3U9SB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
537
structure length
537
Chain Sequence
b'SHMAILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLAGPPLVKAATGEVVSAEELGGADVHCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGFMVGQKYEAGGIAKHGAKLVTAVACARVPKFTVLIGGSFGAGNYGMCGRAYDPRFLWMWPNARIGVMGGEQAAGVLAQVKREQAERAGQQLGVEEEAKIKAPILEQYEHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methylcrotonyl-CoA carboxylase, alpha-subunit
publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
total genus 171
structure length 537
sequence length 537
chains with identical sequence D, F, H, J, L
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9sB02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9sB01
4EMPA 2J5GD 1SZOA 3H0QA 3TDCA 3GF7A 5DKPA 2VSUE 5KDRB 4OG1A 3ST9A 4OMRA 1OD4A 2A81A 3QK8A 3H0SA 4K3WA 3KTJA 5C9GA 3ISAA 3HE2A 5MGBA 3G64A 1WDLA 3NJDA 2GTRA 2ZL3A 3VIVA 3HP0A 3ZW8A 3P85A 3HINA 2PG8A 2X58A 3U9RB 4JCQA 4JYJA 3PE8A 1X0UA 2A7SA 4Z0MA 4OLQA 5INFA 3Q7HA 4JVTA 2VSSA 2VSSF 1FCFA 1XNVA 3U9TB 3H02A 2J5II 4FZWA 4KWBA 2UZFA 1NZYB 5DU8A 3Q0JA 3R9QA 3T8AA 4F47A 2F9IA 2VSSE 5IKLB 1FC7A 1SG4A 4I52A 1HNOA 3LKEA 3TVWA 4ELSA 2Q2XA 4U19A 4FN8A 3OC7A 3MOYA 4Q0GA 3ZWAA 4ASIA 2IEXA 3KTGA 4ZDDA 4IZBA 4GHNA 2J5IB 4FZWC 1UYSA 3R9TA 2FW2A 3N6RB 5INIA 3TT6A 1WDMA 1XNWA 1Y7OA 2ZL2A 3H0JA 2VSUA 2VSUF 3KTKA 3JU1A 3NJBA 4I42A 3Q0GA 4K29A 1O8UA 4QIIA 4JOTA 4QIJA 1Q51A 2ZL0A 4ZDEA 3IBBA 1TG6A 3MFMA 5JBXA 5CTCA 4B3IA 3PZKA 3Q1TA 5DZKH 1XX4A 4L8KA 3GLMA 2VX2A 4JCTA 2J5SA 5G1QA 3RSTA 1K32A 2F6QA 4U0HA 4ZDCA 3T8BA 2VSUC 4B3HA 3QXIA 3H0UA 3TRRA 2VREA 3HLN1 2ZQRA 5DZKA 1ON9A 3M6MA 1MJ3A 3P5MA 4YLHA 4LK5A 3I47A 4EMLA 2DEOA 4KPKA 5DU6A 3T88A 1DCIA 3MYBA 4U1AA 3TVUA 3FF6A 2F9YA 3DORA 4FN7A 4U18A 5DUCA 2F6IA 5G1RA 4RCNA 2D3TA 3TZ3A 4G2RA 1EY3A 4WYOB 4RYFA 4IZCA 4L6WA 3GF3A 4JFCA 1YG6A 2J5GA 4ZDFA 2Q35A 1JXZA 3H81A 5INGA 5E0SA 5KJPA 3SWXA 3PEAA 3R9SA 4JYLA 3QMJA 5CTBA 4MOUA 4NNQA 1Q52A 4B3JA 2ZQQA 2CE3A 2C8TA 2QQ3A 3FDUA 3IB9A 3QWDA 3PGQA 4GM2A 4JSBA 3P2LA 1HNUA 3KTHA 1XNYA 4KD6A 3L3SA 3RRVA 3ZWCA 4EMMA 4JCSA 3QKAA 1EF9A 3LAOA 1YG8A 1WDKA 3OMEA 1PIXA 4ELWA 3QXZA 