3U9TB

Crystal structure of p. aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, free enzyme
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
534
structure length
437
Chain Sequence
AILHTQINPRSAEFAANAATMLEQVNALRTLLGRIHEGGGSAAQARHSARGKLLVRERINRLLDPGSPFLELSALAAHEVYGEEVAAAGIVAGIGRVEGVECMIVGNDATVKGGTYYPLTVKKHLRAQAIALENRLPCIYLVDSGGANLPHFGRIFFNQANMSARGIPQIAVVMGSCTAGGAYVPAMSDETVMVREQATIFLCKVSGVADHYAEDDDHALAIARRCVANLNWRKQGQLQCRAPRAPLYPAEELYGVIPADSKQPYDVREVIARLVDGSEFDEFKALFGTTLVCGFAHLHGYPIAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGGIAKHGAKLVTAVACARVPKFTVLIGGGMCGRAYDPRFLWMWPNARHQGHPYYSSARLWDDGVIDPAQTREVLALALSAALNAPIEPTAFGVFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Methylcrotonyl-CoA carboxylase, alpha-subunit
total genus 147
structure length 437
sequence length 534
ec nomenclature ec 6.4.1.4: Methylcrotonoyl-CoA carboxylase.
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9tB01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3u9tB02
3K8XA 5DU8A 3MOYA 3SWXA 3T3WA 2F9YB 3P5MA 1EF9A 3NJDA 4JVTA 2J5II 2WTBA 3T88A 5JBWA 3NJBA 1N6DA 4FNDA 4WYOB 1FC7A 4FNBA 1DUBA 1RJMA 2F9IA 3PE8A 1J7XA 3STAA 3PGQA 2C8TA 4HNKA 3OMEA 5E0SH 3QMJA 5KDRB 1Y7OA 1YG8A 3Q7HA 3U9SB 3TLFA 4Z0MA 3GKBA 2ZL0A 3FF6A 1TYFA 5DZKH 4K29A 2F6IA 4OG1A 4ZDFA 1X0UA 4IZCA 1FCFA 4HC8A 5G1QA 4B3JA 2ZL4A 3QXIA 3TZ3A 3T8AA 5CTCA 1XNYA 4FJWD 4I52A 5JBXA 5MGBA 2J5IA 4JCRA 2D3TA 1Q52A 3L3SA 3R6HA 1HNUA 4KD6A 1FC9A 2GTRA 4YLHA 4KNPA 4GM2A 3G64A 4ZDDA 3P85A 4WZ8B 1JXZA 1K39A 4L8KA 3KTKA 2VSSF 3I47A 2ZL2A 4KPKA 3IBBA 3R9QA 2A7KA 3HRXA 4B3IA 3H0UA 1HNOA 2PBPA 4OLQA 5FIFA 4ELWA 3IB9A 4QIIA 4JOTA 3RSIA 4I4ZA 3LKEA 3V5EA 4ZU2A 2VSSE 4K2NA 3TDCA 4RYFH 3JU1A 1XNWA 3N6RB 4JSBA 2QQ3A 1Q51A 1UYRA 4G2RA 1DCIA 1SG4A 2J5SA 2VSUF 3SLLA 1RJNA 4QFEA 1UYSA 3ISAA 5CTBA 2VSUC 1UIYA 3H0SA 3VIVA 3M6NA 5G1RA 3U9TB 2A7SA 5E0SA 3H81A 2DEOA 4Q0GA 5DUFA 4F47A 4KWBA 3Q1TA 3ZW9A 4FN8A 1SZOA 3FDUA 2J5GD 4JFCA 2EJ5A 5G1SA 5C90A 3KTHA 3QK8A 3TT6A 1XNVA 2VSUA 3R9TA 1WDLA 3PZKA 3QWDA 2Q2XA 1NZYA 1WZ8A 3R9SA 2IEXA 3LAOA 4MI2A 2DUBA 1YG6A 2F9YA 4U18A 3HP0A 5DL1A 1ON9A 2ZQRA 1WDMA 4ASIA 4LK5A 3DJAA 3MFMA 4JYJA 1K32A 5DU6A 1UYTA 4FB8A 