3U9UA

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
219
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGIGVGWIRQPSGKGLEWLAHIWWNDNKYYNIALRSRLTISKDTSNNQVFLKIASVDTADTATYYCARIPDDHYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fab Heavy Chain
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 219
sequence length 224
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uA01
4XTRC 3S37H 3MV7B 5GPRA 1NCUA 5ID1B 1OF2A 5IBTL 5GRVL 5D5MF 3DARA 1QEWA 4K7PL 3DV4B 1MWAA 4MCYA 4LCWD 5BO1L 3MRCA 1YN6A 3UEZA 1CK0L 1MCRA 4M1CC 3LKOA 3D39A 2AEPL 2XN9D 1U58A 2R29H 2J5LB 3LEYL 4J3UA 1U8PA 3VFTB 4HEME 1RU9H 2BFVL 5T3ZE 3MJ9L 2AAVA 3TA3A 5CLWA 3AS0A 4EZMA 1HH6B 5T5NF 3ARZA 3RY4A 5ISZE 5DQ9B 4LSTL 2XXCB 2CXKA 4OM1L 4MJ6B 2AKRB 1N64L 2VDOH 3EFFA 3WKML 3PDGA 4HWUA 4BH8A 4DVBB 5DMYA 1YYLH 3X3GL 5EBLA 3L3HA 1A7OL 2FGWH 1T22A 5CEZL 3MBEA 5I30H 4Y5YB 5IMKB 5FYJL 5ADOH 1UFUA 5C8JB 3CFDB 2DQCL 5EZLB 1M7IB 2EH7L 1V3LA 4G9DB 2HP4A 3RNQB 4KVCL 3TV3L 5KS9F 1ZLUK 4Z8FL 2C3VA 1HYRC 4X5XB 1ZS8B 5DGRA 5KW9H 3PXHA 3DSFL 4CW1A 3O6LL 1FO0H 2OZ4L 5J13C 1YPZE 4EDWH 2ZUYA 3ZYIA 2XA8L 2M26A 1HHIA 2MJWA 3T65A 2AJZA 3IXAA 4NNXB 1SY6H 3BW9A 3OGCA 5DJCB 5EU3A 2R0LL 1A4JA 1LO3L 4X6EA 5F44A 1RUML 3SN6N 4QGYA 5DK0A 1DBAL 5HVHB 3N06B 2PO6B 2R39A 3U9UB 4OJFL 4LASH 4OF8A 3OKYA 1N59B 2K7QA 4EIGB 3FQRA 2AJUH 4FFYH 4U1MA 5EWIH 2XWTA 4C83A 4KRPC 3GDBA 4F37K 1AJ7L 1B90A 3RZCD 4PJ9C 4KXZI 3VXUB 2IG2L 4PJ8C 1S7UB 1HSBA 2J4WH 3UAJC 5BRZA 1HIMH 4WFHD 1KELL 2WK2A 2IJ0C 1OWRM 1HNFA 3JV6A 25C8L 3QIUB 3F58H 4PJBF 4H1LG 1F3DJ 2V6HA 1CT8A 5D93B 4JN1L 3RJQB 1ZGLB 5JOEA 5IUSA 4FQ1L 1MVUA 3NCCB 1QFWL 5I1GL 3VRJB 5E2WL 3QI9A 3H0TB 3WLWC 1TCMA 2IBGA 4HV8B 2R2HB 5D7LE 4HH9A 1L7TL 1FFRA 1LEIB 3ZE0F 2H32A 