3U9TB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
534
structure length
437
Chain Sequence
AILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGGIAKHGAKLVTAVACARVPKFTVLIGGGMCGRAYDPRFLWMWPNARHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Methylcrotonyl-CoA carboxylase, alpha-subunit
total genus 147
structure length 437
sequence length 534
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9tB01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9tB02
2UZFA 3QYRA 2VX2A 2VSUC 2PPYA 3ZW9A 3SWXA 3QMJA 4HC8A 3KQFA 3PE8A 1PJHA 3H02A 4YLHA 1MJ3A 1N6DA 3TRRA 2F9YA 3QK8A 3TVUA 4L8KA 3P2LA 4WZ8B 3GF3A 2D3TA 4B3IA 4I4ZA 3TDCA 3ZWCA 4EMPA 3DJAA 2F6QA 4I52A 3GMAA 2Q2XA 4JSBA 4KWBA 2J5GA 4FB8A 5G1RA 3ST9A 4FZWC 3FF6A 4FNBA 5DU6A 3R6HA 2FBMA 3Q7HA 1UYRA 5KJPA 3GLMA 2WTBA 3OMEA 3U9RB 2A7SA 5KDRB 3RRVA 4F47A 1JXZA 1SZOA 3HINA 3R9QA 2F6IA 2VREA 3H0JA 2ZL3A 3QWDA 3OC7A 3N6RB 2CE3A 4ASIA 3ZWAA 4I42A 2NP9A 2VSSF 5DUFA 4DI1A 1HZDA 1NZYA 1N6FA 4IZDA 2X24A 3T89A 3TT6A 3L3SA 3JU1A 2HW5A 3TT7A 1HNUA 1RJNA 3PGQA 5INFA 4JWVA 5JBXA 4JCRA 3BPPA 3U9SB 5DZKH 2J5IB 2A7KA 4L6WA 3KTKA 5DUCA 3PEAA 1DCIA 4GHNA 3MYBA 3HRXA 3VIVA 2VSSA 3H0QA 1FC7A 2GTRA 4OMRA 4JCQA 3NJDA 4JCSA 4FJWD 3HLN1 3QKAA 1X0UA 4MXIA 4NNQA 4EMMA 1XO6A 2CBYA 4JOTA 4U1AA 4ZDDA 1WZ8A 5DKPA 2FZSA 4RYFA 1Y7OA 4MI2A 5C90A 4HNKA 4FN8A 2X58A 2Q34A 3DORA 1ON3A 5DL1A 3ISAA 3QXZA 1WDLA 5G1SA 1EF8A 2VSUA 3LAOA 3KTHA 4NEKA 3Q0JA 5DU4A 4K2NA 2VSUF 4QFEA 4JFCA 1OD4A 3OT6A 2F9YB 2PG8A 4KNPA 4B3HA 3TV5A 3MOYA 3ZW8A 3QXIA 1OD2A 5FIFA 3IBBA 4U19A 3V5IA 3TZ3A 4KD6A 5KDRA 1N6EA 4U0HA 3PZKA 3KTGA 1XNWA 3HP0A 5FUSA 1UYSA 1UIYA 3BEZA 5DU8A 5INIA 3KTIA 1YG8A 1J7XA 5DTWA 1TYFA 2ZQQA 4QIJA 4LK5A 4QIIA 1XNYA 4ZDBA 1Q51A 5E0SA 1NZYB 1K39A 3FDUA 4JJTA 5E0NX 3R9TA 2DUBA 2ZL2A 3I47A 3MT6A 3MFMA 3TVWA 3U9TB 3H81A 3QREA 5CTCA 1FCFA 5G1QA 3GF7A 2IEXA 3RSTA 4ELWA 4ELSA 3K50A 4OG1A 5DTPA 1VRGA 5IKLB 4EMLA 4RYFH 1K32A 2BZRA 3K8XA 3TLFA 3ZWBA 2A81A 2W3PA 4ZDFA 4ELXA 3STAA 2ZQRA 4JYLA 2PBPA 1DUBA 4FNDA 1ON9A 4K3WA 1UYTA 2EJ5A 2F9IB 4ZDEA 4KPKA 1WDKA 2QQ3A 4MOUA 2ZL4A 2VSSE 3NJBA 3R0OA 4IZBA 3T88A 