3U9UA

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
219
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGIGVGWIRQPSGKGLEWLAHIWWNDNKYYNIALRSRLTISKDTSNNQVFLKIASVDTADTATYYCARIPDDHYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 43
structure length 219
sequence length 224
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uA01
5LQBH 2MFNA 4PJDF 1OTUD 1XF5B 3PGCA 5IEHB 2ID5A 4ZUUB 5FV2A 3CFKB 1EXUB 3J7HA 4KTEL 2A1WL 5I6XC 3TT3H 1OLLA 5ACLA 1PLGH 3MRFA 4I5BB 4ONGH 1IAIM 3IKCA 2IG2H 1B3JA 1I8MA 4JO3L 3X17A 4Y2DC 1XCQA 4DEPB 1GJIA 3MRCB 2GJ6E 5F1IB 3U7YH 3QXTA 4EXPX 2R1YB 2CDEA 2CLRB 1Q8MA 3AU1B 3SDDD 1WUNT 1JGLH 5I18L 4Z9KB 1YMHA 1AGEA 5C2BL 3OAUH 3FL7A 4IOSD 4D0BB 3PP3H 1VPOL 2CD0A 4WTZA 1HQ4B 1E28B 2WM0A 1FLRL 3RU8H 4MA3A 5CGYD 5GS0L 3DRQB 4OCWL 3D85D 1MPAH 5BVPL 3L3JA 2UVFA 4N5EC 1TQCB 1PW3A 3IDJA 3BPOC 3V5KB 2D2OA 1YN6A 1OAQH 1QPPA 2ICCA 4B7LA 4GG6E 2V7NB 5EA0L 2CK0H 1G6RA 3C60C 4AENA 5IJVA 1ZLUK 3O9WA 3VXRA 5EZLB 5GGTH 3IU4L 1I8KB 3VXME 2ERJB 4P0DA 1M7DA 4JO4L 4XB8A 4S1QL 1KV3A 1HHGB 5IGXH 2ZG1A 3L7FB 3SCMB 2AK4E 4H5SB 2IQAB 2AV1A 1ZHNA 3CFDB 1BWMA 3NTCL 3CXHK 4P46D 1N7MH 4X0KA 3T2PA 1XR9A 2J5LB 1CK0L 4MD5A 4X8XA 5JO5B 1OGAD 2C3XA 4PYHA 4XX1G 3FFCD 3VRJA 3KWWA 5DFTA 3FT2B 3I6GB 5C9JA 1K85A 1TJGL 5HHXH 3WFBL 4YWGL 4Z78A 4GBXA 3BFOA 1KTKE 3T2OA 2XQBH 5I16B 3F58L 4IJ3B 1S9WA 1DANU 1K3IA 1WFUA 2IPTH 4GW4B 1NFDA 4GAFB 1AY1H 3QFJA 1G7IA 1P84K 1MUJB 1WZ1L 3NH7H 3VU2A 4OZIF 3QUKB 4Y19D 5F93C 1KNOB 2GHWB 2X4QA 3RI5F 3P4OB 4W6WB 4N8VG 2RFXB 3AREB 2D7OA 3DHJA 1B9ZA 4TULL 4P3DA 4QHNB 2E9WA 4OZFB 5I1LA 4JPIB 4WV1C 4UILL 2A6IB 5D5ME 1QSED 2F8XC 2QTEA 2GYSA 5GIRB 4UIKL 3DTXB 3WNOA 1UB6A 1NUFA 1UWXK 4FQHA 5C0CB 2L7JA 3X12A 4YDVB 5BV7H 4ZAKA 1ES0A 2H41A 2VAAB 1X6NA 3DUSB 3NZHH 2SEBA 1IC7H 2HLFD 1F3DH 3EUUA 3RWHA 3MRNA 3BMVA 3RWIA 3BZFB 5C09E 4Y5YB 1OPGH 3GKZA 4NQCA 3EFFB 4BH7B 4BSVB 1FNEB 4PGBA 1U41A 2D0FA 2NTSP 4Y4FB 2C9AA 4N0CD 2XRAL 4H25A 4QRTA 1FZJB 4YQXH 4NUJB 4QXGH 2IAMA 4HUXB 3F7VB 3FMGH 5J6HB 1VACA 3H9YA 4KI5D 5FYKL 2D3VA 4X4XA 5C0JA 4XGZB 4OM0L 4PLKC 3WNPA 4HPOL 5EBLB 5HDBF 1IBGH 5EO9B 3QA3B 3H9SB 3UYPA 4KHTL 1JV5B 1BM3L 2IADB 4KMLB 4R26L 1LO0L 1U8QA 3V9FA 3BPNB 2EDOA 4R96B 4LSQL 1LO2L 4HWUA 4MJID 3ULVL 3SQOH 4JY4B 5HYEA 1U92A 3FTGB 4JFED 1CFQB 2DDQH 2NY0C 1Y18B 4YC2C 4HX1A 1B0WA 3QXUA 4QHUA 5KZCD 4U7MA 5CZVH 5IBLD 3ZKMC 2VLRA 3DX7A 3HC0A 4OCSH 5DTFA 2J12B 4MZ2A 3ARFC 2N7AA 4XI5D 2QLVB 1PKQA 3ZYZA 4Y2DB 4K7PX 4M1CD 4WFFD 2DWEA 3IVKB 2NY5C 2F58L 4OZIB 1NGZA 1DLHB 4JR9L 4MNQB 3NN8A 3HUJB 4K8RC 4MQXD 1JPFB 4APQA 4JDTL 4OKVB 5FUZL 2MKLC 2XTLA 1F58L 3TIEB 1H3VA 4MB5A 4JPVH 4NKQB 5K9QI 1ZLSL 1WGOA 5D7IA 3BUYA 4KK6D 2BVQA 4PLJC 4I8DA 3MRLA 3JXAA 1Z2KA 4KJQD 2EDTA 4YHIB 1U3HA 5FYLD 5IBUG 1MREL 4F33A 4CW1B 3RVWD 3RWDB 1RUAH 5L8KB 3BPOB 5AG8A 3PDDA 4U1MB 4OM1H 2FR4B 4KUZH 1S7QA 4J6RH 5C08E 1J8HA 1FGVH 4PGEB 2JIXD 4Q9RL 3AMLA 3C60B 3ALPA 1T66C 4LLMB 4J1UA 4U1KB 1KPUA 4JVWA 2VLJD 4Z7WA 3TWCH 5DMJB 2JJTC 4L4TA 3ARBD 4NIKB 5JDSA 3DXAD 5I15H 4HCRL 4KPHL 5GGUB 4XMPL 4L3CB 4KJWD 3AFLA 2APFA 1G9MC 4F9PC 2BSRB 5HHMD 3OKNB 2H8PA 1W72A 4XWGL 25C8L 4NWUH 1C5CL 3DBXB 3HZYB 4V1DE 2OX5A 5GS1C 3BX7C 1FVDA 3FQUB 3KLSA 2A1WH 3LQAC 2AV7B 4NQSB 1I8LA 5HI3D 2AJXL 1M6OA 3PWPA 5IF0A 2P49B 1KEGL 5I1DB 1YEEH 4LLVA 5SX4I 2GFBA 2VLKD 4JO3H 2MTPA 5CEYA 4QF1B 3T0VA 1WFOA 4HBCH 4KGLA 3J8F7 3MRKB 1V3KA 2Q7YB 5FGSA 3OB0K 2PKDA 3HPLA 5I18H 1JE6A 1WSST 3PQYD 4H20L 3BZDA 1MCOH 2NX5E 3VGAC 4X5XA 5K9JL 5B38B 1CTNA 2NW2A 1VPOH 2YD7A 2BNQB 4YR6B 5KOMC 2ADIB 5L2KE 4WV1B 5HYSB 3W11D 1FLRH 4OCWH 5BVPH 3QQ4A 4HG4J 4X6FA 1ZT7A 3WSQL 1A7OL 2MSPA 1NJ9A 5IB1B 2EXYC 4EVNB 2Y9RT 4ZUUA 5T3ZD 2HG5A 3CFKA 4XBEL 5EA0H 1GOGA 5MEND 1EMTH 3WHE1 5CD5D 4GRLC 5F89B 1RULL 3IU4H 3MOQA 3E2HC 1V8HA 4JO4H 5C70A 4M62L 5SX5K 1KJVA 3UTOA 1T7WA 1C16A 3G9AB 1CFSB 1BEYH 5CLTA 4GRWH 3MRCA 3VXUB 5F1IA 3LPGA 1MVUA 4V2CB 2R1YA 3GSOB 5A2JH 3FB6B 4XVTL 5FGRA 5ALCL 3AU1A 1CK0H 4G8GB 5ESQB 1U3YA 3U1SL 1BFSA 4CRPA 2W60B 3WKNA 1TZHB 3EJYC 5AWNL 4ODWB 1ED3B 3C8HA 2NXYD 4YWGH 4JN2A 3G6DL 4JFDD 4X8JB 2RAMA 1HQ4A 1E28A 4PB0H 3F58H 3SE4C 3SGKC 4ZUTB 3BKJL 3RGVB 4XP4L 1D5IL 1HHHB 1CXIA 1WZ1H 3JVGC 1L6XA 2NY0B 1Z6JT 4YC2B 4FTVB 2YKLL 1BLNB 4ZMAT 5I1CL 2FDBP 2UZYB 4DFIA 3JV4B 4IOIA 3KDMA 5D2LF 1WVZA 3ARFB 3JWOL 1YECL 5TH2B 4UILH 1PYWB 3B2VH 1MI5E 5E2JA 3GK8L 1JZ3A 4UIKH 3QHTC 4JG0L 3X3GH 3SCMA 2GTZB 3CFDA 4S0TD 4LHUD 1Q38A 3QO1B 1KLFA 4NCDA 5JO5A 4L3EE 4PJCB 1LMKA 3MRRB 1TETL 4CJ0A 2J8UF 3I6GA 3TA3D 1SEBB 3BP6B 3L5XL 4TTDC 2HFTA 5I16A 2XRAH 2NNAB 3GSWB 1YDPB 1IGYB 4ZSOA 4GW4A 2UZIL 1SYVB 1MUJA 5KSAC 5ID1A 1G7PB 4UDUB 2N56A 3QUKA 5FYKH 5GRVK 3DYOA 4OM0H 4HPOH 3F7YB 5D1ZD 3P4OA 1ZANL 3AREA 4KHTH 1BM3H 3T4YB 5D7JA 4R26H 1PFCA 1LO0H 3PP4L 3CFJB 4I0KA 4PRHA 4QHNA 3LEVL 1RJYB 4JPIA 5F7WC 3TCLB 4LSQH 1LO2H 3MGOA 3ULVH 1MFNA 4HF5L 4Z7QE 1MCWM 2GCYA 3O4LD 5C0CA 3HC3L 4L8BB 2XTJD 3UAJD 1C1EL 1JF6A 4YDVA 5GS1B 1FP5A 3I3DA 4ISVA 3DUSA 3IDYC 2HKHL 1ZLUH 4C56D 1J0ZA 2E7BA 4N1HB 3NCBB 1AP2B 3MA7B 