3ZWAA 4FZWC 4MOUA 1WDKA 3V5IA 4NNQA 3QXZA 5KDRA 3QKAA 3KQFA 4EMLA 1VRGA 3P2LA 4IZBA 3OC7A 3KTJA 3ZWCA 2VREA 1N6FA 4QIJA 3H0QA 1UYVA 5E0NX 4JJTA 3HE2A 3KTIA 1XO6A 4ZDBA 2FBMA 4FZWA 4L6WA 3TT7A 1EY3A 3M6MA 4U0GH 3GLMA 2Q35A 1MJ3A 1FC6A 1XX4A 4ELSA 5IKLB 1OD4A 4NEKA 2W3PA 3Q0JA 4I42A 4U0HA 4EMMA 2CBYA 1HZDA 2VX2A 3OT6A 3BPPA 4JCTA 3GMAA 1PJHA 5DU4A 2VSSA 2VSUE 3MYBA 3QREA 5DZKA 3BF0A 4MXIA 4U19A 3ST9A 4RYFA 5FUSA 4ZDEA 3H0JA 4B3HA 2FW2A 3ZWBA 5INIA 5DUCA 5INFA 3WG5A 4U0GA 2X24A 3RRVA 1NZYB 5DTWA 3MT6A 3H02A 2NP9A 4FN7A 2J5GA 2PPYA 5DTPA 3TVUA 3PEAA 3TRRA 3T8BA 1N6EA 4JYLA 3U9RB 4EMPA 1OD2A 1PIXA 2F6QA 4JCSA 2CE3A 2J5IB 2ZQQA 4IZDA 4K3WA 3RSTA 4GHNA 3TV5A 4ZDCA 1TG6A 2PG8A 4DI1A 4ELXA 5INGA 3DORA 2X58A 3K50A 4JWVA 2F9IB 3T89A 4Q1IA 3HLN1 3QYRA 2Q34A 2A81A 4U1AA 2FZSA 2UZFA 1W2XA 5C9GA 4RCNA 5DKPA 3KTGA 3TVWA 3IAVA 4WCZA 1EF8A 4JCQA 3BEZA 4OMRA 3HINA 5KJPA 3GF7A 2HW5A 3GF3A 3ZW8A 3R0OA 2ZL3A 1O8UA 2BZRA 1ON3A 3Q0GA
chains in the Genus database with same CATH superfamily
3K8XA 5DU8A 3MOYA 3SWXA 3T3WA 2F9YB 3P5MA 1EF9A 3NJDA 4JVTA 2J5II 2WTBA 3T88A 5JBWA 3NJBA 1N6DA 4FNDA 4WYOB 1FC7A 4FNBA 1DUBA 1RJMA 2F9IA 3PE8A 1J7XA 3STAA 3PGQA 2C8TA 4HNKA 3OMEA 5E0SH 3QMJA 5KDRB 1Y7OA 1YG8A 3Q7HA 3U9SB 3TLFA 4Z0MA 3GKBA 2ZL0A 3FF6A 1TYFA 5DZKH 4K29A 2F6IA 4OG1A 4ZDFA 1X0UA 4IZCA 1FCFA 4HC8A 5G1QA 4B3JA 2ZL4A 3QXIA 3TZ3A 3T8AA 5CTCA 1XNYA 4FJWD 4I52A 5JBXA 5MGBA 2J5IA 4JCRA 2D3TA 1Q52A 3L3SA 3R6HA 1HNUA 4KD6A 1FC9A 2GTRA 4YLHA 4KNPA 4GM2A 3G64A 4ZDDA 3P85A 4WZ8B 1JXZA 1K39A 4L8KA 3KTKA 2VSSF 3I47A 2ZL2A 4KPKA 3IBBA 3R9QA 2A7KA 3HRXA 4B3IA 3H0UA 1HNOA 2PBPA 4OLQA 5FIFA 4ELWA 3IB9A 4QIIA 4JOTA 3RSIA 4I4ZA 3LKEA 3V5EA 4ZU2A 2VSSE 4K2NA 3TDCA 4RYFH 3JU1A 1XNWA 3N6RB 4JSBA 2QQ3A 1Q51A 1UYRA 4G2RA 1DCIA 1SG4A 2J5SA 2YJGA 2VSUF 3SLLA 1RJNA 4QFEA 1UYSA 3ISAA 5CTBA 2VSUC 1UIYA 3H0SA 3VIVA 3M6NA 5G1RA 3U9TB 2A7SA 5E0SA 3H81A 2DEOA 4Q0GA 5DUFA 4F47A 4KWBA 3Q1TA 3ZW9A 4FN8A 1SZOA 3FDUA 2J5GD 4JFCA 2EJ5A 5G1SA 5C90A 3KTHA 3QK8A 3TT6A 1XNVA 2VSUA 3R9TA 1WDLA 3PZKA 3QWDA 2Q2XA 1NZYA 1WZ8A 3R9SA 2IEXA 3LAOA 4MI2A 2DUBA 1YG6A 2F9YA 4U18A 3HP0A 5DL1A 1ON9A 2ZQRA 1WDMA 4ASIA 4LK5A 3DJAA 3MFMA 4JYJA 1K32A 5DU6A 1UYTA 