2J5SA 4JVTA 3H0UA 1XX4A 2VSUE 3P5MA 4IZCA 5CTBA 4ZDCA 1FC9A 1XNVA 3M6MA 3T8AA 4G2RA 1PIXA 4OLQA 3P85A 4JCTA 2J5IA 1EF9A 4FN7A 3WG5A 5DZKA 3IB9A 1UYVA 3Q0GA 4K29A 4U18A 3LKEA 3M6NA 3T8BA 1YG6A 4RCNA 4U0GA 3G64A 3SLLA 1RJMA 3BF0A 4Q1IA 4WYOB 4ZU2A 4GM2A 1HNOA 1WDMA 2ZL0A 3GKBA 1Q52A 5MGBA 3T3WA 2J5GD 4B3JA 3V5EA 1EY3A 1W2XA 4Q0GA 1O8UA 2F9IA 5JBWA 4FZWA 3IAVA 5INGA 2Q35A 3R9SA 4JYJA 3RSIA 2DEOA 1SG4A 1FC6A 5E0SH 3Q1TA 4U0GH 3KTJA 2C8TA 2J5II 3H0SA 2FW2A 3HE2A 5C9GA 4WCZA 1TG6A 4Z0MA
chains in the Genus database with same CATH superfamily
2UZFA 3QYRA 2VX2A 2VSUC 2PPYA 3ZW9A 3SWXA 3QMJA 4HC8A 3KQFA 3PE8A 1PJHA 3H02A 4YLHA 1MJ3A 1N6DA 3TRRA 2F9YA 3QK8A 3TVUA 4L8KA 3P2LA 4WZ8B 3GF3A 2D3TA 4B3IA 3BPTA 4I4ZA 3TDCA 3ZWCA 4EMPA 3DJAA 2F6QA 4I52A 3GMAA 2Q2XA 4JSBA 4KWBA 2J5GA 4FB8A 5G1RA 3ST9A 4FZWC 3FF6A 4FNBA 5DU6A 3R6HA 2FBMA 3Q7HA 1UYRA 5KJPA 3GLMA 2WTBA 3OMEA 3U9RB 2A7SA 5KDRB 3RRVA 4F47A 1JXZA 1SZOA 3HINA 3R9QA 2F6IA 2VREA 3H0JA 2ZL3A 3QWDA 3OC7A 3N6RB 2CE3A 4ASIA 3ZWAA 4I42A 2NP9A 2VSSF 5DUFA 4DI1A 1HZDA 1NZYA 1N6FA 4IZDA 2X24A 3T89A 3TT6A 3L3SA 3JU1A 2HW5A 3TT7A 1HNUA 1RJNA 3PGQA 5INFA 4JWVA 5JBXA 4JCRA 3BPPA 3U9SB 5DZKH 2J5IB 2A7KA 4L6WA 3KTKA 5DUCA 3PEAA 1DCIA 4GHNA 3MYBA 3HRXA 3VIVA 2VSSA 3H0QA 1FC7A 2GTRA 4OMRA 4JCQA 3NJDA 4JCSA 4FJWD 3HLN1 3QKAA 1X0UA 4MXIA 4NNQA 4EMMA 1XO6A 2CBYA 4JOTA 4U1AA 4ZDDA 1WZ8A 5DKPA 2FZSA 4RYFA 1Y7OA 4MI2A 5C90A 4HNKA 4FN8A 2X58A 2Q34A 3DORA 1ON3A 5DL1A 3ISAA 3QXZA 1WDLA 5G1SA 1EF8A 2VSUA 3LAOA 3KTHA 4NEKA 3Q0JA 5DU4A 4K2NA 2VSUF 4QFEA 4JFCA 1OD4A 3OT6A 2F9YB 2PG8A 4KNPA 4B3HA 3TV5A 3MOYA 3ZW8A 3QXIA 1OD2A 5FIFA 3IBBA 4J2UA 4U19A 3V5IA 3TZ3A 4KD6A 5KDRA 1N6EA 4U0HA 4HDTA 3PZKA 3KTGA 1XNWA 3HP0A 5FUSA 1UYSA 1UIYA 3BEZA 5DU8A 5INIA 3KTIA 1YG8A 1J7XA 5DTWA 1TYFA 2ZQQA 4QIJA 4LK5A 4QIIA 1XNYA 4ZDBA 1Q51A 5E0SA 1NZYB 1K39A 3FDUA 4JJTA 5E0NX 3R9TA 2DUBA 2ZL2A 3I47A 2YJGA 3MT6A 3MFMA 3TVWA 3U9TB 3H81A 3QREA 5CTCA 1FCFA 5G1QA 3GF7A 2IEXA 3RSTA 4ELWA 5HUQA 4ELSA 3K50A 4OG1A 5DTPA 1VRGA 5IKLB 4EMLA 4RYFH 1K32A 2BZRA 3K8XA 3TLFA 3ZWBA 2A81A 2W3PA 4ZDFA 4ELXA 3STAA 2ZQRA 4JYLA 2PBPA 1DUBA 4FNDA 1ON9A 