1FG2A 3ZKXC 2BHYA 4WFED 1SBSH 4PJ5E 4XTRD 1AP2B 2HJKB 4S0TD 5LGJB 4U33A 1GC1H 4HS6A 4NC0B 3OKKB 1WT5A 1FNGA 3FO1A 3QG6B 1EIBA 2WUCH 4QHKI 3GJEB 1R5IA 4M48L 3CVHL 1E4XL 4OFKA 3QULB 3VXME 4AEHH 5BMFL 1BAFL 5ENWB 4H5SB 3MCKA 4M1CD 1IFHL 4M5YL 5KTEL 4L3ED 3IS1X 3KLAA 4PY8J 4WNQA 4O2CA 1RJLA 2YKLH 1AIFB 3IGAB 4HQQL 1KCLA 1BQLH 4UNUA 1HHJA 5B8CA 3G04A 5IB1B 1NCAH 1JRHL 3VXTB 3OAYK 5ICXB 3F5WB 5L2JB 4HIIB 1Z9MA 4KDTC 5IR1B 4HPYH 2GY7B 3UTSE 3C6LA 5T3ZH 1DP0A 3NGBC 1KLFA 3MFFA 2G2RB 5JQ6L 4Z7UA 3E8UH 5LG1A 3WIFB 2GHWB 2X2YA 5GSRA 1S5HA 5B39B 5D2NC 2Q86A 3ZT6A 1LP9A 3L9RB 1YQVH 4Y5VA 3I9GH 4KJQC 2NXZD 1I7TB 3TNNA 4F7MB 3K4ZA 5CD3B 2ZSVB 3KXFD 2VLKD 1IGCL 3TBVA 5L88H 1I1FA 4I0PC 4N8VA 4XP9L 1R3JB 4YHKH 4YUEH 4GLRI 2AK4E 4QRRE 3QEHB 4PY8I 1ZAGA 4Z5RA 2VKWA 4JM2F 3HNVH 3FTGA 2W0KA 1FFOB 2R4RH 4NQXA 3UTTB 4WUUD 5BS0B 4BH7B 3AAZA 3DO3A 5DUML 3UXFA 4X9GA 5FA4A 4LQFH 2F9BT 4W6XB 4RMUA 4YHPB 3EO1A 5JDSA 1FRGL 1BWWA 1H3XA 5DA4A 3T08A 2IPTL 2DJSA 3QIBB 4WTZA 2DLIA 3GMQA 4GSDL 4Z76A 1FFNA 3KLHD 5F89B 5DVOA 2R0ZL 1NMAL 5CEZD 1QRNB 4XP1H 4CVUA 2OR9L 4ZSOE 1TZGH 1BX2A 5FYJD 1KB9J 4PJHE 4U1LB 3Q5OA 1GSMA 3D3VE 4RA0C 4UNTA 3G08A 3N85H 3L6FA 1J1PH 5EA0L 3MRFA 4KRPD 2FLBT 3SHSA 5HDOA 1RUPL 3KPSA 1UACL 5FUZL 1MY7A 3I6GA 1D9KC 1G6VK 1OPGH 4H0HB 4PJ8D 5FEBA 4NKOB 4XVJH 2E7CA 4Q6IC 3UAJD 4QGTA 1HDMA 2ZCHL 2R1YA 1GGCL 5ESQA 2LABA 3FFCE 3EYFB 1I7ZB 2F53A 4TUOB 4W6YB 2DMCA 2VXQH 5JHDA 1G9EA 5F1KC 2YPLB 3SKOA 1AKJA 2RCSL 3MV9B 3OR7A 2DBLH 2AEWA 4LMQE 4JB9H 2O61A 3ISWA 3VXNA 3WS6A 4EOWL 1Q9LA 2Z31B 4JHWL 1OT2A 3FOLA 4C4KT 1JNHA 5ERWA 2QL1A 1N8ZA 3HC3H 4XXCA 1KOAA 2HKFH 4GOSA 1NCBL 2NX5B 3HZKA 5LWYL 2X4QB 1HINL 5JOFA 1ED3B 5J57B 3P4MB 3LKSB 1NSNL 4QTIL 1ZHLA 2VLRB 3PL6A 4JREB 2FBJL 2VERN 