3U9UA

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
219
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGIGVGWIRQPSGKGLEWLAHIWWNDNKYYNIALRSRLTISKDTSNNQVFLKIASVDTADTATYYCARIPDDHYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 43
structure length 219
sequence length 224
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uA01
4R97B 1N8ZB 2FR4B 3K7UA 4Q6IB 3KYNA 3RVVD 3D69A 4HJJL 4P9HC 4LCIH 5F89B 4HHAA 4FFZH 4OM0L 3B6SB 3QI9B 1QSFE 4WU7B 4HPOH 1LD9A 3BAEL 2XTLA 3EOBA 3DUHA 4JQIH 1GAFH 1K4DA 4LSDA 4JDZB 1BBJA 1HILA 3PIQA 3KPRA 1U42A 4DOHB 4MS8D 4K3EL 3H2WA 1BJ1H 4PREB 1PYWA 3EJYD 4TSBL 2FEEI 5DJYB 1WBXA 5I17A 4NQCD 4OUUB 1I9RL 2VABB 1AGDA 3NCMA 3SCMC 2GAZB 4OF6A 1XCTB 4U4BA 1DVFC 3UZEA 1DTUA 4J4PA 4GS7B 2ERJB 1RY7B 4MJ2A 3IETB 5IB3A 5EO1B 1IC4H 5FYKH 4MA1B 4HUXA 2R1WA 3TO4B 3U6RB 3HFML 3VXUE 4EOWH 3BKJL 3RA7H 2AEQL 3OR6B 4MS8C 3OKEA 4ZS6D 1K2DB 4DUWA 2YC1B 5HGBB 3H0TA 3VDAA 1W2KT 4RAVA 4ZFFA 5JW4Q 4ZFOB 2R23B 1FE8L 1HH6A 1XF4A 3OQ3B 4U1SA 3L3HA 4F7MB 3FOMB 2DQUL 1NCWL 5IP4A 3ZKQD 1PGRB 1ZGLA 1ULVA 2QSCL 1T03L 3VFWB 2RFXA 4AK1A 2YD3A 5HVHC 2FWOB 3P40A 3MLTA 1SJHB 4OBRA 4OFKA 4GG6E 5BO1H 1MI5A 4LHQB 1RUKL 4AEIL 5IHLB 3HE6D 4YHIA 3EYVA 4JFOA 4WGWB 4RNRB 1LK2A 4QT5B 2NYYD 1VSCA 3D9AL 4OCMC 1UCBH 4ZS6C 1JHKH 4YHZL 3ARBD 2X4TA 5IVXB 1U0QA 2AJUH 5I8CB 3OKKA 3ARTA 4XT1C 5T1KB 2BOBA 5CEYA 1VEPA 2IH1A 3MLZL 3V0AC 2F54B 2IANB 1I1RA 1FZOB 1JWSA 1Z5LA 3BZEB 3VFOB 3IKCA 2P46B 5ETUB 2EXYD 3U9PL 4OI8A 4R96A 4PG9A 2ICCA 1I7ZB 2X44D 2A74B 4KK5D 3W39A 2ADIA 1EERB 2BSED 5T1LD 1MFBH 2EDOA 4X6FB 5HYSB 2B0SH 3ARDA 4P4KD 3HE6C 4UV7H 4ZFOL 4XAWL 1QA9B 5GRJL 5JLZA 4PJFA 3KR3L 4JVUA 1TJIL 4NUGL 4N1HB 3ARBC 3FB6A 1JNHB 4NO0A 3CSYA 3INUH 5DHVB 2FB4L 3KPRE 4FP8L 2J4WL 4LLVB 4TVPH 3CFIC 4G42B 3HMXL 1XEDA 3PQYE 1AHWB 4X5LA 5MERA 2VR5A 4PJIB 3TNNB 3F62A 2EXYC 4LSRL 2VLJB 4CGTA 3WSQH 2V5MA 3MXWL 1LDSA 4PJXA 4UILH 4KK5C 4KAQH 5T3XH 2Y7QB 2AEIT 2VDKL 2Y5TB 1FNFA 4KWUA 4PUBL 3TBYA 5FFLA 3VDBA 2CSPA 2EDBA 2W0FA 1IAKB 5I1JH 1MJUH 3GSQB 4PGBA 2PF6A 1FJ1B 1MIML 4P5TA 1FIGH 1KPVB 1V3LA 2LQRA 3UTSE 3GBML 3TEUA 4QGYA 1A1MB 2CK0L 4LPCA 1KG0B 4U1LA 5L88H 4NRYA 2XWJA 4P2RB 1TENA 4MXVF 2OTUB 1G7IA 1J88A 3GJEA 5SWQB 4L8BB 4QRRB 5HDQH 1RURH 2W0LA 1AQKH 2BDNL 3O3DA 1G0YR 1JV5B 4OI9A 1AP2A 4M43L 5HHPA 3MV8D 2YUVA 3F6LA 4R0LC 3TYGL 1EFQA 2DL2A 1NAKH 2GUOA 3QFJD 3QXUA 3G5ZB 5EU7E 4OQ1A 4JFZH 5AZEH 3KYMA 3MREA 4OZGB 3NA9H 4U1MA 2FEDD 4NWTH 4Z7NE 2X42A 2P8LA 3GB7A 5E1AB 3DX9B 2F58L 3A67H 2BY3A 1JI2A 3ARGB 4DKEL 5C0BD 2OYPA 1T1YA 3CDCA 4GKSA 43CAB 4HDIB 1A7PL 1WUNT 1XAUA 5JR1L 3ZE2F 2I9TB 2XWBB 3D25B 4HXBH 5SX4H 5B39B 4D0BB 1NGXA 3QBTB 1RPQA 2ADFH 3DYMA 4EN3B 1YEHL 4XPAL 1UZ6F 2CLVB 2MQCA 2FLBT 3EGSA 4PJBF 1CL7L 4RDQG 3RWJA 1I7TB 3WFCL 5FDYA 1IM3B 3KYAA 3EYUH 4PGEA 2NY3B 1F3RB 1F2XK 3L3OB 4ZUSB 5JMOC 3RWEB 3BSZL 4WW2C 5GS1B 2YPLA 2Q3ZA 1EEUA 2O5XH 5IF0B 5K9JL 4ZD3H 5EUKA 1IGFL 3H9YA 5DRXA 1Q9KA 2ZUVA 3ARED 3BQUD 4F58H 3HRZA 3VD5A 3MLRH 4RGNE 2A77H 4X6DB 3O4OB 3DXAB 4XPFH 5D2LB 2H9GA 5F8QC 1JZ4A 3KPSE 1YECH 3VWJA 1MAKA 1U8IA 1RK1B 3WO4B 1I8KA 1X5YA 2QHRH 2PCPA 2P48B 3VCLA 3LKOB 5J4MA 4UV4H 2CUHA 1IGJA 1N64H 1WFUA 3G6DL 1H3XA 5MENE 2D4DA 1TCMA 3D2UD 1A7OL 4Y4KD 3U7YH 2XYCA 1JGDA 4PTUB 5IEKA 4OM1L 3OWEA 3NABH 3PP4L 2W9EL 2CD0A 5IKCB 2IAMA 5FO9B 2FJGA 3AB0C 4F33A 4Q9RH 3SE3A 5TFSL 3AREC 1TZGH 4KTYA 3BQUC 1RJYA 1IKNA 5BXFB 1OW0C 2VH5H 3K4DA 3C5ZC 2PTTB 4FXLA 5EU3A 1R3IH 1BLNA 2QADD 3UBXG 2W07A 5JOPE 4K7FA 4JANA 3BYTA 3VXTB 5FCUL 1LO2L 1C5BH 4LPUA 3ARWA 1CTOA 1EK3A 3MCKB 1KTLB 4XH2A 4AL8L 5IIEB 4F57H 1HQRB 4Y4KC 1DUYB 1ZTXL 2H2PD 3BVNB 5DVOA 4CVXA 4IS6B 1I7UA 2OK0L 1NMAH 4OFYA 2XZCH 4R4BA 1KENL 2F19H 3OAYK 3QHFH 5DJ6A 1S7TB 4OB5H 4ORGA 2J6EH 4Z7VE 1JNLL 1RI8A 4QTIH 5ERWB 5ITBL 1FL5B 1UJ3B 1ODAA 1N5AA 3BEVB 4X9HA 1EGJA 4OIBA 1OOAA 5SWSB 5C08D 3MROB 3TYFA 2BVPA 2QADC 3SKMB 4OD1L 3TPUA 4XNMA 1AH1A 2L0DA 1SEQL 1P6FA 3MO1A 4KHTH 1UEMA 4X99A 4JHZA 3DETD 3P9MA 2ZUTA 4Y16B 3UTTE 2H2PC 1FNHA 4KY1L 1DEDA 3BH9A 3T65A 2FDBP 4X0KB 2YD7A 4L8SA 1KCSL 1I3GL 4Y5XB 4JB9L 3RL1A 4GAJH 2CDEB 4MVBD 1NEUA 3WV0A 4RMTA 3DIFB 4ELMA 2MFNA 4F9PC 5DMIL 4GW1A 4TSCH 3MV9B 1CU4L 2YR3A 5C6TH 2E6PA 1S5IL 3BT2H 4JAMA 2JKXA 5JW4N 5ALBL 2X4UA 3TV3L 4MXQD 4O5LH 1VERA 2B1AL 4MNGE 2X4PB 4Q0XL 1CGXA 3NN8B 2LU7A 2QHLA 4LLMA 3S5LB 1H15A 1KCKA 3S88L 4ZUVA 4JG0H 1BGXL 3ETBF 4YPGA 1Q8MA 4GRWH 2EE3A 1YEFH 3DETC 5HHQB 4DFIA 1J05B 3GSXA 4IOIB 4ZFGL 4RISH 3NMEA 4BZ1H 2J8HA 4JR9H 4RMUA 1B0RB 3RJDA 4P46B 4WJ5A 3V52L 3QJHA 1FFNB 1C7SA 2E27L 1JZ2A 2PETA 2WWKO 4XCNA 4Y8AA 4PLKD 5I1IH 3GMOA 4R90H 1WCBA 4Z0XB 1Q9LA 1FV1A 3RWFA 1M4KA 4JRYD 4MXQC 3T77B 2OSLB 3I75A 4X9BA 4NPYA 5DTFB 3TZVD 3B9DA 4JZJB 1CXEA 2CDGB 4LAQL 1ZHLA 1JE6A 2N7BA 1HKLL 1OM3L 3OZ9L 4L4VE 3IDJB 4YFLI 5D5MF 3NIDE 2IJ0C 3FQRA 4C83B 3BJ91 3VXSA 5C7XH 4KKCD 1J11A 3I02B 5DVNA 1EUUA 2L7UA 3VXRA 3V95A 1G9MH 5IOPA 1X5HA 1JPGA 3BYYA 1JGLH 2EDDA 2CKBB 3GSNH 4S0SD 4YDKH 4HS3A 2XFXB 4JM4L 3V5HB 5I30L 1A1OA 2B2XH 3P73B 3T8XA 2V5RA 1MOEA 2MQ3A 