3L1OL 3BZFA 4QRUB 1D5MB 2CR6A 4JJ5A 2IBZX 1I4FB 4FQLL 4Y5YA 2E7MA 4BH7A 4RAVB 1P5UA 1IAKB 2F58H 1ZVSB 4XPHL 1DL7L 4EUPA 2P5EA 4JR9H 2EH7L 4Y2OA 4L8SA 4NUJA 1FGNL 1A4KB 1IGTB 2CKBA 3O0RH 4JDTH 5EU7E 5FUZH 5C6PB 1XEDA 1F58H 5D2LB 3VGAB 4P59L 4X6DE 4GRWE 1NSNL 4TVPH 2YSSB 1ZLSH 3UTQB 3C9NB 3QDHA 5FECA 1JBJA 4R90L 5EO9A 1GC1C 3H9SA 4FXKB 1HH9A 5SWSD 3C2SA 2HFGL 3PHOB 4XPTL 4OLXL 1MREH 4IDLA 3B9EA 3MZGB 5JLZB 3QQ3B 3SJVB 4OI9A 3D1MC 4RWYL 4UUJA 4OUUA 2HFFB 4JY4A 5ABDE 4WHYH 1T2XA 1BZ7B 5IW1B 3FTGA 3MV7B 5DS8A 5FGCE 5HI4D 1CFQA 4Q9RH 1Y18A 3JUYA 1G7JB 4F7CB 3P30L 3QWQB 4WY7L 2XZZA 1U8OB 4MAYD 4UT6L 4PUBL 2K9UA 4IOFD 4R8WL 4ERSL 4P2RD 2BVPA 4HCRH 4UNTA 5LGKA 32C2B 4XMPH 4OF3A 1DUYB 3DX8B 1UWXH 2BDNL 3KPSE 2FJHA 3IVKA 1WBZB 3IJSB 4OV5B 1XIWC 4XWGH 25C8H 2EYSB 1DLHA 3H7BB 2OJZL 1C5CH 1RUQL 4Y16A 5D1XA 1FYTA 1CVSC 4WFHD 3HUJA 3V6OA 1I1YA 4OKVA 2HT2D 1OTTC 1BZ9B 3QUXD 3BD3A 3TIEA 2VDKL 5HHOD 4I9WE 2AJXH 4JPWL 1RZKC 1OQXA 4YDIL 3D2UD 1KEGH 5IW6B 4JHBA 2J6EL 2HMIC 1UM6L 3ZHLA 2WZPD 3D3VB 4CW1A 2VXUL 4RAHA 3REWA 4U1MA 3HE7A 2FR4A 3B43A 4L4VE 1HSAA 5GRVL 4BZYA 4RFNC 5HDOA 2ESVA 3O11A 4H20H 4PGEA 5D70L 5K9JH 1CDIA 4U1KA 4P2QE 2H9GB 2G5RA 5FYKE 3ZE1E 2B1HL 4N0UE 4HKBA 1KOAA 2P47B 2C3HA 3WSQH 1A7OH 3QISA 2R0WL 4M7ZB 2G75A 1F6FB 3VGEA 4WHTB 2FEDC 4OQ1A 3JUZA 2VDPL 3ULVE 4XBEH 2VABA 3MXVL 2Q8BL 2AV7A 4N9GB 1BFVH 1G7QB 5D6CA 2VH5L 1N6VA 4NQSA 1VESA 4PJGF 4K3GA 1T22B 4BFEA 3V95A 3NIGF 1U42A 4HUUA 3GDBA 1MAJA 1MCNA 4PV9B 2UY7A 2CDGA 5KSBE 2W65B 4HMEA 3GMMA 4XP1L 2PO6A 2Y5EA 4QF1A 2X1XR 1U8LB 1U0QA 1JPTL 1Z9SA 2IFFL 1DDHA 3JWNC 5ALCH 5KSAB 1IQWL 1D5XB 4X99A 3PNWA 5E1AB 3OR6B 3U1SH 2GTWA 2OR8A 1TENA 1U8NA 3P9MB 1CICB 3WN5C 3KPLB 4MSWB 1YY8B 1MAMH 4WHYG 4XVUC 2MKWA 5AWNH 4BZ1L 2YPVL 2C3WA 4YR6A 1F45A 2BNQA 4PGZA 5C07A 3MNVB 2BHYA 4K3HA 4GW5B 5HYSA 4X5LA 3U30B 4ZO7A 2GSIB 5T1KA 4MS8D 2ZKHH 3SE8L 1D5IH 5KS9F 1FQ9C 1V05A 3V5DB 1V3LA 3IDYB 5GGRA 2YKLH 5CJBA 1BOGB 1SEQL 1WZLA 3JWOH 1YECH 4KQ3L 5BS0D 2P8MB 3GK8H 4NRYB 5LVEA 3LKOA 2AVGA 3Q3GA 1ZMYA 3NA4A 1DFBL 5E08L 4LEXL 3VXUA 1KENL 2QR0B 4MAUH 4I0PC 2YC1A 3GSOA 2FL5A 4J3SA 4LSRL 5ESQA 4KDTA 2O5XL 4R4FL 3DWTA 5JHLL 2W60A 1EZVX 2AKRB 4LVEA 1TLKA 1W72L 1NC2D 3L5XH 4OFPA 3STBA 4X8JA 5IMOB 4Z77A 1YPZE 3TN0D 3VXTA 3ARDC 1G84A 4ZUTA 5GSVB 4MQ7B 3ZDYE 1KF9B 3RGVA 2R56L 5C3LD 2CO6B 3OB0H 1F3DJ 1HHHA 2UZIH 3QHZL 2EEDA 1BQHB 1ZGLP 1F6AA 4YAQA 4FTVA 3BH8B 4DWHA 1ZANH 1T7VA 1QRNA 3RVTD 3RX5A 4JFOB 3VFWA 1J5OL 3GJEB 3PP4H 3VGBA 3LEVH 4PJ7E 3ZT6A 1PYWA 5LBSL 3QDME 3UX9B 5HBBA 5EUOA 3RZCD 4HF5H 4XXCA 5C0NC 2YA2A 3HC3H 4WRLA 1C1EH 1I3GH 3C6LC 3I02A 1EEYA 3QDGE 4AY0A 1P5VA 5ID0B 4O4YH 4QOKD 2HKHH 3RJDA 2VDOL 1S78C 3TLRA 3WFDH 3BEWA 3BAEL 2P24A 2BVUA 2EE3A 3HI1B 3PV6A 3KYNB 1WAAF 3L3GB 3L1OH 3MRRA 2ADFL 5KVFL 4FQLH 5SX5H 4R0LC 2VKXA 3BP6A 4BQ8A 2ZOLB 1I7UB 1IKFL 4P2OB 4U6XA 4D0DB 5DMIL 4XPHH 5KSUB 1RK1B 2RCSL 2NNAA 3S36L 1DL7H 1HIML 3GSWA 5ERWB 1YDPA 1G6RH 2EH7H 4JQIL 1IGYA 2NR6C 1N59B 1FGNH 4RFNB 1SYVA 3WFHA 5BOZG 2ED8A 1G7PA 1CIDA 4P59H 1NSNH 4C4KO 2ICWB 5T1MA 2GJ6D 4HT1H 3F7YA 2DQJL 2JJTA 3IDMA 5TDOB 2HFGH 3CFJA 1KG0B 4XPTH 1FFOB 4OLXH 1U8IA 1RJYA 1CU4H 3DJ9A 4JANA 4MA8L 4RWYH 5A3IC 4LPTA 2HJLB 1KPVB 1WT5A 3RQ3A 2VL4A 1INEL 1A6TB 4L8BA 4MQTB 5DJAB 3L3HA 3ZHDA 1QR1B 2EKSB 5HPMB 4PIRF 4LVOB 3P30H 3VWKD 4UT6H 5EIQA 1AP2A 4PUBH 4R8WH 1Y0LB 4QRUA 1YJDC 1D5MA 5GQBA 4UU9B 4OLVL 2N1KA 3VDCA 4M7JL 2BDNH 5AD0B 1IM3A 3AM8A 2GAZA 1NL0L 4WUUB 4AQOA 2D31B 4RDQF 1RUQH 5C3TA 3MRJB 2Y06H 5DR5L 3VXMD 3P9LB 4HDIB 3WN5B 2VQUA 2VDKH 4HK3N 1IL1B 2YSSA 4U3CA 3C9NA 4JPWH 3UTQA 1CQKA 1NCAL 2AK4D 2NXZB 4WHCA 4XHJD 5J12C 4PRPA 1WTLA 1CLYL 3UJIL 4UNUA 1SJXA 3KXFE 1BECA 2VXUH 5HYJA 4PRDA 4ZXBD 2K1MA 4JQXA 3SJVA 4XTRC 4PJXE 4HKZB 3U36B 1JI1A 1R5IA 2OTUB 4XNZC 5IW1A 2FJGB 3FHQA 5D70H 1UJ3C 5FUOL 4F7CA 4OQTA 4M48H 4M02A 4XBGB 4KXZI 4Y4HB 1DVFD 2FZ3A 2B1HH 3R0MA 5BJTA 32C2A 2YWZA 3LAFA 2V2WB 3DX8A 4YX2H 1OD7A 5GZOC 2HYMA 1NQBA 2R0WH 5I66B 4CN1A 4LNVA 1X7QB 2B1AL 2EYSA 3P0YL 5ENWA 2W91A 3MXVH 4F3FB 2VXTL 4CKVX 2Q8BH 1MQKL 1FE8L 5C92A 1KB5B 4FZ8L 3MLXH 4KUCD 1KCVL 4UQ3B 4I4WA 3FN9A 5CGTA 5JDJA 4W68A 4PV8A 5IESL 1HI6A 1JPTH 2IFFH 5C09D 1YY9D 5ACMA 2VITA 1PG7W 1IGCL 4P5TA 4BH8A 4HIJA 5H94A 4LDLB 6FABL 5KJRL 4BZ1H 3VXRE 2QQLL 1T89C 4NP4L 4F7MB 2H9GA 4XPFL 3P73A 4LMQE 3MMEA 1UA6L 3FRUB 4U4BA 3SE8H 5TPWL 3C6LB 3Q6FB 5C6TH 4M5ZL 4CVXB 5SWZB 5BRZB 4YHNA 2YRPA 1JZ4A 3H2WA 5JIHA 3SDXF 3QUMB 3TZVC 1SEQH 1G7QA 4KQ3H 4R0LB 1T22A 3L3DB 4CL7A 1VDGA 5GS2H 4PV9A 1DFBH 2W65A 2H6PA 4LEXH 5FOJA 3THML 1NFDE 1UG9A 3ZDXF 3QFJE 1M7IA 5ETUB 3ECBB 3AB0B 4LSRH 3OR6A 4FQXD 2O5XH 3MJ8B 2VDNL 4R4FH 3P9MA 5KOVC 3GSUA 1CICA 2YUXA 5JHLH 2YN5A 4WW2A 1W72H 4P5MB 1YZZA 3HR5B 1CFNB 1JHTB 3DVNA 2GSIA 3T3ME 2R56H 5EBWB 3OWEA 5AYUH 3TT1L 3QHZH 4LLAA 5E5MA 3UYRL 4G7VH 1G7MB 1T5XA 3RTQC 3BW9B 1NGPL 4GG8B 3BMWA 1BPVA 1U93A 5FDWA 2A6DA 5FV1L 2Q76A 1BOGA 3VA6A 2VZ1A 5TE7L 4NQCE 5C08D 5LBSH 2CUHA 4NRYA 3W82A 3VFOB 4LIQL 5DUML 4NBXB 1Q9WA 1A4JB 3CVHB 3QG7L 4L1HA 2VDOH 5FO8B 