4K3WA 4NARA 1UYTA 2EJ5A 2F9IB 4ZDEA 4KPKA 1WDKA 2QQ3A 4MOUA 2ZL4A 2VSSE 3NJBA 3R0OA 4IZBA 3T88A 2J5SA 4JVTA 3H0UA 1XX4A 2VSUE 3P5MA 4IZCA 5CTBA 4ZDCA 1FC9A 1XNVA 3M6MA 3T8AA 4G2RA 1PIXA 4OLQA 3P85A 4JCTA 2J5IA 1EF9A 4FN7A 3WG5A 5DZKA 3IB9A 1UYVA 3Q0GA 4K29A 4U18A 3LKEA 3M6NA 3T8BA 1YG6A 4RCNA 4U0GA 3G64A 3SLLA 1RJMA 3BF0A 4Q1IA 4WYOB 4ZU2A 4GM2A 1HNOA 1WDMA 2ZL0A 3GKBA 1Q52A 5MGBA 3T3WA 2J5GD 4B3JA 3V5EA 1EY3A 1W2XA 4Q0GA 1O8UA 2F9IA 5JBWA 4FZWA 3IAVA 5INGA 2Q35A 3R9SA 4JYJA 3RSIA 2DEOA 1SG4A 1FC6A 5E0SH 3Q1TA 4U0GH 3KTJA 2C8TA 2J5II 3H0SA 2FW2A 3HE2A 5C9GA 4WCZA 1TG6A 4Z0MA
chains in the Genus database with same CATH topology
2UZFA 3QYRA 2VX2A 2VSUC 2PPYA 3ZW9A 3SWXA 3QMJA 4HC8A 3KQFA 3PE8A 1PJHA 3H02A 4YLHA 1MJ3A 1N6DA 3TRRA 2F9YA 3QK8A 3TVUA 4L8KA 3P2LA 4WZ8B 3GF3A 2D3TA 4B3IA 3BPTA 4I4ZA 3TDCA 3ZWCA 4EMPA 3DJAA 2F6QA 4I52A 3GMAA 2Q2XA 4JSBA 4KWBA 2J5GA 4FB8A 5G1RA 3ST9A 4FZWC 3FF6A 4FNBA 5DU6A 3R6HA 2FBMA 3Q7HA 1UYRA 5KJPA 3GLMA 2WTBA 3OMEA 3U9RB 2A7SA 5KDRB 3RRVA 4F47A 1JXZA 1SZOA 3HINA 3R9QA 2F6IA 2VREA 3H0JA 2ZL3A 3QWDA 3OC7A 3N6RB 2CE3A 4ASIA 3ZWAA 4I42A 2NP9A 2VSSF 5DUFA 4DI1A 1HZDA 1NZYA 1N6FA 4IZDA 2X24A 3T89A 3TT6A 3L3SA 3JU1A 2HW5A 3TT7A 1HNUA 1RJNA 3PGQA 5INFA 4JWVA 5JBXA 4JCRA 3BPPA 3U9SB 5DZKH 2J5IB 2A7KA 4L6WA 3KTKA 5DUCA 3PEAA 1DCIA 4GHNA 3MYBA 3HRXA 3VIVA 2VSSA 3H0QA 1FC7A 2GTRA 4OMRA 4JCQA 3NJDA 4JCSA 4FJWD 3HLN1 3QKAA 1X0UA 4MXIA 4NNQA 4EMMA 1XO6A 2CBYA 4JOTA 4U1AA 4ZDDA 1WZ8A 5DKPA 2FZSA 4RYFA 1Y7OA 4MI2A 5C90A 4HNKA 4FN8A 2X58A 2Q34A 3DORA 1ON3A 5DL1A 3ISAA 3QXZA 1WDLA 5G1SA 1EF8A 2VSUA 3LAOA 3KTHA 4NEKA 3Q0JA 5DU4A 4K2NA 2VSUF 4QFEA 4JFCA 1OD4A 3OT6A 2F9YB 2PG8A 4KNPA 4B3HA 3TV5A 3MOYA 3ZW8A 3QXIA 1OD2A 5FIFA 3IBBA 4J2UA 4U19A 3V5IA 3TZ3A 4KD6A 5KDRA 1N6EA 4U0HA 4HDTA 3PZKA 3KTGA 1XNWA 3HP0A 5FUSA 1UYSA 1UIYA 3BEZA 5DU8A 5INIA 3KTIA 1YG8A 1J7XA 5DTWA 1TYFA 2ZQQA 4QIJA 4LK5A 4QIIA 1XNYA 4ZDBA 1Q51A 5E0SA 1NZYB 1K39A 3FDUA 4JJTA 5E0NX 3R9TA 2DUBA 2ZL2A 3I47A 2YJGA 3MT6A 3MFMA 3TVWA 3U9TB 3H81A 3QREA 5CTCA 1FCFA 5G1QA 3GF7A 2IEXA 3RSTA 4ELWA 5HUQA 4ELSA 3K50A 4OG1A 5DTPA 1VRGA 5IKLB 4EMLA 4RYFH 