5LG1A 1WCQA 4PLKC 5HDBF 2DIJA 3MLXH 4HIIB 2HT3C 3IXTA 4ODSH 4PJHA 4UINL 3UX9B 5E8EB 2N56A 1DCLA 1SEBB 5FO8B 1MLCB 4K9EC 3QRFM 4XP5H 3FT3B 2HJFA 4DCQB 1OGAA 5TQ0H 5GS3A 1U3HA 4HEME 4F9LC 5FYJL 5B3JE 2A83A 4XHQA 3UO1L 1UH2A 4OV5B 3OJDB 1QKZL 1ADQH 3DVNA 5D2NC 1J0IA 3L3GB 5F7DB 1BOGA 1WZKA 3MNVB 4Z7WB 4ZQKB 3WN5A 2HMID 4Y5YB 4WI4A 5DXWA 3I6GA 1CLCA 1GGIL 2XA8L 4YXKL 4Y4FA 1RZ8B 1S9WB 3SO5A 4Y4HC 1A6VH 3AROA 3PG2A 2EH8L 3WDJA 2IBZY 1HHHB 2ITCA 3OAYH 4U1KB 1D6VH 5CD3A 2CRMA 1QFWI 4TULH 2D0HA 4LSPL 4X80H 1GOFA 4Z7UE 2CKBL 2A6IA 1IQDA 4NRZB 4ZXBA 3F7VB 1A6ZB 5KSUB 1E4XI 2X2YA 1TCRA 1F58H 2XT1B 2UVFA 4OUOA 3IAGC 1S7UB 4EQ3A 4XNYH 3EKCA 1HIMH 4ISVB 3CFCL 2BNQD 3CVIH 1IBGL 1YPZB 2HMIC 2VLKD 1EBPA 4IRZH 2BCKA 4JZOB 2GFBB 4ZSOA 4P23A 3S35X 3UJJL 2F5AL 2EH7L 1BWMA 3OHXB 4I2XE 2ESVE 2VQ1B 5CBEB 3F7YA 2YWZA 4FZEH 4JREB 2Q7YA 1QSEB 2NPLX 2VKXA 1YMMB 4M61A 1FNEA 3V8OA 4WW2F 2YD5A 3PDOB 4OQTL 3IVKB 5EUOB 1T1WB 5SV4A 1LVEA 2YEZA 4EIZC 3WFHB 2CDFA 4I4WB 1GOGA 4OCRH 4LGPB 4LLYA 4ZS7L 4YHML 5JIIA 1DR9A 3CVHH 1NFDF 3VD7A 1PX4A 4JFXB 4RFOH 5CBAB 5DJXA 1A7QL 5J9PB 2V2TA 3RNKB 3UYPA 4OZHF 2PXYB 4DGIL 1CS6A 2HJKB 3WHE0 4GMSH 2HTKD 5B8CA 5CJXC 5JZ7D 1V7MH 5IMLA 3GI9L 3CC5B 3BMVA 2KQNA 1AIFA 1PG7H 3MRGB 5IQ9A 4R9HA 3WNLA 4YFLF 2ZWLT 3QQ4B 1B0GB 3GSUB 5D70H 4FFYL 5LKNA 4G80B 4HZLA 1TZHA 1BREA 5E56A 1BD2A 2VTFA 4WWKB 2RBLA 2P5ED 4N0YL 2NY4D 2DTSA 2J2ZA 3ZKSD 1EHNA 4PJ9B 5D1ZD 5HHOE 3CU7A 4LCIL 1C16A 4M00A 3L3IB 5I16A 2HTKC 5JZ7C 4HX1A 3GHEL 1FORH 2NY2C 4JHWH 5IMKA 5ISZE 2AXJA 4X6CA 1G6RA 3PHQB 4YE4H 1GAFL 1GC1C 1U8MB 4BFEA 4JVPA 3C5SB 5IVZB 1QSFD 1NBYA 1SHMA 2ITDB 3VFVB 4JFEE 3PWPE 3BP4A 5ICYB 1NANI 4NC0B 2H3NB 3V79C 3WLBB 3MLPA 4JE4B 1XF3B 5AYUL 1N59B 5J6HB 3GIVB 4BSVA 1H5BB 2NY4C 4PJAE 4OLUH 4PJ7A 1F90H 1XR8B 4BK5A 4Z7QE 1MY5A 2B7DT 3FFCB 4IJ3B 4LLUA 5FYKL 4N9OB 3F7PC 3IFOB 5HHNB 5CLTA 1TVDA 3BI9X 4DVBB 2EIEA 1KYOK 5DRZB 5GZOD 2QKIB 3U46A 5CCKL 4EOWL 2YBRA 3PJSA 1IGYA 1IVLA 2GTWA 3BESR 3NCYP 2XRAH 3VXUD 1TETH 2ED8A 2J8UF 1T04A 4RQQA 1QFWH 4PTTA 3QUZA 2IMNA 2MJWA 3VG0H 1W8OA 3AM8C 1NDGB 3KXFE 5D7JA 4HK3J 1E4XH 3K8KA 1QLFB 3K3QA 2C3VA 1H3PH 1J0KA 2HP4A 1BEYH 4E41E 4GSDL 4RIRB 3SQBA 5F7EL 1F02I 2I07A 3ES6B 4X4YA 5KSVA 1W0WB 1YZZA 5ANMB 1URLA 1T66D 2R56L 1W72H 2FH6A 2DWEA 5EPMB 3IJSA 3IU4H 1I9EA 1RHHA 2LVEA 1K6QH 3QFDA 2WQ8A 3BP6A 3AY4C 2Y5EA 3BO8B 3EYOB 3TN0B 4ZPVA 1X5KA 4XP4L 1W0VA 5CIPB 1UCBL 4X6EA 2J12B 3EOAA 2H26B 4MQ7A 2F53E 5KSBE 2BXYA 3W9EA 5J11B 4UOW0 4HV8B 1RIHH 2WLZA 4PRPB 4P59H 4GKNA 4FXKA 4LLQA 2FH8A 4LMQE 2UWEB 4OTXH 5DD0H 3BDYH 1MCPH 1XGUA 2ICES 5F9JB 1K3IA 3LIZH 5JIKA 4FQXA 1T66C 4JRXA 4Y7MA 1MELA 3SPVA 1I75A 1MFBL 3TBWB 2ILLA 1MH5B 2QBWA 5KVGH 1KACB 3V4UL 4UV7L 3T0EE 4G6FB 3CPLA 5BRZE 2CIKB 5FCSH 4BUHA 4PJ5A 2XN9B 3E1F1 3TBSA 4X6CE 5J12B 3N9GL 1I8IA 3P4LA 1MFAH 1JIBA 2CJUH 2OZ4L 3VI3E 6FABH 1Z9OA 1MAMH 4U05A 1LMKA 2BNRE 4O58L 3MBXL 4E42A 1JPTH 1BQSA 2FRGP 3KPRD 5ITFA 1AGCB 3WSQL 2HKFH 3WUZA 5KW9H 4UTAH 3PQYD 3BISA 3KPPB 3MRRA 4JFDE 1FZKA 5T3XL 5C0AB 3NVQA 3RY6A 1N3NA 2AK4E 5I1JL 1MJUL 15C8H 4U7SA 2DTMH 3O3BB 5HYJA 2X1OA 5ICZB 4NOBA 1FIGL 1Q1JH 2C3WA 3BGFC 3TP4A 4PRDB 4J4PD 5ILTH 5GGRA 3VD3A 3PL6A 1PKQA 4CU8A 4CADB 4O51B 2NXZD 4M8VA 5FF6B 1NBQA 3UTSD 4QRUB 4X7DC 1ND0A 3BD3A 3HS0A 4UQ2B 5HDQL 1RURL 4XVSH 4HLZH 3FCTA 1I9JL 4EIGB 3VFGL 2DRUA 2Z93B 1DEEA 2GJJA 2X4NB 4GBXD 5DI8B 2XWTA 1EJOH 1H0DB 1T5XB 3TVMB 3MOBL 1CE6A 1NAKL 4HWEH 1SBSH 2OR9H 4IOFD 3MLUH 1LO0H 5C0CE 2ZUWA 3MGOA 3ZYIA 2A0LD 4ENED 5AZEL 3HAEH 4ZOBA 2X5PA 1F4WH 4NWTL 4H1LH 4FTVA 4PRIA 4JVWA 4J4PC 3W9DB 3MX0A 3SDAB 3A67L 3ALWA 1CE1H 2NXZC 25C8H 2NLJB 5FYLH 5IMOB 5IEHA 2DWDA 4G7VH 3HCVB 5DQDH 4G8EA 3BGMA 3MA7A 5GSRB 4MQXD 2HVJA 5SV3A 1MI5D 2BC4A 3AMLA 3ULVH 1L7TH 5E5MA 5T3ZE 3F58H 5DSCA 3QDGB 4Z77B 5DK2A 3HUJE 4I9WE 1QUNA 2LTQC 1YC8A 4GBXC 1JF6A 5F88A 5I1LB 4NSKB 2Y07L 2FX8H 3HI5L 4UNTA 2A0LC 4ENEC 1J8HA 3DJ9A 2WUCH 3EYUL 1RQ5A 5TGBA 3DO7A 4XC3H 1NC2B 3O3AB 4NBZB 1XMWA 5L2KB 1Q94B 3UC0H 2MPAH 1FIEA 4I18B 4PJ8D 3O11B 4JJ5B 2C5DC 4L9LB 4QRTB 2GSIA 4MNQE 1B4JH 1QBMH 1G7JB 4GRLB 5EIVA 3HMWL 4F58L 3OSKA 4RBPK 3MLRL 3SKNA 1NC4D 4MQXC 4CDHA 2FR4A 1N8ZA 1EEZB 1XGTB 4OLEA 5EFIB 3R8BB 4Q6IA 3WNPA 3ZE1E 4Z76A 4U6HB 1HE7A 1SJEB 1I8LA 2VR9A 2YD6A 2QHRL 4RGND 4IM8A 1XCQB 2ZOKB 4UV4L 4CVWA 3QI9A 4WU7A 5BZWB 3MV11 3KPSD 1WBYB 4JZNB 4NO0D 4JDZA 2FO4B 3UTQB 4JG1L 3U7YL 4IMLB 1UH4A 3LAFA 4PJEE 3C8KB 3HZKB 4PREA 3NABL 4R2GD 1KV3A 1CG9B 5MEND 5DJYA 1EHAA 4H8WH 4PJ8C 5FKAB 2VABA 2CLRB 2MHAB 5KZCB 3O6FB 4O2CB 2GAZA 1YQVH 3RWCB 1XCTA 2X1WL 3K74B 5IFJB 2EE9A 3QUXD 4I77H 5CEZE 1MWAH 2VH5L 1R3IL 4TUJB 1NPUA 2BMKB 3B8YA 5C09A 4G8IB 5EO1A 1A3QA 4Y89A 1FFPB 2ZCKH 3PDGA 1C5BL 3QIUD 4FFVD 1AQDB 3T3ME 3U6RA 5JOPD 4M93B 4F57L 3ZHLA 3QEHB 5SWZE 1Z6JT 2FD6H 1A7BA 3OR6A 5DHYB 32C2A 2R2BA 3VGAB 3MJ7B 4HFWB 1AKJB 1NMAL 4R2GC 4PJGE 2VSDA 2WIMA 1K2DA 2XZCL 1BIIA 2YC1A 4NQVB 5HGBA 4WW1B 2F19L 3QHFL 3VWKA 4OB5L 2J6EL 1KCUH 4PLJC 4GRWB 4OZIF 4QTIL 4ZFOA 2R23A 3QUXC 4YZFF 3RI5K 4ODBD 2RR3A 3S3SA 3FOMA 