3IAVA 4WCZA 3T89A 3BPPA 1DUBA 1J7XA 2PPYA 4HNKA 3ZW9A 1WZ8A 3QREA 3RSIA 1RJNA 2BZRA 5C90A 2Q34A 4KNPA 1HZDA 3R6HA 1N6FA 3K8XA 5DL1A 1N6DA 1K39A 5DUFA 3MT6A 5JBWA 3WG5A 3BF0A 4MI2A 4ZDBA 3ZWBA 1UYVA 2F9YB 4RYFH 3T3WA 4ZU2A 3M6NA 2WTBA 4DI1A 3K50A 5KDRA 3TV5A 4IZDA 1UYTA 3STAA 5E0SH 2F9IB 1FC9A 3HRXA 3R0OA 3TLFA 1RJMA 4U0GH 2CBYA 1EF8A 2FZSA 5E0NX 4JCRA 4FNDA 2A7KA 2NP9A 2EJ5A 2HW5A 3OT6A 3KQFA 4HC8A 4U0GA 5DTWA 3SLLA 4I4ZA 2ZL4A 1TYFA 4JJTA 4QFEA 3KTIA 1XO6A 4NEKA 5FUSA 1NZYA 2X24A 4FJWD 3QYRA 4FB8A 1PJHA 3GMAA 1VRGA 3V5EA 5DU4A 1N6EA 4WZ8B 1UIYA 3V5IA 5FIFA 2PBPA 3GKBA 3BEZA 4K2NA 4ELXA 4MXIA 5G1SA 1W2XA 4Q1IA 4FNBA 2DUBA 1FC6A 3TT7A 1ON3A 1UYRA 2FBMA 2J5IA 5DTPA 1OD2A 4JWVA 2W3PA 3DJAA 3U9SB
chains in the Genus database with same CATH superfamily
4EMPA 2J5GD 1SZOA 3H0QA 3TDCA 3GF7A 5DKPA 2VSUE 5KDRB 4OG1A 3ST9A 4OMRA 1OD4A 2A81A 3QK8A 3H0SA 4K3WA 3KTJA 5C9GA 3ISAA 3HE2A 5MGBA 3G64A 1WDLA 3NJDA 2GTRA 2ZL3A 3VIVA 3HP0A 3ZW8A 3P85A 3HINA 2PG8A 2X58A 3U9RB 4JCQA 4JYJA 3PE8A 1X0UA 2A7SA 4Z0MA 4OLQA 5INFA 3Q7HA 4JVTA 2VSSA 2VSSF 1FCFA 1XNVA 3U9TB 3H02A 2J5II 4FZWA 4KWBA 2UZFA 1NZYB 5DU8A 3Q0JA 3R9QA 3T8AA 4F47A 2F9IA 2VSSE 5IKLB 1FC7A 1SG4A 4I52A 1HNOA 3LKEA 3TVWA 4ELSA 2Q2XA 4U19A 4FN8A 3OC7A 3MOYA 4Q0GA 3ZWAA 4ASIA 2IEXA 3KTGA 4ZDDA 4IZBA 4GHNA 2J5IB 4FZWC 1UYSA 3R9TA 2FW2A 3N6RB 5INIA 3TT6A 1WDMA 1XNWA 1Y7OA 2ZL2A 3H0JA 2VSUA 2VSUF 3KTKA 3JU1A 3NJBA 4I42A 3Q0GA 4K29A 1O8UA 4QIIA 4JOTA 4QIJA 1Q51A 2ZL0A 4ZDEA 3IBBA 1TG6A 3MFMA 4J2UA 5JBXA 5CTCA 4B3IA 3PZKA 3Q1TA 5DZKH 1XX4A 4L8KA 3GLMA 2VX2A 4JCTA 2J5SA 5G1QA 3RSTA 1K32A 2F6QA 4U0HA 4ZDCA 3T8BA 2VSUC 4B3HA 3QXIA 3H0UA 3TRRA 2VREA 3HLN1 2ZQRA 5DZKA 1ON9A 3M6MA 1MJ3A 3P5MA 4YLHA 4LK5A 3I47A 4EMLA 2DEOA 4KPKA 5DU6A 3T88A 1DCIA 3MYBA 4U1AA 3TVUA 3FF6A 2F9YA 3DORA 4FN7A 4U18A 5DUCA 2F6IA 5G1RA 4RCNA 2D3TA 3TZ3A 4G2RA 1EY3A 4WYOB 4RYFA 4IZCA 4L6WA 3GF3A 5HUQA 4JFCA 1YG6A 2J5GA 4ZDFA 2Q35A 1JXZA 3H81A 5INGA 5E0SA 5KJPA 3SWXA 3PEAA 3R9SA 4JYLA 3QMJA 5CTBA 4MOUA 4NNQA 1Q52A 4B3JA 2ZQQA 2CE3A 2C8TA 2QQ3A 3FDUA 3IB9A 3QWDA 3PGQA 4GM2A 4JSBA 3P2LA 1HNUA 3KTHA 1XNYA 4KD6A 3L3SA 3RRVA 3ZWCA 4EMMA 4JCSA 3QKAA 1EF9A 