3U9SB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
537
structure length
537
Chain Sequence
SHMAILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLAGPPLVKAATGEVVSAEELGGADVHCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGFMVGQKYEAGGIAKHGAKLVTAVACARVPKFTVLIGGSFGAGNYGMCGRAYDPRFLWMWPNARIGVMGGEQAAGVLAQVKREQAERAGQQLGVEEEAKIKAPILEQYEHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Methylcrotonyl-CoA carboxylase, alpha-subunit
total genus 171
structure length 537
sequence length 537
chains with identical sequence D, F, H, J, L
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9sB02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9sB01
3FF6A 1HZDA 2W3PA 3GMAA 3U9RB 5G1RA 3DORA 4QIJA 4WCZA 4FZWC 4JJTA 4ZU2A 2A81A 3M6MA 3NJBA 3MT6A 4U0GA 3H0QA 3BF0A 1TG6A 3GKBA 1N6EA 4U18A 3V5EA 3U9TB 3R9TA 4RCNA 3PGQA 4WYOB 3H02A 3G64A 3T89A 4ZDFA 3Q1TA 3R9QA 2IEXA 5E0SA 4JCTA 1OD2A 2ZL4A 4FZWA 5DU6A 3RRVA 3MYBA 4MOUA 1K39A 4FJWD 2VSUC 1FC9A 3M6NA 3T88A 3P5MA 3GF3A 5DKPA 4GHNA 5JBXA 1UYVA 2FBMA 3PEAA 3T8BA 1WDLA 3KQFA 1ON3A 4B3HA 1Y7OA 1VRGA 4ELXA 1SG4A 3HP0A 2F9IA 3QXIA 1XNWA 3K50A 4KD6A 2FZSA 2X24A 3QREA 4YLHA 4G2RA 2VREA 4K3WA 1EF9A 3HE2A 4JSBA 3GF7A 3TDCA 2J5GD 3BEZA 4KWBA 3KTJA 1X0UA 3U9SB 2F6QA 2PG8A 5KDRB 3BPPA 2J5IA 1XO6A 4ZDBA 3TV5A 4L8KA 4K29A 3TT6A 4HNKA 1SZOA 3RSIA 1UIYA 3Q0JA 2Q2XA 3PZKA 1NZYA 3QK8A 3HINA 4FN7A 3P2LA 3GLMA 3H0JA 2Q35A 4ZDEA 2VSUF 1XNVA 1WDMA 4B3IA 3TZ3A 3Q7HA 1FCFA 3HLN1 3KTGA 2F9IB 3ZW8A 1K32A 3QMJA 4JCQA 3MFMA 3MOYA 3QYRA 5FIFA 4L6WA 4OG1A 4I52A 5CTCA 1HNOA 2HW5A 2VSUE 3PE8A 5DTPA 4ZDCA 4IZBA 3ZW9A 3QXZA 1N6DA 4MXIA 1DUBA 1UYRA 2GTRA 4RYFH 4EMMA 3ZWAA 1TYFA 5INIA 3K8XA 4ELWA 2UZFA 5DU8A 3QWDA 3RSTA 3Q0GA 1ON9A 1XNYA 5DUFA 3IBBA 3H81A 4F47A 3TVUA 4LK5A 4IZCA 2J5IB 3H0UA 3ST9A 2CBYA 1O8UA 4FN8A 2A7SA 2DUBA 4JCSA 4WZ8B 4FB8A 3STAA 4ELSA 5INGA 1NZYB 2F9YA 1Q52A 3IAVA 4FNBA 3SLLA 1RJMA 4JCRA 5E0SH 2VSSE 4KNPA 2ZL2A 4U19A 3IB9A 4ZDDA 2A7KA 2J5GA 4GM2A 3DJAA 3R9SA 3HRXA 1EY3A 3SWXA 2J5II 1PIXA 4U0HA 4Z0MA 2QQ3A 3OMEA 5DZKH 5MGBA 1W2XA 5KJPA 3TVWA 2F6IA 3ISAA 3R6HA 5E0NX 1WZ8A 3OC7A 4RYFA 2EJ5A 5JBWA 2VX2A 4I42A 