1JYVA 5A2KH 5DR5H 4QO1A 3G6JA 3QIBB 3VFWA 1LQSR 4YDLB 2FWOA 4P5TC 2XZQL 3CD4A 2VLME 2OXHA 1SJHA 4S2SB 1D9KB 3HMXA 5EOCH 1N5YL 4W6WB 5B3NA 5I74C 2GCYB 3QIUC 4KHTL 5CGYD 4FFVC 2EYRB 5IESH 4L8DB 4RNRA 4QT5A 3V5KB 4ZNCD 1YEIH 2BJMH 4NC2B 1L7IH 3QDJB 4V1DB 5IVXA 5IW1A 3UTTD 4GAJL 2H1PL 1QBLL 1H3VA 3LEYL 3ZHKA 5T1KA 3WJJA 2OM5A 1S7WB 2F54A 2IANA 5IFAH 3BZEA 1YY9D 2X70B 3VFOA 4G6MH 5ETUA 5C6TL 4LVNC 4QY8A 4EDWH 3BT2L 2GY7B 1I7ZA 3GSNB 2ZUXA 5GS0D 1IQWH 1WAAE 2A74A 1DSFH 5FUOH 4NFBA 3PNWB 2VLLB 3Q6GH 5FM4A 1F5WA 2W1NA 1B2WH 4JG0L 3MMEB 4X6FA 5HYSA 1MRFH 2GK2A 3OG6B 4HF5L 2X4SA 5CGYC 1YEFL 3I9GH 1QA9A 1NDMB 2F74B 3QCTH 2OXGA 4RISL 1M7IB 5C8JB 4JR9L 4NHCL 4NNYB 5J57B 5C70A 1JNHA 1UWGL 3LEVH 3HC4L 4GLRH 5DHVA 1DLHA 1P7QD 5I8KL 4G42A 4FQCL 2HVKB 3QXWA 2ICWA 1AHWA 4PG2C 5E2TH 3TNNA 1UZ8B 1YY9C 4PJIA 2P44B 4R90L 3AS0A 4LVHC 2VLJA 1C12A 1ZVYA 4YDVA 4LHUB 1JN6B 4X83A 5T1DH 4GG6F 4KRPC 2YA0A 4FQHB 2Y7QA 2Y5TA 3GO1H 1T89C 1H8SA 4KC3B 4RBPH 1IAKA 1U92B 3BJLA 3GSQA 3G9AB 4LNRB 2LABA 5LCVH 4Q2ZB 4C56E 5C09E 1KPVA 1CICB 1F2QA 4X7SL 3WKMH 5I75C 1A1MA 3UP1A 5EWIH 1KG0A 1J5OL 2AJVH 1K3ZA 1YJDH 4P2RA 5JO5B 4WO4D 1AI1H 3GSNL 4XVUD 3U30C 3VWJC 4YDKL 1I9IH 3ALPA 2P7TB 2OTUA 4TPRH 3RZCB 4HIJB 2GW5A 3HZYB 5DF0A 5SWQA 4U6YB 3UYOD 3KPMB 4L8BA 4QRRA 1UKTA 2WBJB 3NPSC 2R1XB 3WUWB 1FZMB 2DLEA 3MLXL 3QEUB 4XGZB 5C3LD 1JV5A 1MJJB 4ODSL 1CTNA 1YMHB 3S4SB 1MREL 3MLVH 4S1SH 4RFNC 3TPKA 4AEHL 4XP5L 5FIEA 3EIFA 3G5ZA 3R06B 3ZDXE 4KQ4H 1U41A 5TQ0L 5IJVB 4MWFB 4OZGA 1YEEH 4PS4H 3G6JE 3SE3C 2VZUA 2E7BA 5E1AA 4RDQF 3DX9A 5F72S 1ADQL 1GJIA 4PD4K 3ARGA 3TA3A 2DYPB 1XH3B 5I18L 2OR7A 4XVUC 1X4XA 2QLVB 4HDIA 43CAA 4DKFL 1GGBH 4F8QA 2VDLH 5INDB 2YXFA 3CVHB 2KL6A 1QOKA 2XWBA 3D25A 3PDDA 4JKLA 5JHDB 5B39A 4D0BA 4BKLB 3QPXH 4LIQL 5TF1H 2HRLA 4EN3A 2B1HH 2CLVA 4ONGH 2Y06H 5ID1B 1I7TA 3BZDA 1XGPB 2KBGA 3F7RA 4X80L 4P2QE 5E08L 2BERA 1ZLSH 1IM3A 3LKRB 1UM4L 3IRPX 3L3OA 4ZUSA 3KS0H 3RWEA 2Y23A 4ODHH 3BP7B 3M1BB 1E4KA 2AJYH 4OCYH 1XGQB 5E1HB 1NKRA 5GS1A 4ZTPH 4FQIL 1HIML 1VB9A 2AJXH 3HB3D 3CVIL 5IF0A 1I4FB 1MFDH 4LSUL 4DUXA 1GGUA 1BF2A 5IT2H 2VN4A 4XCFL 4LOUC 1WC7B 4NKOB 2R4SH 4X6DA 3DXAA 5D2LA 2AABH 1FQ9C 2MWCA 5TE6H 5F6HI 4E0RB 3KVQA 3P30H 2ESVD 1CDYA 3OJVC 2VXVL 4XCYB 2J5LB 4R3SB 4L8SC 1WQVT 2Z31D 4IHOB 3BKCH 4YC2C 4OCRL 3TWCH 4Z7NF 1INEH 3LN9A 4YWGL 4M7ZB 4PTUA 4LLWB 4JGMA 3FZUD 3P4NB 4TUKH 3CVHL 2JCCB 1FVDB 5IKCA 1IZJA 5FO9A 5DWUH 5HHVH 3OKLA 5BOZG 4GKZB 3HB3C 3MRBB 3MA9H 4FXGB 2DLGA 3MRHB 3RIFF 3NZHL 5BXFA 2OCFD 1BHGA 2IG2H 2PTTA 4YDIH 4GMSL 1NFKA 4BH7B 2APXA 2J3SA 4YPJA 4YUEH 1PG7L 1WIOA 3VXRD 1KTRL 2YUXA 5GGTL 3MCKA 5IIEA 1KTLA 2Z31C 4AT6B 5IGXH 3BVNA 4DEPC 2Z4QA 4IS6A 1H9VA 5EU6B 2PYFA 3ULUE 1XF5B 3FZUC 1JYNA 2OMNA 1WEJL 2BSSB 1S7TA 1FAKT 1JHTB 2AQ1A 3N06B 2DMKA 2R9HD 1I1YA 5ERWA 4ODTL 1QO3B 1FPTH 4PJFF 2NX5B 1FL5A 1UJ3A 3EO1B 3BEVA 4ODXB 2GY5A 1OGAD 5SWSA 4LCWB 1U3HD 1JF5A 3MROA 4JHWL 5EU4B 3MQIA 1S9VA 1HEZB 5HHOD 4MSWA 3RPKA 4I3SL 3DECA 3WS6C 5HYSG 3U0WH 2DLIA 4G9FB 5ISZD 4NN6C 2QQNL 2IGFL 2R39A 2ZCLH 3DYPA 3CDGB 3ZZ1A 4PJXF 4Y16A 2ZUUA 4U6TA 2FYYB 4Z5RB 4UIMB 2I9LB 3QWQB 4NFDA 4APQB 1I1AB 4BQ8A 1CFNB 4X0KA 5BW7A 3WCYA 2VAAA 4BZ2H 5IJKA 2VITA 2VL5B 2BNUA 4JFED 3PWPD 2CDEA 2H6PB 4I3RL 3LKQB 5GS2H 2R0KH 3DIFA 4F15B 1QFHA 4HG4K 3VA6A 2R9HC 5IMMB 3O9WB 3VRJB 2PW2B 3MV9A 3QT2A 2ZSVB 1JVKA 1CI5A 3W0WB 4WV1B 4ZXBD 4MAUH 3GZKA 1U3HC 3MBEB 4WENB 4NJ9L 2X4PA 3NN8A 2FECL 3S5LA 2ZUQB 1A6AB 1TDQA 2XG5A 2Q8BL 3WN5C 1AR1D 5E6IB 5HHQA 2P5WE 4K2UH 4PJDE 2DDQH 4YNYB 4Y4FC 2FHFA 3VG0L 1B0RA 4P46A 3VG9C 1MPAL 4Z7VF 4KKNA 4KKAC 5INCB 5CWSB 1FFNA 1U2HA 1S7VB 4K07A 1H3PL 1T1XB 2VLRB 1BEYL 3EOTH 3BKMH 3DX7B 4RGOH 3VGDA 4Z0XA 5I6XC 4YQXH 4JJHA 5DJZB 4ZXBC 4DUVA 5M95B 4PRHE 2OSLA 3IU4L 4QHKI 5DTFA 1K6QL 4JZJA 1BIHA 4L1HA 1TTUA 2CDGA 4ZO6A 3RU8L 5MP6H 1KN4H 1FC2D 3IDJA 4WTWA 4BELD 4JKKA 1AR1C 4C83A 1UKSA 3NFSH 3LQMA 3G5YA 3V0WH 4NQDE 3I02A 3KLAB 4HWNA 5IHUH 1RIHL 2AAVA 2RB8A 2F53D 2XFXA 5TPWH 1P6AB 3P73A 4LCUB 3BDYL 1MCPL 4MJ4A 4HIIA 4U3HA 3SKJH 1Y0LB 1MFEH 3LIZL 2JIXD 3B9KD 4LASH 5CZVH 3MRMB 1JFQH 1OB1B 4NQEB 5E8EA 5E2JA 5F1SA 1SEBA 1IL1A 1OLLA 5FO8A 3G6AB 4RX4D 1BD2D 1DBBL 1AXTH 4Y19E 5KVGL 3TO2A 5IV2B 3FT3A 1U8PA 4LPVA 4OZFH 3ZTJH 1MFAL 3T0ED 4OV5A 4LQ1A 4OSUH 3HAEB 3L3GA 2Z9TA 4OQTA 4WI6A 5F7DA 5BRZD 5B8CC 1MAML 4Y5YA 3TIEB 1U8LB 4H1LB 1I1FA 1U8KB 1JHLL 2K7QA 4CBPA 2YD2A 1S9WA 2VDML 2BNRD 5I73B 5KW9L 1FYTE 1G0XA 4X5XB 3D0LA 3PGDB 1HHHA 2AXFB 3JTTB 3B5TA 3B9KC 4U1KA 5F44A 1OQXA 4JFDD 5CLWA 5E9DE 5I76B 2IWGA 3NIDF 1MCIA 1E6JH 4NRZA 1Q1JL 4X4XB 3F7VA 1TNNA 1A6ZA 5MEQB 1INQB 5ILTL 2PO6D 1J12A 2AK4D 3MXVL 1S7SB 3C6SB 1CK0H 3QZWG 3JWOH 1S7UA 3VMPA 3T0EC 2BK8A 3KJ6L 4HWBH 2EICA 1WSST 4ISVA 1GCFA 2DL9A 4HKZB 4LK4A 1YPZA 1DLFH 2AVGA 3HZVB 4JZOA 4XVSL 5FUCE 2GFBA 3L5HA 3OHXA 4MJ6B 2VQ1A 5LBSH 1INDL 4NCC1 5CBEA 3LKSB 4CNIB 4M4PA 2DM4A 3OBAA 4HAFA 4HWEL 1QSEA 4L3EA 1LO0L 1YMMA 4N8CH 1F3JB 4NC1E 4NZUL 3IDMB 3PDOA 4NKDB 1UKQA 3IVKA 5EUOA 1T1WA 5BMFH 3WFHA 1F4WL 4I4WA 5C0CD 2P8PB 2BRRL 