3TEUA 1XCQB 2J88H 2I60H 2Y4SA 4WI9A 1JWUB 5KVEH 4HG4K 1XIWC 3DJ9A 3O45B 4AH2A 4YXKL 3VFUA 5GS3A 2B4CH 2H26A 4ZXBD 5EIQA 1K2DB 3PP4H 1HQRA 4KKAD 1OOAA 5F6HJ 4U6VL 3QUYD 3G5YB 1J0ZA 5LCVH 4YH6A 3MZGB 2P5WE 5DWUL 5ESVA 1MREH 1DUZA 4PRIB 2Q7YA 4P59L 1MPAH 4HJGA 3L7FA 3B3IA 4UAOB 2OSLA 3DO7B 1ZE3C 2FNBA 2FYYB 3FQNA 4NZTL 5I0DA 3V79C 3WFDL 3DRQA 4XNXH 1ZVHA 5IM7A 3OF6A 5J3HD 1YMMD 1CXLA 5DUPH 2VABA 1UZ6E 3OHXA 4X6CE 5C08D 3H6JA 3HMWH 1E6OH 4IIQC 1NC4D 3LN5B 1C16A 1TETH 3J7HA 12E8L 4HC1L 3BXNB 4I0PD 1T0MA 4XPAH 3TCLA 5GGSB 3QFJB 4PBVC 1ZA3B 1G7QA 4OM0H 5HHVL 4MCZB 4MA1B 3AS2A 1DQDH 5C0BB 4GKNA 5F6HI 5IEKA 4PB0H 1NBZB 3T4AB 4U6YA 1CLOH 3GO1L 4NNPL 3BQUC 5HHNB 4IRJD 3UPRB 4CL7A 2ITCA 3GSUA 4Z7VA 5IROA 3QUXA 1A5FL 4XRCA 5CP7A 4JRXA 5TDNB 2P1YA 1JUFB 2FIKA 3MODH 4O9HL 3VCLB 4PRPB 4N0YL 4NC1E 1N2RA 3HZVA 4B5EA 4WVRA 3FOMB 2LQRA 3UTQA 3STLB 3ZYOA 2CK0L 4Q97A 2VZOA 5DR5H 4Q9CA 2CDGA 2DMKA 1FE8H 3INUH 4EJ1C 5K33A 1Q0YL 2MWCA 1UADC 5JA8B 3GMPB 2GK2A 3NIDF 1ZT1A 2PYED 5DFVC 4PBXA 4LLVA 3GI9L 4JLRB 4YQXH 3RWGB 1S7WB 1D9KD 2E9JA 2Z91B 3O2WH 1TLKA 2JIXA 3WO4C 3QEQB 2WW8A 5SWZB 1UCBL 4UT6H 4KKLC 5DJ8A 3BP6B 3UBXA 5GSVA 5E1AA 4G43A 4KDVA 4JQXC 1I9RH 4HUVB 4N0FB 5IMMB 1AGFB 5L2KD 2APWA 3BUYA 1E27A 1GAFH 3IVKA 5SX5H 5DMIL 5M95B 4Z7OF 1I1AC 3ARFB 5JIPA 4U1SA 4Z78B 5KN5B 3NAAL 3WE6B 3WN5B 1DEDA 4KTDL 4JN2B 4P5TC 5DUBB 3ZE2E 3KYOA 1X5HA 4RQQA 1DN0A 4X6DB 4ZNEA 1INEH 5IBLC 3ARGC 1GXEA 2B1AL 1BPVA 4DGVL 5IFHL 4EUPH 2GTWA 1KPUA 3O4OC 4GMSH 1W0WB 5A2FA 3VGAC 4PJDA 4G7YL 4FNLH 1U8IB 2HJFB 1E0OB 5C9JB 5H8DA 4NNYA 5C0EB 2CDFB 5DURD 4F7TB 4WI7A 3QZWG 4N0UB 2IAMA 3PJSB 4UV7H 1DQTA 1JV5A 3C09C 2DDQH 1FNSL 2BZDA 2EYSB 3M45A 3MX0A 4YHIB 1A0QH 1D5MB 1OAQH 3R1GL 2DLHA 1EEUA 1VFAA 3EFDL 