3LAOA 1YG8A 1WDKA 3OMEA 1PIXA 4ELWA 3QXZA 3IAVA 4WCZA 3T89A 3BPPA 1DUBA 1J7XA 2PPYA 4HNKA 3ZW9A 1WZ8A 3QREA 3RSIA 1RJNA 2BZRA 5C90A 2Q34A 4NARA 4KNPA 1HZDA 3R6HA 1N6FA 3K8XA 5DL1A 1N6DA 1K39A 5DUFA 3MT6A 5JBWA 3WG5A 3BF0A 4MI2A 4ZDBA 3ZWBA 1UYVA 2F9YB 4RYFH 3T3WA 2YJGA 4ZU2A 3M6NA 2WTBA 4DI1A 3K50A 5KDRA 3TV5A 4IZDA 1UYTA 3STAA 5E0SH 2F9IB 1FC9A 3HRXA 3R0OA 3TLFA 1RJMA 4U0GH 2CBYA 1EF8A 2FZSA 5E0NX 4JCRA 4FNDA 2A7KA 2NP9A 2EJ5A 2HW5A 3OT6A 3KQFA 4HC8A 4U0GA 5DTWA 3SLLA 4I4ZA 2ZL4A 1TYFA 4JJTA 4QFEA 3KTIA 1XO6A 4NEKA 5FUSA 1NZYA 2X24A 4FJWD 3QYRA 4FB8A 1PJHA 3BPTA 3GMAA 1VRGA 3V5EA 5DU4A 1N6EA 4WZ8B 1UIYA 3V5IA 5FIFA 2PBPA 3GKBA 3BEZA 4K2NA 4ELXA 4MXIA 5G1SA 1W2XA 4Q1IA 4FNBA 4HDTA 2DUBA 1FC6A 3TT7A 1ON3A 1UYRA 2FBMA 2J5IA 5DTPA 1OD2A 4JWVA 2W3PA 3DJAA 3U9SB
chains in the Genus database with same CATH topology
4EMPA 2J5GD 1SZOA 3H0QA 3TDCA 3GF7A 5DKPA 2VSUE 5KDRB 4OG1A 3ST9A 4OMRA 1OD4A 2A81A 3QK8A 3H0SA 4K3WA 3KTJA 5C9GA 3ISAA 3HE2A 5MGBA 3G64A 1WDLA 3NJDA 2GTRA 2ZL3A 3VIVA 3HP0A 3ZW8A 3P85A 3HINA 2PG8A 2X58A 3U9RB 4JCQA 4JYJA 3PE8A 1X0UA 2A7SA 4Z0MA 4OLQA 5INFA 3Q7HA 4JVTA 2VSSA 2VSSF 1FCFA 1XNVA 3U9TB 3H02A 2J5II 4FZWA 4KWBA 2UZFA 1NZYB 5DU8A 3Q0JA 3R9QA 3T8AA 4F47A 2F9IA 2VSSE 5IKLB 1FC7A 1SG4A 4I52A 1HNOA 3LKEA 3TVWA 4ELSA 2Q2XA 4U19A 4FN8A 3OC7A 3MOYA 4Q0GA 3ZWAA 4ASIA 2IEXA 3KTGA 4ZDDA 4IZBA 4GHNA 2J5IB 4FZWC 1UYSA 3R9TA 2FW2A 3N6RB 5INIA 3TT6A 1WDMA 1XNWA 1Y7OA 2ZL2A 3H0JA 2VSUA 2VSUF 3KTKA 3JU1A 3NJBA 4I42A 3Q0GA 4K29A 1O8UA 4QIIA 4JOTA 4QIJA 1Q51A 2ZL0A 4ZDEA 3IBBA 1TG6A 3MFMA 4J2UA 5JBXA 5CTCA 4B3IA 3PZKA 3Q1TA 5DZKH 1XX4A 4L8KA 3GLMA 2VX2A 4JCTA 2J5SA 5G1QA 3RSTA 1K32A 2F6QA 4U0HA 4ZDCA 3T8BA 2VSUC 4B3HA 3QXIA 3H0UA 3TRRA 2VREA 3HLN1 2ZQRA 5DZKA 1ON9A 3M6MA 1MJ3A 3P5MA 4YLHA 4LK5A 3I47A 4EMLA 2DEOA 4KPKA 5DU6A 3T88A 1DCIA 3MYBA 4U1AA 3TVUA 3FF6A 2F9YA 3DORA 4FN7A 4U18A 5DUCA 2F6IA 5G1RA 4RCNA 2D3TA 3TZ3A 4G2RA 1EY3A 4WYOB 4RYFA 4IZCA 4L6WA 3GF3A 5HUQA 4JFCA 1YG6A 2J5GA 4ZDFA 2Q35A 1JXZA 3H81A 5INGA 5E0SA 5KJPA 3SWXA 3PEAA 3R9SA 4JYLA 3QMJA 5CTBA 4MOUA 4NNQA 1Q52A 4B3JA 2ZQQA 2CE3A 2C8TA 2QQ3A 3FDUA 3IB9A 3QWDA 3PGQA 4GM2A 4JSBA 3P2LA 