4FB8A 3ZWAA 4FZWC 4MOUA 1WDKA 3V5IA 4NNQA 3QXZA 5KDRA 3QKAA 3KQFA 4EMLA 1VRGA 3P2LA 4IZBA 3OC7A 3KTJA 3ZWCA 2VREA 1N6FA 4QIJA 3H0QA 1UYVA 5E0NX 4JJTA 3HE2A 3KTIA 1XO6A 4ZDBA 2FBMA 4FZWA 4L6WA 3TT7A 1EY3A 3M6MA 4U0GH 3GLMA 2Q35A 1MJ3A 1FC6A 1XX4A 5HUQA 4ELSA 5IKLB 1OD4A 4NEKA 2W3PA 3Q0JA 4I42A 4U0HA 4EMMA 2CBYA 1HZDA 2VX2A 3OT6A 3BPPA 4JCTA 4NARA 3GMAA 1PJHA 5DU4A 2VSSA 2VSUE 3BPTA 3MYBA 3QREA 5DZKA 3BF0A 4MXIA 4U19A 3ST9A 4RYFA 5FUSA 4ZDEA 3H0JA 4B3HA 2FW2A 3ZWBA 5INIA 5DUCA 5INFA 3WG5A 4U0GA 2X24A 3RRVA 1NZYB 5DTWA 3MT6A 3H02A 2NP9A 4FN7A 2J5GA 2PPYA 5DTPA 3TVUA 3PEAA 3TRRA 3T8BA 1N6EA 4JYLA 3U9RB 4EMPA 1OD2A 1PIXA 4J2UA 2F6QA 4JCSA 2CE3A 2J5IB 2ZQQA 4IZDA 4K3WA 3RSTA 4GHNA 3TV5A 4ZDCA 1TG6A 2PG8A 4DI1A 4ELXA 5INGA 3DORA 2X58A 3K50A 4JWVA 2F9IB 3T89A 4Q1IA 3HLN1 3QYRA 2Q34A 2A81A 4U1AA 2FZSA 2UZFA 1W2XA 5C9GA 4RCNA 5DKPA 3KTGA 3TVWA 3IAVA 4WCZA 1EF8A 4JCQA 3BEZA 4OMRA 3HINA 5KJPA 3GF7A 2HW5A 3GF3A 3ZW8A 3R0OA 2ZL3A 1O8UA 2BZRA 1ON3A 4HDTA 3Q0GA
chains in the Genus database with same CATH topology
3K8XA 5DU8A 3MOYA 3SWXA 3T3WA 2F9YB 3P5MA 1EF9A 3NJDA 4JVTA 2J5II 2WTBA 3T88A 5JBWA 3NJBA 1N6DA 4FNDA 4WYOB 1FC7A 4FNBA 1DUBA 1RJMA 2F9IA 3PE8A 1J7XA 3STAA 3PGQA 2C8TA 4HNKA 3OMEA 5E0SH 3QMJA 5KDRB 1Y7OA 1YG8A 3Q7HA 3U9SB 3TLFA 4Z0MA 3GKBA 2ZL0A 3FF6A 1TYFA 5DZKH 4K29A 2F6IA 4OG1A 4ZDFA 1X0UA 4IZCA 1FCFA 4HC8A 5G1QA 4B3JA 2ZL4A 3QXIA 3TZ3A 3T8AA 5CTCA 1XNYA 4FJWD 4I52A 5JBXA 5MGBA 2J5IA 4JCRA 2D3TA 1Q52A 3L3SA 3R6HA 1HNUA 4KD6A 1FC9A 2GTRA 4YLHA 4KNPA 4GM2A 3G64A 4ZDDA 3P85A 4WZ8B 1JXZA 1K39A 4L8KA 3KTKA 2VSSF 3I47A 2ZL2A 4KPKA 3IBBA 3R9QA 2A7KA 3HRXA 4B3IA 3H0UA 1HNOA 2PBPA 4OLQA 5FIFA 4ELWA 3IB9A 4QIIA 4JOTA 3RSIA 4I4ZA 3LKEA 3V5EA 4ZU2A 2VSSE 4K2NA 3TDCA 4RYFH 3JU1A 1XNWA 3N6RB 4JSBA 2QQ3A 1Q51A 1UYRA 4G2RA 1DCIA 1SG4A 2J5SA 2YJGA 2VSUF 3SLLA 1RJNA 4QFEA 1UYSA 3ISAA 5CTBA 2VSUC 1UIYA 3H0SA 3VIVA 3M6NA 5G1RA 3U9TB 2A7SA 5E0SA 3H81A 2DEOA 4Q0GA 5DUFA 4F47A 4KWBA 3Q1TA 3ZW9A 4FN8A 1SZOA 3FDUA 2J5GD 4JFCA 2EJ5A 5G1SA 5C90A 3KTHA 3QK8A 3TT6A 1XNVA 2VSUA 3R9TA 1WDLA 3PZKA 3QWDA 2Q2XA 1NZYA 1WZ8A 3R9SA 2IEXA 3LAOA 4MI2A 2DUBA 1YG6A 2F9YA 4U18A 3HP0A 5DL1A 1ON9A 2ZQRA 1WDMA 4ASIA 4LK5A 