5ACMA 2PO6C 1EEYB 4NQUA 1CFQB 4ZO8A 5GPRA 5FYLL 3C6LD 1GSMA 3MRQB 4R7NB 4LLDB 4JFXA 5DQDL 5E94B 4HJ0D 5EDXA 3QH3B 5CBAA 2AGJH 5J9PA 3ZKXC 4LBEA 4OFIA 4G43B 3RNKA 1KCVL 1T6WA 4PB9L 3ULVL 2M1KA 1L7TL 1FLRL 1QRNA 3F58L 5AZ2H 1ROWA 2PXYA 2HJKA 2DIBA 4YJZL 3N1GC 4EVNA 2R15A 1ZHNB 3CC5A 3T2NH 4R6UA 1NCBH 1MWAB 2FX8L 3MRGA 4UMGA 4I9WD 5B4MD 3U4EB 1EO8H 5C6PB 4XC3L 2B4CC 5GIRB 5D7JC 3NTCH 3QQ4A 3N1QC 4PJCB 1B0GA 5K33A 2MPAL 2NY5C 3O6KL 1MAJA 4PP1D 4G80A 3LH2H 2LVCA 4XMKH 3MGAA 4PB0L 1QBML 3C6LC 4WWKA 4KJQC 4FQXD 1BFVH 4LKXB 4HJ0C 1AC6A 4JRXD 3UXFA 1GGCL 4HCRH 4PJ9A 4AZ8A 35C8H 4MNQD 2ZCHL 3ZDYE 1LP9E 4YEEA 2VZSA 4YO0B 5HDOA 3L3IA 2UZXB 3DO3A 4AYFA 3GMNB 4PJ5D 1N7MH 1ZAGA 3PHQA 1BVZA 2AK1H 1U8MA 3ARPA 3RZWA 1MVFA 3MNWB 3WXWH 3C5SA 5B4MC 5IVZA 1WBZB 5CEXB 4GRMB 3NIFE 2W91A 5I9QC 3HA0A 3GKZA 2ITDA 3VFVA 3MACL 5I1HH 1NL0H 3IFPB 2P24A 4PP1C 5H2BB 4KDWA 2FJFA 2H3NA 2DOCA 3OJ2C 3WLBA 1YQVL 2VNCA 3SJVB 3NBNA 5FM8A 1N59A 5J6HA 3GIVA 4FQXC 4M7KH 1JGVH 4O00A 1H5BA 4I77L 3IFLH 1CBVH 1MWAL 4Z95L 1R3LB 5IQ7H 1XR8A 5IB5B 4PBWD 3O2DH 4JKMA 3FFCA 4IEFB 1QPPA 5CEZD 1WT5A 3IFOA 5HHNA 2ZCKL 5GISH 3PL6D 4YGAB 4ZNEE 5EC2B 2FHBA 1BWWA 4Y2DB 3VFPB 1JJUA 3EJZC 4DVBA 5IVNA 5DRZA 4UT7H 2QKIA 1I85A 2FD6L 3BRDA 1T3FB 5E5RB 4PJHF 1X9QA 1S8DB 3BFOA 3K0WA 3RHWF 4EQ2A 5SWZD 4L3EE 1HNGA 1CDUA 5DMYA 2ZUSA 2HAZA 1ZMYA 1NDGA 1TITA 4XC1H 1QLFA 4FHBD 5CAYB 4S1DC 1EHXA 1BVKA 3RY6C 1NKOA 5KTEL 3BPOB 5DR5L 4RIRA 2OZ4A 3ES6A 3WIIH 1W0WA 2AW2A 1RZJC 1LO3L 5D7KD 4PRID 1ZT7B 5EPMA 1GPOH 2CXGA 3ARSA 3PL6C 1IGIH 1N6UA 5CZKA 3RWGB 4WU5B 5IESL 1QRNE 2XZAH 2VLMD 5E4EC 3BO8A 3TN0A 1QFWM 1MLBB 1YEIL 4U6XA 1IEAB 5TDPB 2H26A 1L7IL 1RZIB 5FDWB 3MV7E 3SDYH 3P0VH 4GW4B 3K1DA 1AO7B 4OCXL 2E3VA 4PJAF 1UB5B 4PRPA 1IAIH 2CR3A 5GHWH 1NCCH 5F9WB 1M05B 4EDWL 1OAZH 3FKUS 2G75B 3K4ZA 1A1NB 2PUQT 5F9JA 1GHFH 1IQWL 3V0VB 2C1PA 1DSFL 3K8MA 2D0FA 4D9LH 2G2RB 1H3GA 4MX7B 1A14H 5D71H 1U8JB 3Q6GL 5ICXB 3TBWA 1MH5A 2IADB 1MRFL 1REIA 2DD8H 3KS0J 4X7EC 4XVJH 4RA0C 1AD9B 1UYWL 3H3KA 1YEKH 2CIKA 2IQ9L 3QCTL 1J1OL 3HG1E 2XN9A 4ZUWA 4G6KL 2AQ2A 2A2QT 3LEVL 4Y0GA 4TSAH 1ZA3B 3D3VA 2AJ3B 3QI9D 4FNLH 1O5DT 4QOKE 5E2TL 3LQAL 1UGNA 3HPJB 1AGCA 3HHRB 3K1KC 4ALAH 3MRNB 4MJIB 3KPPA 1C8PA 5C0AA 3WDHA 3G5XB 4JCLA 3GO1L 2R0LL 2R1YB 3MUGB 4IRSA 3O3BA 5DD5H 3GNMH 3SOBL 2VXTL 5LCVL 5ICZA 2HH0H 4S0TD 4PRDA 3WKML 1N6VA 1ZANL 1Q38A 4R97C 3MOAL 2EDWA 4CADA 4O51A 2Y36L 3KGRA 1YJDL 4DZBB 1AI1L 5C09D 4C56D 4FABL 5FF6A 4MD4B 1I9IL 4QRUA 5F7MC 1I8LC 4UQ2A 4ZUTA 1MRDH 1HQ4B 3QI9C 3B5GA 2XPGB 5A1AA 4MGXA 1AGBB 2VRAA 5F3HB 2YWYA 2Z93A 4JO4H 2X4NA 3MLVL 4HBQA 5DI8A 1T5XA 1H0DA 3TVMA 5IROA 5F7YC 3R8QA 1EAPB 3VWKD 4DAGH 1OPGL 2E7CA 4M6NH 2DQDH 5IHZB 4JFFB 4PS4L 5ACZB 4LEXH 3GIZH 4X6CF 4TVPE 4UTBL 3SDAA 2XG4A 1IM9B 2D2OA 2ERJC 3M17B 2GJ6B 2NLJA 5IMOA 3HCVA 3HNSH 1N4XH 3HPLA 4R7DA 3EDKA 5GSRA 1KOAA 4M1GH 2VDLL 1GH7A 1IGMH 4MA1C 1TPXB 4QF1B 2P43B 3QDGA 3QPXL 4Z77A 5TF1L 4OLWH 4DWHA 2B1HL 1FGNL 4O4YH 1CDHA 4PYHA 2Y06L 3L5XH 3LRGA 1P4LA 4U7MA 1OQOA 5I1LA 4NSKA 5DFWH 3PXHA 2HG5A 4PJ7F 1DP0A 3DSFH 3VWKC 1ZLSL 3ZT5A 2WWKT 1NC2A 3O3AA 5F96L 2IAND 4EI5B 4G8FB 4QYOB 5L2KA 1Q94A 4ODHL 4P2QD 5BV7H 2AI0H 4OCYL 5DEFB 5IBTH 1YNLH 2FX9H 4L9LA 1RUML 3TH4T 2AJXL 1MFDL 1GRWA 5J06A 5C0IB 4GRLA 4MXVE 5JDJA 4K7PX 5IT2L 4MCZB 5DA4A 2ED7A 2FGZA 1EEZA 1XGTA 3JVGA 5EFIA 5CP7B 2AABL 2D7MA 2DLFH 5DS8B 2Z8RA 2J6EA 1CLYH 3MLSH 3D3VE 2VZTA 1DQTA 1ZSDB 1XCQA 2ZOKA 2W38A 5BZWA 5ESAB 1R5WB 4DTGH 1WBYA 4JZNA 3WJLA 4J3UA 2FO4A 3UTQA 2ZKHH 3LZFH 3TWCL 1KCRL 4IMLA 1NCDH 3WJJC 3C8KA 2COQA 3QQ3B 4LFHG 2QSTA 1CG9A 4TUKL 3GRWH 4FA8A 2CIIB 1OAUH 2IPUG 5FKAA 5HHVL 2ZG3A 2CLRA 3SDCB 3V6OE 2DQFA 2MHAA 4O2CA 5C71A 5D1QB 3RWCA 1ZV5A 4L3CB 5IFJA 2MNUA 1HCVA 2XI9A 2IG2L 1J0YA 3FO1B 1MRCL 4NM4H 1LE9B 3DLQR 1DBAL 2FJHB 3HR6A 3ZKMC 4Q9BA 4TUJA 3WXVH 3HUJF 3ZE2E 2BMKA 3GUTB 3JWDC 4G8IA 4YUEL 5I8OL 3FB5B 5K9OB 5KG9B 1FFPA 1UZ6E 4PJBE 4JRWA 4KVCH 2A1WL 4M62L 3BEWB 4P2RD 4M48H 1GOHA 4WI8A 1NBVH 4JO2H 4L3AA 1CGUA 3QEHA 4BZYA 2R4RH 5DHYA 3V7MA 3MJ7A 2OJEB 4HFWA 2H8PB 1VEOA 4NZJA 4WW1A 4NOFA 5D7IB 4HK0B 1EJ6A 4N0FB 1F6LL 4RMSA 4S11A 4XVTH 2O5ZH 3RKPA 3CX5K 4M03A 1JPST 4OF5A 3PGCB 4UBDD 3MFGB 2VZ3A 3IDGB 3SO3B 3ZE1F 3QP3A 4S1QL 5F97E 5DJDB 3QIBA 4QCIB 2W60B 1KJ2H 1AFVL 4KRLB 1VCAA 4S2SA 1D9KA 4B7IA 4GKOA 3TA3D 1T5WB 2GCYA 2N7AA 4S1RH 2ZCLL 2LV4A 3OXRB 2EYRA 2GJZB 4PJEF 4WGVB 3SBWC 4MHHI 3CFBB 4L8DA 1II4E 1EXUB 4WRLA 4UAOC 3V5KA 3CMOH 2HLAB 4HBCL 1QEWB 3TJEH 3MRCB 1FHGA 4HFUH 1UFUA 4HS6B 5HDLA 4BZ2L 4V1DA 3E6FB 3D85B 4JO1H 4JY5L 2CGRH 1P4IH 3QDME 2AP2A 3TIDB 3U82B 1S7WA 3HE7D 3OF6D 2X70A 4I3GA 1G9NH 4UBDC 4OJFH 4MAUL 4XZUA 2MOVA 1MF2H 5HPMA 2NY3D 3GSNA 3SCMB 4JFPB 4JO3H 4X98A 2IPKA 3KHQA 5CUSH 3N1MC 2GQHA 3T3MF 4OCSH 3ARGC 3MMEA 2YPVH 2IEPA 4UDTB 3O6MH 3TA3C 1A02N 1HYSD 4XP1H 2A6KB 3IF1B 2R8SH 4NZRH 5LXGH 4NHUB 3GMRB 2BSRB 1NDMA 3NOIA 5F9DC 2F74A 2HJLA 2RIKA 1MCHA 1M7IA 4PFEA 4OD3L 5C8JA 3FO9B 4G7YH 4NNYA 2P5WD 1HXYA 5HGGS 1ZE3C 2VDNH 4OZFB 3F12B 2HVKA 2Y4SA 3EOTL 3BKML 4H0HB 