1K32A 2BZRA 3K8XA 3TLFA 3ZWBA 2A81A 2W3PA 4ZDFA 4ELXA 3STAA 2ZQRA 4JYLA 2PBPA 1DUBA 4FNDA 1ON9A 4K3WA 4NARA 1UYTA 2EJ5A 2F9IB 4ZDEA 4KPKA 1WDKA 2QQ3A 4MOUA 2ZL4A 2VSSE 3NJBA 3R0OA 4IZBA 3T88A 2J5SA 4JVTA 3H0UA 1XX4A 2VSUE 3P5MA 4IZCA 5CTBA 4ZDCA 1FC9A 1XNVA 3M6MA 3T8AA 4G2RA 1PIXA 4OLQA 3P85A 4JCTA 2J5IA 1EF9A 4FN7A 3WG5A 5DZKA 3IB9A 1UYVA 3Q0GA 4K29A 4U18A 3LKEA 3M6NA 3T8BA 1YG6A 4RCNA 4U0GA 3G64A 3SLLA 1RJMA 3BF0A 4Q1IA 4WYOB 4ZU2A 4GM2A 1HNOA 1WDMA 2ZL0A 3GKBA 1Q52A 5MGBA 3T3WA 2J5GD 4B3JA 3V5EA 1EY3A 1W2XA 4Q0GA 1O8UA 2F9IA 5JBWA 4FZWA 3IAVA 5INGA 2Q35A 3R9SA 4JYJA 3RSIA 2DEOA 1SG4A 1FC6A 5E0SH 3Q1TA 4U0GH 3KTJA 2C8TA 2J5II 3H0SA 2FW2A 3HE2A 5C9GA 4WCZA 1TG6A 4Z0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZF A;  3QYR A;  2VX2 A;  2VSU C;  2PPY A;  3ZW9 A;  3SWX A;  3QMJ A;  4HC8 A;  3KQF A;  3PE8 A;  1PJH A;  3H02 A;  4YLH A;  1MJ3 A;  1N6D A;  3TRR A;  2F9Y A;  3QK8 A;  3TVU A;  4L8K A;  3P2L A;  4WZ8 B;  3GF3 A;  2D3T A;  4B3I A;  4I4Z A;  3TDC A;  3ZWC A;  4EMP A;  3DJA A;  2F6Q A;  4I52 A;  3GMA A;  2Q2X A;  4JSB A;  4KWB A;  2J5G A;  4FB8 A;  5G1R A;  3ST9 A;  4FZW C;  3FF6 A;  4FNB A;  5DU6 A;  3R6H A;  2FBM A;  3Q7H A;  1UYR A;  5KJP A;  3GLM A;  2WTB A;  3OME A;  3U9R B;  2A7S A;  5KDR B;  3RRV A;  4F47 A;  1JXZ A;  1SZO A;  3HIN A;  3R9Q A;  2F6I A;  2VRE A;  3H0J A;  2ZL3 A;  3QWD A;  3OC7 A;  3N6R B;  2CE3 A;  4ASI A;  3ZWA A;  4I42 A;  2NP9 A;  2VSS F;  5DUF A;  4DI1 A;  1HZD A;  1NZY A;  1N6F A;  4IZD A;  2X24 A;  3T89 A;  3TT6 A;  3L3S A;  3JU1 A;  2HW5 A;  3TT7 A;  1HNU A;  1RJN A;  3PGQ A;  5INF A;  4JWV A;  5JBX A;  4JCR A;  3BPP A;  3U9S B;  5DZK H;  2J5I B;  2A7K A;  4L6W A;  3KTK A;  5DUC A;  3PEA A;  1DCI A;  4GHN A;  3MYB A;  3HRX A;  3VIV A;  2VSS A;  3H0Q A;  1FC7 A;  2GTR A;  4OMR A;  4JCQ A;  3NJD A;  4JCS A;  4FJW D;  3HLN 1;  3QKA A;  1X0U A;  4MXI A;  4NNQ A;  4EMM A;  1XO6 A;  2CBY A;  4JOT A;  4U1A A;  4ZDD A;  1WZ8 A;  5DKP A;  2FZS A;  4RYF A;  1Y7O A;  4MI2 A;  5C90 A;  4HNK A;  4FN8 A;  2X58 A;  2Q34 A;  3DOR A;  1ON3 A;  5DL1 A;  3ISA A;  3QXZ A;  1WDL A;  5G1S A;  