3DJAA 3MFMA 4JYJA 1K32A 5DU6A 1UYTA 4FB8A 3ZWAA 4FZWC 4MOUA 1WDKA 3V5IA 4NNQA 3QXZA 5KDRA 3QKAA 3KQFA 4EMLA 1VRGA 3P2LA 4IZBA 3OC7A 3KTJA 3ZWCA 2VREA 1N6FA 4QIJA 3H0QA 1UYVA 5E0NX 4JJTA 3HE2A 3KTIA 1XO6A 4ZDBA 2FBMA 4FZWA 4L6WA 3TT7A 1EY3A 3M6MA 4U0GH 3GLMA 2Q35A 1MJ3A 1FC6A 1XX4A 5HUQA 4ELSA 5IKLB 1OD4A 4NEKA 2W3PA 3Q0JA 4I42A 4U0HA 4EMMA 2CBYA 1HZDA 2VX2A 3OT6A 3BPPA 4JCTA 4NARA 3GMAA 1PJHA 5DU4A 2VSSA 2VSUE 3BPTA 3MYBA 3QREA 5DZKA 3BF0A 4MXIA 4U19A 3ST9A 4RYFA 5FUSA 4ZDEA 3H0JA 4B3HA 2FW2A 3ZWBA 5INIA 5DUCA 5INFA 3WG5A 4U0GA 2X24A 3RRVA 1NZYB 5DTWA 3MT6A 3H02A 2NP9A 4FN7A 2J5GA 2PPYA 5DTPA 3TVUA 3PEAA 3TRRA 3T8BA 1N6EA 4JYLA 3U9RB 4EMPA 1OD2A 1PIXA 4J2UA 2F6QA 4JCSA 2CE3A 2J5IB 2ZQQA 4IZDA 4K3WA 3RSTA 4GHNA 3TV5A 4ZDCA 1TG6A 2PG8A 4DI1A 4ELXA 5INGA 3DORA 2X58A 3K50A 4JWVA 2F9IB 3T89A 4Q1IA 3HLN1 3QYRA 2Q34A 2A81A 4U1AA 2FZSA 2UZFA 1W2XA 5C9GA 4RCNA 5DKPA 3KTGA 3TVWA 3IAVA 4WCZA 1EF8A 4JCQA 3BEZA 4OMRA 3HINA 5KJPA 3GF7A 2HW5A 3GF3A 3ZW8A 3R0OA 2ZL3A 1O8UA 2BZRA 1ON3A 4HDTA 3Q0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8X A;  5DU8 A;  3MOY A;  3SWX A;  3T3W A;  2F9Y B;  3P5M A;  1EF9 A;  3NJD A;  4JVT A;  2J5I I;  2WTB A;  3T88 A;  5JBW A;  3NJB A;  1N6D A;  4FND A;  4WYO B;  1FC7 A;  4FNB A;  1DUB A;  1RJM A;  2F9I A;  3PE8 A;  1J7X A;  3STA A;  3PGQ A;  2C8T A;  4HNK A;  3OME A;  5E0S H;  3QMJ A;  5KDR B;  1Y7O A;  1YG8 A;  3Q7H A;  3U9S B;  3TLF A;  4Z0M A;  3GKB A;  2ZL0 A;  3FF6 A;  1TYF A;  5DZK H;  4K29 A;  2F6I A;  4OG1 A;  4ZDF A;  1X0U A;  4IZC A;  1FCF A;  4HC8 A;  5G1Q A;  4B3J A;  2ZL4 A;  3QXI A;  3TZ3 A;  3T8A A;  5CTC A;  1XNY A;  4FJW D;  4I52 A;  5JBX A;  5MGB A;  2J5I A;  4JCR A;  2D3T A;  1Q52 A;  3L3S A;  3R6H A;  1HNU A;  4KD6 A;  1FC9 A;  2GTR A;  4YLH A;  4KNP A;  4GM2 A;  3G64 A;  4ZDD A;  3P85 A;  4WZ8 B;  1JXZ A;  1K39 A;  4L8K A;  3KTK A;  2VSS F;  3I47 A;  2ZL2 A;  4KPK A;  3IBB A;  3R9Q A;  2A7K A;  3HRX A;  4B3I A;  3H0U A;  1HNO A;  2PBP A;  4OLQ A;  5FIF A;  4ELW A;  3IB9 A;  4QII A;  4JOT A;  3RSI A;  4I4Z A;  3LKE A;  3V5E A;  4ZU2 A;  2VSS E;  4K2N A;  3TDC A;  4RYF H;  3JU1 A;  1XNW A;  3N6R B;  4JSB A;  2QQ3 A;  1Q51 A;  1UYR A;  