4QIIA 4QFEA 1EF8A 4I4ZA 5DUCA 4NEKA 4U0GH 3H0SA 1UYSA 2F9YB 1FC7A 1DCIA 2X58A 4ASIA 2CE3A 2WTBA 2FW2A 3V5IA 2ZL0A 4NNQA 4JVTA 3T3WA 2VSSF 5C90A 3FDUA 2ZQRA 2PPYA 3ZWCA 3KTKA 1HNUA 5G1SA 3VIVA 1FC6A 4JYJA 2D3TA 5CTBA 2BZRA 4HC8A 5DZKA 3TRRA 4JOTA 1JXZA 1PJHA 4EMLA 2ZQQA 4K2NA 1WDKA 1J7XA 5DTWA 5DL1A 2Q34A 4OLQA 3WG5A 1N6FA 1MJ3A 1OD4A 1YG8A 4EMPA 4FNDA 2VSSA 1Q51A 3KTHA 2C8TA 2DEOA 4U1AA 2PBPA 3ZWBA 3JU1A 5C9GA 2J5SA 5KDRA 1RJNA 3OT6A 2VSUA 3TT7A 4JFCA 5G1QA 3LAOA 4DI1A 5FUSA 3P85A 3R0OA 4MI2A 4B3JA 3LKEA 3N6RB 5IKLB 3TLFA 4Q1IA 3L3SA 2ZL3A 3I47A 5DU4A 1UYTA 3T8AA 2NP9A 4Q0GA 1YG6A 3QKAA 5INFA 3NJDA 4OMRA 4IZDA 4JWVA 1XX4A 3KTIA 4JYLA 4KPKA
chains in the Genus database with same CATH superfamily
3FF6A 1HZDA 2W3PA 3GMAA 3U9RB 5G1RA 3DORA 4QIJA 4WCZA 4FZWC 4JJTA 4ZU2A 2A81A 3M6MA 3NJBA 3MT6A 4U0GA 3H0QA 3BF0A 1TG6A 3GKBA 1N6EA 4U18A 3V5EA 3U9TB 3R9TA 4RCNA 3PGQA 4WYOB 3H02A 3G64A 3T89A 4ZDFA 3Q1TA 3R9QA 2IEXA 4J2UA 5E0SA 4JCTA 1OD2A 2ZL4A 4FZWA 5DU6A 3RRVA 3MYBA 4MOUA 1K39A 4FJWD 2VSUC 1FC9A 3M6NA 3T88A 3P5MA 3GF3A 5DKPA 4GHNA 5JBXA 1UYVA 2FBMA 3PEAA 3T8BA 1WDLA 3KQFA 1ON3A 4B3HA 1Y7OA 1VRGA 4ELXA 1SG4A 3HP0A 2YJGA 2F9IA 3QXIA 1XNWA 3K50A 4KD6A 2FZSA 2X24A 3QREA 4YLHA 4G2RA 2VREA 4K3WA 1EF9A 3HE2A 4JSBA 3GF7A 3TDCA 2J5GD 3BEZA 4KWBA 3KTJA 1X0UA 3U9SB 2F6QA 2PG8A 5KDRB 3BPPA 2J5IA 1XO6A 4ZDBA 3TV5A 4L8KA 4K29A 3TT6A 4NARA 4HNKA 1SZOA 3RSIA 1UIYA 3Q0JA 2Q2XA 3PZKA 1NZYA 3QK8A 3HINA 4FN7A 3P2LA 3GLMA 3H0JA 2Q35A 4ZDEA 2VSUF 1XNVA 1WDMA 4B3IA 3TZ3A 3Q7HA 1FCFA 3HLN1 3KTGA 2F9IB 3ZW8A 1K32A 3QMJA 4JCQA 3MFMA 3MOYA 3QYRA 5FIFA 4L6WA 4OG1A 4I52A 5CTCA 1HNOA 2HW5A 2VSUE 3PE8A 5DTPA 4ZDCA 4IZBA 3ZW9A 3QXZA 1N6DA 4MXIA 1DUBA 1UYRA 2GTRA 4RYFH 4EMMA 3ZWAA 1TYFA 5INIA 3K8XA 4ELWA 2UZFA 5DU8A 3QWDA 3RSTA 3Q0GA 1ON9A 1XNYA 5DUFA 3IBBA 3H81A 4F47A 3TVUA 4LK5A 4IZCA 5HUQA 2J5IB 3H0UA 3ST9A 2CBYA 4HDTA 1O8UA 4FN8A 2A7SA 2DUBA 4JCSA 4WZ8B 4FB8A 3STAA 4ELSA 5INGA 1NZYB 2F9YA 1Q52A 3IAVA 4FNBA 3SLLA 1RJMA 4JCRA 5E0SH 2VSSE 4KNPA 2ZL2A 3BPTA 4U19A 3IB9A 4ZDDA 2A7KA 2J5GA 4GM2A 3DJAA 3R9SA 3HRXA 1EY3A 3SWXA 2J5II 1PIXA 4U0HA 4Z0MA 2QQ3A 3OMEA 5DZKH 5MGBA 1W2XA 