4RGOL 5GXBB 3SE8H 1UZ8A 1UACL 1ADQA 4YHPB 4NQCB 4HIHA 4HJJH 4LHUA 1JN6A 1T7VA 3EFDH 2NY3C 4FQHA 3D1MC 1E4KC 1GC1H 5GS1C 5MP6L 1KN4L 1HYSC 1RZ7L 4PRHD 4K3GA 1U92A 4LEOB 3S7GA 4LNRA 2QL1A 5DT1H 3NFSL 5HVHB 4QRSB 4Q2ZA 2NY1B 3STBA 1LHZA 2XICA 3IJHA 3QXDB 5IHUL 1C5CH 3U7WL 5JO5A 3IDUA 1WFNA 3QA3A 3V6ZB 2P7TA 2Q7NA 3WO4C 4NQDD 4DN4H 3BRGC 4RGMB 3VJ6B 3HZYA 3L9RB 1OTSD 3KPMA 2WBJA 1IC1A 1OAKH 2R1XA 3WUWA 1FZMA 3QEUA 1EFXD 4XGZA 1MFEL 1PD6A 3QEQB 4QXTB 4LASL 5CZVL 1JFQL 1VFBB 5DJ2B 4UNUA 3DX6B 4X4ME 3BKYL 1AXTL 2VYRE 3R06A 1CLZH 2F5BH 2XV6B 4KV5F 4HUVB 3MRKA 4B0MM 5IJVA 4MWFA 1YQ2A 4MJ5B 2AEQH 5IW6B 1J8KA 1J0HA 4JDTL 3GSWA 3X13B 4OSUL 2W9LA 2DYPA 1XH3A 3D6GA 5J8OA 3BOVA 4AIZB 5TF0A 3HE6B 3LKPB 2EO9A 3GGWB 2DKMA 1CL7I 1FE8H 1JUFB 1OTSC 5INDA 4JQVC 1WGOA 1ZOXA 3CVHA 3ARBB 3I85A 5JHDA 4J3XA 1PEWA 2DQUH 4G8GB 4BKLA 3Q2CA 5D5MB 1KJVB 2QSCH 1T03H 5EIIB 5C3TA 3REVB 4F8TA 1P69B 4QWWD 5ID1A 5AG8A 1FYTD 1XGPA 3SKOB 4DGYL 1H3UA 2HN7B 3DMMB 1E6JL 5I71C 3QEGL 5C0GB 5F7NC 3LKRA 3SQOL 1GL4B 3D9AH 3VFUB 3WFBH 1YNKH 1CK0L 2AKRB 3M1BA 1FZJB 3JWOL 1XGQA 1IT9L 5T1LB 3H42L 1CCZA 5GGTA 3DV4B 1MJ8L 1O0VA 1L0QA 1MVUA 4BM7A 4DK6A 4P4KB 2OJZL 1C7TA 1DJSA 2NW3B 4KUZH 1KTDA 4NKOA 2NY6D 5LBSL 1A2YA 1CFVH 1JP5A 1X5FA 2CRZA 1K4CB 2ZJSL 4Y16C 4E0RA 5FHAL 5HD8C 4N8CL 4QWWC 4XCYA 2EDNA 3ZDXF 5BW7C 2BHYA 3H7BB 4NN5C 4P46D 4IHOA 3Q1SL 4TNVF 4N8VG 1A3RH 3G6JF 4OZ4B 5KSAD 3VXMB 4LLWA 3JSSA 4R0LB 4XAWH 4E9LA 5GRJH 3P4NA 4WNQB 3KR3H 3FOLA 4NUGH 1QLEL 2JCCA 1FVDA 1Z9SA 4JHAH 3SE4A 3UZQA 3GSOA 5E8PB 4PY8J 2QEJA 3LSOB 3MRBA 4U6VL 4FP8H 4WUUA 4L4TA 4U1NA 4FXGA 2VAJA 3MRHA 5AZ2L 3BIKA 4U31A 3TLRA 1UWXK 2NTFB 5IVXF 3P4OB 2NY6C 4LSRH 4KKLD 3EYFB 5CMAB 4BH7A 5HXMA 1P84J 4X5WB 3T2NL 4DVRL 1CD0A 5FUCC 4WDIB 1NCBL 3I6LE 4JPKH 2AV7B 2VZ1A 1CFSB 4HH8A 4JFHD 4MZ3A 4PUBH 1EO8L 4P46C 1EDQA 3S35L 3DTXA 3S36X 4AT6A 3MV8B 3RP1A 4NC1C 3UPAA 2APTA 5EU6A 4FZ8L 1N6QH 4O02H 1XF5A 2CK0H 3LD8C 4XMKL 2XTJE 1M7DB 2BSSA 5DD1L 3WNMA 1A8JH 1JHTA 1BFVL 5ALCL 3O4LE 1QO3A 4HCRL 4JZJC 3DURB 35C8L 4JY4B 1UXWB 4GAYB 3EO1A 1JGUL 2CO7B 4ODXA 1UT9A 4JM2B 4Z7OE 1OP5K 3QFJE 4LCWA 2P8MB 4KKLC 1N7ML 3NFNB 1HEZA 3TYGH 4M02A 1KT2B 2I25N 5LGHH 4PJIF 1NFDB 3WXWL 1KBGH 3IDNB 4G9FA 3HR5B 5DEGB 1G9EA 1K9TA 4CAGA 1T7XA 1SM3H 1W72A 2FYYA 4Z5RA 5I1HL 5C0BE 4JFQA 4UIMA 2I9LA 4APQA 1I1AA 3RNQB 5LVEA 1CFNA 2HFFB 2RCSH 2VL5A 1JCKA 1NFDE 4I0CC 4JPIB 2H6PA 5BS0E 3LKQA 2DQEL 2O93L 3G9VA 5IMMA 2JJVA 3WLWD 3O9WA 5DC9B 5IQ7L 2PW2A 1OTUD 2ZSVA 2IC2A 3O2DL 4OZHE 3W0WA 4WV1A 3LMJH 3AB0B 4KHXH 1T0MA 3MBEA 1ZHBB 2FL5A 4XPAH 5GISL 3IXAB 5DMJB 1IKFH 4UT7L 1A6AA 3BPNB 1ZT4B 1U9KA 2FSEB 2VERN 5DO2D 3V7AE 3WFCH 4Y5YC 5E6IA 1AXIB 3B9VA 1KCLA 4YNYA 2XQYK 3BSZH 3H9SE 3P11L 1CLOL 1VDGA 2D7OA 5B38B 5C07A 3QCUH 5INCA 3D2UB 5CWSA 4Y4KB 1A6UH 5K9JH 4L3ED 4L8CB 1IGFH 2IALA 1CQYA 1S7VA 4MAYB 1T1XA 2VLRA 2V5YA 5K93A 2BZDA 3WLWC 3WUWG 3DX7A 2DMBA 1OTUC 3WIIL 3FONB 2OP4H 3QAZC 1F6AB 1GPOL 1V3KA 5F6IB 5FYJU 3STZA 4L4TE 1IGIL 2N4IA 2XZAL 5TH2B 4KJPD 5DDHB 5DO2C 2QADB 3PWVB 3PV7A 3GSRB 3P77B 4OM1H 1QRND 1RUPL 2NW2B 3T09A 3KLAA 1UENA 4LVOC 4M7JH 5KS9B 3IAPA 3PGFL 2E9WA 3UZVB 3ARFD 4EXPX 1BQHA 3MLWH 2VUYA 1F97A 4CN1A 1IAIL 4P3DB 5GHWL 3MV7D 4LRIA 5MI0B 5TQ2L 2UZIH 5TFSH 2I5YL 4LCUA 4D9QE 2NY7H 4YLQT 1GHFL 1FDLH 1Y0LA 2HLFD 4D9LL 1B6DA 1J1PH 5D71L 3MRMA 1OB1A 4NQEA 4KI5C 3NGBC 3MYZA 2J8UB 3G6AA 4LCCA 2DD8L 4C58B 5D2LF 3DNKA 1FFRA 4OGXL 5C08B 2BRQA 1UWXH 4WI3A 3G04B 5EZOH 2OK0H 2EDLA 3FT2B 3ULSB 2PXYC 5HVWA 1OT1A 3HAEA 4TSAL 3AUVA 3ARFC 3HG1D 1NGZB 4LAJH 1AXSA 2AJZB 1U8LA 4KDVA 3TIEA 4H1LA 1JNLH 3RDTD 5FA4B 2ZOLA 1VFUA 4QOKD 2J88L 1AGFB 4I1NB 1OAYL 4OCWH 3PGDA 2HLFC 3VGHA 2WP3O 3KYOB 1SEQH 1A6PA 5DD5L 3GNML 3PWNA 1DBKL 1INQA 3RKDD 3UYRH 1EZVX 1S7SA 3C6SA 3BW9B 2JK5B 1G0DA 4DZ8B 5EB9A 2HFGH 1KCSH 3FTGA 1CXHA 4JB9H 2EC9U 1MRDL 3HZVA 1IFHH 3KWWB 2DQJH 4D8PA 3PWUB 5BV7B 1A64A 5DMIH 5JORB 3BIBX 3RDTC 4MJ6A 1CD8A 1NEZG 3LKSA 5ALBH 4CNIA 5C07E 2WSKA 3C8DA 1WVZA 4PV8B 4LFHD 2B1AH 4X9GA 3LCYA 1EUTA 1F3JA 4DAGL 1SYSB 3IDMA 4WEBH 2YRPA 3S88H 1MNUH 2DQDL 4M6NL 4NKDA 1N2RB 1HN1A 4TN9A 4OAWA 4NP4H 1H5BC 2P8PA 1EEYA 2VDOH 1X5XA 3TZVB 1CFQA 1M71B 3MRQA 4R7NA 2WINB 2OQJB 4LLDA 3HNSL 1HH9B 4TVPD 5E94A 3QH3A 1WT5C 3ZTNL 2ZPKH 4G43A 4MDJB 1IGML 2E27H 5IB1B 4JRYE 3VDCA 1JYXA 1KFAH 3DHJA 5D2NB 3TN0D 4OLWL 3L6FB 4O4YL 3QCVL 3CXDL 1ZHNA 3IDXH 5GGVY 5GS0H 1MWAA 5F1KC 3U4EA 3V2AR 3A6OA 4PRPD 1Z9MA 4CVZB 1RAMA 4PJCA 5BV7L 2NCMA 3H3BC 5IBTL 1YNLL 2PW1B 4IBLT 2FX9L 3TFKD 3FO2B 3VXPB 1VFAB 4UIKH 4LKXA 2YUWA 4JM4H 5F8RC 3FHQA 3U0PB 1EIBA 2PYEE 4P2YA 3FMGH 3RL2B 4YO0A 1AY1H 1VADB 5T33L 3TN0C 1CXIA 1MHCB 4UINH 1EMTL 3TM6A 2ED9A 3ARRA 1KLFA 4DTGL 1RULL 4N1EA 2ZKHL 5J11C 3MNWA 3D3VD 2YD4A 3RGVD 1NCDL 1WBZA 5CEXA 1F42A 4XBPB 2EIZB 1MCDA 1BZQK 2R0ZH 3GRWL 5DQ9B 1A9BB 3LDBC 3T4YB 5JPNB 5DUBB 3UPCA 3IFPA 1IC7L 2QSQA 4WTZA 1DN2A 5H2BA 3EBAA 1KSRA 1QKZH 1QLRA 2DF3A 3SJVA 3EDEA 3U48A 2HRPH 4CJ1A 2JLLA 4J3WA 4NM4L 5DRNB 4YIQB 1R3LA 1VGKB 2DB8A 2XA8H 4IRSD 1NCNA 4YXKH 1GXEA 3IJYB 4KRNA 