4G2R A;  1DCI A;  1SG4 A;  2J5S A;  2VSU F;  3SLL A;  1RJN A;  4QFE A;  1UYS A;  3ISA A;  5CTB A;  2VSU C;  1UIY A;  3H0S A;  3VIV A;  3M6N A;  5G1R A;  3U9T B;  2A7S A;  5E0S A;  3H81 A;  2DEO A;  4Q0G A;  5DUF A;  4F47 A;  4KWB A;  3Q1T A;  3ZW9 A;  4FN8 A;  1SZO A;  3FDU A;  2J5G D;  4JFC A;  2EJ5 A;  5G1S A;  5C90 A;  3KTH A;  3QK8 A;  3TT6 A;  1XNV A;  2VSU A;  3R9T A;  1WDL A;  3PZK A;  3QWD A;  2Q2X A;  1NZY A;  1WZ8 A;  3R9S A;  2IEX A;  3LAO A;  4MI2 A;  2DUB A;  1YG6 A;  2F9Y A;  4U18 A;  3HP0 A;  5DL1 A;  1ON9 A;  2ZQR A;  1WDM A;  4ASI A;  4LK5 A;  3DJA A;  3MFM A;  4JYJ A;  1K32 A;  5DU6 A;  1UYT A;  4FB8 A;  3ZWA A;  4FZW C;  4MOU A;  1WDK A;  3V5I A;  4NNQ A;  3QXZ A;  5KDR A;  3QKA A;  3KQF A;  4EML A;  1VRG A;  3P2L A;  4IZB A;  3OC7 A;  3KTJ A;  3ZWC A;  2VRE A;  1N6F A;  4QIJ A;  3H0Q A;  1UYV A;  5E0N X;  4JJT A;  3HE2 A;  3KTI A;  1XO6 A;  4ZDB A;  2FBM A;  4FZW A;  4L6W A;  3TT7 A;  1EY3 A;  3M6M A;  4U0G H;  3GLM A;  2Q35 A;  1MJ3 A;  1FC6 A;  1XX4 A;  4ELS A;  5IKL B;  1OD4 A;  4NEK A;  2W3P A;  3Q0J A;  4I42 A;  4U0H A;  4EMM A;  2CBY A;  1HZD A;  2VX2 A;  3OT6 A;  3BPP A;  4JCT A;  3GMA A;  1PJH A;  5DU4 A;  2VSS A;  2VSU E;  3MYB A;  3QRE A;  5DZK A;  3BF0 A;  4MXI A;  4U19 A;  3ST9 A;  4RYF A;  5FUS A;  4ZDE A;  3H0J A;  4B3H A;  2FW2 A;  3ZWB A;  5INI A;  5DUC A;  5INF A;  3WG5 A;  4U0G A;  2X24 A;  3RRV A;  1NZY B;  5DTW A;  3MT6 A;  3H02 A;  2NP9 A;  4FN7 A;  2J5G A;  2PPY A;  5DTP A;  3TVU A;  3PEA A;  3TRR A;  3T8B A;  1N6E A;  4JYL A;  3U9R B;  4EMP A;  1OD2 A;  1PIX A;  2F6Q A;  4JCS A;  2CE3 A;  2J5I B;  2ZQQ A;  4IZD A;  4K3W A;  3RST A;  4GHN A;  3TV5 A;  4ZDC A;  1TG6 A;  2PG8 A;  4DI1 A;  4ELX A;  5ING A;  3DOR A;  2X58 A;  3K50 A;  4JWV A;  2F9I B;  3T89 A;  4Q1I A;  3HLN 1;  3QYR A;  2Q34 A;  2A81 A;  4U1A A;  2FZS A;  2UZF A;  1W2X A;  5C9G A;  4RCN A;  5DKP A;  3KTG A;  3TVW A;  3IAV A;  4WCZ A;  1EF8 A;  4JCQ A;  3BEZ A;  4OMR A;  3HIN A;  5KJP A;  3GF7 A;  2HW5 A;  3GF3 A;  3ZW8 A;  3R0O A;  2ZL3 A;  1O8U A;  2BZR A;  1ON3 A;  3Q0G A; 
#chains in the Genus database with same CATH topology