5KJPA 3TVWA 2F6IA 3ISAA 3R6HA 5E0NX 1WZ8A 3OC7A 4RYFA 2EJ5A 5JBWA 2VX2A 4I42A 4QIIA 4QFEA 1EF8A 4I4ZA 5DUCA 4NEKA 4U0GH 3H0SA 1UYSA 2F9YB 1FC7A 1DCIA 2X58A 4ASIA 2CE3A 2WTBA 2FW2A 3V5IA 2ZL0A 4NNQA 4JVTA 3T3WA 2VSSF 5C90A 3FDUA 2ZQRA 2PPYA 3ZWCA 3KTKA 1HNUA 5G1SA 3VIVA 1FC6A 4JYJA 2D3TA 5CTBA 2BZRA 4HC8A 5DZKA 3TRRA 4JOTA 1JXZA 1PJHA 4EMLA 2ZQQA 4K2NA 1WDKA 1J7XA 5DTWA 5DL1A 2Q34A 4OLQA 3WG5A 1N6FA 1MJ3A 1OD4A 1YG8A 4EMPA 4FNDA 2VSSA 1Q51A 3KTHA 2C8TA 2DEOA 4U1AA 2PBPA 3ZWBA 3JU1A 5C9GA 2J5SA 5KDRA 1RJNA 3OT6A 2VSUA 3TT7A 4JFCA 5G1QA 3LAOA 4DI1A 5FUSA 3P85A 3R0OA 4MI2A 4B3JA 3LKEA 3N6RB 5IKLB 3TLFA 4Q1IA 3L3SA 2ZL3A 3I47A 5DU4A 1UYTA 3T8AA 2NP9A 4Q0GA 1YG6A 3QKAA 5INFA 3NJDA 4OMRA 4IZDA 4JWVA 1XX4A 3KTIA 4JYLA 4KPKA
chains in the Genus database with same CATH topology
3FF6A 1HZDA 2W3PA 3GMAA 3U9RB 5G1RA 3DORA 4QIJA 4WCZA 4FZWC 4JJTA 4ZU2A 2A81A 3M6MA 3NJBA 3MT6A 4U0GA 3H0QA 3BF0A 1TG6A 3GKBA 1N6EA 4U18A 3V5EA 3U9TB 3R9TA 4RCNA 3PGQA 4WYOB 3H02A 3G64A 3T89A 4ZDFA 3Q1TA 3R9QA 2IEXA 4J2UA 5E0SA 4JCTA 1OD2A 2ZL4A 4FZWA 5DU6A 3RRVA 3MYBA 4MOUA 1K39A 4FJWD 2VSUC 1FC9A 3M6NA 3T88A 3P5MA 3GF3A 5DKPA 4GHNA 5JBXA 1UYVA 2FBMA 3PEAA 3T8BA 1WDLA 3KQFA 1ON3A 4B3HA 1Y7OA 1VRGA 4ELXA 1SG4A 3HP0A 2YJGA 2F9IA 3QXIA 1XNWA 3K50A 4KD6A 2FZSA 2X24A 3QREA 4YLHA 4G2RA 2VREA 4K3WA 1EF9A 3HE2A 4JSBA 3GF7A 3TDCA 2J5GD 3BEZA 4KWBA 3KTJA 1X0UA 3U9SB 2F6QA 2PG8A 5KDRB 3BPPA 2J5IA 1XO6A 4ZDBA 3TV5A 4L8KA 4K29A 3TT6A 4NARA 4HNKA 1SZOA 3RSIA 1UIYA 3Q0JA 2Q2XA 3PZKA 1NZYA 3QK8A 3HINA 4FN7A 3P2LA 3GLMA 3H0JA 2Q35A 4ZDEA 2VSUF 1XNVA 1WDMA 4B3IA 3TZ3A 3Q7HA 1FCFA 3HLN1 3KTGA 2F9IB 3ZW8A 1K32A 3QMJA 4JCQA 3MFMA 3MOYA 3QYRA 5FIFA 4L6WA 4OG1A 4I52A 5CTCA 1HNOA 2HW5A 2VSUE 3PE8A 5DTPA 4ZDCA 4IZBA 3ZW9A 3QXZA 1N6DA 4MXIA 1DUBA 1UYRA 2GTRA 4RYFH 4EMMA 3ZWAA 1TYFA 5INIA 3K8XA 4ELWA 2UZFA 5DU8A 3QWDA 3RSTA 3Q0GA 1ON9A 1XNYA 5DUFA 3IBBA 3H81A 4F47A 3TVUA 4LK5A 4IZCA 5HUQA 2J5IB 3H0UA 3ST9A 2CBYA 4HDTA 1O8UA 4FN8A 2A7SA 2DUBA 4JCSA 4WZ8B 4FB8A 3STAA 4ELSA 5INGA 1NZYB 2F9YA 1Q52A 3IAVA 4FNBA 3SLLA 1RJMA 4JCRA 5E0SH 2VSSE 4KNPA 2ZL2A 3BPTA 4U19A 3IB9A 4ZDDA 2A7KA 2J5GA 4GM2A 3DJAA 3R9SA 