1HNUA 3KTHA 1XNYA 4KD6A 3L3SA 3RRVA 3ZWCA 4EMMA 4JCSA 3QKAA 1EF9A 3LAOA 1YG8A 1WDKA 3OMEA 1PIXA 4ELWA 3QXZA 3IAVA 4WCZA 3T89A 3BPPA 1DUBA 1J7XA 2PPYA 4HNKA 3ZW9A 1WZ8A 3QREA 3RSIA 1RJNA 2BZRA 5C90A 2Q34A 4NARA 4KNPA 1HZDA 3R6HA 1N6FA 3K8XA 5DL1A 1N6DA 1K39A 5DUFA 3MT6A 5JBWA 3WG5A 3BF0A 4MI2A 4ZDBA 3ZWBA 1UYVA 2F9YB 4RYFH 3T3WA 2YJGA 4ZU2A 3M6NA 2WTBA 4DI1A 3K50A 5KDRA 3TV5A 4IZDA 1UYTA 3STAA 5E0SH 2F9IB 1FC9A 3HRXA 3R0OA 3TLFA 1RJMA 4U0GH 2CBYA 1EF8A 2FZSA 5E0NX 4JCRA 4FNDA 2A7KA 2NP9A 2EJ5A 2HW5A 3OT6A 3KQFA 4HC8A 4U0GA 5DTWA 3SLLA 4I4ZA 2ZL4A 1TYFA 4JJTA 4QFEA 3KTIA 1XO6A 4NEKA 5FUSA 1NZYA 2X24A 4FJWD 3QYRA 4FB8A 1PJHA 3BPTA 3GMAA 1VRGA 3V5EA 5DU4A 1N6EA 4WZ8B 1UIYA 3V5IA 5FIFA 2PBPA 3GKBA 3BEZA 4K2NA 4ELXA 4MXIA 5G1SA 1W2XA 4Q1IA 4FNBA 4HDTA 2DUBA 1FC6A 3TT7A 1ON3A 1UYRA 2FBMA 2J5IA 5DTPA 1OD2A 4JWVA 2W3PA 3DJAA 3U9SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMP A;  2J5G D;  1SZO A;  3H0Q A;  3TDC A;  3GF7 A;  5DKP A;  2VSU E;  5KDR B;  4OG1 A;  3ST9 A;  4OMR A;  1OD4 A;  2A81 A;  3QK8 A;  3H0S A;  4K3W A;  3KTJ A;  5C9G A;  3ISA A;  3HE2 A;  5MGB A;  3G64 A;  1WDL A;  3NJD A;  2GTR A;  2ZL3 A;  3VIV A;  3HP0 A;  3ZW8 A;  3P85 A;  3HIN A;  2PG8 A;  2X58 A;  3U9R B;  4JCQ A;  4JYJ A;  3PE8 A;  1X0U A;  2A7S A;  4Z0M A;  4OLQ A;  5INF A;  3Q7H A;  4JVT A;  2VSS A;  2VSS F;  1FCF A;  1XNV A;  3U9T B;  3H02 A;  2J5I I;  4FZW A;  4KWB A;  2UZF A;  1NZY B;  5DU8 A;  3Q0J A;  3R9Q A;  3T8A A;  4F47 A;  2F9I A;  2VSS E;  5IKL B;  1FC7 A;  1SG4 A;  4I52 A;  1HNO A;  3LKE A;  3TVW A;  4ELS A;  2Q2X A;  4U19 A;  4FN8 A;  3OC7 A;  3MOY A;  4Q0G A;  3ZWA A;  4ASI A;  2IEX A;  3KTG A;  4ZDD A;  4IZB A;  4GHN A;  2J5I B;  4FZW C;  1UYS A;  3R9T A;  2FW2 A;  3N6R B;  5INI A;  3TT6 A;  1WDM A;  1XNW A;  1Y7O A;  2ZL2 A;  3H0J A;  2VSU A;  2VSU F;  3KTK A;  3JU1 A;  3NJB A;  4I42 A;  3Q0G A;  4K29 A;  1O8U A;  4QII A;  4JOT A;  4QIJ A;  1Q51 A;  2ZL0 A;  4ZDE A;  3IBB A;  1TG6 A;  3MFM A;  5JBX A;  5CTC A;  4B3I A;  3PZK A;  3Q1T A;  5DZK H;  1XX4 A;  4L8K A;  3GLM A;  2VX2 A;  4JCT A;  2J5S A;  5G1Q A;  3RST A;  1K32 A;  2F6Q A;  4U0H A;  4ZDC A;  3T8B