4KK5D 3MJGX 5TF1L 2ADGB 3BAEH 2MPAL 1XGYL 2FWOA 4MNGB 5J12B 4EOWL 3NOIA 5KVFH 2ADFH 2A6KB 4V1DD 1IKFH 4CVUA 1UXWB 4RSVA 2XNAB 5DMIH 3DURB 3RWCB 2RCSH 3S36H 1GGYA 1HIMH 3M45A 1WIOA 5GSVA 4MQ7A 4JQIH 5F8RC 2ZP0T 4XNZB 3X3FL 4PP1C 1BP3B 4YDKL 1JWSB 3U0WL 1HOCA 5LAXB 4RMTA 1UJ3B 2DKUA 5J9PB 3IKKA 2K7PA 2MQ0A 3ZZ1A 4XMLL 2VLRE 2X4RB 3CXHJ 2B39A 5HHNA 2DQJH 4NQVB 2OXGA 4JFOA 3ZDZF 1PKQE 1XF2B 4QHMB 1N64L 1E4KA 4JM2A 2NX5D 4MA8H 2X4NB 1G1CA 3PHSA 5D2NC 1INEH 3DI3B 3HLAB 1MFDH 3D0LB 5L2KD 5JZ7D 1QEWB 1S7UB 2ZCHL 3ALXA 1EEQA 5D7IE 2H32A 3HI1A 4EI5D 5EO1A 1EUUA 1C12B 1P84J 3KYNA 3L3GA 3VFPB 1S5HB 4M3JA 3U83A 4OLVH 4M7JH 2ZOLA 3O3AA 4P2OA 4ZO8A 1NL0H 4D0DA 5KSUA 2HWZL 4NBZB 3R8BB 4JB9L 1AQDB 1JHLL 3QSKB 4PR5B 1GVIA 1Q9KB 4HULB 2QSTA 1J8HE 3S98A 3VDAA 1XFPA 2FLBT 2QSCL 4MYWB 5DQJA 1JN6B 3GHEL 1N8ZB 1CLYH 4L4TE 4NKOB 3UJIH 3MLTA 4HKXA 3B83A 4O02H 4KROD 5I8CB 5E7BA 3DNKA 1DP0A 3RAJL 3BP7A 2HJLA 4KI1A 1T0NA 1A6TA 3MNWB 1XZ0B 1T04A 5DJAA 1UYWH 1QR1A 1IT9L 2X89A 3FQRA 5HPMA 3O6FB 5FUOH 1YMMA 1P4LB 3BHBB 1T1XB 1GGIH 4LPXA 3PWPE 1JUFA 1Y0LA 1T1WA 5ISZD 3HS0B 5ESVB 1TJIL 4QHKJ 3T0DA 3VI4F 3OF6D 2X41A 1ONQB 4HGWB 1E4JA 1P7QB 3QQNA 4BELD 2B1AH 5HD8D 3T09A 3CH8A 3P0YH 5ECJE 5D8JL 4JLRB 5DZOA 3MRJA 1MNUL 1MI5D 3HI6H 4A2MA 2VDML 2VXTH 4TUOB 1MQKH 1FE8H 1I1RA 1GIGL 2OR7A 1H15B 4ELMF 1IC5L 3PGDB 2I9LB 4FZ8H 3CXDH 4XPGH 1HINH 1K8IB 1NPUA 4UOW0 3BO8A 4IS6B 1JYXA 4Z76B 1GGBL 1UH3A 3CPLB 5IESH 1FNSL 2EE2A 2V2XB 5F7HA 4L3ED 1PBYA 3IF1B 1K2DB 1IARB 3F8UB 3U36A 5EOQL 3ARUA 2YZ1A 1IGCH 3S88L 2XZAL 2NYYC 6FABH 4TUKL 1JYNA 4FNLL 2QQLH 1CBVH 4NP4H 4XBGA 4EUPH 3OKOA 4C83A 4XPFH 2VNCA 4Y4HA 5J11C 3QUYC 1UA6H 3HRPA 2CKBH 1TNMA 3CUPB 1PEZA 3BPLB 5TPWH 5E6ID 5CAYB 5I71C 1OF2A 3TF7C 5I66A 1EBAA 4M5ZH 4OZHF 5DD3L 2WQ8A 1LE9A 4M03A 3HN3A 4GKOA 1HNFA 3PL6C 4U1HB 1MFAL 5GS0D 2NY2C 3SDAA 5CWSB 3THMH 5MEQB 3LQAL 4PGCB 5DLML 1WFTA 5HGHA 4O2CB 5SWQA 3TO2A 2E6PA 5JHDA 1ND0B 2Z9TA 4LFHD 4YXHH 4PGDA 2VDNH 2Z92B 2AJZA 4JHZA 1CXKA 4HH9B 4UDTB 4PJ9C 4WJ5B 5DEFA 4G9DB 1YYMH 3GM0A 1KLGA 1ZHKB 2BOCA 5E8NB 4I1NB 4OKDA 4XAKE 5HYFA 5D2NB 3TT1H 3VFNA 4ODXA 2ZUUA 3BIAX 1A1OA 3D39D 3IXTB 3UYRH 4P4KB 3TH2T 4JDVA 5AUMB 1NGPH 4ELMB 1NGYB 4WO4C 4XCEB 2ZUWA 2PXYA 3MBED 1L7TL 2L7UA 2O5ZL 1IAII 3QUMA 2KPNA 1RK0B 5J89A 3VI3E 4POZD 3ARGD 2XWTB 1A6ZB 4OZFG 1G9EA 2DQEL 5GRJL 1A7QL 4LIQH 5DUMH 2PR4L 4ZSOE 4OQTL 3KYKL 2CIIA 3FCTB 4H26B 2B2XL 2I25N 1ZS8B 3QG7H 1H3PL 5ETUA 5TF1H 2ED7A 2MPAH 1XGYH 2EIBA 3MRHA 5EUKA 3KPSD 4DCQB 3KLDA 4EOWH 1JGEB 3EYOB 4WI9A 4OFYD 1BVKA 2R0ZH 4P5MA 3RNKB 3I6LE 1T1ZB 3BQUD 2G2RA 2Y1VA 1RHHB 4OZHB 1SBBA 3MYZA 3NFSL 3TIDB 4UTAH 4I9WD 5EBWA 5CHNB 5GISL 1KYOK 5C0CE 4YDKH 1LO5B 1VFUA 3WHXB 1T4KA 3QI9D 1QUNA 3HZMB 2GW5A 3BW9A 4GG8A 1A5FL 5F3HA 4XMLH 4L8CA 4NT6B 1RY7B 4L4VD 1N64H 2EE6A 2FH8A 2Z31D 3UTZB 2WBJC 5DVMA 4JZOB 4OT1L 5H2BA 4P2QD 3WFCH 1A4JA 3SO5A 2V17L 5FYKD 4Y7MA 3UEZA 2UVEA 3C5JA 3VFSA 4AG4L 3OPZL 2NZIA 4LOUD 4MDIB 1S7TB 1OL0A 3H9SE 5FEBA 2A6KA 2WW8A 4G42B 3ULVD 1UXWA 2HWZH 3RWCA 4I3SL 4JB9H 1LEIB 4NGHL 2EH8H 1C8PA 1JHLH 2IH3B 3BIKB 4A2LA 3EO0B 3VFVB 2DBLL 2QADD 4OB5L 4RFOH 1Q9LA 3IDGB 1JYWA 5CJ5A 4XVSL 1UJ3A 5KN5A 4ZUSB 4D3CL 4NCC2 2QSCH 3IDNB 4X9BA 4P99A 1F11A 2E9BA 3GHEH 5LGJA 2EZ0D 3VRLE 4NQVA 3UO1L 5JW5B 3QUYB 1NGWB 5C0DB 2AXFB 1XF2A 3K46A 4POYA 1IGMH 1DQQA 4QHMA 4HBQA 3O8XD 3QIBB 2OMNA 4C4KT 5AZ2L 2X4NA 4IRSC 3FO0H 1FYTE 3BYYA 4MNQE 4X4ZA 1N26A 3HUJE 3G08B 1IT9H 3V6OE 1I7RB 2YD8A 4M8VA 3PL6B 4UV4L 1UKSA 4IRJC 2LAAA 2B5IC 3BD4A 3GI9H 3GSRB 1TJIH 2YUVA 3QUZC 4WWKD 1VFAA 1LD9A 2NY2B 4WIQA 3RWJA 3F6LA 3C8DA 1AQDA 1QVOB 1QR4A 3DV6A 3EYFA 3DGGA 3SKMB 4PR5A 4N0RA 1Q9KA 2ESVE 2VDMH 2VKWA 3LV3B 1KIQB 4LIQE 5E9DA 1EJOL 1S5IL 4YHPA 1GIGH 1T89A 1IC5H 1JN6A 2DQDL 2CQVA 4ZYKB 4HFWB 4NKOA 1OP5H 4J12A 1ZSDB 3O6KH 4PD4K 2X9XA 3D6GA 1XF4B 4X6BB 1GGBH 1I1FA 5EFIA 3DIFB 1FNSH 1VCAA 1MCWW 1QFHA 4JFFA 4PP2B 5FO7B 3SEPA 4D2NA 5CJ8A 4XXDB 3S88H 1QLRB 3MNWA 4QTHA 2XZAH 1RPQA 3K4DA 4WO4B 2P8PA 3GO1L 2H26B 2LU7A 3O6FA 4TUKH 4FNLH 4K7PL 5B38G 1I1AC 4PJHB 1Q0YL 3B9DA 4U7SA 4N8CL 4JRXB 1IAMA 1MCPL 2NY6D 3HS0A 1MJ8H 4JJHA 5HYSG 5K59F 3GZKA 3OXSB 2GK0B 3C5ZC 1S7XA 5JW4N 2VQTA 2DOCA 1WITA 2BNRB 4HGWA 5E00B 3K8LA 4LPCA 2QQQA 5DD3H 4JLRA 5EZOH 2XWJA 5GRXG 4QXTB 2VZTA 3QDMD 3BJ91 4JKWA 4LVHC 2B20A 4OCLC 4P23C 1UQSA 4TUOA 4DGIL 3RA7H 4NC2B 4TNVK 5IK3B 3MGTA 3U4AA 2BNQE 1MFAH 1H15A 4RIRA 5C07E 2I9LA 4K23L 2LVCA 3QDGD 3IFPB 3BKMH 1K8IA 3RX8A 1OARH 5T1LD 3U9UB 3EYVB 1I85C 2CK2A 4M6ML 3LQAH 5DLMH 3LKSA 3RY6A 3IF1A 5DJ8A 1BD2A 1PQZA 1WV7T 2CLZB 5FDYA 4UOW1 1U58B 5GGQL 1ORSA 3LDBC 3QIUB 2X7LA 3QCTL 3FQWB 3ZKNC 5EU4B 3QPQC 2EIZB 4UT9L 3ULUC 1DTUA 1JGVH 2HJKB 4Q6IC 1RZJC 3CUPA 1HYRC 5FIEA 4NM4L 3CDYA 3GRWA 4XBPB 3VXUE 3MA9L 2C7UB 3N1PC 5BQ7B 4G43B 2PYFB 1U36A 2WQRA 1G6VK 1CDCA 5FYJL 2J7LA 1L7TH 2O5ZH 1GZPB 1ZWIB 1H3XA 5JMOC 3SDCC 2OL3B 4J4PD 3TESA 1WCBB 3BZ4A 5IIEA 3IJYB 2AAVA 5GRJH 4KHXL 4X7SL 1A7QH 4D94A 2PR4H 2Y7QB 2XG5A 2EDFA 3FB8A 4LCWB 4OQTH 1MWAB 4P3WA 3IDXL 4O2CA 1N5AB 2VZOA 