3HRXA 1EY3A 3SWXA 2J5II 1PIXA 4U0HA 4Z0MA 2QQ3A 3OMEA 5DZKH 5MGBA 1W2XA 5KJPA 3TVWA 2F6IA 3ISAA 3R6HA 5E0NX 1WZ8A 3OC7A 4RYFA 2EJ5A 5JBWA 2VX2A 4I42A 4QIIA 4QFEA 1EF8A 4I4ZA 5DUCA 4NEKA 4U0GH 3H0SA 1UYSA 2F9YB 1FC7A 1DCIA 2X58A 4ASIA 2CE3A 2WTBA 2FW2A 3V5IA 2ZL0A 4NNQA 4JVTA 3T3WA 2VSSF 5C90A 3FDUA 2ZQRA 2PPYA 3ZWCA 3KTKA 1HNUA 5G1SA 3VIVA 1FC6A 4JYJA 2D3TA 5CTBA 2BZRA 4HC8A 5DZKA 3TRRA 4JOTA 1JXZA 1PJHA 4EMLA 2ZQQA 4K2NA 1WDKA 1J7XA 5DTWA 5DL1A 2Q34A 4OLQA 3WG5A 1N6FA 1MJ3A 1OD4A 1YG8A 4EMPA 4FNDA 2VSSA 1Q51A 3KTHA 2C8TA 2DEOA 4U1AA 2PBPA 3ZWBA 3JU1A 5C9GA 2J5SA 5KDRA 1RJNA 3OT6A 2VSUA 3TT7A 4JFCA 5G1QA 3LAOA 4DI1A 5FUSA 3P85A 3R0OA 4MI2A 4B3JA 3LKEA 3N6RB 5IKLB 3TLFA 4Q1IA 3L3SA 2ZL3A 3I47A 5DU4A 1UYTA 3T8AA 2NP9A 4Q0GA 1YG6A 3QKAA 5INFA 3NJDA 4OMRA 4IZDA 4JWVA 1XX4A 3KTIA 4JYLA 4KPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF6 A;  1HZD A;  2W3P A;  3GMA A;  3U9R B;  5G1R A;  3DOR A;  4QIJ A;  4WCZ A;  4FZW C;  4JJT A;  4ZU2 A;  2A81 A;  3M6M A;  3NJB A;  3MT6 A;  4U0G A;  3H0Q A;  3BF0 A;  1TG6 A;  3GKB A;  1N6E A;  4U18 A;  3V5E A;  3U9T B;  3R9T A;  4RCN A;  3PGQ A;  4WYO B;  3H02 A;  3G64 A;  3T89 A;  4ZDF A;  3Q1T A;  3R9Q A;  2IEX A;  5E0S A;  4JCT A;  1OD2 A;  2ZL4 A;  4FZW A;  5DU6 A;  3RRV A;  3MYB A;  4MOU A;  1K39 A;  4FJW D;  2VSU C;  1FC9 A;  3M6N A;  3T88 A;  3P5M A;  3GF3 A;  5DKP A;  4GHN A;  5JBX A;  1UYV A;  2FBM A;  3PEA A;  3T8B A;  1WDL A;  3KQF A;  1ON3 A;  4B3H A;  1Y7O A;  1VRG A;  4ELX A;  1SG4 A;  3HP0 A;  2F9I A;  3QXI A;  1XNW A;  3K50 A;  4KD6 A;  2FZS A;  2X24 A;  3QRE A;  4YLH A;  4G2R A;  2VRE A;  4K3W A;  1EF9 A;  3HE2 A;  4JSB A;  3GF7 A;  3TDC A;  2J5G D;  3BEZ A;  4KWB A;  3KTJ A;  1X0U A;  3U9S B;  2F6Q A;  2PG8 A;  5KDR B;  3BPP A;  2J5I A;  1XO6 A;  4ZDB A;  3TV5 A;  4L8K A;  4K29 A;  3TT6 A;  4HNK A;  1SZO A;  3RSI A;  1UIY A;  3Q0J A;  2Q2X A;  3PZK A;  1NZY A;  3QK8 A;  3HIN A;  4FN7 A;  3P2L A;  3GLM A;  3H0J A;  2Q35 A;  4ZDE A;  2VSU F;  1XNV A;  1WDM A;  4B3I A;  3TZ3 A;  3Q7H A;  1FCF A;  3HLN 1;  3KTG A;  2F9I B;  3ZW8 A;  1K32 A;  3QMJ A;  4JCQ A;  3MFM A;  3MOY A;  3QYR A;  5FIF