A;  2VSU C;  4B3H A;  3QXI A;  3H0U A;  3TRR A;  2VRE A;  3HLN 1;  2ZQR A;  5DZK A;  1ON9 A;  3M6M A;  1MJ3 A;  3P5M A;  4YLH A;  4LK5 A;  3I47 A;  4EML A;  2DEO A;  4KPK A;  5DU6 A;  3T88 A;  1DCI A;  3MYB A;  4U1A A;  3TVU A;  3FF6 A;  2F9Y A;  3DOR A;  4FN7 A;  4U18 A;  5DUC A;  2F6I A;  5G1R A;  4RCN A;  2D3T A;  3TZ3 A;  4G2R A;  1EY3 A;  4WYO B;  4RYF A;  4IZC A;  4L6W A;  3GF3 A;  4JFC A;  1YG6 A;  2J5G A;  4ZDF A;  2Q35 A;  1JXZ A;  3H81 A;  5ING A;  5E0S A;  5KJP A;  3SWX A;  3PEA A;  3R9S A;  4JYL A;  3QMJ A;  5CTB A;  4MOU A;  4NNQ A;  1Q52 A;  4B3J A;  2ZQQ A;  2CE3 A;  2C8T A;  2QQ3 A;  3FDU A;  3IB9 A;  3QWD A;  3PGQ A;  4GM2 A;  4JSB A;  3P2L A;  1HNU A;  3KTH A;  1XNY A;  4KD6 A;  3L3S A;  3RRV A;  3ZWC A;  4EMM A;  4JCS A;  3QKA A;  1EF9 A;  3LAO A;  1YG8 A;  1WDK A;  3OME A;  1PIX A;  4ELW A;  3QXZ A;  3IAV A;  4WCZ A;  3T89 A;  3BPP A;  1DUB A;  1J7X A;  2PPY A;  4HNK A;  3ZW9 A;  1WZ8 A;  3QRE A;  3RSI A;  1RJN A;  2BZR A;  5C90 A;  2Q34 A;  4KNP A;  1HZD A;  3R6H A;  1N6F A;  3K8X A;  5DL1 A;  1N6D A;  1K39 A;  5DUF A;  3MT6 A;  5JBW A;  3WG5 A;  3BF0 A;  4MI2 A;  4ZDB A;  3ZWB A;  1UYV A;  2F9Y B;  4RYF H;  3T3W A;  4ZU2 A;  3M6N A;  2WTB A;  4DI1 A;  3K50 A;  5KDR A;  3TV5 A;  4IZD A;  1UYT A;  3STA A;  5E0S H;  2F9I B;  1FC9 A;  3HRX A;  3R0O A;  3TLF A;  1RJM A;  4U0G H;  2CBY A;  1EF8 A;  2FZS A;  5E0N X;  4JCR A;  4FND A;  2A7K A;  2NP9 A;  2EJ5 A;  2HW5 A;  3OT6 A;  3KQF A;  4HC8 A;  4U0G A;  5DTW A;  3SLL A;  4I4Z A;  2ZL4 A;  1TYF A;  4JJT A;  4QFE A;  3KTI A;  1XO6 A;  4NEK A;  5FUS A;  1NZY A;  2X24 A;  4FJW D;  3QYR A;  4FB8 A;  1PJH A;  3GMA A;  1VRG A;  3V5E A;  5DU4 A;  1N6E A;  4WZ8 B;  1UIY A;  3V5I A;  5FIF A;  2PBP A;  3GKB A;  3BEZ A;  4K2N A;  4ELX A;  4MXI A;  5G1S A;  1W2X A;  4Q1I A;  4FNB A;  2DUB A;  1FC6 A;  3TT7 A;  1ON3 A;  1UYR A;  2FBM A;  2J5I A;  5DTP A;  1OD2 A;  4JWV A;  2W3P A;  3DJA A;  3U9S B; 
#chains in the Genus database with same CATH topology