 3K8X A;  5DU8 A;  3MOY A;  3SWX A;  3T3W A;  2F9Y B;  3P5M A;  1EF9 A;  3NJD A;  4JVT A;  2J5I I;  2WTB A;  3T88 A;  5JBW A;  3NJB A;  1N6D A;  4FND A;  4WYO B;  1FC7 A;  4FNB A;  1DUB A;  1RJM A;  2F9I A;  3PE8 A;  1J7X A;  3STA A;  3PGQ A;  2C8T A;  4HNK A;  3OME A;  5E0S H;  3QMJ A;  5KDR B;  1Y7O A;  1YG8 A;  3Q7H A;  3U9S B;  3TLF A;  4Z0M A;  3GKB A;  2ZL0 A;  3FF6 A;  1TYF A;  5DZK H;  4K29 A;  2F6I A;  4OG1 A;  4ZDF A;  1X0U A;  4IZC A;  1FCF A;  4HC8 A;  5G1Q A;  4B3J A;  2ZL4 A;  3QXI A;  3TZ3 A;  3T8A A;  5CTC A;  1XNY A;  4FJW D;  4I52 A;  5JBX A;  5MGB A;  2J5I A;  4JCR A;  2D3T A;  1Q52 A;  3L3S A;  3R6H A;  1HNU A;  4KD6 A;  1FC9 A;  2GTR A;  4YLH A;  4KNP A;  4GM2 A;  3G64 A;  4ZDD A;  3P85 A;  4WZ8 B;  1JXZ A;  1K39 A;  4L8K A;  3KTK A;  2VSS F;  3I47 A;  2ZL2 A;  4KPK A;  3IBB A;  3R9Q A;  2A7K A;  3HRX A;  4B3I A;  3H0U A;  1HNO A;  2PBP A;  4OLQ A;  5FIF A;  4ELW A;  3IB9 A;  4QII A;  4JOT A;  3RSI A;  4I4Z A;  3LKE A;  3V5E A;  4ZU2 A;  2VSS E;  4K2N A;  3TDC A;  4RYF H;  3JU1 A;  1XNW A;  3N6R B;  4JSB A;  2QQ3 A;  1Q51 A;  1UYR A;  4G2R A;  1DCI A;  1SG4 A;  2J5S A;  2YJG A;  2VSU F;  3SLL A;  1RJN A;  4QFE A;  1UYS A;  3ISA A;  5CTB A;  2VSU C;  1UIY A;  3H0S A;  3VIV A;  3M6N A;  5G1R A;  3U9T B;  2A7S A;  5E0S A;  3H81 A;  2DEO A;  4Q0G A;  5DUF A;  4F47 A;  4KWB A;  3Q1T A;  3ZW9 A;  4FN8 A;  1SZO A;  3FDU A;  2J5G D;  4JFC A;  2EJ5 A;  5G1S A;  5C90 A;  3KTH A;  3QK8 A;  3TT6 A;  1XNV A;  2VSU A;  3R9T A;  1WDL A;  3PZK A;  3QWD A;  2Q2X A;  1NZY A;  1WZ8 A;  3R9S A;  2IEX A;  3LAO A;  4MI2 A;  2DUB A;  1YG6 A;  2F9Y A;  4U18 A;  3HP0 A;  5DL1 A;  1ON9 A;  2ZQR A;  1WDM A;  4ASI A;  4LK5 A;  3DJA A;  3MFM A;  4JYJ A;  1K32 A;  5DU6 A;  1UYT A;  4FB8 A;  3ZWA A;  4FZW C;  4MOU A;  1WDK A;  3V5I A;  4NNQ A;  3QXZ A;  5KDR A;  3QKA A;  3KQF A;  4EML A;  1VRG A;  3P2L A;  4IZB A;  3OC7 A;  3KTJ A;  3ZWC A;  2VRE A;  1N6F A;  4QIJ A;  3H0Q A;  1UYV A;  5E0N X;  4JJT A;  3HE2 A;  3KTI A;  1XO6 A;  4ZDB A;  2FBM A;  4FZW A;  4L6W A;  3TT7 A;  1EY3 A;  3M6M A;  4U0G H;  3GLM A;  2Q35 A;  1MJ3 A;  1FC6 A;  1XX4 A;  5HUQ A;  4ELS A;  5IKL B;  1OD4 A;  4NEK A;  2W3P A;  3Q0J A;  4I42 A;  4U0H A;  4EMM A;  