A;  4L6W A;  4OG1 A;  4I52 A;  5CTC A;  1HNO A;  2HW5 A;  2VSU E;  3PE8 A;  5DTP A;  4ZDC A;  4IZB A;  3ZW9 A;  3QXZ A;  1N6D A;  4MXI A;  1DUB A;  1UYR A;  2GTR A;  4RYF H;  4EMM A;  3ZWA A;  1TYF A;  5INI A;  3K8X A;  4ELW A;  2UZF A;  5DU8 A;  3QWD A;  3RST A;  3Q0G A;  1ON9 A;  1XNY A;  5DUF A;  3IBB A;  3H81 A;  4F47 A;  3TVU A;  4LK5 A;  4IZC A;  2J5I B;  3H0U A;  3ST9 A;  2CBY A;  1O8U A;  4FN8 A;  2A7S A;  2DUB A;  4JCS A;  4WZ8 B;  4FB8 A;  3STA A;  4ELS A;  5ING A;  1NZY B;  2F9Y A;  1Q52 A;  3IAV A;  4FNB A;  3SLL A;  1RJM A;  4JCR A;  5E0S H;  2VSS E;  4KNP A;  2ZL2 A;  4U19 A;  3IB9 A;  4ZDD A;  2A7K A;  2J5G A;  4GM2 A;  3DJA A;  3R9S A;  3HRX A;  1EY3 A;  3SWX A;  2J5I I;  1PIX A;  4U0H A;  4Z0M A;  2QQ3 A;  3OME A;  5DZK H;  5MGB A;  1W2X A;  5KJP A;  3TVW A;  2F6I A;  3ISA A;  3R6H A;  5E0N X;  1WZ8 A;  3OC7 A;  4RYF A;  2EJ5 A;  5JBW A;  2VX2 A;  4I42 A;  4QII A;  4QFE A;  1EF8 A;  4I4Z A;  5DUC A;  4NEK A;  4U0G H;  3H0S A;  1UYS A;  2F9Y B;  1FC7 A;  1DCI A;  2X58 A;  4ASI A;  2CE3 A;  2WTB A;  2FW2 A;  3V5I A;  2ZL0 A;  4NNQ A;  4JVT A;  3T3W A;  2VSS F;  5C90 A;  3FDU A;  2ZQR A;  2PPY A;  3ZWC A;  3KTK A;  1HNU A;  5G1S A;  3VIV A;  1FC6 A;  4JYJ A;  2D3T A;  5CTB A;  2BZR A;  4HC8 A;  5DZK A;  3TRR A;  4JOT A;  1JXZ A;  1PJH A;  4EML A;  2ZQQ A;  4K2N A;  1WDK A;  1J7X A;  5DTW A;  5DL1 A;  2Q34 A;  4OLQ A;  3WG5 A;  1N6F A;  1MJ3 A;  1OD4 A;  1YG8 A;  4EMP A;  4FND A;  2VSS A;  1Q51 A;  3KTH A;  2C8T A;  2DEO A;  4U1A A;  2PBP A;  3ZWB A;  3JU1 A;  5C9G A;  2J5S A;  5KDR A;  1RJN A;  3OT6 A;  2VSU A;  3TT7 A;  4JFC A;  5G1Q A;  3LAO A;  4DI1 A;  5FUS A;  3P85 A;  3R0O A;  4MI2 A;  4B3J A;  3LKE A;  3N6R B;  5IKL B;  3TLF A;  4Q1I A;  3L3S A;  2ZL3 A;  3I47 A;  5DU4 A;  1UYT A;  3T8A A;  2NP9 A;  4Q0G A;  1YG6 A;  3QKA A;  5INF A;  3NJD A;  4OMR A;  4IZD A;  4JWV A;  1XX4 A;  3KTI A;  4JYL A;  4KPK A; 
#chains in the Genus database with same CATH topology
