;  2ZL2 A;  3QWD A;  3TVU A;  4U0G A;  2QQ3 A;  1ON9 A;  4NEK A;  5E0N X;  3BEZ A;  2CE3 A;  3P5M A;  5DKP A;  4FND A;  4QIJ A;  4HNK A;  3H0U A;  2VSU E;  4FZW A;  3GLM A;  3Q1T A;  3LKE A;  3GMA A;  5ING A;  5DTW A;  4MOU A;  1JXZ A;  5DU6 A;  4LK5 A;  3KTG A;  5DZK H;  4G2R A;  1J7X A;  5CTB A;  2F6I A;  4L8K A;  4FNB A;  1XNW A;  2PG8 A;  2HW5 A;  5KDR B;  4EMP A;  4B3H A;  4FZW C;  3STA A;  4JCT A;  1FC7 A;  4ZDE A;  3ZW9 A;  3BF0 A;  3ZW8 A;  2J5G A;  4U0H A;  4Q1I A;  1MJ3 A;  2PPY A;  1WDL A;  3L3S A;  4U1A A;  2GTR A;  3M6N A;  2UZF A;  3Q0G A;  4JJT A;  1W2X A;  5DU8 A;  4L6W A;  3ZWA A;  1NZY B;  4KD6 A;  5HUQ A;  2BZR A;  2ZL0 A;  3N6R B;  3U9S B;  1FC9 A;  4OG1 A;  1XNV A;  3Q7H A;  4YLH A;  2J5I B;  4QII A;  5DUC A;  5G1R A;  2VRE A;  4JYL A;  3G64 A;  1WZ8 A;  2ZL3 A;  3Q0J A;  1TYF A;  3K50 A;  4K3W A;  3VIV A;  4ZDD A;  4OMR A;  2F9Y A;  4JYJ A;  2Q35 A;  4WZ8 B;  3M6M A;  3KTJ A;  3BPT A;  1O8U A;  2VSU C;  5C9G A;  4HDT A;  1UYV A;  4MXI A;  1WDK A;  3H0Q A;  4FJW D;  5KDR A;  2CBY A;  1HNO A;  4NAR A;  4MI2 A;  5G1S A;  5E0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...