1H3PH 5KSVB 4FTVE 1ND0A 2FATH 2W59A 4NO0D 1S7WB 2UWEF 1GCFA 4PJIB 3KPPA 1T3FB 4RMRA 4G8FB 4CU8A 2Z92A 4NNXB 1QRNE 2A38A 2D7TH 3DGCR 5TDPA 4DVRL 2DTSA 4HH9A 4UDTA 5F96H 4G9DA 1K8DB 2JKXA 5EUOE 4KTYA 1YN7B 3NFSH 1ZHKA 5E8NA 5GISH 4IRSB 1JF5A 4PYGA 1QO3B 2JELH 1GSMA 2W0KA 4P4KA 3O3EA 3MJ7A 3FB7B 2FHCA 4EN3D 3KXFD 3NIDE 3VXSB 5IQ9A 4X4YB 2AXGB 3U0TB 5DQDL 4XCEA 5ANMB 2E6QA 1MELA 4U1SB 4LCIL 2B5IB 4IIQA 4PJCE 1OTUC 5CS7A 2IF7A 1HILB 5JA8B 2XWTA 5KVDL 3GMNB 1FC2D 5F9AC 4MMXC 2EO9A 3ULUF 5C0IB 2OMBA 4FQ1L 5E4IA 4RFEB 2IH1B 2XKUA 2BY3A 3BN9D 2V17H 4H26A 5ESAB 4PJFF 3UBXI 4AG4H 2WWKT 3V4PL 1CIUA 1H5BB 1MQ8A 2J1KA 3OPZH 5K9OA 3PUCA 3TO4A 4DCQA 3SDDC 1OWRM 5D7LB 2DWDB 4K2UL 3RNKA 2BVTA 3S7GA 4NHUB 5DHXB 3GJFA 1RHHA 4I3SH 3RIFF 5ICYA 4KV5E 5J8OA 5CHNA 4QHKI 4OB5H 4R6UA 1LO5A 1CL7L 5B39B 3WHXA 5CGYC 3MROB 4XVSH 1KB5L 3KNBB 4D3CH 3RFZC 2ED9A 1I1AB 3DECA 3Q5TA 4D9RE 3UO1H 3VWJA 2VOTA 3C5ZB 1N6QL 5AZ2H 1OWWA 4Q6YA 3O9WD 2CR3A 3VXRD 4ODVL 1C08A 5EU6A 3NCEB 3VGGA 4PJ8B 4P48A 2Z8VC 1K4DA 2NY3C 5CD3A 4LVHB 4P23B 4F80A 4UV4H 3IDUA 3FN0H 3I9GL 1NMBH 4PRPE 3F12A 5EN2A 1S7TA 5CBAA 1PZ5B 4OZGB 4CN6A 4Z0XB 3VXNA 4HC1A 4G42A 2ZCKL 3R1GL 1JZ7A 3BP5B 1IVLA 5DJXA 1Y6NR 1NLDL 3SJVE 4KVCL 4QWWD 1LEIA 3EOYG 1XGPB 2IH3A 3EO0A 1X6LA 4ORZC 3QUML 4GBXD 4HUMB 4M1GL 3VFRB 4KJPD 1EJOH 1S5IH 3L5WA 1LGVA 4HLJA 3T3PF 3ZKQD 3IDNA 2DQDH 4HXBL 3QFJD 1NGWA 4I3RL 4JREC 3GMLA 4Q6IB 5C0DA 3OKKB 3RWEA 3SO3C 3QIBA 5LCVL 4PJFB 3H0TB 1AH1A 2EDNA 2VUOA 2UZXB 2FECL 2BK8A 2X4PA 3NAAL 3GO1H 1I7RA 5C9KA 4MD4A 2OQJB 4EDXB 3OB8A 3PL6A 1JGDA 1Q0YH 1ZA6A 3K2MC 4N8CH 4PJEA 3VE0B 4ZAKD 1AXSB 1MCPH 1ROWA 2HLFC 4NBYB 5F1NA 4GSDH 1IFHL 4LCYB 5IKCB 2AXHA 4HJ0C 3QT2A 1QVOA 3MRIA 3UDWA 1FL6A 4NQCD 3HPJB 3AAZB 5I76B 1SJHB 4N0CC 2IMNA 3GMPB 1OAUL 4DGIH 3QFDB 1AJ7H 4Z7VF 3QIWB 1UT9A 3OBAA 2Q3AA 5FO9B 2BJML 2IAMD 2A83B 4HFWA 5E70A 4KI5C 5JNYB 2BSTA 3C87A 3CVHL 2Q86A 1DQJB 3AC0A 3DIFA 3V4VL 5FO7A 1MH5A 2H32H 1GL4B 2FB4L 1JPSH 2R9HD 4OZ4B 1QLRA 5GGQH 1OHQA 2DQGL 3O41B 3HKFA 3QCTH 4K3DL 1L9NA 2GT9B 4PJHA 3PWNA 1OB1B 1MCFA 4JRXA 4UT9H 1AKJB 5ICZB 2EC9T 1R3IL 2VC2H 1R5VB 4LPVA 5DRXA 2GK0A 5DI8A 4NM4H 2PW1A 2BNRA 3MA9H 2VLRD 5HY9A 4JY6B 3EOTH 3S3SA 2AEQL 2DRUA 3P4NA 5FYJH 1JJUA 4M1CC 4HS3A 4UQ2A 5IVOA 3RKDC 4FN0A 3DX9B 5IK3A 4PG2C 4MQXC 1EH9A 2GKIA 4APQD 4KHXH 4X7SH 3AS3A 1HQRB 3U9UA 5I1HL 3T0BA 3EYVA 4KK6C 3F62A 3IDXH 5E2UL 1P4BL 2DQHL 3PDOA 1FV1A 2OR9L 3D85B 4XZUB 1U3HD 2WWMD 4LMQI 3KPMB 5CBEA 3RVWC 4RA3A 1ADQA 3QIUA 5C8JB 5E8OB 5D6DC 1IC1A 3FQWA 4GS7B 4DVRH 1JNHB 4NO3A 4LSPL 2I07A 5EORH 1J8HD 5GS2D 2EIZA 3LD8C 1K4CB 4MVBD 5BOPA 2HJKA 3ZT7A 4KI5F 4R4BB 4LF3B 3CIQA 5DURB 1VFOA 3LPWA 4XBPA 1MCCA 2R4SL 4L4TD 5BQ7A 2NTFB 4G43A 2NY3B 4Z7VB 4KJWC 2PYFA 1BQHG 3CCHA 3S97C 1VB9A 2CLVA 2X4TA 4LCIH 4NZJA 1ZWIA 2ENSA 4UV7L 2FD6H 2OL3A 5KVDH 3D18B 1BIIA 4AEIL 1BBJB 3SBWC 4YHYC 5HI3C 2E7LA 2HTKD 1CT8B 4WI2A 4U6HA 1ZXQA 3O3BB 3PWPD 1OAXL 3CJJA 1HEZA 3RDTA 2ICEA 4R97B 15C8L 1N5AA 1BMGA 5KSVA 4PY7B 3MLYL 5DD1H 4QXUH 4Z7UB 3V4PH 4PJIA 1T3FA 4DUXA 1KCKA 4NNXA 3WDJA 4Y19B 3DLQR 5B4MD 4JREB 2GQHA 5FOBB 3CDGA 3P0GB 3SO3B 5A2FA 5DHYA 1YN7A 1WWCA 3JSSA 1YEIH 2OSLB 4NNYB 1DN0B 3W39B 1WBXA 3I50L 3W9EB 2XPGA 4B53A 1R0AL 3W11C 1CL7H 3TP4A 5GHWH 2N7BA 5DYOA 3S8WA 4PJBA 3K3QA 2FGZA 5HVGB 2AXGA 3V6ZA 4UZGA 4E42B 3AS0A 3GJFK 1HILA 4MJ2A 2BOBB 4FXGA 3KS0H 3U7WL 1N6QH 1PX4A 3GMNA 1OAZL 4Y1AB 5E8DL 1EIBA 4QRQA 4ODVH 3MLPA 2R8SL 1B90A 4RFEA 1ZGLB 4PTUB 4JHAL 4S1RH 1TTUA 5ESAA 5I75C 5D5MA 5CKAA 3CFBA 3VMPA 3TFKD 1F13A 3I9GH 1H5BA 3G5VB 4C57C 5TDNB 5IMMB 3X11B 5FYJE 3GI8L 5T1DL 5FA4A 1N0LA 2FGWL 2ZCKH 1MRDL 4BQCA 1NLDH 1SM3L 4KVCH 4UINL 3EZ8A 4OCMC 3U46B 3WXVL 5JQ6L 4PRNA 4HMCA 4MWFB 3QUMH 4M1GH 1HXYB 5ICXB 3MACL 4MJIB 3MROA 3UMTA 4F7PB 5ALBL 3OJ2C 1BQSA 3KNBA 5H37H 2ZZUT 2LVEA 3MV8A 4LLWB 1XMWA 4HXBH 1A3LL 2OBGA 4JFEB 1WQVT 1A1MB 2N4IA 4JGUA 3LKQB 1OSZB 4I3RH 4E41B 5EBGA 1XH3B 3UPRB 1WIUA 4JGJA 3MRGB 2OI9C 5LCVH 3WNLA 3MV9B 5I74C 2VWEE 2X5PA 4HXAL 2B7DT 4XT1C 1XR8B 2AJ3A 1GPOL 5B3NA 3V2AR 3NABH 4PJ8A 4NRXA 3NAAH 2LFGA 2GUOB 3C08L 5JOEA 1URLA 3QNZB 2X1PA 4XAKD 3SCMD 2CH8A 4F37F 1CFTB 2W9LA 4ZO9A 1PZ5A 1IFHH 1I85A 3BP5A 3LKRB 4QY8B 3Q6GL 5E4EC 4EIZC 1QP1A 2CMRL 3WJJC 5EIVA 2X4OB 5E03A 4ZS7L 2PTUA 3RPIB 2EDWA 4WU7B 5I8KL 1MHPH 1OAUH 4XP5L 1U8MB 5DA4A 1M05B 1JZ2A 3P3YA 2F8OA 3H8NA 1PY9A 4KZEL 2VZ3A 2BJMH 4LCCC 3LD8B 4GQPH 2I27N 1RZGB 1WWWX 1YEJH 3OKKA 2Q7NA 3G9VA 5D1ZC 1NGQL 3ARED 1DUZB 2FB4H 1ITBB 4GXUN 4UTBL 4PRHD 3MUZ1 3I6LD 3A6CL 3BOVA 4JFPA 5HHMB 4RX4A 4AH2A 2A6JB 4H0HB 4PJAA 1XGQB 4K3DH 4Q74A 1LK2B 2XTJC 4X5WB 3UAJC 5C0CD 4FS0A 3KPNB 5IB5B 1AHWB 2DM2A 3VE0A 3WL9B 4PTTA 1R3IH 2NY1B 2VXQL 4YHYB 4CNIB 4LCYA 2Q6WB 5IKCA 2DJ4A 5IQ7L 5CKGA 4U1GC 5F21B 1LP9F 1J1PL 1YNKL 2VLKB 2AEQH 4NN6B 5JHDE 5DC9B 1TNNA 2VZVA 3HPJA 1CE1L 4YNYB 1TVHA 3AAZA 4D9LL 2DS4A 2LV4A 3GMPA 2VE6B 1RV6X 1QA9B 2P5ED 3T77B 3QIWA 2JF1A 2LE9A 5FO9A 1R24B 4FFVD 4WW1A 4UBDC 5F7FA 5F7NC 5I1HH 1FL3B 5T3ZH 3MRQB 1DQJA 2P44B 1B0RB 3QO0B 1CLZH 5E2UH 1P4BH 