 4EMP A;  2J5G D;  1SZO A;  3H0Q A;  3TDC A;  3GF7 A;  5DKP A;  2VSU E;  5KDR B;  4OG1 A;  3ST9 A;  4OMR A;  1OD4 A;  2A81 A;  3QK8 A;  3H0S A;  4K3W A;  3KTJ A;  5C9G A;  3ISA A;  3HE2 A;  5MGB A;  3G64 A;  1WDL A;  3NJD A;  2GTR A;  2ZL3 A;  3VIV A;  3HP0 A;  3ZW8 A;  3P85 A;  3HIN A;  2PG8 A;  2X58 A;  3U9R B;  4JCQ A;  4JYJ A;  3PE8 A;  1X0U A;  2A7S A;  4Z0M A;  4OLQ A;  5INF A;  3Q7H A;  4JVT A;  2VSS A;  2VSS F;  1FCF A;  1XNV A;  3U9T B;  3H02 A;  2J5I I;  4FZW A;  4KWB A;  2UZF A;  1NZY B;  5DU8 A;  3Q0J A;  3R9Q A;  3T8A A;  4F47 A;  2F9I A;  2VSS E;  5IKL B;  1FC7 A;  1SG4 A;  4I52 A;  1HNO A;  3LKE A;  3TVW A;  4ELS A;  2Q2X A;  4U19 A;  4FN8 A;  3OC7 A;  3MOY A;  4Q0G A;  3ZWA A;  4ASI A;  2IEX A;  3KTG A;  4ZDD A;  4IZB A;  4GHN A;  2J5I B;  4FZW C;  1UYS A;  3R9T A;  2FW2 A;  3N6R B;  5INI A;  3TT6 A;  1WDM A;  1XNW A;  1Y7O A;  2ZL2 A;  3H0J A;  2VSU A;  2VSU F;  3KTK A;  3JU1 A;  3NJB A;  4I42 A;  3Q0G A;  4K29 A;  1O8U A;  4QII A;  4JOT A;  4QIJ A;  1Q51 A;  2ZL0 A;  4ZDE A;  3IBB A;  1TG6 A;  3MFM A;  4J2U A;  5JBX A;  5CTC A;  4B3I A;  3PZK A;  3Q1T A;  5DZK H;  1XX4 A;  4L8K A;  3GLM A;  2VX2 A;  4JCT A;  2J5S A;  5G1Q A;  3RST A;  1K32 A;  2F6Q A;  4U0H A;  4ZDC A;  3T8B A;  2VSU C;  4B3H A;  3QXI A;  3H0U A;  3TRR A;  2VRE A;  3HLN 1;  2ZQR A;  5DZK A;  1ON9 A;  3M6M A;  1MJ3 A;  3P5M A;  4YLH A;  4LK5 A;  3I47 A;  4EML A;  2DEO A;  4KPK A;  5DU6 A;  3T88 A;  1DCI A;  3MYB A;  4U1A A;  3TVU A;  3FF6 A;  2F9Y A;  3DOR A;  4FN7 A;  4U18 A;  5DUC A;  2F6I A;  5G1R A;  4RCN A;  2D3T A;  3TZ3 A;  4G2R A;  1EY3 A;  4WYO B;  4RYF A;  4IZC A;  4L6W A;  3GF3 A;  5HUQ A;  4JFC A;  1YG6 A;  2J5G A;  4ZDF A;  2Q35 A;  1JXZ A;  3H81 A;  5ING A;  5E0S A;  5KJP A;  3SWX A;  3PEA A;  3R9S A;  4JYL A;  3QMJ A;  5CTB A;  4MOU A;  4NNQ A;  1Q52 A;  4B3J A;  2ZQQ A;  2CE3 A;  2C8T A;  2QQ3 A;  3FDU A;  3IB9 A;  3QWD A;  3PGQ A;  4GM2 A;  4JSB A;  3P2L A;  1HNU A;  3KTH A;  1XNY A;  4KD6 A;  3L3S A;  3RRV A;  3ZWC A;  4EMM A;  4JCS A;  3QKA A;  1EF9 A;  3LAO A;  1YG8 A;  1WDK A;  3OME A;  1PIX A;  4ELW A;  3QXZ A;  3IAV A;  4WCZ A;  3T89 A;  3BPP A;  1DUB A;  1J7X A;  2PPY A;  4HNK A;  3ZW9 A;  1WZ8 A;  3QRE A;  3RSI A;  1RJN A;  2BZR A;  5C90 A;  2Q34 A;  4NAR A;  4KNP A;  1HZD A;  