 3FF6 A;  1HZD A;  2W3P A;  3GMA A;  3U9R B;  5G1R A;  3DOR A;  4QIJ A;  4WCZ A;  4FZW C;  4JJT A;  4ZU2 A;  2A81 A;  3M6M A;  3NJB A;  3MT6 A;  4U0G A;  3H0Q A;  3BF0 A;  1TG6 A;  3GKB A;  1N6E A;  4U18 A;  3V5E A;  3U9T B;  3R9T A;  4RCN A;  3PGQ A;  4WYO B;  3H02 A;  3G64 A;  3T89 A;  4ZDF A;  3Q1T A;  3R9Q A;  2IEX A;  4J2U A;  5E0S A;  4JCT A;  1OD2 A;  2ZL4 A;  4FZW A;  5DU6 A;  3RRV A;  3MYB A;  4MOU A;  1K39 A;  4FJW D;  2VSU C;  1FC9 A;  3M6N A;  3T88 A;  3P5M A;  3GF3 A;  5DKP A;  4GHN A;  5JBX A;  1UYV A;  2FBM A;  3PEA A;  3T8B A;  1WDL A;  3KQF A;  1ON3 A;  4B3H A;  1Y7O A;  1VRG A;  4ELX A;  1SG4 A;  3HP0 A;  2YJG A;  2F9I A;  3QXI A;  1XNW A;  3K50 A;  4KD6 A;  2FZS A;  2X24 A;  3QRE A;  4YLH A;  4G2R A;  2VRE A;  4K3W A;  1EF9 A;  3HE2 A;  4JSB A;  3GF7 A;  3TDC A;  2J5G D;  3BEZ A;  4KWB A;  3KTJ A;  1X0U A;  3U9S B;  2F6Q A;  2PG8 A;  5KDR B;  3BPP A;  2J5I A;  1XO6 A;  4ZDB A;  3TV5 A;  4L8K A;  4K29 A;  3TT6 A;  4NAR A;  4HNK A;  1SZO A;  3RSI A;  1UIY A;  3Q0J A;  2Q2X A;  3PZK A;  1NZY A;  3QK8 A;  3HIN A;  4FN7 A;  3P2L A;  3GLM A;  3H0J A;  2Q35 A;  4ZDE A;  2VSU F;  1XNV A;  1WDM A;  4B3I A;  3TZ3 A;  3Q7H A;  1FCF A;  3HLN 1;  3KTG A;  2F9I B;  3ZW8 A;  1K32 A;  3QMJ A;  4JCQ A;  3MFM A;  3MOY A;  3QYR A;  5FIF A;  4L6W A;  4OG1 A;  4I52 A;  5CTC A;  1HNO A;  2HW5 A;  2VSU E;  3PE8 A;  5DTP A;  4ZDC A;  4IZB A;  3ZW9 A;  3QXZ A;  1N6D A;  4MXI A;  1DUB A;  1UYR A;  2GTR A;  4RYF H;  4EMM A;  3ZWA A;  1TYF A;  5INI A;  3K8X A;  4ELW A;  2UZF A;  5DU8 A;  3QWD A;  3RST A;  3Q0G A;  1ON9 A;  1XNY A;  5DUF A;  3IBB A;  3H81 A;  4F47 A;  3TVU A;  4LK5 A;  4IZC A;  5HUQ A;  2J5I B;  3H0U A;  3ST9 A;  2CBY A;  4HDT A;  1O8U A;  4FN8 A;  2A7S A;  2DUB A;  4JCS A;  4WZ8 B;  4FB8 A;  3STA A;  4ELS A;  5ING A;  1NZY B;  2F9Y A;  1Q52 A;  3IAV A;  4FNB A;  3SLL A;  1RJM A;  4JCR A;  5E0S H;  2VSS E;  4KNP A;  2ZL2 A;  3BPT A;  4U19 A;  3IB9 A;  4ZDD A;  2A7K A;  2J5G A;  4GM2 A;  3DJA A;  3R9S A;  3HRX A;  1EY3 A;  3SWX A;  2J5I I;  1PIX A;  4U0H A;  4Z0M A;  2QQ3 A;  3OME A;  5DZK H;  5MGB A;  1W2X A;  5KJP A;  3TVW A;  2F6I A;  3ISA A;  3R6H A;  5E0N X;  1WZ8 A;  3OC7 A;  4RYF A;  2EJ5 A;  5JBW A;  2VX2 A;  4I42 A;  4QII A;  4QFE A;  1EF8 A;  4I4Z A;  5DUC A;  4NEK A;  4U0G H;  3H0S