2CBY A;  1HZD A;  2VX2 A;  3OT6 A;  3BPP A;  4JCT A;  4NAR A;  3GMA A;  1PJH A;  5DU4 A;  2VSS A;  2VSU E;  3BPT A;  3MYB A;  3QRE A;  5DZK A;  3BF0 A;  4MXI A;  4U19 A;  3ST9 A;  4RYF A;  5FUS A;  4ZDE A;  3H0J A;  4B3H A;  2FW2 A;  3ZWB A;  5INI A;  5DUC A;  5INF A;  3WG5 A;  4U0G A;  2X24 A;  3RRV A;  1NZY B;  5DTW A;  3MT6 A;  3H02 A;  2NP9 A;  4FN7 A;  2J5G A;  2PPY A;  5DTP A;  3TVU A;  3PEA A;  3TRR A;  3T8B A;  1N6E A;  4JYL A;  3U9R B;  4EMP A;  1OD2 A;  1PIX A;  4J2U A;  2F6Q A;  4JCS A;  2CE3 A;  2J5I B;  2ZQQ A;  4IZD A;  4K3W A;  3RST A;  4GHN A;  3TV5 A;  4ZDC A;  1TG6 A;  2PG8 A;  4DI1 A;  4ELX A;  5ING A;  3DOR A;  2X58 A;  3K50 A;  4JWV A;  2F9I B;  3T89 A;  4Q1I A;  3HLN 1;  3QYR A;  2Q34 A;  2A81 A;  4U1A A;  2FZS A;  2UZF A;  1W2X A;  5C9G A;  4RCN A;  5DKP A;  3KTG A;  3TVW A;  3IAV A;  4WCZ A;  1EF8 A;  4JCQ A;  3BEZ A;  4OMR A;  3HIN A;  5KJP A;  3GF7 A;  2HW5 A;  3GF3 A;  3ZW8 A;  3R0O A;  2ZL3 A;  1O8U A;  2BZR A;  1ON3 A;  4HDT A;  3Q0G A; 
#chains in the Genus database with same CATH homology
 3K8X A;  5DU8 A;  3MOY A;  3SWX A;  3T3W A;  2F9Y B;  3P5M A;  1EF9 A;  3NJD A;  4JVT A;  2J5I I;  2WTB A;  3T88 A;  5JBW A;  3NJB A;  1N6D A;  4FND A;  4WYO B;  1FC7 A;  4FNB A;  1DUB A;  1RJM A;  2F9I A;  3PE8 A;  1J7X A;  3STA A;  3PGQ A;  2C8T A;  4HNK A;  3OME A;  5E0S H;  3QMJ A;  5KDR B;  1Y7O A;  1YG8 A;  3Q7H A;  3U9S B;  3TLF A;  4Z0M A;  3GKB A;  2ZL0 A;  3FF6 A;  1TYF A;  5DZK H;  4K29 A;  2F6I A;  4OG1 A;  4ZDF A;  1X0U A;  4IZC A;  1FCF A;  4HC8 A;  5G1Q A;  4B3J A;  2ZL4 A;  3QXI A;  3TZ3 A;  3T8A A;  5CTC A;  1XNY A;  4FJW D;  4I52 A;  5JBX A;  5MGB A;  2J5I A;  4JCR A;  2D3T A;  1Q52 A;  3L3S A;  3R6H A;  1HNU A;  4KD6 A;  1FC9 A;  2GTR A;  4YLH A;  4KNP A;  4GM2 A;  3G64 A;  4ZDD A;  3P85 A;  4WZ8 B;  1JXZ A;  1K39 A;  4L8K A;  3KTK A;  2VSS F;  3I47 A;  2ZL2 A;  4KPK A;  3IBB A;  3R9Q A;  2A7K A;  3HRX A;  4B3I A;  3H0U A;  1HNO A;  2PBP A;  4OLQ A;  5FIF A;  4ELW A;  3IB9 A;  4QII A;  4JOT A;  3RSI A;  4I4Z A;  3LKE A;  3V5E A;  4ZU2 A;  2VSS E;  4K2N A;  3TDC A;  4RYF H;  3JU1 A;  1XNW A;  3N6R B;  4JSB A;  2QQ3 A;  1Q51 A;  1UYR A;  4G2R