1EF8 A;  2VSU A;  3LAO A;  3KTH A;  4NEK A;  3Q0J A;  5DU4 A;  4K2N A;  2VSU F;  4QFE A;  4JFC A;  1OD4 A;  3OT6 A;  2F9Y B;  2PG8 A;  4KNP A;  4B3H A;  3TV5 A;  3MOY A;  3ZW8 A;  3QXI A;  1OD2 A;  5FIF A;  3IBB A;  4U19 A;  3V5I A;  3TZ3 A;  4KD6 A;  5KDR A;  1N6E A;  4U0H A;  3PZK A;  3KTG A;  1XNW A;  3HP0 A;  5FUS A;  1UYS A;  1UIY A;  3BEZ A;  5DU8 A;  5INI A;  3KTI A;  1YG8 A;  1J7X A;  5DTW A;  1TYF A;  2ZQQ A;  4QIJ A;  4LK5 A;  4QII A;  1XNY A;  4ZDB A;  1Q51 A;  5E0S A;  1NZY B;  1K39 A;  3FDU A;  4JJT A;  5E0N X;  3R9T A;  2DUB A;  2ZL2 A;  3I47 A;  3MT6 A;  3MFM A;  3TVW A;  3U9T B;  3H81 A;  3QRE A;  5CTC A;  1FCF A;  5G1Q A;  3GF7 A;  2IEX A;  3RST A;  4ELW A;  4ELS A;  3K50 A;  4OG1 A;  5DTP A;  1VRG A;  5IKL B;  4EML A;  4RYF H;  1K32 A;  2BZR A;  3K8X A;  3TLF A;  3ZWB A;  2A81 A;  2W3P A;  4ZDF A;  4ELX A;  3STA A;  2ZQR A;  4JYL A;  2PBP A;  1DUB A;  4FND A;  1ON9 A;  4K3W A;  1UYT A;  2EJ5 A;  2F9I B;  4ZDE A;  4KPK A;  1WDK A;  2QQ3 A;  4MOU A;  2ZL4 A;  2VSS E;  3NJB A;  3R0O A;  4IZB A;  3T88 A;  2J5S A;  4JVT A;  3H0U A;  1XX4 A;  2VSU E;  3P5M A;  4IZC A;  5CTB A;  4ZDC A;  1FC9 A;  1XNV A;  3M6M A;  3T8A A;  4G2R A;  1PIX A;  4OLQ A;  3P85 A;  4JCT A;  2J5I A;  1EF9 A;  4FN7 A;  3WG5 A;  5DZK A;  3IB9 A;  1UYV A;  3Q0G A;  4K29 A;  4U18 A;  3LKE A;  3M6N A;  3T8B A;  1YG6 A;  4RCN A;  4U0G A;  3G64 A;  3SLL A;  1RJM A;  3BF0 A;  4Q1I A;  4WYO B;  4ZU2 A;  4GM2 A;  1HNO A;  1WDM A;  2ZL0 A;  3GKB A;  1Q52 A;  5MGB A;  3T3W A;  2J5G D;  4B3J A;  3V5E A;  1EY3 A;  1W2X A;  4Q0G A;  1O8U A;  2F9I A;  5JBW A;  4FZW A;  3IAV A;  5ING A;  2Q35 A;  3R9S A;  4JYJ A;  3RSI A;  2DEO A;  1SG4 A;  1FC6 A;  5E0S H;  3Q1T A;  4U0G H;  3KTJ A;  2C8T A;  2J5I I;  3H0S A;  2FW2 A;  3HE2 A;  5C9G A;  4WCZ A;  1TG6 A;  4Z0M A; 
#chains in the Genus database with same CATH topology