3DX6A 1J1XL 1UYWL 4UT9H 5DHYA 3PWLB 4OUUB 1G0DA 2WLYA 4RFOH 4WDIB 1NFIB 3ARRA 2VNCA 4XX1E 5F21B 4G6KL 2OMNA 3T0BA 3CZFB 4M4RA 1E6JH 1NFDF 3RVTC 1MAML 3NCEB 5SV4A 4X7SL 2BOCA 4Y1AD 4I4WA 2LAGB 3MYJB 1FNFA 2CIIA 4HKJA 5T1LA 3MLYH 1KB5H 4JO3L 3STZB 2ADJB 4JFDE 4DUWA 3QR2A 1XF1A 4JR9L 4XCEA 1C5CL 4K55A 3OKOB 3P73B 4OCMC 5T33L 5GISH 1NBQA 2DLTA 4J3TA 1PFCA 5IVNA 1XGRA 4UIKL 4WHYH 5DK2B 4R4BA 4LLUB 3MLSH 4OCSL 1KIRB 1BLNA 1FL6A 5D1XC 5K9KA 1T6WA 3NFNA 5I6XB 5TPWL 1MJ8L 4Y4HD 1BREA 1WAAA 4WHTB 4F57L 2NY1C 5HHPA 2OL3H 5F7EL 4U0QB 3E3QE 5KJRL 3EYOB 3N1MC 1I9IH 5D7IE 4UT7L 1AY1L 3GGWA 1ODAA 5IBUB 2VZ1A 2Y9RT 5EU6D 1DQJA 5H2BA 2VQ1A 2X1QA 4D9RE 1CBVL 5I8OH 1S9XA 3BQUD 3DVIA 2FDBP 5HI4D 2Y6SC 4FP8H 5IOPB 3LN4A 3TCXA 3ZMRA 4BYHA 4YHZL 1CFSB 4IRSC 1G7IA 1FO0A 3BP5A 4OLXH 3LDBB 4PGBA 4RAVB 1WISA 4X4XB 5I9QB 1V7NH 4J8RB 5E5UB 2YXMA 3STBA 3RIFK 2GJ6E 3TBSB 1ZLSL 3QDJD 1D6EB 1U8NA 3T0EE 5IHZB 4V2BA 3T2QA 1PG7W 2I9LB 1MCFA 1CN4A 1NCCH 4ZUTA 5D7JD 4LEOA 5HD8C 5DFVD 1FDLL 3VW3H 2C1OA 15C8L 1MOEA 3VD5A 1IGFL 2G75A 4X6DF 3TIEA 4QHNB 3VRIA 2UYLB 4ZAKA 3BDYH 1LO5B 3LEVL 4DAGL 5KSUA 4TVPE 4KKLD 3GSQB 3I75B 2R23B 4F2MB 4HIXL 4LFHG 4KQ4H 4ZODA 1IKFL 2UZIL 5I15L 1OAUH 3C6SB 1U8KB 4P23A 5F93C 4LIQL 5E99L 1I1AD 5A1AA 2FLRT 1CXHA 4JY6A 4X6BB 2B1HL 3MMEA 2XPGA 3AS1A 3E6FA 1LDPH 5F96H 3L95B 3VJ6B 5IBLD 3ARGD 3S35H 1FL3B 2FWOB 3T77B 3SGEI 3UJTH 4KRMB 4M62L 2VXTL 2X40A 5CWSB 2HRLA 1TJIH 1JI1A 5F7DB 1MCHA 3SJVD 4XGZA 1G84A 1SJHA 4EN3C 1F6LL 3HC0A 2OJZL 4H1LH 2VQTA 1QSFA 2F54D 3DXAE 3QUMB 1BZ7B 2VXUH 2LU3A 32C2A 4XBGB 4MAYC 3WUWG 4F7PB 5HHXH 5B38G 3PDOB 2Y07L 3GHEL 5F3BB 2H6PB 3H42L 1OAZL 4ZYKA 1G6RL 1F3RB 1P7KB 4KY1L 2ATPA 4OTXL 2Z8VC 2Y7QB 5DT1L 3OKEA 3GMLA 1I9EA 4Y19B 3RVTD 4DOHE 5KG9B 