3R6H A;  1N6F A;  3K8X A;  5DL1 A;  1N6D A;  1K39 A;  5DUF A;  3MT6 A;  5JBW A;  3WG5 A;  3BF0 A;  4MI2 A;  4ZDB A;  3ZWB A;  1UYV A;  2F9Y B;  4RYF H;  3T3W A;  2YJG A;  4ZU2 A;  3M6N A;  2WTB A;  4DI1 A;  3K50 A;  5KDR A;  3TV5 A;  4IZD A;  1UYT A;  3STA A;  5E0S H;  2F9I B;  1FC9 A;  3HRX A;  3R0O A;  3TLF A;  1RJM A;  4U0G H;  2CBY A;  1EF8 A;  2FZS A;  5E0N X;  4JCR A;  4FND A;  2A7K A;  2NP9 A;  2EJ5 A;  2HW5 A;  3OT6 A;  3KQF A;  4HC8 A;  4U0G A;  5DTW A;  3SLL A;  4I4Z A;  2ZL4 A;  1TYF A;  4JJT A;  4QFE A;  3KTI A;  1XO6 A;  4NEK A;  5FUS A;  1NZY A;  2X24 A;  4FJW D;  3QYR A;  4FB8 A;  1PJH A;  3BPT A;  3GMA A;  1VRG A;  3V5E A;  5DU4 A;  1N6E A;  4WZ8 B;  1UIY A;  3V5I A;  5FIF A;  2PBP A;  3GKB A;  3BEZ A;  4K2N A;  4ELX A;  4MXI A;  5G1S A;  1W2X A;  4Q1I A;  4FNB A;  4HDT A;  2DUB A;  1FC6 A;  3TT7 A;  1ON3 A;  1UYR A;  2FBM A;  2J5I A;  5DTP A;  1OD2 A;  4JWV A;  2W3P A;  3DJA A;  3U9S B; 
#chains in the Genus database with same CATH homology
 4EMP A;  2J5G D;  1SZO A;  3H0Q A;  3TDC A;  3GF7 A;  5DKP A;  2VSU E;  5KDR B;  4OG1 A;  3ST9 A;  4OMR A;  1OD4 A;  2A81 A;  3QK8 A;  3H0S A;  4K3W A;  3KTJ A;  5C9G A;  3ISA A;  3HE2 A;  5MGB A;  3G64 A;  1WDL A;  3NJD A;  2GTR A;  2ZL3 A;  3VIV A;  3HP0 A;  3ZW8 A;  3P85 A;  3HIN A;  2PG8 A;  2X58 A;  3U9R B;  4JCQ A;  4JYJ A;  3PE8 A;  1X0U A;  2A7S A;  4Z0M A;  4OLQ A;  5INF A;  3Q7H A;  4JVT A;  2VSS A;  2VSS F;  1FCF A;  1XNV A;  3U9T B;  3H02 A;  2J5I I;  4FZW A;  4KWB A;  2UZF A;  1NZY B;  5DU8 A;  3Q0J A;  3R9Q A;  3T8A A;  4F47 A;  2F9I A;  2VSS E;  5IKL B;  1FC7 A;  1SG4 A;  4I52 A;  1HNO A;  3LKE A;  3TVW A;  4ELS A;  2Q2X A;  4U19 A;  4FN8 A;  3OC7 A;  3MOY A;  4Q0G A;  3ZWA A;  4ASI A;  2IEX A;  3KTG A;  4ZDD A;  4IZB A;  4GHN A;  2J5I B;  4FZW C;  1UYS A;  3R9T A;  2FW2 A;  3N6R B;  5INI A;  3TT6 A;  1WDM A;  1XNW A;  1Y7O A;  2ZL2 A;  3H0J A;  2VSU A;  2VSU F;  3KTK A;  3JU1 A;  3NJB A;  4I42 A;  3Q0G A;  4K29 A;  1O8U A;  4QII A;  4JOT A;  4QIJ A;  1Q51 A;  2ZL0 A;  4ZDE A;  3IBB A;  1TG6 A;  3MFM A;  4J2U A;  5JBX A;  5CTC A;  4B3I A;  3PZK A;  3Q1T A;  5DZK H;  1XX4 A;  