2BHUA 1OY3B 3RX8A 2R29H 2BNQB 1F45A 3V6FA 1R3HB 1PW3A 2EH8H 3WKNA 2DJ4A 2VLKB 4NQSB 5HY9B 5EC2A 4Y2DA 3VFPA 3T3PE 1NBVL 1UB6B 3EHBC 1T80A 4LSPH 2CH8A 2XKNB 2E7MA 2V2XA 4XTRC 1VFMA 2CKBH 1T3FA 5EU5B 2XOTA 1DUZB 1S8DA 3QNZB 2ZZUT 4XCEB 1FP5A 1DL7L 4XXCA 1HSAB 1F8TL 1BQHG 2XQBH 3RIAK 5F7FA 4N8PA 3H6JA 3CFCH 1KNOB 3RWDB 3AXLB 1V3JA 3UAJD 1LP9F 5E03A 3V6OC 2F5AH 2EH7H 5IFHL 4IRSC 4GG8B 3RPIB 3FQNB 1QFOA 1ETZB 4KPHL 4LDLB 5E8OB 2AEWA 3U0TB 3FRPA 4LARH 1ZT7A 3C9NA 5J6GB 4HLZG 3V6BR 3RWGA 1MHPH 2PR4L 3NIFF 5IR1B 4OQTH 1YC7A 5HVFB 4JQXA 3KPTA 5BJTB 1MLBA 1PX3A 2YOCA 1TQCC 5AD0B 4ZS7H 5TDPA 5EOTA 2H41A 3QDGD 5ECJE 1KF9B 5DMGD 4N9GB 1A6TB 4GW4A 1P4IL 4MQSB 1AO7A 1MCKA 4H1LG 1HKFA 1UB5A 2AV1B 3D5OF 1P9MA 4GOSA 1A7QH 5IROC 3PHSA 2OTWA 5J1TC 2J8OA 5DFTA 3DGGB 4HUMB 1M05A 5DFVD 2R2HA 3RUGE 1G9NL 3SDXB 2A6DA 2HWZH 2G75A 2NNAB 3QDMD 4OJFL 4D2NA 1A1NA 2WUBH 5K9QG 4AIXA 1HSBB 5F1NB 1MF2L 4DGIH 5DZNA 3V0VA 4JO3L 2P5EB 1YPZF 4X7FC 2G2RA 3GI9H 2NY4B 4MX7A 2M2DA 4BYHA 4OCSL 5ICXA 2YPVL 3O6ML 9CGTA 2IADA 5D1ZB 4QLRA 1BPVA 1AD9A 5LXGL 1MCSA 4GRLD 4OZIB 4U1HB 5JNYA 5EG6C 3T1FB 5H35A 3FAWA 1LGVA 4CRPA 4N0UE 4NGHH 1ZS8B 5DMGC 3TCLB 5EUOF 1IAIM 1ZA3A 2AJ3A 2VDNL 3WFDH 2Q6WB 1QSFB 1WZ1H 4XMPL 4OGYH 4KI5F 3SE8L 3A0OA 4NNXB 5DFVC 4ERSH 2B8OT 3OV6A 4Y5VA 4YZFE 4JKPL 1M7XA 3EFDL 4MJIA 3GHEH 5E00B 3G5XA 1GC1L 4WFFE 1CGSH 4UT9L 2R1YA 4L9LC 1ZT1B 3MUGA 5FGCE 3IFNL 5DT1L 3KHOA 4GRLC 3LOWA 5KVFH 4ZDHB 3JVGC 3IDYC 3MV01 2PN5A 3QQNA 5D7LE 2EDXA 1C5CL 3L3KB 4DZBA 4D9RE 4KXZI 4MD4A 4DN4L 5AYUH 5T5FH 1HQ4A 2O5YH 2C4XA 4UU9A 4QXWA 2XPGA 3T04D 1OAKL 3VXUB 3NZ8B 3WJLC 1AGBA 1BM3L 5F3HA 4PBVC 4GT7A 1YEDA 1XIWA 4XNXH 1FNSH 1P4BL 2CXKA 1FSKB 3O41B 3U4AA 3SGJC 5ADOH 4QRPE 4Z6AT 3MJ8A 4CN6A 2JTDA 3TF7C 1EAPA 4Q9QH 4UDUB 1CLZL 2F5BL 3VGGA 4AIOA 3RQ3A 2X6MA 2EE6A 5CCKH 3O0RL 4JFFA 5IHZA 5ACZA 1T0NB 4XWOD 2X9WA 3Q6FB 3OGCA 2YHGA 4UNVA 1IM9A 4GAGL 4WIQA 1KXVC 1HINL 5HYQB 2YZ1A 2GJ6A 1N0XL 3M17A 5SX4I 1KPRA 3MTRA 2CKNA 3OX8A 5GGVL 4MD5B 1FCCA 1RK0B 4GG6B 3P0YL 2C4FU 5DQJB 1ZA6B 1RMFL 4QF1A 2FIKB 4GSDH 1WFTA 4N0RA 5F7EH 1OF2B 2R56H 4TQEH 3UDWA 5L9DL 1UWEH 4KMLB 4TNWK 1OAQL 3AS1A 1EHLL 1N0LA 4EI5A 4G8FA 4IOSD 4QYOA 1Z2KA 4XP4H 4XWOC 3WFBL 1YNKL 1PZUB 3M8OL 2WM0A 3HNVL 3NH7H 5F3BB 2EEDA 5L6YL 5C0IA 3BGFB 4KUZL 4F7TB 4X6BB 4MCZA 4X8XA 1ZEAH 3X14A 1CFVL 3TT3L 3P9LB 4E5XB 1LDPH 4Y1AE 5DS8A 5EN2B 1LEGA 3ECBA 5F1OB 1Y18B 1ZSDA 1LD9B 4OLZH 4QNPF 1R5WA 3B3IB 3WO3B 2DBLL 1A3RL 3KDMB 3KPRB 4TYUA 3V4UH 3V8CA 3PQYB 2Z92B 3QQ3A 1SY6L 3OL2A 1RVFH 4PRBB 2CIIA 5DD3H 5C0FB 1WBXB 3N9GH 1PKOA 4OV6F 4JHAL 1G9MC 3SDCA 2OZ4H 1CR9H 2OX5A 5D1QA 1RIVL 4L3CA 4CMHC 4AM0A 4O58H 3MBXH 1LE9A 3FO1A 2FJHA 4NZTH 2YD9A 4FQLL 1C1EL 2NXZB 3QNXB 5TJWK 4FMFA 4P48A 3FRPG 4MA8L 5HI5D 3UTSB 5K9OA 3FB5A 5KG9A 3DRQB 5CIPH 4BSJA 4JPKL 3DRTA 4GH7B 4DFHA 4YBLC 3BEWA 4KTEH 1R6VA 3PWJB 4NNPH 2F15A 3CH1B 3I6LD 1J7VR 3JV0A 2OJEA 2LTQB 4GBXB 4PRNA 1N6QL 3EJJX 4O02L 3DOSA 1UJTA 5D7IA 4HK0A 4N0FA 1M1SA 1U8QB 3DSNA 4HGKC 2DLTA 1XF4B 2XTJD 3L3HB 3PGCA 3LS5H 5F93C 3IDGA 2X41A 4RMVA 4P5KA 1WFOA 3NCCB 3U7AA 1ZGLB 4KXZH 5DJDA 3L3JB 3O4LD 2RFXB 1T0PB 1I9JH 4HUNB 3V9FA 3VFGH 5HI5C 3UBXB 5JW3L 3O8XB 3MOBH 5LGHL 2P47B 4K3JL 1KBGL 1T5WA 4MCYB 3OXRA 1SM3L 2DM3A 3CFBA 3ZL4H 3U79A 1EXUA 2HLAA 3FL7A 1QEWA 1P1ZB 2WQRA 3MRCA 5I2IA 4IDJL 4HS6A 2X4TB 5JHDD 5GRWA 3LHPL 3D39A 3AVEA 1BX2B 2RCSL 3D85A 1MI5E 3K4AA 3UROR 3IYLW 2CK2A 2P45B 3TIDA 4ETYA 1NGPL 1DQLH 2XTJC 4PJ8B 5HGDB 4Q97A 5BS0D 4JGJA 3LMJL 4KHXL 4PG9B 5FB8A 43C9B 4R4FL 3SCMA 5TE7L 3E3QC 2ADGB 4JFPA 4QHMB 2ADIB 3IKKA 1IKFL 3K80A 5LAXB 4XPHH 4UDTA 1NC4B 1R5IB 1Q0XH 2Y07H 1L9NA 2FCBA 2A6KA 3HI5H 3IF1A 5HHME 1D5ZB 4NHUA 3GMRA 2DLHA 2W0PA 3TJHD 5JLZB 3RAJH 2VXQH 4RGNB 1FAIL 3W2DH 2G5BB 3VW3L 4MB3A 3FO9A 3KPSB 3FB6B 4YHLH 4NYLB 1P7KA 2NQCA 4NO0B 1KN2L 3QCUL 1A6UL 2WIIB 4C4KO 4OZFA 3H9SD 4O9HL 3HMWH 4R2GB 2JJSA 1G7HA 4W68A 3CUPB 4PJFE 3C5ZD 4YHNA 3HC0B 5MENB 2P42B 4YHPA 1LEIA 2OP4L 4KK9D 1FL3B 4OIIH 1T22B 1A6WH 2D03H 5IG7A 5T3ZH 3QUXB 3TBYB 4RAUB 3CZJA 4LEOA 4JG1H 2CPCA 4WUUD 4L4TD 4ELKB 4QRSA 2QJDA 4PJXE 5DRWB 3TJHC 4WI2A 4K8RD 4M7JL 4U1LB 3LV3B 4NRYB 3QIUB 3QXDA 2DM2A 3UJIH 1NGQL 1MEXL 3MLWL 2ZUYA 3V6ZA 1G7IB 3ME0A 3GJEB 1JPSL 2UZIL 2HFTA 3L9RA 3VJ6A 2YMXL 2BVQB 4P2OA 1PG7W 4C59B 3C60B 4O2FB 4BH8B 2NY7L 4ZFZB 4MZ2A 1U3YA 4HWBA 1FDLL 3UTOA 4FQQB 3WDIA 3ZE0F 1AP2B 3QEQA 4QXTA 4Y88A 1J1PL 5KVMC 3QULB 3ZDZF 1ZGLP 4M7ZC 4KK9C 4D9QD 1VFBA 5DJ2A 2BOCB 3DX6A 4U1GC 2GUOB 2IBGA 1T1ZB 1VPOH 4Z7VB 4CU7A 3BWUC 3SE4C 4HUVA 4F37K 4HC1H 4MJ5A 5IW6A 5EZOL 3CSPA 5ENWA 5JUEH 3X13A 2DKSA 4K8RC 1VEMA 4GQ9H 2D4FA 4LCWD 4D3CH 4AIZA 3I84A 3NACL 4OCNC 4U0QB 3BPLC 3HE6A 3LKPA 3GGWA 4K71B 5HBBA 2AXGA 5F9AC 4ZTOH 3X3GL 3ALXA 4POYA 4XHJD 1AE6L 5K9KA 4G8GA 1BAFL 1NGXB 3D39E 3UTTB 4OCWL 3VFMA 2Z8WC 1KJVA 4XNUL 3REVA 4POUB 5GRYA 5EIIA 2XZQH 4ESKA 4R8WL 3SKOA 3L1OH 2E5EA 2VDQH 4LVHB 1N5YH 2HN7A 1BECA 3DMMA 4HPYL 5C0GA 1XGYL 5C0JA 5HVGB 3UYRL 1KEGH 4K94C 3VFUA 4XWGL 3GMQB 1FZJA 3W0WD 5I15H 1HZHH 5T1LA 2HFGL 