2DQHH 3H9SD 3MLWL 4NDMB 2OR9H 3OZ9L 5D9SB 5SWZE 5IVZB 5H35A 4OZ4A 2DM3A 3MCKB 4HC1L 2IPUK 5KG9B 1H0DA 2GT9A 1JMZA 3DYMA 5CZKA 5HI4C 4LSPH 3QEHA 1CYGA 1AKJA 1F2XK 4X6EB 5ICZA 5IJKA 3GMOB 4X83A 1R5VA 5IBTH 4K9EL 3CMGA 4MAYC 2KUTA 2R4SH 4IOFC 4HUWA 3B2UD 5TGBB 4JY6A 4OCYL 5I2IB 5I75B 3C09C 2XWBA 4OF5A 4HFUL 3ZL4L 3IT8D 4XNQA 5L9DL 4RNRA 4YHLL 4XAWL 3RVXD 4G6FD 2ZNWA 2HRPH 5C0FB 4Y16D 5D1XD 1F4YL 1FYTD 4PREB 2F5BL 2HT2C 4AEIH 3QUXC 4FP8L 4LPUA 3W5MA 2ITDB 3BRDA 1B2WL 1OAXH 1LHZA 2HT3D 5MERB 4XZUA 3MLYH 3PG2A 3KPMA 5F9JB 3T4AA 1MHCA 1FCCA 5L88L 1RHFA 4OIBA 4QRSA 5C8JA 4Y4KC 5E8OA 43CAB 3HE7D 1R3KB 1JNHA 1BJ1H 3M8OL 3ARRA 2ESVD 3CFIC 3ROOB 3L3OB 1LP9B 2OI9B 3HZKB 5GSRA 3OKYA 4J8RA 1CS6A 4R4BA 3N9GL 2M2DA 3I50H 4LF3A 4YK4C 5GGVY 5IVXF 5L0QC 1UH4A 43C9A 4YEFA 2JB6A 3DX6B 3HA0A 1A7RL 1ZHBA 2DI9A 3WS6C 3BRGC 3LSOB 4BSWB 4MNGE 4MLSA 4LHUB 1MLCB 1FVEB 1Q9OB 3NCJL 4I77L 4X80H 1B88A 3U7WH 1XCTA 3GKWL 2AEIT 1I8IA 4MB3A 4NO2B 2VL5A 4HQQL 3I2CH 1BBJA 5HGAB 3JTTB 4N1CA 5E4EB 1HDMB 2BNUB 3O3BA 4JHAH 4XRCA 1A1NB 3MR9B 3QWRA 1G7LA 1I9JH 5GGSB 4PY7A 1NFKA 4M43L 1FRGL 1OT2A 2UV3A 3HG1A 2V5TA 1L6ZA 2PO6D 3SPVA 3SGJA 3GRWH 4IRZH 4LCCB 2P42B 5T1DH 5E94B 3R06B 1MRDH 4HLZH 3S4SB 1SM3H 4UINH 5D1ZB 1MCSA 3WXVH 2E3VA 2M26A 2X1QA 5JQ6H 4LSUL 5AZEH 3JWDC 2KH2B 4K7FA 2OSLA 4NNYA 1DN0A 2BNQD 3W39A 5C07D 4JVUA 3W9EA 1J0YA 4Z5RB 4KRPB 3MACH 4B41A 3TBVA 1HZHL 3U4EB 4MS8C 5ALBH 5T1KD 3O4LB 5HTSA 2BXYA 4K94H 2NQCA 2Q20A 5FGBA 4K07A 3QJHA 5E99L 2OYPA 4P3CL 3LHPH 5DZLA 2BOBA 2IGFL 2X4SB 4Y0GA 4Y1AA 3LS4L 4U1GB 4HXAH 4MGXA 3ZT5A 5E7FA 1GPOH 2IFGA 1ZGLA 1NDGB 2W9EL 3TNMB 4U2YA 2PN5A 3C08H 4LLYB 5EBMB 1RJZB 1D6EA 4FA8A 1FL5B 1YEKH 4S2SA 1KYOJ 3VXUD 2FBJL 1ZKAA 2AEPL 5IMMA 3X11A 4NPYB 1UWEL 2BMKB 2W38A 1D9KA 3L6FB 4DQOL 1BVLB 4D0CB 5IVXB 1G0YR 2BVEA 5MI0C 4U1JB 2V5YA 4JFFE 4PLKD 3Q6GH 1KTDB 4OI7A 4MWFA 5F7DB 2VZUA 5FM8A 5ICXA 2ZJSL 4G9FA 3TN0C 5I8KH 4K7PY 2OL3L 4XP5H 1TPXC 1I3RA 4F7PA 1FPTL 3RGVD 4LLWA 1K5NB 3VXOB 4JO2L 3T0AA 4ZQKB 1NBYB 3LKQA 3LN5B 4IMKC 2VZSA 2J2ZA 1OSZA 3HB3D 1MWAL 5F1KC 1MCBA 5LJYH 4FTVD 4E41A 4X6DA 4QYOB 2VERN 4BFGA 3MV9A 1QRND 4MXVF 1HKLL 4X6CF 3QULA 4KKAD 3RZCC 1W8OA 4CMHB 4F2MA 3VGDA 2HN7B 1LWRA 3G6JF 4LRIA 5FYKU 4MCYB 3GJFH 3MQIA 1OCWL 3QNZA 4S1DD 4JAMB 4FXLA 4I18A 5DDHA 3QUXB 2VXQH 1HWGB 1JHKL 2JCCB 5HHOB 4WWID 1UVQB 3D2UB 4U0RC 4AMKL 2GI7A 3LKRA 1JIBA 1J1PH 1YNKH 3O45B 2B4CL 3A0OA 4L5FL 4OAWA 2VXSL 2FX9L 1BD2E 3MBXL 4ACPA 1U8JA 1CE1H 3KPTA 2VN7A 2X4OA 3DSFL 4WU7A 5F97E 4D9LH 1U8MA 1S9YB 2DQFB 1KULA 4Y4KB 3T65B 1M05A 1W0VB 1V7MH 5DHVB 4DZ8A 3MO1A 1ORQB 1F4AA 4KC3B 3VFUB 2FEEL 4YK4B 2ZUVA 1RJCA 3MLWH 5L0QB 3FOMB 2VO5A 1DUZA 5CUSL 3TVMB 4C58B 2BFVL 3L3KB 3LRGA 5GRZA 4HC1H 3SOBL 3T0EA 2A6JA 4NQTA 1YNLL 4CN4A 4NKDA 3KPNA 1T1YB 5IB5A 1AHWA 3WL9A 3QEGL 3VWKC 4K9EH 4CNIA 1CD0A 1T83C 1CXHA 3OMZA 2X05A 3WS3B 1S3KL 1NC4A 2ITCB 4P2QA 1N4XL 4OCYH 4X9HA 1I9RL 4RWHA 3FQTB 1OVZA 4PD4J 1KLUB 4YNYA 5HJ3B 3ZL4H 5L9DH 4XAWH 1F4YH 4M6NL 4M7LL 3T77A 5IHLB 3K74B 1ZHLA 2F5BH 3WO4C 4E5XB 4W4OC 4FP8H 4XHJC 5FUCC 4UB0H 5MEPA 4LAQL 1B2WH 3MRQA 1MFBH 4H1LB 2FX7H 2CRIA 3OG6B 4PRPD 1KN2L 5IEKB 3G6JB 3QO0A 4UT7L 3ESUF 1U2HA 5D9SA 5BZDA 4ELME 3G5YB 4ZXBC 5IVZA 1LDPL 2WLZA 5HVWA 5HYJD 3SJVD 4GW1A 2IEPA 4G6KL 1DBBL 4G3YH 3M8OH 4YHOH 4NUGL 1CI5A 1MHEB 4Y8DC 5E95B 4X6EA 5IT2L 3O8XA 3VJ6B 5BS0B 1HCFX 2VR5A 1DVFC 5CSZA 5CP7A 1U3JA 4HWNA 4Q97A 4X4MA 2H45A 2W0FB 1A7RH 4S10A 3FZUC 5IW3A 5DT1L 1P9MA 1RZJL 3EHBC 2EEBA 3NCJH 5B8CC 4I77H 1X4ZA 5IROA 5C0FA 3NFNB 3GKWH 2EYRA 3SKOB 4QRPA 4HQQH 3HZVA 5MI0B 3TBWA 1CG9B 1PX3A 1NUDA 2ITDA 3TEUA 3KPOB 1DBKH 3LS5L 1W0WB 3EJYD 4HV8A 2V6HA 2PUQT 1R6VA 3KPQA 2F19H 4MJ6A 4ZDHA 1UC6A 4Q7DA 4ODUB 5F6IC 1TPXB 3Q48A 4M43H 1DLFL 1FRGH 3KS0J 5ITBL 1KTLB 1CDHA 4R4ND 4CVZA 4MLIA 4WI6A 5F9JA 1AI1L 4GG6F 3C2AH 2E5EA 3LEXA 1CR9L 1JF1B 2JJUA 1YY9C 2PTTB 2DJUA 4ODBD 3SKNA 1R3KA 4WI3A 3HFML 4P5TD 3ROOA 3L3OA 4OGAD 3HZKA 4LSUH 1DE4B 5F88B 5EU6E 1TVBB 2I60L 4MX7A 1HZHH 3RZCB 3QRFM 3QBTB 4JHWL 4DTGL 1Z9LA 3HE6A 1FNAA 3DX6A 3VDBA 1TMCB 2P5WA 5DWUL 3LSOA 5E99H 4RISL 1U9KA 3S37L 1NANH 4U05A 3PHQA 4P3CH 3QDAA 4LSDA 2IGFH 2NY7L 3MRPB 4NO2A 4U0RB 2ZUSA 4N9OB 1KJ2B 3LS4H 5HGAA 1U8KB 2VR4A 1ADQH 2BNUA 3GMRA 1ZT1A 4PJ7A 1A1NA 1K9TA 1IQDB 2EXWD 4KMQA 1DEDA 1RIUL 2FBJH 3CU7A 1IAOB 2AEPH 3DETD 2CKNA 3VFTB 4LCCA 4CBPA 3Q5YA 4ZPVA 5A2LH 1UWEH 4LEOB 2EDHA 4MZ3A 4DQOH 4FQXC 2GJ6B 2P8LA 2ICES 3S4SA 2I5YL 5D5MF 1TZIB 1AGDA 1CICD 3CNKA 4AIZB 2DKSA 2IBZY 1FZOA 4AIXA 2ZJSH 3MYJB 4ZUWA 4Z5RA 3BZEA 1OQOA 2OL3H 1FFPB 3U4EA 3BT2L 4KUCF 3INUL 1FPTH 1OGTB 2F74B 4O2EA 4JEGB 3CDFA 3TNNB 2R69L 1YUHA 4JO2H 4PJEE 3L7EA 4QGYA 1FAIL 2X4SA 5DMKA 1D5BB 5IFHL 3K81A 2W9DL 3SGDH 4N68A 5K33A 1HKLH 3BH9B 4QNPE 1JPGB 1RZ7H 3TNMA 3GB7A 4YGVB 4WI8A 2LTQC 3QEUB 1RJZA 1OCWH 4DKDC 3NACL 3H7LA 1I7ZB 1O0VA 1Q94B 4H88L 3S34L 4BFBD 3WO4B 5E0QA 1HWHB 4KK5C 1DR9A 4NPYA 1JHKH 2AK4B 5AG9A 4AMKH 3V0AC 2B4CH 4L5FH 5CSBA 5CJXA 3LCYA 2VXSH 2FX9H 1KTDA 3MBXH 4P5KB 1QLFB 2EDEA 1QYGL 3DSFH 3P4MA 4ZXBB 4Z8FL 