4GQ9H 2NY2D 5KAQG 1ITCA 2XNAB 1M71B 2DLGA 4P4KB 4OF7A 3AUVA 2A6JA 2FX9L 4U49A 1L0YA 4OIBA 3PV6B 1UM5H 1TPXC 4XPFL 1GZQA 2H9GB 2UWEB 4F58H 1YC8A 2ICWJ 5DJYA 1A6UL 1W72L 3H3PH 5E9DD 3C5JA 3JWOL 3CFJB 2ZSWA 5DQJB 3BD4A 5D1XD 4I3SL 1ACYL 3SCMB 5J11B 1CIUA 3RPKA 1BD2B 2JJSA 2NY1D 3QJHA 1EA9C 4DVRL 3AMKA 1A4KA 1A22B 2VIRA 3WFCH 5K9QG 2EC9U 4NM4H 4ODUB 4DUXA 3B2VL 5ISZA 1JNNH 5J56B 4PGCA 4OF5A 4IRZH 5AD0B 2IQAB 1PSKL 1U93B 1S9VA 5JW4M 1EVTC 4XNMA 1ZT4B 4OGXH 1G0XA 1DBKL 5C09E 4JQIL 5LAXB 3HRPA 4HKXA 3WDHA 1CLZH 4GXUN 4TYUA 1QLEL 4HXAH 1KTDA 1QUNA 2IWGA 4X9BA 4PLJC 1U8QA 1EX0A 5IB5B 3PHOA 4O58L 3NOIA 5IW6A 4PJAA 4N8PA 3KJ6L 5GGVY 4Q2ZA 1RZJH 5ANME 4CKVX 5JORB 3P11L 3RVVC 3L7EA 5DTFA 2V5YA 5F1IA 5BV7C 4LSRL 3JWOC 4Q9RL 4OKDA 3H9SB 2YZ1A 3VFPB 1T1YA 2PTVA 2YA0A 2RQ8A 3I84A 5EORL 2JELH 1U8OA 1IAOA 1YPZA 4FXGA 1C12B 3BD5A 4HBCL 5EB9A 1KJVB 2Z4QB 2EZ0C 1IEHA 4OLUH 4IOIB 2P8PA 4XAWH 3NABL 1I7RA 1MFBH 1G7MB 2X4SB 2NXYC 1HI6A 1JGUH 3VXSD 2A83B 4JFED 1ZA6A 1U8HA 4UDUA 5FUCE 2HTLC 2DBJA 3DIFB 4ELMB 2R56L 5F97E 4HCRL 5LXGH 1DQQB 1OAYH 4U6XB 2KUTA 2YA1A 4U1GB 4HG4J 3FJTA 1OSPH 4WUKL 1T7ZA 4TVPH 5FM8A 2FX8L 1T83C 5GGTH 1F4XL 5E5MB 2PTTA 4RFNC 5C07E 2F74B 4FQ2H 3UO1H 3EJYD 2DM2A 2X89A 4CU8A 5CJ5A 1XGPB 1QP1A 2YUZA 1RURL 3O0RL 4K8RL 4EN3D 4LCCB 1P7QA 1JGEB 3LSOA 2VR5A 5L7XL 5DD1H 4QY8B 3KPRD 1AGBB 5EO9B 1RZKH 3D5OF 5BVJB 1DSFH 4MNHA 5IMLA 3V6ZB 5GS1A 1JHKL 2DM4A 3LRHA 5L9DL 4HKZA 3W39A 3PWUA 5IKCB 2AXJA 4JRWA 1R0AH 3IS0X 3LV3B 1BOGB 4GXVL 3DX8A 1JP5A 3GMOB 4LU5L 5D7LA 1Q9KB 3Q6GL 4RMVA 3LVEA 5DRXB 4JFFE 1F5WA 1H0DB 3TBTA 4EI5B 1D5IL 5D71H 2BNQD 4XC1L 3UP1A 4L5FH 3MNZB 1FFPA 4KAQL 2VTFA 4PJ5A 4L9LA 1KN4H 2EH8H 1OGAE 4F9PC 5BZDA 4QCIA 4PJCF 1AFVH 1T0NB 4GRWF 2KBGA 4WFGD 5IW3A 