A;  1DCI A;  1SG4 A;  2J5S A;  2YJG A;  2VSU F;  3SLL A;  1RJN A;  4QFE A;  1UYS A;  3ISA A;  5CTB A;  2VSU C;  1UIY A;  3H0S A;  3VIV A;  3M6N A;  5G1R A;  3U9T B;  2A7S A;  5E0S A;  3H81 A;  2DEO A;  4Q0G A;  5DUF A;  4F47 A;  4KWB A;  3Q1T A;  3ZW9 A;  4FN8 A;  1SZO A;  3FDU A;  2J5G D;  4JFC A;  2EJ5 A;  5G1S A;  5C90 A;  3KTH A;  3QK8 A;  3TT6 A;  1XNV A;  2VSU A;  3R9T A;  1WDL A;  3PZK A;  3QWD A;  2Q2X A;  1NZY A;  1WZ8 A;  3R9S A;  2IEX A;  3LAO A;  4MI2 A;  2DUB A;  1YG6 A;  2F9Y A;  4U18 A;  3HP0 A;  5DL1 A;  1ON9 A;  2ZQR A;  1WDM A;  4ASI A;  4LK5 A;  3DJA A;  3MFM A;  4JYJ A;  1K32 A;  5DU6 A;  1UYT A;  4FB8 A;  3ZWA A;  4FZW C;  4MOU A;  1WDK A;  3V5I A;  4NNQ A;  3QXZ A;  5KDR A;  3QKA A;  3KQF A;  4EML A;  1VRG A;  3P2L A;  4IZB A;  3OC7 A;  3KTJ A;  3ZWC A;  2VRE A;  1N6F A;  4QIJ A;  3H0Q A;  1UYV A;  5E0N X;  4JJT A;  3HE2 A;  3KTI A;  1XO6 A;  4ZDB A;  2FBM A;  4FZW A;  4L6W A;  3TT7 A;  1EY3 A;  3M6M A;  4U0G H;  3GLM A;  2Q35 A;  1MJ3 A;  1FC6 A;  1XX4 A;  5HUQ A;  4ELS A;  5IKL B;  1OD4 A;  4NEK A;  2W3P A;  3Q0J A;  4I42 A;  4U0H A;  4EMM A;  2CBY A;  1HZD A;  2VX2 A;  3OT6 A;  3BPP A;  4JCT A;  4NAR A;  3GMA A;  1PJH A;  5DU4 A;  2VSS A;  2VSU E;  3BPT A;  3MYB A;  3QRE A;  5DZK A;  3BF0 A;  4MXI A;  4U19 A;  3ST9 A;  4RYF A;  5FUS A;  4ZDE A;  3H0J A;  4B3H A;  2FW2 A;  3ZWB A;  5INI A;  5DUC A;  5INF A;  3WG5 A;  4U0G A;  2X24 A;  3RRV A;  1NZY B;  5DTW A;  3MT6 A;  3H02 A;  2NP9 A;  4FN7 A;  2J5G A;  2PPY A;  5DTP A;  3TVU A;  3PEA A;  3TRR A;  3T8B A;  1N6E A;  4JYL A;  3U9R B;  4EMP A;  1OD2 A;  1PIX A;  4J2U A;  2F6Q A;  4JCS A;  2CE3 A;  2J5I B;  2ZQQ A;  4IZD A;  4K3W A;  3RST A;  4GHN A;  3TV5 A;  4ZDC A;  1TG6 A;  2PG8 A;  4DI1 A;  4ELX A;  5ING A;  3DOR A;  2X58 A;  3K50 A;  4JWV A;  2F9I B;  3T89 A;  4Q1I A;  3HLN 1;  3QYR A;  2Q34 A;  2A81 A;  4U1A A;  2FZS A;  2UZF A;  1W2X A;  5C9G A;  4RCN A;  5DKP A;  3KTG A;  3TVW A;  3IAV A;  4WCZ A;  1EF8 A;  4JCQ A;  3BEZ A;  4OMR A;  3HIN A;  5KJP A;  3GF7 A;  2HW5 A;  3GF3 A;  3ZW8 A;  3R0O A;  2ZL3 A;  1O8U A;  2BZR A;  1ON3 A;  4HDT A;  3Q0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...