 2UZF A;  3QYR A;  2VX2 A;  2VSU C;  2PPY A;  3ZW9 A;  3SWX A;  3QMJ A;  4HC8 A;  3KQF A;  3PE8 A;  1PJH A;  3H02 A;  4YLH A;  1MJ3 A;  1N6D A;  3TRR A;  2F9Y A;  3QK8 A;  3TVU A;  4L8K A;  3P2L A;  4WZ8 B;  3GF3 A;  2D3T A;  4B3I A;  3BPT A;  4I4Z A;  3TDC A;  3ZWC A;  4EMP A;  3DJA A;  2F6Q A;  4I52 A;  3GMA A;  2Q2X A;  4JSB A;  4KWB A;  2J5G A;  4FB8 A;  5G1R A;  3ST9 A;  4FZW C;  3FF6 A;  4FNB A;  5DU6 A;  3R6H A;  2FBM A;  3Q7H A;  1UYR A;  5KJP A;  3GLM A;  2WTB A;  3OME A;  3U9R B;  2A7S A;  5KDR B;  3RRV A;  4F47 A;  1JXZ A;  1SZO A;  3HIN A;  3R9Q A;  2F6I A;  2VRE A;  3H0J A;  2ZL3 A;  3QWD A;  3OC7 A;  3N6R B;  2CE3 A;  4ASI A;  3ZWA A;  4I42 A;  2NP9 A;  2VSS F;  5DUF A;  4DI1 A;  1HZD A;  1NZY A;  1N6F A;  4IZD A;  2X24 A;  3T89 A;  3TT6 A;  3L3S A;  3JU1 A;  2HW5 A;  3TT7 A;  1HNU A;  1RJN A;  3PGQ A;  5INF A;  4JWV A;  5JBX A;  4JCR A;  3BPP A;  3U9S B;  5DZK H;  2J5I B;  2A7K A;  4L6W A;  3KTK A;  5DUC A;  3PEA A;  1DCI A;  4GHN A;  3MYB A;  3HRX A;  3VIV A;  2VSS A;  3H0Q A;  1FC7 A;  2GTR A;  4OMR A;  4JCQ A;  3NJD A;  4JCS A;  4FJW D;  3HLN 1;  3QKA A;  1X0U A;  4MXI A;  4NNQ A;  4EMM A;  1XO6 A;  2CBY A;  4JOT A;  4U1A A;  4ZDD A;  1WZ8 A;  5DKP A;  2FZS A;  4RYF A;  1Y7O A;  4MI2 A;  5C90 A;  4HNK A;  4FN8 A;  2X58 A;  2Q34 A;  3DOR A;  1ON3 A;  5DL1 A;  3ISA A;  3QXZ A;  1WDL A;  5G1S A;  1EF8 A;  2VSU A;  3LAO A;  3KTH A;  4NEK A;  3Q0J A;  5DU4 A;  4K2N A;  2VSU F;  4QFE A;  4JFC A;  1OD4 A;  3OT6 A;  2F9Y B;  2PG8 A;  4KNP A;  4B3H A;  3TV5 A;  3MOY A;  3ZW8 A;  3QXI A;  1OD2 A;  5FIF A;  3IBB A;  4J2U A;  4U19 A;  3V5I A;  3TZ3 A;  4KD6 A;  5KDR A;  1N6E A;  4U0H A;  4HDT A;  3PZK A;  3KTG A;  1XNW A;  3HP0 A;  5FUS A;  1UYS A;  1UIY A;  3BEZ A;  5DU8 A;  5INI A;  3KTI A;  1YG8 A;  1J7X A;  5DTW A;  1TYF A;  2ZQQ A;  4QIJ A;  4LK5 A;  4QII A;  1XNY A;  4ZDB A;  1Q51 A;  5E0S A;  1NZY B;  1K39 A;  3FDU A;  4JJT A;  5E0N X;  3R9T A;  2DUB A;  2ZL2 A;  3I47 A;  2YJG A;  3MT6 A;  3MFM A;  3TVW A;  3U9T B;  3H81 A;  3QRE A;  5CTC A;  1FCF A;  5G1Q A;  3GF7 A;  2IEX A;  3RST A;  4ELW A;  5HUQ A;  4ELS A;  3K50 A;  4OG1 A;  5DTP A;  1VRG A;  5IKL B;  4EML A;  4RYF H;  1K32 A;  2BZR A;  3K8X A;  3TLF A;  3ZWB A;  2A81 A;  2W3P A;  4ZDF A;  4ELX A;  3STA A;  2ZQR A;  4JYL A;  2PBP A;  1DUB A;  4FND A;  1ON9 A;  4K3W A;  4NAR A;  