1AXTH 3I2CH 3MRIB 4QRPE 3PG2A 4KJWC 3CGTA 1GZPB 3X11B 4Y88A 5FHAH 3VXOB 2ICWB 5FOBB 4U1IB 4TOYL 4K8RC 5GGVH 3UROR 4RNRB 3G6DH 5F7KC 4PB9L 4YX2H 1OF2B 4WENB 1BJ1J 1KBGH 4FS0A 3UYRH 2GSGA 4P48A 4TRPH 1QEWB 2F5AH 3WXVH 5GS2H 3HI5H 1MWAB 4MCYB 1SJVA 5DYOA 1YN6B 2FL5B 2HH0L 4AG4H 1E4JA 5IMOB 3IDUA 3D39B 3LEXA 1CGSL 1U58B 4EXPX 1RIVH 4WJ5B 3UTSA 3QNZB 1TCRA 5JW4R 5KSAB 4BM7A 1E4WL 4F8QA 1F2XK 5EUOE 3MUGA 4PG2A 5DDHA 2Y5TA 4R97C 2IFGA 3GIZL 4CMMA 4PLJD 1BBDL 3WNOA 4C56E 3CUPA 3CIQA 1UH2A 1MIMH 3EFFB 4WWKC 2VB5A 3MRLA 5FCUL 4OCXH 1XF5A 1BOYA 4Y4KB 3B6SA 1YEEH 3HE7C 5GGQH 3IXTA 5BXFA 5C86A 4E5XB 1T22B 3QNXA 4UTAH 1FORH 2AK4A 3CSBA 4QRRA 3O4LE 1IAIH 4XAKE 2MHAB 3PGCA 1A7RH 3P4OA 4KV5E 3T2NH 1A7NH 3V7MA 1MFDH 4WO4D 1WCBA 2F5BL 4DQOL 2EZ0D 3DETC 2YRPA 4WV1B 1UENA 3MLZL 2C3VB 5INCB 1LO4L 3NZ8A 3NA9H 4G42A 4E0RB 4IBLT 1TZHA 2VZ3A 5F9AC 4YHLL 2HTLD 1A6ZA 2YUXA 1MEXH 3NFSH 4IM8A 3NBNA 5K59F 2J5LC 3O2VL 2KQNA 5HYJD 4R26H 1HHIB 3X12A 1EPFA 4G6ML 4ZSOA 3KYKH 5JDJA 3WFHA 1J1OL 4KHXH 2P8MA 2AJZB 3IXAB 1IC5L 2IPKA 4PJHA 4XHQA 2HFFB 3MRGA 3D3VA 1U3ZA 1JF5A 1ZANL 4MJIE 4X7TB 4LSPL 3LHPL 1A4JB 2EECA 3OKNB 1PYWA 4DTGH 5HDQH 4LARL 5IB3B 4M6AA 3SGJA 5IVXF 4TQEH 4WCYH 2OK0H 2XQBL 3FFCA 3ULVL 3FQRB 3WHE1 1IL1A 4U1MB 4Y5YC 3F7VA 2XWTB 4MD5B 1XH3B 4C83B 3OXRB 4WEBL 5E7FA 4G8IB 1HSBB 4GW1B 5BRZB 4XP6H 5GGUA 3R0MA 3BPCA 1SEBA 2XN9E 1DUYA 2VISB 3AY4C 1KXTB 4LFHD 5B3NA 5I66A 3P3YA 5J06A 1DE4B 5D70H 1SQ2N 3FFDA 1NUFA 3TN0B 3SE8L 4OD3H 4OQTH 1MVUB 2ZKHL 2VDPH 4U3CA 4PV8A 5CJBA 1UWGL 3QI9B 3FONA 3O9WB 1KGCE 1IKNC 1AC0A 4KJWD 4HH9B 3GSNB 3T0XA 1J8HE 3WSQH 1R5VA 2H32B 1FG2B 2EDHA 4K8RD 3D87B 3W11C 5ADPL 2DQJH 1G9NH 1YYML 4NOBA 3HNSH 3ULVC 5EU5B 4HS6B 4UU9A 2PO6C 3T1FA 2NW2B 3FO1B 4FQIH 1C5DA 