A;  1UYS A;  2F9Y B;  1FC7 A;  1DCI A;  2X58 A;  4ASI A;  2CE3 A;  2WTB A;  2FW2 A;  3V5I A;  2ZL0 A;  4NNQ A;  4JVT A;  3T3W A;  2VSS F;  5C90 A;  3FDU A;  2ZQR A;  2PPY A;  3ZWC A;  3KTK A;  1HNU A;  5G1S A;  3VIV A;  1FC6 A;  4JYJ A;  2D3T A;  5CTB A;  2BZR A;  4HC8 A;  5DZK A;  3TRR A;  4JOT A;  1JXZ A;  1PJH A;  4EML A;  2ZQQ A;  4K2N A;  1WDK A;  1J7X A;  5DTW A;  5DL1 A;  2Q34 A;  4OLQ A;  3WG5 A;  1N6F A;  1MJ3 A;  1OD4 A;  1YG8 A;  4EMP A;  4FND A;  2VSS A;  1Q51 A;  3KTH A;  2C8T A;  2DEO A;  4U1A A;  2PBP A;  3ZWB A;  3JU1 A;  5C9G A;  2J5S A;  5KDR A;  1RJN A;  3OT6 A;  2VSU A;  3TT7 A;  4JFC A;  5G1Q A;  3LAO A;  4DI1 A;  5FUS A;  3P85 A;  3R0O A;  4MI2 A;  4B3J A;  3LKE A;  3N6R B;  5IKL B;  3TLF A;  4Q1I A;  3L3S A;  2ZL3 A;  3I47 A;  5DU4 A;  1UYT A;  3T8A A;  2NP9 A;  4Q0G A;  1YG6 A;  3QKA A;  5INF A;  3NJD A;  4OMR A;  4IZD A;  4JWV A;  1XX4 A;  3KTI A;  4JYL A;  4KPK A; 
#chains in the Genus database with same CATH homology
 3FF6 A;  1HZD A;  2W3P A;  3GMA A;  3U9R B;  5G1R A;  3DOR A;  4QIJ A;  4WCZ A;  4FZW C;  4JJT A;  4ZU2 A;  2A81 A;  3M6M A;  3NJB A;  3MT6 A;  4U0G A;  3H0Q A;  3BF0 A;  1TG6 A;  3GKB A;  1N6E A;  4U18 A;  3V5E A;  3U9T B;  3R9T A;  4RCN A;  3PGQ A;  4WYO B;  3H02 A;  3G64 A;  3T89 A;  4ZDF A;  3Q1T A;  3R9Q A;  2IEX A;  4J2U A;  5E0S A;  4JCT A;  1OD2 A;  2ZL4 A;  4FZW A;  5DU6 A;  3RRV A;  3MYB A;  4MOU A;  1K39 A;  4FJW D;  2VSU C;  1FC9 A;  3M6N A;  3T88 A;  3P5M A;  3GF3 A;  5DKP A;  4GHN A;  5JBX A;  1UYV A;  2FBM A;  3PEA A;  3T8B A;  1WDL A;  3KQF A;  1ON3 A;  4B3H A;  1Y7O A;  1VRG A;  4ELX A;  1SG4 A;  3HP0 A;  2YJG A;  2F9I A;  3QXI A;  1XNW A;  3K50 A;  4KD6 A;  2FZS A;  2X24 A;  3QRE A;  4YLH A;  4G2R A;  2VRE A;  4K3W A;  1EF9 A;  3HE2 A;  4JSB A;  3GF7 A;  3TDC A;  2J5G D;  3BEZ A;  4KWB A;  3KTJ A;  1X0U A;  3U9S B;  2F6Q A;  2PG8 A;  5KDR B;  3BPP A;  2J5I A;  1XO6 A;  4ZDB A;  3TV5 A;  4L8K A;  4K29 A;  3TT6 A;  4NAR A;  4HNK A;  1SZO A;  3RSI A;  1UIY A;  3Q0J A;  2Q2X A;  3PZK A;  1NZY A;  3QK8 A;  3HIN A;  4FN7 A;  3P2L A;  3GLM A;  3H0J A;  2Q35 A;  4ZDE A;  2VSU F;  1XNV A;  