1UYT A;  2EJ5 A;  2F9I B;  4ZDE A;  4KPK A;  1WDK A;  2QQ3 A;  4MOU A;  2ZL4 A;  2VSS E;  3NJB A;  3R0O A;  4IZB A;  3T88 A;  2J5S A;  4JVT A;  3H0U A;  1XX4 A;  2VSU E;  3P5M A;  4IZC A;  5CTB A;  4ZDC A;  1FC9 A;  1XNV A;  3M6M A;  3T8A A;  4G2R A;  1PIX A;  4OLQ A;  3P85 A;  4JCT A;  2J5I A;  1EF9 A;  4FN7 A;  3WG5 A;  5DZK A;  3IB9 A;  1UYV A;  3Q0G A;  4K29 A;  4U18 A;  3LKE A;  3M6N A;  3T8B A;  1YG6 A;  4RCN A;  4U0G A;  3G64 A;  3SLL A;  1RJM A;  3BF0 A;  4Q1I A;  4WYO B;  4ZU2 A;  4GM2 A;  1HNO A;  1WDM A;  2ZL0 A;  3GKB A;  1Q52 A;  5MGB A;  3T3W A;  2J5G D;  4B3J A;  3V5E A;  1EY3 A;  1W2X A;  4Q0G A;  1O8U A;  2F9I A;  5JBW A;  4FZW A;  3IAV A;  5ING A;  2Q35 A;  3R9S A;  4JYJ A;  3RSI A;  2DEO A;  1SG4 A;  1FC6 A;  5E0S H;  3Q1T A;  4U0G H;  3KTJ A;  2C8T A;  2J5I I;  3H0S A;  2FW2 A;  3HE2 A;  5C9G A;  4WCZ A;  1TG6 A;  4Z0M A; 
#chains in the Genus database with same CATH homology
 2UZF A;  3QYR A;  2VX2 A;  2VSU C;  2PPY A;  3ZW9 A;  3SWX A;  3QMJ A;  4HC8 A;  3KQF A;  3PE8 A;  1PJH A;  3H02 A;  4YLH A;  1MJ3 A;  1N6D A;  3TRR A;  2F9Y A;  3QK8 A;  3TVU A;  4L8K A;  3P2L A;  4WZ8 B;  3GF3 A;  2D3T A;  4B3I A;  3BPT A;  4I4Z A;  3TDC A;  3ZWC A;  4EMP A;  3DJA A;  2F6Q A;  4I52 A;  3GMA A;  2Q2X A;  4JSB A;  4KWB A;  2J5G A;  4FB8 A;  5G1R A;  3ST9 A;  4FZW C;  3FF6 A;  4FNB A;  5DU6 A;  3R6H A;  2FBM A;  3Q7H A;  1UYR A;  5KJP A;  3GLM A;  2WTB A;  3OME A;  3U9R B;  2A7S A;  5KDR B;  3RRV A;  4F47 A;  1JXZ A;  1SZO A;  3HIN A;  3R9Q A;  2F6I A;  2VRE A;  3H0J A;  2ZL3 A;  3QWD A;  3OC7 A;  3N6R B;  2CE3 A;  4ASI A;  3ZWA A;  4I42 A;  2NP9 A;  2VSS F;  5DUF A;  4DI1 A;  1HZD A;  1NZY A;  1N6F A;  4IZD A;  2X24 A;  3T89 A;  3TT6 A;  3L3S A;  3JU1 A;  2HW5 A;  3TT7 A;  1HNU A;  1RJN A;  3PGQ A;  5INF A;  4JWV A;  5JBX A;  4JCR A;  3BPP A;  3U9S B;  5DZK H;  2J5I B;  2A7K A;  4L6W A;  3KTK A;  5DUC A;  3PEA A;  1DCI A;  4GHN A;  3MYB A;  3HRX A;  3VIV A;  2VSS A;  3H0Q A;  1FC7 A;  2GTR A;  4OMR A;  4JCQ A;  3NJD A;  4JCS A;  4FJW D;  3HLN 1;  3QKA A;  1X0U A;  4MXI A;  4NNQ A;  4EMM A;  1XO6 A;  2CBY