4L8K A;  3GLM A;  2VX2 A;  4JCT A;  2J5S A;  5G1Q A;  3RST A;  1K32 A;  2F6Q A;  4U0H A;  4ZDC A;  3T8B A;  2VSU C;  4B3H A;  3QXI A;  3H0U A;  3TRR A;  2VRE A;  3HLN 1;  2ZQR A;  5DZK A;  1ON9 A;  3M6M A;  1MJ3 A;  3P5M A;  4YLH A;  4LK5 A;  3I47 A;  4EML A;  2DEO A;  4KPK A;  5DU6 A;  3T88 A;  1DCI A;  3MYB A;  4U1A A;  3TVU A;  3FF6 A;  2F9Y A;  3DOR A;  4FN7 A;  4U18 A;  5DUC A;  2F6I A;  5G1R A;  4RCN A;  2D3T A;  3TZ3 A;  4G2R A;  1EY3 A;  4WYO B;  4RYF A;  4IZC A;  4L6W A;  3GF3 A;  5HUQ A;  4JFC A;  1YG6 A;  2J5G A;  4ZDF A;  2Q35 A;  1JXZ A;  3H81 A;  5ING A;  5E0S A;  5KJP A;  3SWX A;  3PEA A;  3R9S A;  4JYL A;  3QMJ A;  5CTB A;  4MOU A;  4NNQ A;  1Q52 A;  4B3J A;  2ZQQ A;  2CE3 A;  2C8T A;  2QQ3 A;  3FDU A;  3IB9 A;  3QWD A;  3PGQ A;  4GM2 A;  4JSB A;  3P2L A;  1HNU A;  3KTH A;  1XNY A;  4KD6 A;  3L3S A;  3RRV A;  3ZWC A;  4EMM A;  4JCS A;  3QKA A;  1EF9 A;  3LAO A;  1YG8 A;  1WDK A;  3OME A;  1PIX A;  4ELW A;  3QXZ A;  3IAV A;  4WCZ A;  3T89 A;  3BPP A;  1DUB A;  1J7X A;  2PPY A;  4HNK A;  3ZW9 A;  1WZ8 A;  3QRE A;  3RSI A;  1RJN A;  2BZR A;  5C90 A;  2Q34 A;  4NAR A;  4KNP A;  1HZD A;  3R6H A;  1N6F A;  3K8X A;  5DL1 A;  1N6D A;  1K39 A;  5DUF A;  3MT6 A;  5JBW A;  3WG5 A;  3BF0 A;  4MI2 A;  4ZDB A;  3ZWB A;  1UYV A;  2F9Y B;  4RYF H;  3T3W A;  2YJG A;  4ZU2 A;  3M6N A;  2WTB A;  4DI1 A;  3K50 A;  5KDR A;  3TV5 A;  4IZD A;  1UYT A;  3STA A;  5E0S H;  2F9I B;  1FC9 A;  3HRX A;  3R0O A;  3TLF A;  1RJM A;  4U0G H;  2CBY A;  1EF8 A;  2FZS A;  5E0N X;  4JCR A;  4FND A;  2A7K A;  2NP9 A;  2EJ5 A;  2HW5 A;  3OT6 A;  3KQF A;  4HC8 A;  4U0G A;  5DTW A;  3SLL A;  4I4Z A;  2ZL4 A;  1TYF A;  4JJT A;  4QFE A;  3KTI A;  1XO6 A;  4NEK A;  5FUS A;  1NZY A;  2X24 A;  4FJW D;  3QYR A;  4FB8 A;  1PJH A;  3BPT A;  3GMA A;  1VRG A;  3V5E A;  5DU4 A;  1N6E A;  4WZ8 B;  1UIY A;  3V5I A;  5FIF A;  2PBP A;  3GKB A;  3BEZ A;  4K2N A;  4ELX A;  4MXI A;  5G1S A;  1W2X A;  4Q1I A;  4FNB A;  4HDT A;  2DUB A;  1FC6 A;  3TT7 A;  1ON3 A;  1UYR A;  2FBM A;  2J5I A;  5DTP A;  1OD2 A;  4JWV A;  2W3P A;  3DJA A;  3U9S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...