1A0QH 3WEXB 3DV4A 1S7QB 3MBED 2H1PH 1QBLH 3LEYH 4MNGB 4P4KA 2H45A 1IFHL 1Q9KB 2DQJL 1DQQB 3BZFB 2NW3A 4GMTL 5I75B 4I48B 1G1YA 4WFGE 4XHJC 3L5IA 5E6ID 1HXMB 2YPLE 1K4CA 3WFEH 2V7NB 4P3CH 4GRWF 4U3XA 3VCLB 1P7QB 1DBJL 4HJGB 1R24B 4HCRA 4APQC 5KOVC 1IARB 4WEBL 1IGJB 3NPSB 1FCGA 4HUWB 2E7LA 1MNUL 3H7BA 2HA1A 1HDMA 4URTB 4GO6B 5CJOH 4PRAB 5C07D 4PGJA 4OZ4A 5JXAH 4NP4L 4HF5H 4M9PA 1CDJA 2DQGL 3VXMA 4F15C 1RD6A 4R0LA 2VDOL 3VD4A 1T83C 3O9WC 3RY4A 4WNQA 4OGAD 3DGCR 3S98A 4NHCH 1UWGH 3HC4H 4NZDA 5E8PA 2ZPKL 3MBEC 4C57C 3U9UB 5I8KH 1FRGH 1A4JB 4FQCH 1KFAL 2ZUQC 4KRMB 4WCYH 3QSKB 4L4VB 3H8NA 5EU3B 2NTFA 3QB7C 1UA6L 2HT3D 1BZ7B 3EYFA 5CMAA 5E6IC 4X5WA 3IDXL 5ABDE 4WO4B 3BX7C 1CFBA 1CFTB 4WDIA 4F2MB 5GS0L 3I50H 2AV7A 2XY2A 4QHKJ 1CFSA 4PGZA 5DJ8B 3O2DA 4XH2B 3FN0L 4BQ6A 3CLEH 1ZVHA 2Q86A 4PGDB 1RFDH 1ONQB 4X7SH 5E70A 3MRDB 1ZHKB 4OGAC 2W9DL 1J5OH 4UIKL 1M7DA 2C3GA 1VGEH 3MUY1 4Z9KB 3D87B 4ZMAT 3NIGE 2Z0BA 3FMGL 1UXWA 4JY4A 4GAYA 1MCFA 1AY1L 4JM2A 4KGJA 4Y4HD 3KG5A 2P8MA 1KTKE 2PYED 3ISWA 5FK9A 4GW5B 2HFEB 3KLSA 1MREH 4PLOB 1KT2A 3NAAL 3VXNB 2VDRL 3QISA 4AEHH 3IDNA 5DEGA 3HR5A 5GQBA 3AU1B 3MLYL 2G60L 3P9MB 1UXSB 4LRIC 2R0ZL 5E7FA 2CRIA 2HTLD 2X89A 3BH9B 3RNQA 2VXSL 2HFFA 3RL1B 4YC2B 5I18H 1MIEL 4JPIA 2HRPL 3ZTJG 4LPXA 5AEAA 3EUUA 1X7QA 3Q3GB 4DKFH 2VXUH 4LCCC 3S36H 1WTLA 3O45A 2FECI 4Z7UB 4L29B 2R29L 3BGAA 4LIQH 1ZHBA 1QPXA 3IXAA 5H94B 4B5EA 1QFPA 5J13C 4ELME 1H15B 1OW0A 3SY0A 1E27A 1ZT4A 4HSQA 2DI9A 5E08H 3AAZB 1X5AA 1VESA 1X5IA 1UM4H 4I2XB 2HTLC 2ESVB 2XQBL 1KXQE 5B38A 1AJ7H 2Z31B 4FQIH 4JDVB 3UJTH 4K7PY 2WWMD 5IB2A 4L8CA 1Q9OB 4LSUH 4MAYA 2OI9C 3ULVC 4XCFH 4Z7OF 1WCBB 4LARL 4CMMB 1F6AA 4NPYB 1U3ZA 4XPGL 4RWYL 1YN7B 2VXVH 1ZHLB 4ONHB 1MHPL 3BN3B 4NO2A 1WZMA 5DDHA 3PWVA 3GSRA 4YWGH 4J2XA 5GGQL 2NW2A 5KS9A 1O7SA 5HGHB 1FNAA 2D7PA 1PSKL 5CSZB 4P3DA 1DQMH 2WWMC 4TRPH 2HWZL 3VXSE 4AENB 3NZHH 3NCJH 2WUBL 5JQ6H 5BCAA 4KDTC 3VXRE 4YHKH 2B5IB 2NY2D 2ARJB 2EC9T 4HD9A 1JNNL 4F9PA 3RTQB 2J8UA 3QUYA 3WYRA 2VISA 5GGTH 1EV2E 1S9YB 4JN2B 4XBEL 1P53A 1U3HB 5C08A 4PJHE 3G04A 4H8WC 4I0PD 5HHOB 3FB8B 3FT2A 3ULSA 4NGHL 4PBXA 3ILPB 1WEJH 3WFDL 5ISZB 1NGZA 3K2UH 1WZ1L 4N1CA 2AJZA 5DHXB 4JN1H 4OGYL 1OGAE 4ODTH 3B83A 3X11B 3E6HB 4ERSL 5C6WH 2ZG2A 3CCHB 2JCCF 1JK8A 2BVOA 5EZJB 5FA4A 4ACPA 1TZIB 3B2VL 3VG9B 3LB6C 4LPYA 4JFEB 3PWPB 4MYWB 1E6OH 4NIKB 1CGSL 3KYOA 1D3CA 4I3SH 4OFVA 2F8XC 4ZO7A 5I6XB 2QQNH 2MCPL 2IGFH 4PJAB 5I1DA 4WFFD 1HOCB 5KVFL 1X5LA 1T4KA 3MRJB 3O81A 3BW9A 2JK5A 4DZ8A 4I0PC 1UG9A 3R1GL 3SE9L 5T5FL 3V4VL 1CDBA 3RX7A 2MMXA 2O5YL 4I3RH 1S9KC 3ULUH 5D7LD 3KWWA 4ZOAA 3PWUA 2FO1A 1WV7T 4WY7H 4D9RD 5JORA 3AFLA 2Q87A 4XNXL 1T2JA 1FNSL 4HT1H 5ADOL 2AXHA 4PV8A 4J3OC 2W92A 4NJ9H 3OAUH 1TTGA 5JXEA 1FNEB 5M94B 2A73B 3GFUA 2RHEA 4Q9QL 1SYSA 4ZSOE 5CHNB 5C0EB 3KXFB 4QRPD 1FYHB 1N2RA 5K9QI 2Q8BH 3P4MB 4XCCL 5DLMH 5FM5O 4E41B 3PP3K 3TZVA 3QNYB 1MCCA 4NDMB 2HKHL 3MNZB 1K5NB 1Q0YH 2OQJA 2WINA 4WI7A 1MPAH 3S97C 1FNGB 4MDJA 5A2FA 3GRWA 5FKPB 5IB1A 1QNZL 1U2CA 2XXMB 4KU1A 5D2NA 3SDDD 3L6FA 4KK6D 3O2WL 4TQEL 1IEBB 1UWEL 5FUZH 2F53B 5KSBB 2IPTL 1RZGB 5IQ9B 4YR6A 4XXCC 3VFNB 1U93B 5BQ7A 3RU8H 5EO9B 4BFGA 4ODWB 4Y2OA 4CVZA 5ID0B 1JRHL 5GJTL 2JIXB 3OKMB 3B9KB 4QXGH 4KGLA 2PW1A 1MJ7H 3BPOC 5I1AB 5GGRY 3NH7L 1VFAA 3OXSB 1WITA 1SJVA 2XXCB 1BMGA 3WHXB 4NM8L 4FQJL 2X1QA 3FN3A 1ZEAL 3U0PA 3MODH 4RRPA 5CSBA 1LDPL 3JWNC 1S3KL 3RL2A 3T0EB 4Q9CA 1VADA 1K8DB 2GSGB 4IRJD 2NXYD 3SDDC 5BRZB 3CZFB 1BD2E 1ED3B 4KK6C 3DUUB 1MHCA 4X6CB 1CIUA 4O2EB 4OLZL 1EVTC 4Y1AD 4MA3B 5E6YA 1IJ9A 3PHOB 5HTSA 2HYMA 2LAGB 1DBBH 1OVZA 5E8DH 2BNRB 2EIZA 5C2BH 1KJ2A 3IT8D 2Q76B 5F9WC 2BY0A 4M7LT 5DQ9A 1RVFL 3T4YA 3BP4B 5DD3L 5DUBA 5D72H 4X8JB 5B38G 2VC2L 1CR9L 1RU9H 4JFDB 1Q9WB 2BHZA 3RVTC 1JMXA 2RQ8A 1KIQB 2A9ML 2XNAB 2PO6B 2AK4B 2FGWL 1JHLH 5DRNA 4NZTL 4YIQA 1VGKA 1LNUB 4S10A 3IJYA 2X05A 2VDMH 1U36A 4LLUB 4IRJC 2NXYC 2BNQA 3ZKXB 1R3HA 2G5RA 2VLKA 2WV3A 5HY9A 5IK3B 3ZKND 4KTEL 4K7PL 4NNPL 2W65B 1UB6A 4ZPTB 3ZYOA 4PJ7E 2BP3A 2D0GA 5TDNB 2XKNA 5EU5A 2NY0D 3TNMB 4XP6L 1DUZA 1JTOA 3QNZA 3UTZA 3MXVH 1DANT 1CD1B 1AD0B 4XCEA 1PJ9A 1GIGL 4Y5VC 1LEKB 1XIWD 3VGEA 3KJ6H 5DYOB 3RWDA 3AXLA 5FO7B 5C0CB 2CLZB 2MQ0A 4U1IB 5D1XA 3LS5L 1RSFA 4GG8A 5EBWB 3RPIA 3FQNA 1INDH 1ETZA 1MHHB 3C6LB 1NCAL 4HKJB 5E8OA 2GEEA 1IM9D 3QFDB 4UT6H 3BP6B 3ZKNC 4NZUH 4N5ED 5GRXG 5B22A 3RWIB 5IR1A 3ZL4L 4ZPVB 5DZLA 1KIRB 2AJSL 1FH5H 5AD0A 2NY0C 4MDIB 2DI7A 4UOJA 2BRRH 3DARA 3DROB 3B5HA 3ULVF 5E99H 3FQTB 4N9GA 5JDSB 3HUJB 1XIWC 5D6CB 5DMKB 2KH2B 2JE8A 3PV6B 2AV1A 3G5VB 3NPZB 5IB4B 4UZGA 1DQLL 2GIYA 3B2UD 5HI4C 4GKNB 1KCVH 1FVCB 1G7MB 3DGGA 3SDXA 4PB9H 1ITCA 3WE6B 5I0ZA 3C08H 1B6UA 1MFCH 1FLRH 1JZ7A 1HSBA 5F1NA 3PP3H 3S96B 4WVRA 3HNTL 2P5EA 4NKIH 4HIEB 1JTPA 3T3PF 4XPHL 1Q0XL 5D1ZA 2AQ3A 4MNQB 3KNBB 1DN0B 4GLRI 2B4CL 4N5EC 3VH8A 4OZIA 1A3LL 4U1HA 5D96B 1KIPB 4KMTH 3RAJL 2VXQL 3W2DL 1UH3A 1F11A 3T1FA 1DFBL 4RFEB 3GMLA 5KJRL 3O3EA 1XZ0B 3O6KH 5HHMD 4YHLL 5JOFB 4JRXE 4QHNB 5FHBL 1ZS8A 4U3CA 5DK3A 4PB0H 3M45A 1V8HA 1QSFA 1UEYA 