3FAWA 2EIDA 5HHPB 1K5NA 4PLOB 4PJHE 2I9TA 2AQ2A 2E9JA 4JRXE 1KT2A 2NMSA 3LN5A 1X5HA 4ZQKA 5SV3A 3VFMB 3RVUD 1OOAA 3NIFE 3QP3A 4PRIB 2XZQL 1HHJB 2BNRE 1DVFB 2LAGB 1RUPL 3U4BH 3W81A 4GKZB 5CUSH 4QEGA 2BFVH 4F7TA 1JPST 4RBPK 5A16B 5EU3B 4MD0B 4PGJA 5EOTA 3SOBH 4JM2D 4HGKC 1RIVL 2HN7A 4M8QB 1A02N 1YNLH 4NZTH 2IALB 5JZ7C 4E9LA 2G9HB 3QEGH 2MQ3A 1JWMA 1MIEH 2JCCA 5IM7B 1BGXL 1MIML 3WFZA 4EI5C 3PE9A 5EIIB 5HPOA 5DSCB 3QXAB 1N4XH 3TBTB 3O45A 1IKNC 1I9RH 3STZB 3NBNA 5F6IB 1PDKA 1QLEL 3BVNB 4HEME 4BA8A 4P2OD 5JW4Q 3CDCA 5I1AB 2QSQA 2YS4A 2V9TA 3SE3C 3AGVA 5GRUL 4Y4KA 3T65A 4M6NH 4M7LH 1FFNA 3RIAK 5IMLA 4I48B 1ORQA 4AT6A 2CUMA 5HDQL 3VG9C 4LAQH 1ZAGA 1X5FA 3ZYJA 4FQIL 1R5WB 1KN2H 4AJ0A 2EECA 5FYJD 3FOMA 4KROC 3Q0HA 3TVMA 1YQVH 2PYEA 4L1DA 1ZOXA 3L3KA 3WCYA 5EB9A 4BK5A 1LDPH 1GZQB 3VG0L 5F44A 3R4DA 2NCMA 1DBBH 2FEDD 2R2HB 4YZFE 2QQKL 3ILPB 5DUBB 1R3LB 4NUGH 3ZKXC 3OAZK 3IU3A 5IT2H 1NCUA 2X89D 2H3NB 4GMSL 4F7EB 1YMMD 3EJJX 3WS3A 4RGMC 2ITCA 1MEXL 3CLEL 3FT3B 1BJ1J 2AK1L 3TJHC 4PJIE 5DT1H 1UJTA 3S5LB 4NHCL 3OAYK 1IZKA 1I75A 1XGTB 5FK9B 5HD8C 3RUGA 2WANA 1K3ZA 5ILTL 1HSBA 1LDSA 5EC1A 1EFXA 4JQVA 5TE4L 5JXEA 1E27B 1IRAY 4GAGL 4PJ5B 1F8TL 3LS5H 3MSPA 3FONA 2NXZD 5F1SA 4BK4A 1P7KA 3EYQC 4PJBE 4JY5L 1FN4A 5DO2D 2V5MA 4LPYA 4XPAH 5ITBH 1DLFH 3BDYL 2OTWB 4OLWH 1FJ1B 3BRFA 4PJDB 1WZMA 3BE1L 1AI1H 5F7UA 1CR9H 3NGBB 3HFMH 1ZGLM 1QBML 1MHEA 1A6UL 4ZFZB 4XX1E 2AXJA 2VISB 3L95A 5C08B 4OBRA 2WIMA 4KKBD 4QTIH 2I60H 4Q9QL 4Y4HD 1ZVYA 4JHWH 4DTGH 5B39G 1INQB 2BCKB 4HHAA 4HKJA 1OT1A 2LTQB 1WC7B 2W0FA 5DWUH 4KU1A 3O3DA 4RISH 2ATPA 3S37H 5JTWA 2J6EA 3B9KA 2NY7H 5JORB 5F7MC 2R2BB 2E6JA 5E5RB 4J3WA 2EC9U 1CG9A 2FSEB 5F9DC 4N0YL 4JPKL 4V1DB 3ES6B 2ZPKL 4QCIA 4HIXL 4RMWA 4WGWB 4DZBB 4ODHL 5EULV 4ENEC 1DBAL 4YPGB 4KK9D 3MV8E 2CRMA 1RIUH 1KTLA 3SDAD 3SKUD 4NQUA 2PTTA 3OKDB 1EHNA 5JHDD 3PWVB 3LOWA 1LE5B 4YIQB 3GIVA 2I5YH 3RWFA 4H8WL 4LKXA 4WEMB 3HRZB 3HMXA 1TVBA 1FIGL 1JCKA 2NPLX 3D87B 3V0WL 2NX5B 3BT2H 4GXVL 5BMFL 5DK3A 1AD0A 3DVIA 5L2KB 2R69H 4J3OC 3ZTJG 3NZ8B 1TZGL 4OZGE 1FAIH 3BKYL 1VFMA 3LB6D 4X98A 4YFDB 4HUNB 1S78D 2PXYD 4EI5B 2W9DH 5I6XB 1KJ2A 3VRIA 4POZC 3ARGC 1G9NC 4NFCA 1U8KA 3LH2L 3UROR 4HS6A 4U1IB 4JDZB 4NNPL 1L9MA 3B8SA 1MCIA 3NACH 2JJSC 2G5BB 1AGBB 2P43B 3STLA 4H88H 1IAOA 2QKIA 3S34H 4U1NB 1KN4L 5INDA 3UTPE 3VG9B 1QNZL 4LEOA 4R3SB 2Z91A 4MA7L 3CC5B 4CADB 2Y25A 1EEZB 4AM0A 4Z7QF 4LQ1A 1XF3B 2YD5A 4QRRA 1L7IL 1QYGH 3BQUC 1A3QA 1X5ZA 4EXKA 2VIRA 4R7NB 3MRBB 1FAKT 1FFPA 4ZOBA 7CGTA 4PJAE 1WTGT 1OGTA 1JNJA 3G5ZB 4HUVA 4BSJA 4M4RA 2ZG3A 3QI9C 1WZKA 3ZKXB 3GHBL 4OGXL 3QH3A 2XZQH 1A2YB 1IGIH 2DIJA 2OS7A 2EDXA 4RGMB 5ISZB 1RUPH 5A40E 1HHIA 3VCLB 3RL1B 2BY0A 1JPGA 1DQML 2Z31C 1S7VB 4XNMB 1RIVH 3KYMA 4YGVA 1YNTB 1BOYA 4X6DF 4GRWF 3REVB 4HS8L 1CDBA 5TE7H 1I7ZA 3C5SA 1MI5B 3M1BA 1WISA 1Q94A 3PGFL 1R3HB 2JE8A 4GLRH 2DI8A 4U1LB 1BGXH 4KTEH 1MIMH 4LOUC 4EBQL 1UM4L 1DEEB 3WMSA 4O51B 3LKNB 4I3GA 4RCAA 3WO3B 1QLFA 3ULVC 3ABZA 3L5HA 4L3EB 3VD4A 1A9BB 3PWJB 4W6YB 1QFWL 5GRUH 3FO2B 1CLOL 5CSGA 2QADC 2X70B 4A6YA 5GZND 3DRTA 4NKMA 5DJ0B 5IB4B 5HDQH 3VFMA 5J3HD 4PRIA 4D8PA 5C2BH 1RMFL 4J7RA 1HYSD 1HHJA 4ETYA 2UYLB 4FQIH 4WNQA 2EZ0C 4YBQD 2GITB 1CL7I 5DRWA 3VD9A 4LL9A 4N5UA 5A16A 5GS0H 4MD0A 3RZWA 1CGVA 3AY4A 3VG0H 2F54A 1T21B 2FX8L 4DN4L 4MJ5A 4WDIB 2ZOKB 4KWUA 1H9VA 1XF5A 2G9HA 5K9QG 2HTLD 3GBML 4GMSH 1KELL 1P69B 3DSNA 1EXUA 3BYTA 1M71B 4O58L 3C6SB 3UTSB 3WJLA 2JLLA 5EIIA 3QXAA 4I5BA 3ALWA 2XQYG 1W0YT 5CEZL 3BSZL 3STZA 3CLEH 5FCSH 4S1QH 2AK1H 5I1AA 1J0JA 5HXMA 4LP5A 5EWIL 5ILTH 3NTCH 1RI8A 4M6OL 3MCG1 2CLRA 1GGCL 2DD8L 5TE4H 5EU5B 5E9DD 2RGSA 4GAGH 3ZE1F 1F8TH 1UEMA 2YWYA 3QNXB 4GKSB 1TJGH 1IMHC 1QACA 1R5WA 3WFBH 2KKQA 4D0BA 3S35L 4AQ1B 1NFIB 4GRWB 3S6CA 3BDYH 3BE1H 3DRQA 1FO0B 2P1YA 3ULVF 1GZQA 3D39B 4JFFD 1QFWM 3TC9A 3V5KA 3F5WB 2R2HA 3ILPA 1QBMH 2ZNXA 1A6UH 1HNGA 3O6FD 3QPXL 4F7EA 2V7NA 2ZUQC 3ARGB 5KSBF 4OLUL 2FIKB 4RBPH 1NUNB 2EYTB 4TULH 4Q9QH 5EZLA 2NY6C 5DVLA 1I8KA 1S7RB 1J86A 3IXAB 4DGYL 4HG4K 4Z7UE 3HG1E 5L2JB 1HHGA 3S5LA 2DQCL 3DI2B 3L7FA 1CGYA 5HGDB 4H5SA 2IQAA 4G8EB 5D71L 4NYLB 5GXBB 1JGUL 3OKLB 2WP3O 1OW0A 5BCAA 2WK2A 1Q1JL 3LIZL 5LKNA 4N0YH 4KK8D 4JPKH 3OKMB 2EIEA 4HIXH 3FT2A 1PAMA 4ODHH 2X9WA 3QDJB 5B3JE 1DBAH 4GH7B 4KJYB 1CXFA 1FJ1A 4PJDA 1PD6A 3BWAB 1CVRA 1DQLL 3QI9B 3B3IB 3Q1SL 1BD2D 3VGFA 1BX2B 5D72L 1EUTA 3RBGA 1KNOA 4Y1AE 3FAXA 4MXQC 4H8WH 5IVNA 1H3GA 1DZBA 2VYRE 4L4VB 2KDGA 2VN4A 2RFXA 2E7HA 4X7FC 2H1PL 1FIGH 3EOAB 3V0WH 4OZFA 5KANI 4GXVH 1ZLWK 4UIMB 5BMFH 2BCKA 2A6IA 5A2KH 4M7KL 4G80B 1WC7A 2WSKA 5GIRA 4FQCL 3DTXA 4WTXA 2R1XB 5CEXB 5I8OL 4WCYL 2QHRL 3OAZH 2EDQA 3NFPB 1TZGH 4N0UB 4OFIA 3WV0A 3BKYH 2VAAA 3PIQB 1OAYL 1MFCL 2R2BA 1VGKB 3GBNL 5HYIA 1YPZF 1BAFL 2FSEA 2Y07L 3LH2H 3CFEB 1NCDL 4J4PC 3ZDYF 5IEHA 2J8HA 3G04B 4NNPH 2V7HB 4G9FE 3JV6B 3EFFA 4BSVA 1FNEA 3DPBA 3OAYH 4Y4FA 2AJVL 1F3JB 4XHQA 2QADB 2HVKB 4JFEE 2DB8A 1FZJA 4TN9A 1GAFL 3OKDA 4KKCD 2JTDA 4HUXA 3F7VA 5DMGD 1MF2L 4E41E 1LE5A 5J6HA 4PJ7F 4MA7H 3ZO0A 1RZIB 3JWOC 4XGZA 