A;  4JOT A;  4U1A A;  4ZDD A;  1WZ8 A;  5DKP A;  2FZS A;  4RYF A;  1Y7O A;  4MI2 A;  5C90 A;  4HNK A;  4FN8 A;  2X58 A;  2Q34 A;  3DOR A;  1ON3 A;  5DL1 A;  3ISA A;  3QXZ A;  1WDL A;  5G1S A;  1EF8 A;  2VSU A;  3LAO A;  3KTH A;  4NEK A;  3Q0J A;  5DU4 A;  4K2N A;  2VSU F;  4QFE A;  4JFC A;  1OD4 A;  3OT6 A;  2F9Y B;  2PG8 A;  4KNP A;  4B3H A;  3TV5 A;  3MOY A;  3ZW8 A;  3QXI A;  1OD2 A;  5FIF A;  3IBB A;  4J2U A;  4U19 A;  3V5I A;  3TZ3 A;  4KD6 A;  5KDR A;  1N6E A;  4U0H A;  4HDT A;  3PZK A;  3KTG A;  1XNW A;  3HP0 A;  5FUS A;  1UYS A;  1UIY A;  3BEZ A;  5DU8 A;  5INI A;  3KTI A;  1YG8 A;  1J7X A;  5DTW A;  1TYF A;  2ZQQ A;  4QIJ A;  4LK5 A;  4QII A;  1XNY A;  4ZDB A;  1Q51 A;  5E0S A;  1NZY B;  1K39 A;  3FDU A;  4JJT A;  5E0N X;  3R9T A;  2DUB A;  2ZL2 A;  3I47 A;  2YJG A;  3MT6 A;  3MFM A;  3TVW A;  3U9T B;  3H81 A;  3QRE A;  5CTC A;  1FCF A;  5G1Q A;  3GF7 A;  2IEX A;  3RST A;  4ELW A;  5HUQ A;  4ELS A;  3K50 A;  4OG1 A;  5DTP A;  1VRG A;  5IKL B;  4EML A;  4RYF H;  1K32 A;  2BZR A;  3K8X A;  3TLF A;  3ZWB A;  2A81 A;  2W3P A;  4ZDF A;  4ELX A;  3STA A;  2ZQR A;  4JYL A;  2PBP A;  1DUB A;  4FND A;  1ON9 A;  4K3W A;  4NAR A;  1UYT A;  2EJ5 A;  2F9I B;  4ZDE A;  4KPK A;  1WDK A;  2QQ3 A;  4MOU A;  2ZL4 A;  2VSS E;  3NJB A;  3R0O A;  4IZB A;  3T88 A;  2J5S A;  4JVT A;  3H0U A;  1XX4 A;  2VSU E;  3P5M A;  4IZC A;  5CTB A;  4ZDC A;  1FC9 A;  1XNV A;  3M6M A;  3T8A A;  4G2R A;  1PIX A;  4OLQ A;  3P85 A;  4JCT A;  2J5I A;  1EF9 A;  4FN7 A;  3WG5 A;  5DZK A;  3IB9 A;  1UYV A;  3Q0G A;  4K29 A;  4U18 A;  3LKE A;  3M6N A;  3T8B A;  1YG6 A;  4RCN A;  4U0G A;  3G64 A;  3SLL A;  1RJM A;  3BF0 A;  4Q1I A;  4WYO B;  4ZU2 A;  4GM2 A;  1HNO A;  1WDM A;  2ZL0 A;  3GKB A;  1Q52 A;  5MGB A;  3T3W A;  2J5G D;  4B3J A;  3V5E A;  1EY3 A;  1W2X A;  4Q0G A;  1O8U A;  2F9I A;  5JBW A;  4FZW A;  3IAV A;  5ING A;  2Q35 A;  3R9S A;  4JYJ A;  3RSI A;  2DEO A;  1SG4 A;  1FC6 A;  5E0S H;  3Q1T A;  4U0G H;  3KTJ A;  2C8T A;  2J5I I;  3H0S A;  2FW2 A;  3HE2 A;  5C9G A;  4WCZ A;  1TG6 A;  4Z0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...