3T4AA 3UDWC 3NCFB 3B2UC 3WD5H 1GGCH 4PJ5E 3ARDD 4NNXA 1SBBA 3CDYA 2ZCHH 4PJEB 4OLXH 3CFEB 3AM8A 1FO0H 4FFWD 5F89A 4OIIL 3A6BH 1TIUA 3MRRB 1A6WL 2D03L 5E00A 5CP3H 3B6SA 5T3ZL 3WHE1 2C4FT 2YKLL 3QG6B 2E6JA 1ZT1A 4G5ZH 5D1QD 4ODVL 3BXNB 3LKNB 3F5WB 3MACH 2JB5L 3VA2C 4ZDHA 3PL6B 3IU3B 3L3KA 4OUUA 3UJIL 4PLJD 5GS2D 4U0RC 5E4EB 5EOQH 1W8NA 5HYJE 3RUGF 3VXUA 1DBMH 3NZ8A 1QG3A 1EBAA 4Z95H 5SWZB 3ARDC 1PKQE 2V17L 3IETA 4P0DA 4P5TD 4PJGB 3FQWB 3CNKA 3O41A 4FFWC 2XWTB 3QO1B 3TH3T 4WEMB 1OWRM 1JTTA 3MGOB 4WHYH 5FGBA 5MHSE 4UUJB 4I0KA 4UDUA 3TO4A 1VPOL 2SEBB 3EDJA 3U4BL 4HC1L 4X7CC 5D1QC 1T0NA 2P4AB 1KB5H 1J87A 1YDPB 5JUEL 1E4JA 4GQ9L 4D3CL 1FVEB 4MD5A 2BY2A 1RK0A 4G8EB 4ZTOL 4GG6A 3BGMB 5DQJA 2BFVL 1HHJB 3TBVB 1HNFA 1ZA6A 2HVJB 2LFGA 4TTDD 4F7MA 5D7KE 5E5MB 4FTVE 4PRIE 2FIKA 5KTEH 2I27N 3T2PA 3TT1L 4B50A 1RZJL 4LU5L 1OF2A 4U33A 2JELL 5CEZL 4DKAA 2DQTL 1LO3H 5DC4B 4HUKB 1OP3K 5F88B 1JL8A 3D39D 3L1OL 3D85D 2VDQL 4YDJB 3DO7B 3WIHL 4M3KB 1KEGL 2YA2A 3FN9A 5I15L 1HZHL 3SO3C 1A0QL 2YS4A 4OIAA 5I8CA 1RIUL 5F3BA 4KJYB 1J8HE 4OCXH 3RY5A 5HJ3B 4X6BA 4M1DH 4DW2L 1FZOA 3DBXB 3MJ6A 4HAGA 5JHLH 4E5XA 3P9LA 4TTDC 5L2JB 4I5BB 1YEJL 2VKWA 4EI6B 3WFEL 4Z76B 5D93C 5EN2A 4P3CL 1KLUB 2C1OB 1TTFA 4KRPD 1Y18A 4WFGD 2X4OB 3B3IA 2YPLD 5CJOL 3KDMA 4C54A 4D94A 3BN9D 5JXAL 4NO5B 4KV5E 4F3FB 2EC8A 1UYWH 3PQYA 2Z92A 2IQ9H 4X7TB 1J1OH 4PRBA 1QQDB 5C0FA 4G6KH 4HS8L 4YBHA 3VWJD 1IGCL 5FOBB 2EIDA 1QVOB 5E5UB 3NCEB 4LLVA 4DOHE 1FRGL 4UOW1 4WCYL 4V2CB 3LS4L 3LQAH 3VFRB 5DVMA 2GTZB 5DD6B 3QNXA 5EULV 3LQZB 4HXAL 1HK6A 4C56B 5C09B 3RVVC 5EZIH 5GJSL 1D5XB 3UTSA 3DRQA 3I50L 2NY1D 5L0QC 3NFPB 1LO4L 2F9BT 1I3UA 5F1IB 2C7UB 4HIXH 2IAMD 1J10A 1NAMH 2UZYB 2VL4A 2R0LH 3PWJA 2MKLC 3CLEL 3CH1A 3BN9C 3AS3A 2Z91B 1EZVY 32C2B 2R2BB 2VXTH 1RFDL 1FJ1A 4OKVB 4P2OD 3SOBH 4GBXA 2JJSC 2GT9B 1BIIB 1U8NB 3EJYC 3N50A 3RBGA 1ZANH 5AWNH 3MOAH 2Y36H 3DVIA 3QEQD 1U8QA 1VGEL 1EO5A 3VWKB 3WIFB 4FABH 1KJ3L 1RUQH 2WP3T 3BD5A 4M1CD 4DQOH 4XX1E 3RWHB 1C08B 1BF8A 3I3BA 1HHIB 3G6JB 3L3JA 1I3RB 1MFNA 3KAAA 3MFFB 2P1YA 3UBXA 4OFYD 5H37H 2DBJA 2NY1C 3O8XA 5GZND 4LGRB 2IAMC 1A4KB 4MCYA 3VH8G 4ZYKB 1OPGH 3LN4B 2ICWJ 3GJFK 5CJBA 4RGMC 4P2OC 1P1ZA 1IKNC 4UTBH 3JWOC 4G8GD 5IW1B 1BX2A 4JPVL 3EYSH 1BVLB 1IMHC 4GQPH 2VB5A 1VKXB 4J3VA 1ZK9A 4LOUD 2VXUL 3S36L 4M1CC 4P2QB 4QY8B 5EBGA 4PJ8A 5HGDA 3DMMD 5I1GH 2I9TA 4YXLL 5IVXE 43C9A 3RI5F 2ADGA 4QHMA 1FGNH 2VZVA 1F3DJ 1NMCB 1FBIL 2F54E 2IANE 5LAXA 5GZNC 4LSTL 1NC4A 1R5IA 4J1UB 5CJ5A 1TJGL 3AMKA 2X4SB 2CUIA 1BP3B 3H9HB 1D5ZA 2DKUA 3GKWH 5L8JB 2V5SA 4M7LH 4KI1A 5F96H 2NYYC 3QR2A 2G5BA 1G6VK 3KPSA 4NYLA 1AJ7L 5IM7B 2BSTB 1NUGA 3UJTL 1NQBA 1RUMH 1OP3H 2WIIA 1DLHB 3DI2B 3N1PC 2ICWB 1BBDH 3CUPA 3HC0A 5MENA 4BSWB 3L95B 4MHHG 1C12B 3DMMC 4Q7DA 3RVXD 4YDVB 1RJCA 3VXMD 1RK1A 1FL3A 1T22A 3QDHA 4JKWA 3LKOA 1ZLVK 3QUXA 4YK4C 1ZVSB 4RAUA 3MRFB 1IE5A 4ZAKB 3P9WB 4PJIE 4CW1B 3C87A 4IIQB 4GXVH 2VLJE 1KCRH 4P4KC 4ELKA 5FV2A 4XX1G 5DRWA 1GVIA 3F8UB 2V9QA 2OTPA 3LV3A 3QIUA 1WWAX 4FG6D 1TLKA 1DQML 5EA0H 4TRPL 4UAOB 1AC0A 1R3KB 2BVQA 4M6MH 5HYFA 3C60A 3NCJL 4O2FA 4BH8A 5JQ6L 2E7LC 4ZFZA 1U91B 1MRCH 1DBAH 1HWGB 3ILQD 4YHKL 4EKXA 3HI6L 3AC0A 4FQQA 5DURD 1CIDA 1D5IH 3JWDL 3RVXC 4P2RE 3QULA 3VXSD 5I8OH 3UPRB 1YUHB 2BOCA 2KQMA 1LWRA 3VXTA 2A1WH 4QRRE 1T1ZA 4M62H 1RZKH 2WNGA 4Z7VA 1HQRA 1QACA 1DUYA 3VD9A 4TUOB 4JM2D 1P5UA 3TA3B 3V5DB 3WFZA 3K2UL 3BDBA 3EFFB 5EZLB 4FG6C 4JN1L 4C55A 4OZGE 4H0IA 5CFHA 2QQQA 3UTTA 3ILQC 4S1QH 3GBNH 3SKMA 2X89D 1E6OL 4NJAH 1AFVH 3HE7B 2K7PA 4NWUL 4PG2A 5T1MB 4LKCB 2PNDA 12E8L 4EUPH 3D18B 3DX8B 3THMH 2FEDC 3GMQA 4HBCH 4Y4FD 3FQUB 2QSVA 4AH2B 1GZPB 1BQUA 4JM2C 1T89A 1YYLH 3WEXA 4Y5XA 1NMBL 2DQHL 4KKAD 1S7QA 4JY5H 2UUDK 3GM0A 4MNGA 1FFQA 3ULUL 4F7EB 1DQQA 3BZFA 5KAQG 4MD0B 4WY7L 4I48A 4UQ3B 1DQDH 5J7CC 4KJWD 1OSPL 3GJFH 5D7IF 3Q48A 5KVDH 2P5WB 4OBSA 5EIQA 3U36B 4P5MB 1HXMA 4HT1L 2V7NA 1A7RH 4PJDB 1TFHA 1P7QA 3OAUL 4HJGA 1R24A 4LL9A 4HUWA 4PRAA 2QQKH 4X6DE 3DXAE 5D2LE 2ORBL 4MAYD 5DLML 1ZKAA 4P23D 3TH2T 1J05A 4IOIA 1L6ZA 4XB7A 4OD3H 5F7WC 5DK0B 3QZWB 1Q0YL 3OKLB 1D5MB 1OGTB 3MRLB 1B0WA 4PRHB 2EEBA 3IB4A 5LJYH 4OF0A 3U9UA 2EIBA 1A4JA 4L4VA 2QQLH 3BPNC 4KJWC 1UACH 1A7NL 1BZ7A 3EZJB 1KULA 4P9HH 4WO4A 5GRVL 5FUZL 1CFTA 4F2MA 3T77A 1BFTA 3MUZ1 4NQDB 1S5HB 2UYLB 5DJ8A 5D4QA 1U8HB 1RZ7H 3QUMH 1EFXB 1U58B 2DJUA 3ZT7A 4PGDA 3HC3L 5CJQH 4MAYC 2Z4QB 4QXGL 1ONQA 2PYFB 1VENA 1MJ7L 4P23C 1YY8B 5I8EB 4ZUUB 3MRDA 1ZHKA 4XPTL 1RZFH 2W59A 1ZLVH 3CXHJ 3U7WH 5I71B 2DQCH 2CMRL 2CKBA 5A43C 3V5HA 1I1YB 4JPWL 5F6IC 3CFJB 3MODL 3QUYD 4Y19B 3C2SA 3RGHA 2A6JB 3O6LH 2O61B 5B39G 4KUCD 4KK8D 5JTWA 1S9VB 4GW5A 1NUFA 2HFEA 4MSWB 5JMRA 3D0VB 3VXNA 5MEOB 1MLCA 3BKYH 1KGCE 2PTVA 5E8DL 3AU1A 2Z8SA 5C2BL 4DCQA 1UXSA 2V7HB 5SWSE 5MI0C 2IFFH 4H25B 5D72L 4JDTH 4NKMB 1FYTB 3OJDA 2VAAB 1RU9L 4NN5B 4X9IA 1D7FA 2VITB 2ZSWB 1PQZB 4BUGA 2BNUB 3MNVA 1HHKB 4Z7WA 5C9KA 4ZQKA 3Q3GA 3QUYC 3SGDI 5E9DB 4Z7UA 4L29A 1RZ8A 2Q20A 3CSGA 4KK8C 2V9TA 1JZ3A 2AS5M 3C5JB 5H94A 4ONFH 2EE2A 3CFKB 4DGYH 5C0RH 3CH8A