2V5SA 2Z8RA 4Q9BA 3MV9E 4LHQB 5EBLA 4ZUVB 1L7IH 3HRZA 3QA3A 1OTSC 4KKLD 5LXGL 1JV5A 5LWYL 2IADA 4G7YL 4M9PA 5I1IL 3VXPB 4R96A 2E8ZA 2COQA 1SYSB 4E0RB 1U6AL 3RWGB 1UEYA 3ZTNL 3NZ8A 3GHBH 4P4KD 4KRNA 1MRCL 2J8UB 3BP4B 3QEQB 4NSKB 4GRLB 2HLAB 1J8KA 1MCHA 3ZE2E 4M5YL 1GGUA 1P2CB 3E2HB 2NLJB 1DQMH 4U1IA 4FQQB 1B0GB 4KPHH 2O5YL 3CD4A 1BZQK 5DRNB 4Y2DA 2W92A 3DO7B 4X9IA 2XIDA 3SE3A 5BW7C 4OZIA 2G5BA 3BN9C 1RFDL 2BY1A 3PGFH 4MNQA 3LRSB 3I75B 2ORBL 4WGVB 3UP1A 1JPFA 2YEZB 4FRWA 3RHWK 3GUTB 4R3SA 4EBQH 1UM4H 4XPBL 3CC5A 3TO4D 1NBVL 1EEZA 1XF3A 3S36X 2D0GA 2FYYB 1QZ1A 4GAYB 4YHIA 5FF6B 5HHME 4WEBL 3DROB 3QWOB 1QFWH 3T0EE 1CLOH 3RWDA 1YA5A 2PW2B 3G5ZA 4J3UA 3EOBB 3UBXB 4O2FB 1YPZB 4QLRA 3KLAB 1BREA 4JFQB 1F97A 1RMFH 1QSZA 3ZE0E 3C60A 1A2YA 1FCGA 5AEAA 5CIPB 4LLMA 4OCXL 1NBZB 3RL1A 3IFNL 3VWJD 1X3DA 1VEPA 3DARA 1S7VA 4RZCB 5EH1A 5GGUA 4L3CA 1L0XA 4XNMA 5INCB 4J23A 3O9WC 2FX8H 1YNTA 3K2UL 4DN4H 2BSRA 1IILE 3OKNA 3IDIB 12E8L 4TSAL 5EU6D 5DGRA 1NEZB 1CZ8L 2CJUL 4M61B 3QDMB 3HZYA 3DBXA 3FQXB 1HH6B 3HMXL 1R3HA 3GBMH 1KELH 5IR1B 4O58H 3FQUA 2X6MA 3WIFB 1RULH 1YEHL 2DLEA 4M1DL 4PJXF 5CEZH 1MCRA 3BSZH 5I1DA 4M62H 2OJEB 2R39A 4QWWC 3VXQB 4AZ8A 3PWJA 1T6WA 4GRMB 3PWUB 4M6OH 4GBXC 1KJ2L 3MRKA 5I0ZA 4XVTH 5IMKB 1GGCH 2DD8H 2Q7YA 4KJPC 5DJ0A 1T2QL 4XP6L 4ZNCD 5B38A 3WE6B 2UYLA 1NGXB 2GITA 3S35H 3G6DH 1A21A 2ADIA 2VDLL 4X4ME 1UZ8B 3EDJA 4WV1A 3DVGB 1AR1C 3BKJH 2MJWA 4XP4H 3QIBD 5DK2B 4TSBL 1T21A 1D5ZB 4YDJB 3ZMRA 4AEHL 3JTSB 5IUSA 4P9ML 5IB1A 4ZNEA 4QRPE 5FKPB 4EVNA 4EZMA 1JTTA 3LZFL 4NC1E 1CD1B 3MCLL 3QPXH 4U0QB 5I1CH 3MODL 4PG9B 5HI5D 4FMFA 2ZG2A 3C6SA 3UTSA 3PL6D 4NN5C 4ZAKC 5F89A 2Z35B 3D69B 2PCPB 2NY2D 2PTVA 1Q0XL 4GUPB 1C5DB 1EK3A 2DQCH 1CFSA 4JG0H 1SVCP 3ARZA 4LHUG 4TNWK 5D71H 1OP3K 3PP3K 1JGUH 1A14L 1GOHA 2JK5B 3FB6A 4NO0B 1Q1JH 3LIZH 4G8GA 1LP9E 5EU5A 4HWEL 2VQ1B 5DQ9B 3AXLB 1TETH 4ZD3L 1TZHA 4GKSA 2IAMC 2WUBL 4ODWA 1ED3A 3CZFB 4K3JL 1RVFL 3V0VB 4JG1L 2P5WE 1S7SB 2YBRB 1FH5L 1FO0A 4F8TA 1HKFA 4X7TB 4LDOB 1DQLH 1SJEB 3Q1SH 4OF6A 4CMMB 1UM5L 3TV3L 1T7XA 4WHDA 3KXFB 2AI0L 2R9HC 3F5WA 5D72H 1VADB 3E6FB 4PJGB 4GJTB 5IFAL 1BLNA 3S4SG 5B21A 3L9RB 2FIKA 3JV4A 3BGFC 2H1PH 1J1XL 1NFDF 2RIKA 3ARFA 4JRXD 4WI5A 5F7LB 5TH2A 4A6YL 3ARQA 1II4E 4M7KH 4FQCH 1XIWB 3MRFB 5I8OH 5BO1L 2BNRD 4WCYH 4KQ4L 5GPRA 6CGTA 1I8MB 4OLYL 2PF6A 2GTZA 4NYLA 3OKLA 8FABB 1MFCH 3OJMB 3QO1A 2DN7A 3GBNH 1A9EB 4JO1L 1BAFH 1NCDH 3T3MF 4PJCA 3OKMA 1EO8L 3AS1A 3QDJA 4APQC 1YMHB 4CAGA 1AGEB 1SEBA 3TGXA 5KS9B 2EDJA 3MV11 1KJMB 4KJYA 2AJVH 3KPRB 4ODSL 3GNML 3O4LE 4IDJL 3IRZA 1J10A 1QOKA 1FZMB 3MLZL 5CEZE 1E4XI 5C86A 5ACZB 2CUIA 1GAFH 4Z18A 4ZPTB 1A0QL 1U3HC 2R0KL 2WWMC 4PFEA 1MF2H 2D03L 1BX2A 4LCUB 4UDUA 3HC4L 5L6YL 2I24N 1X5GA 3IDJB 1YN6B 3T2QA 3QIUD 2DYPB 4R90H 1G0DA 5BZWB 5LXGH 3T4YA 5LWYH 4MVBC 3EOAA 4L9LC 4G7YH 3ELAT 1G6RB 4UIMA 3AMKA 1KBGL 3TCLA 3VXRB 4F9PA 3TT3L 1U6AH 4L9DA 4LDEB 2R1XA 2IG2L 1M7DB 2XN9B 3ZTNH 3CU1A 5GS1A 1MRCH 2VSCA 1L4IA 3PIQA 4YO0B 3QRGL 2XT1B 4WY7H 4X0KB 4M5YH 1XR9B 2BERA 2EDLA 5CJQL 5HGBB 1QD0A 4R2GC 3MA7A 2NY4D 3UZEA 4ERSH 1VKXB 4YXLL 1DSFL 1I4FA 1KGCE 2O5YH 2V7HA 3JV6A 4RAVA 1IAKA 3VRJB 3OAUL 2HTKC 5C9JB 1ZVSA 1F3JA 4Z78B 1RFDH 2OJZH 4WI7A 5DC4B 2HVKA 4NQEB 4RGNC 3P0VL 2APVA 3HI5L 3RDTD 2ORBH 1A4KA 1IGTA 2A77L 3QCVL 3BI9X 5CZXD 5D2LA 4MHHI 4XPBH 1NFDB 2XZCL 4P9HC 4YDIH 1NBVH 3BN3B 4XMKL 1PSKL 2X4QB 4NRZB 5HHQB 2OM5A 4FXKA 1JNNL 2J6EH 4HAGA 1UM6H 4YHZL 3DHMA 3PHOA 4WEBH 4DK3A 5JLZA 3QQ3A 3RI5K 4KXZH 2A2QT 2VLME 3OGOE 2HFFA 5I1LB 5D7IF 3RWGA 1BZ7A 2A0LD 4G6JL 2VDRL 3MV7A 3VH8B 1UB6B 2JCCE 5HHOE 1BHGA 4FQHB 2J8UA 4LK4A 1G7JA 2GY5A 3BP4A 4KFZC 4OCXH 3QEQA 2KBGA 4GRLA 2HLAA 1ES0B 1GRWA 4M93C 1U8OA 3IFNH 1ZLWH 1IC4L 4U6VL 2C1OB 2NLJA 1MCQA 2XACC 4X9FA 3TBSB 1CLCA 3RWHB 5DRNA 3MRNB 1DUYA 1GGTA 3DO7A 2YN3A 1WBZA 3IJSA 4NQCB 1F2QA 4OV5A 12E8H 4TSAH 4I0PB 4PGBB 1CZ8H 2CJUH 3H7BA 3HMXH 4Z7WF 2VDPH 3LRSA 1FDLL 5F9WC 2DLIA 5I17B 1BZ9A 1QBLL 3AVEA 2IAMB 2VH5H 3IAGC 2AS5M 4M1DH 5I73C 3JV5A 1PG7L 4X4XB 5C0JB 5IW6A 2PYEE 3ARDB 3SE4A 3SGKA 4GAYA 4XP1H 3C8KB 3DROA 3D3VA 2C26A 2HP4A 4MMZC 1KJ2H 3W0WB 2PW2A 3JVGA 2P4AB 3UBXA 5C1MB 1IQWH 2H2PD 3E0GA 1QQDB 3GSXB 4LPWA 4O2FA 3I3EA 1T2QH 4XP6H 4JFQA 3MV8D 5FKAB 3WNKA 2YPVH 3BGFB 5CIPA 4H1LG 3QXVA 1IEAB 1FC1A 2A74B 2J8OA 2VDLH 2KQNA 4HX1B 3NZHL 4FG6D 3WBDA 5C0AB 4TSBH 3EGSB 3RUGE 4Q2ZB 4AEHH 3IDIA 4XC1L 1PKQB 1NANI 1NEZA 4WHTA 3LQZB 2YOCA 2DWEB 4PJ8D 4CJ1A 1HH6A 1NGZB 3LZFH 5I8EB 5L8JB 3A67L 3MODH 2HT4C 3RY5A 3NN8B 2IQ9L 4N9GA 3WIFA 4APQB 5E8PB 1PVHA 2O93L 1Q0XH 5D7IB 1ZT4B 3BUYB 5E08H 2BVQB 4CDHA 2C3VB 1KENH 1WWBX 1A14H 3PWUA 1U8LA 5C0BB 5IMKA 4F33B 5KSAA 1D5XA 1FFRA 5E1AA 3BGMB 4HWEH 1RU9L 2Y36L 4TVSa 1S7QB 3KPLA 4MSWA 1YY8A 4JFXB 2WUBH 5BS0E 1J8HB 4K3JH 1RVFH 3MNVA 4L9LB 4JRWA 3UTPD 4GW5A 3DVGA 4J1UB 1FH5H 2AEWA 3K0WA 5C0GB 5L8LB 3D9AL 4Z7WB 1IAIL 4L4TB 3AREC 1UM5H 1D5ZA 3TV3H 5D7JC 5JDSB 2AI0H 4LRNL 3V5DA 2VRAA 4YPJA 3MTRA 2E27L 1EX0A 3MJ9A 5IFAH 2H8PB 4RX4D 4XCCL 4EKXA 1J0IA 4TTGA 5IHZB 2DF3A 3SGDI 4PG9A 