1WDM A;  4B3I A;  3TZ3 A;  3Q7H A;  1FCF A;  3HLN 1;  3KTG A;  2F9I B;  3ZW8 A;  1K32 A;  3QMJ A;  4JCQ A;  3MFM A;  3MOY A;  3QYR A;  5FIF A;  4L6W A;  4OG1 A;  4I52 A;  5CTC A;  1HNO A;  2HW5 A;  2VSU E;  3PE8 A;  5DTP A;  4ZDC A;  4IZB A;  3ZW9 A;  3QXZ A;  1N6D A;  4MXI A;  1DUB A;  1UYR A;  2GTR A;  4RYF H;  4EMM A;  3ZWA A;  1TYF A;  5INI A;  3K8X A;  4ELW A;  2UZF A;  5DU8 A;  3QWD A;  3RST A;  3Q0G A;  1ON9 A;  1XNY A;  5DUF A;  3IBB A;  3H81 A;  4F47 A;  3TVU A;  4LK5 A;  4IZC A;  5HUQ A;  2J5I B;  3H0U A;  3ST9 A;  2CBY A;  4HDT A;  1O8U A;  4FN8 A;  2A7S A;  2DUB A;  4JCS A;  4WZ8 B;  4FB8 A;  3STA A;  4ELS A;  5ING A;  1NZY B;  2F9Y A;  1Q52 A;  3IAV A;  4FNB A;  3SLL A;  1RJM A;  4JCR A;  5E0S H;  2VSS E;  4KNP A;  2ZL2 A;  3BPT A;  4U19 A;  3IB9 A;  4ZDD A;  2A7K A;  2J5G A;  4GM2 A;  3DJA A;  3R9S A;  3HRX A;  1EY3 A;  3SWX A;  2J5I I;  1PIX A;  4U0H A;  4Z0M A;  2QQ3 A;  3OME A;  5DZK H;  5MGB A;  1W2X A;  5KJP A;  3TVW A;  2F6I A;  3ISA A;  3R6H A;  5E0N X;  1WZ8 A;  3OC7 A;  4RYF A;  2EJ5 A;  5JBW A;  2VX2 A;  4I42 A;  4QII A;  4QFE A;  1EF8 A;  4I4Z A;  5DUC A;  4NEK A;  4U0G H;  3H0S A;  1UYS A;  2F9Y B;  1FC7 A;  1DCI A;  2X58 A;  4ASI A;  2CE3 A;  2WTB A;  2FW2 A;  3V5I A;  2ZL0 A;  4NNQ A;  4JVT A;  3T3W A;  2VSS F;  5C90 A;  3FDU A;  2ZQR A;  2PPY A;  3ZWC A;  3KTK A;  1HNU A;  5G1S A;  3VIV A;  1FC6 A;  4JYJ A;  2D3T A;  5CTB A;  2BZR A;  4HC8 A;  5DZK A;  3TRR A;  4JOT A;  1JXZ A;  1PJH A;  4EML A;  2ZQQ A;  4K2N A;  1WDK A;  1J7X A;  5DTW A;  5DL1 A;  2Q34 A;  4OLQ A;  3WG5 A;  1N6F A;  1MJ3 A;  1OD4 A;  1YG8 A;  4EMP A;  4FND A;  2VSS A;  1Q51 A;  3KTH A;  2C8T A;  2DEO A;  4U1A A;  2PBP A;  3ZWB A;  3JU1 A;  5C9G A;  2J5S A;  5KDR A;  1RJN A;  3OT6 A;  2VSU A;  3TT7 A;  4JFC A;  5G1Q A;  3LAO A;  4DI1 A;  5FUS A;  3P85 A;  3R0O A;  4MI2 A;  4B3J A;  3LKE A;  3N6R B;  5IKL B;  3TLF A;  4Q1I A;  3L3S A;  2ZL3 A;  3I47 A;  5DU4 A;  1UYT A;  3T8A A;  2NP9 A;  4Q0G A;  1YG6 A;  3QKA A;  5INF A;  3NJD A;  4OMR A;  4IZD A;  4JWV A;  1XX4 A;  3KTI A;  4JYL A;  4KPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...