3MUY1 2GJJA 4R2GB 1H8OA 1J5OH 1J1XH 3OGCB 2Z35A 4A6YH 2XOTA 2ENYA 2P8MA 2WWKO 2Y6SC 4GUPA 5C0RL 3UC0L 3OX8B 5IF0B 2FLRT 5BO1H 4LLVB 2HFEB 2GFBB 4OLYH 4RGNB 4Y5YC 2QR0A 2JK5A 4JO1H 2L4OA 4LSVL 4KUZL 4DFHA 3HPLB 4L8SC 3HAEB 3QIWD 1EO8H 2AKRA 4FFVC 1EA9C 1FGVL 2WP3T 4X5XB 5IMOA 3GNMH 3V0VA 4IDJH 3MLZH 2IBGA 3CK0L 4EIGB 4X7TA 4CMMA 3W5NA 5I15L 1A0QH 2R0KH 3BESR 3VI3F 3WUZA 3SDXB 2D03H 4JZJC 1BQHA 3BPNC 3HC4H 4X6FB 4J3XA 3U6RB 2PNDA 5L6YH 2FEEI 1NJ9B 3BH8A 1RZ8B 2LABA 3D0VB 4M93B 3L9RA 2HG5B 3GJEA 3CX5K 1AKJD 2YZ8A 1KBGH 1P6AB 5BW7A 1AO7B 1XIWA 3ARWA 3K8MA 4M3KB 4HSQA 3B2UC 1YEEL 3E8UL 1KJVB 1C16B 5F9WB 3TPKA 5ID0A 8FABA 4ODTL 5D1QC 4P57B 1WCQA 5JOFB 1A9EA 1MVUB 1Z3GL 3RVXC 3VGHA 3QRGH 3VD7A 5MEOB 4HBCL 2F53B 5CJQH 4Y16C 5D1XC 4QRRE 5I73B 3O6LL 1RZFL 1U2CA 4YXLH 1IGJB 1DSFH 3V6OC 5AAMA 5KS9A 1MCOL 3EO9L 1I7UA 5KVGL 3RL2B 1KJMA 4D9QE 3KPRA 1RUML 1OP3H 1RK1A 4JN2B 5ERWA 1FZMA 3P0VH 5ACZA 4XNUL 2HT3C 5DR5H 3HI5H 1N59A 4NCC1 2Y72A 2A77H 3OJVC 3QCVH 4LARL 4ZPTA 3F7QA 4LCUA 2XZCH 2ICWA 4NM8L 1NCAH 3HE7C 2DYPA 4XMKH 3PXHA 4WFEE 1PSKH 1JNNH 5BZWA 1ZK9A 5TDOA 4YHZH 1QSFB 1KG0A 1FFOA 4N1EA 4FQJL 3KDMB 4IOIB 4W70A 4Z7NE 1EMTL 1UH2A 1I9IL 5CJOL 5DURD 1KPVA 1SBSL 1PEWA 2XN9A 4G6JH 1YC8A 2VDRH 3NCYP 2NY3D 4XP9L 2EKSA 4HK0B 1BEYL 1WF5A 4Y8AA 5FUCE 4YO0A 3TZVB 5MHSE 3T04D 1ULVA 1PZUB 1FO0L 3L3IB 1IC4H 4U6VH 3KAAA 5HGBA 4F58L 1VKXA 4UU9A 5DZNA 2QHLA 5AD0A 2Q87A 2DMKA 4WUUA 2D31A 2YPLB 1QSVA 5T3XL 3FOLB 1G9NL 4NQEA 4Q58C 4PB0L 3E3QE 3QWRD 3VRLF 1FDLH 5GGSY 4PRIE 4OZFH 2DJSA 3P9LA 2PO6C 1OSPL 4ZSOB 4HDIA 1K6QL 3WN5A 1QBLH 3HG1D 1IL1A 2NY5L 1UZ6E 5ID1B 1F90L 1PG7H 1KCVH 4NRZA 3VFGL 5HHQA 4K8RL 3HUJF 2F54E 2JB5L 2HAZA 2CXGA 1CDGA 5D7JB 4PRHB 4HKZA 2OTUA 3B2VL 3WLWD 3MGOB 3RTQB 2FJGA 1FBIL 3VH8A 1WJ3A 1WAAA 2GCYB 4OGZA 1ZE3C 5KJRH 5LG1A 4LASL 3X3GL 4B0MM 1CDUA 5HVHC 5EZIL 2D4FA 4ISVB 3U9PL 4FQPA 2YRLA 2X40A 4MJ4A 2C1OA 3TBSA 4Y1AD 2V2WA 4HJ0D 1UKTA 2DIAA 4JJ5B 4BUGA 3DV4B 1ZV5A 1NCNA 5BVJB 4XC1H 2EO1A 4KY1L 5IG7B 4I0PA 1X7QA 5JW4R 4LGPB 3A67H 1NKRA 4EUPB 4F3FA 2P5EB 4PS4L 5I17A 1G9ML 4L8SB 2IQ9H 2CKBB 4NZRL 1KB5A 5E2VL 4UQ3A 1D9KD 3ARDA 4KDTC 5FECB 5J4MA 3S5LG 1AGFB 3C8KA 1HH9B 1ZTXL 1A8JH 3W0WA 4JZJB 1AC0A 3GSXA 4G9FD 1QQDA 1E6JL 1CGTA 4UUJB 4OUUB 3T0WA 3RGVC 2ATKB 3DOSA 3UTTB 3NCCB 1RU9H 2Y36H 4LGRB 4RMVA 4NOFA 5FKAA 4LSTL 3O2DA 3EIFA 5DS8B 2XKNB 1O5DT 5F1OB 1IEAA 2DTML 3HB3C 2A74A 4F7MA 4E41D 3MLSL 5C0AA 3CMOL 3FRUA 4DJMA 3D9AH 1IAIH 3KHQA 3MV9D 3EGSA 2BVPB 4Q2ZA 4KKAC 3C6LA 4LRNH 3Q6FA 3K1KC 4CVXA 3LQZA 2E27H 2FJHB 5D1QB 4XCCH 5I8EA 5SWZA 5BRZA 4XXCC 5KVMC 5EDXA 4G6FB 4S1DC 1NAKL 4PJ5E 4Y16B 5D1XB 3RKDD 1FYTB 3QQ9D 3SHSA 1BF8A 4R0LA 1I1YB 3O0RL 5E8PA 3L3DA 2KL6A 4TVPL 4WUKL 5C0RH 2AERT 3UC0H 4PJDE 1ZT4A 4C55A 2C3VA 4GAJL 5C0BA 5DD0L 3ECBA 4NJAL 3WDIA 2YD4A 3REWB 1NEUA 2XV6B 3BGMA 3MJ8A 3ZKSD 3HE7B 4LSVH 2Y5TB 5JOPE 1HSAB 4JFXA 2ZSVB 3LY6A 2ESVB 3O11B 4L9LA 3HR5A 4DUVA 3IETB 2QBWA 1CFNA 3DMMC 4YXKL 1JHTA 1A22B 4G6AD 5C0GA 3CK0H 2GJZB 1HHKB 3X3FH 5IP4A 3U0WH 4HKBB 4GKNB 1G7MA 4QGTA 3LRHA 4Y5XC 1IEHA 2G75B 3T0ED 4PRAB 5IHZA 1WT5C 4JKPL 3TPUB 4PBVC 2VABB 3OGCA 2EC8A 3QB7C 1EDQA 2NY1D 3VFOA 4POUB 2LQRA 4YBLC 5D6CB 1FSKC 1I7TB 3OX8A 3IAQA 2WNGA 1NC4D 2HFEA 4HUUB 1UFUA 3E8UH 1LK3L 4X7CC 1SJVA 2CDGB 2FO1A 3CVHA 4GLRI 3AM8C 3GMMB 2PO6B 4ODTH 2ZCHH 5GGVL 5FO8A 1Z3GH 3RVVD 2ADGA 2J4WL 5EUOF 4MNGA 1DDHB 3O6LH 1RZFH 4X99B 3PNWB 3HAEA 3SN6N 2GTWB 3PF2A 1U8NB 1MJ7L 3EO9H 5KVGH 5JXAL 1RUMH 2XNAA 3DURA 3NIDF 2DQTL 1SQ2N 2DL9A 5C07B 3UPAA 3ESVF 4XNUH 4PJCF 4KGJA 3MFFB 1IJ9A 5T1KB 4LARH 1JWSA 3BD5A 3NCFB 3M17B 3SDXA 5LAXA 5DA0B 3U6RA 2OK0L 4JQXC 4NM8H 5J9PA 1RZ8A 2BRRL 5HVHB 3D0VA 3HNTL 1KEML 2X4RA 5GGRB 3X13B 5J11B 3RY4A 1ZEAL 1B4JL 2BZDA 1S9VB 4FQJH 5DVKA 5I71B 1BFVL 2EE9A 3RAJH 4OZIE 1AO7A 1I9IH 5CJOH 1SBSH 1X44A 3TYGL 3HLAA 4Z7OF 3LKOB 3D0LA 4XP9H 3Q3GB 2XFXB 1QEWA 1S7UA 4YE4L 3NVQA 4BUHA 1RQ5A 2YA1A 4P57A 5JOFA 5MEOA 3PJSB 5D93C 2YC1B 1FO0H 2FL5B 2F53A 1KSRA 4KV5F 1F00I 1C12A 3VFPA 1S5HA 4F58H 1IGJA 4QRPD 2D9QB 3D5OF 3KR3L 3RL2A 1MAML 3MJ9L 3WDHA 3UJTL 4AL8L 5T3XH 1G9NH 5D8JH 4Z77B 3VXTB 5GRYA 1MNUH 3B9VA 3CH1B 4R4NC 5F7EL 1OSPH 1BQUA 2ZCLL 2ZKHL 1K6QH 1HXMB 4HIIB 2NY5H 3QXDB 3MOBL 5ISZE 1F90H 1F6AB 4YAQB 3RKPA 4PJ9B 1N8ZA 3VFGH 4P5TC 2EDYA 4K8RH 4OGAC 4ONFL 1QSFA 2AQ1A 2JB5H 1QRNB 4H0IA 5I8CA 5L7XL 5DGQA 2B0SL 1NCCL 2MNUA 3DO3A 3H42L 3VFWB 5C2UB 5FXCH 5EOQH 1F02I 1S8DB 2ARJQ 4B7IA 5EUOB 1FBIH 1GC1L 1XZ0A 5HDBE 3HE6D 4HK0A 2P5WD 4LASH 1CN4A 3I02B 3TZVA 1P4LA 2XY1A 1EEYB 4MAUL 4M7ZC 5EZIH 3BHBA 1T1XA 1BFTA 3U9PH 3L3IA 1BBDL 3BEWB 5ESVA 2P24B 4NQDB 3PV6B 1M4KA 1R3JB 1ONQA 4KY1H 3SE9L 1E4WL 1P7QA 2YPLA 4LU5L 4U6XB 2A9NL 3FOLA 2EXWC 1OLZA 4OIAA 5J1AB 4PS4H 1G9MH 2CIKB 3DETC 3WFHB 5E56A 4DKFL 3PGDA 4NZRH 4C59B 5E2VH 3MREB 1N3NB 5T1MB 3DMMB 4IS6A 1CICC 4Z76A 3ARXA 3CPLA 1JZ8A 5C7XL 2V2XA 3IDMB 1ZTXH 4WW2C 3UZQA 1K2DA 5I30L 1U8IB 1RZKL 4ZNEE 4LFHG 1E6JH 4KRPD 2YRZA 3U30C 4JANB 3RTQA 4CDGC 3ZYOA 4Y5XB 3KLHC 3UTSE 4LSTH 1I3GL 5CEZD 3L3HB 2F5AL