4JZJA 1JWSA 4GBXA 1BQHA 4OI9A 4W68A 5I8CB 1R5IB 1FC2D 1KFAH 1OLLA 2P5WA 5GZOC 1WCQA 1RSFA 3MCKB 4P2QE 4O02H 2HLAA 3KLAB 1QFOA 3ECBB 2APFA 4XI5C 1FVDA 3KS0H 5CJOH 3TVMD 4WNQB 1WWBX 1FIGL 2OXGA 4O2CB 2P5ED 4TSCL 2BP3A 2HT4C 1XF3A 4NN7B 3AM8C 4ODTH 3D18A 3CPLA 5AUMA 3C60D 5IGXL 5B8CB 5KSVA 3RY5A 3K1KC 2BSRA 1PAMA 3BKJH 1NLBH 4P2RE 3B83A 1Q1JH 5D93C 5AG9A 4X6CA 5H35A 2VZSA 4P3WA 4WWKD 1ZMYA 3NIFF 3MFFB 3HE7D 4HIJA 4Z7UB 1SYSB 2D31A 2W1NA 5GSRB 1S5HB 3KAAA 4PR5A 4HUMB 2Q86B 1LP9B 5K9JH 3E6HA 2W9EH 3FO0H 3A67L 4DUVA 4M1GL 4Y5VB 1MCCA 4Y2DC 2J1KA 3TNNB 4GAJL 1X3DA 5F8QC 4R9HA 2F8XC 3MV7D 4WI5A 2J8UF 1I1FB 3GFUA 4R4FL 4YBQD 1RD6A 1X4YA 2CH8A 5F88B 1MRFH 3L3OB 1TQBC 4HUUA 2YXFA 2JJTC 4C57C 2IMMA 3FTGB 1RMFL 4Z7QF 3TPKA 3OKMA 4ZUUB 1AD9A 3LKPB 3CC5A 4NO2A 4Y2OA 5C0NC 4R90H 4M8QA 4NQXB 2AQ1A 4XCFL 2DQFB 4OFYA 4FZEL 3TZVA 2QQLL 1CGYA 5FA4B 3P4NB 1QSZA 1SMAA 1AI1H 1UVQA 1KJMA 3EO1B 4FG6D 5JDSB 2NLJA 2BNRE 1D6VL 5J9PA 1OAKH 2EDBA 3GMQB 4LK4A 1FFNB 4D9LL 3Q48A 2OYPA 2DQHH 3MSPA 4QXUH 3ZTNL 3QDAA 3V4UL 5D2LE 5ALCH 1C5BL 4Z95H 2CUMA 3MV11 4Q0XL 5IW1B 3O41A 1BX2B 1S7VB 4RWYH 5HDLA 3W2DH 4JM4H 2YPVH 3CDYA 1ZEAH 4NHCL 4G7VH 1F58L 3QIWA 4ETYA 1N4XL 5CJQH 2C4XA 1LILA 5A2JH 4G6JL 1MJUL 4OZFH 2R1YB 1J0HA 2NY6B 3VWKA 2F53B 3BPNB 1SBBA 5A3ID 2QJDA 1B88A 1KEMH 2D0FA 4LRIC 3ARVA 5INDA 3QHFL 1PEWA 3SKOB 1AKJB 1MJ7L 4IOFC 3MA9L 1UQSA 3OR7B 2R4SL 4D94A 2NZ9C 2A9NL 4DKEH 3V8OA 2EC9T 3FOLB 5HSFA 4GG6E 5TE6H 2RGSA 4NJAH 4A6YA 5ERWB 1N8ZB 3LIZH 4YC2B 3MOAH 4IDJH 5C1MB 4S1SL 5FCSH 3W11D 1MCWW 4E9LA 1XCTA 3QIBC 4NT6A 1ZHLB 2QQKH 3OJDA 3ULVD 3HHRB 2O5XH 2EDEA 1YDPA 3GRWL 3S96A 1XEDA 4ZOCA 3PDDA 4YK4B 2IBBA 1Z5LB 5GZOD 4AH2B 4NIKB 3CFBB 1UM4H 1V3JA 4DEPB 3VFUB 5FF6A 3KPOA 1U3HA 4JFDA 5CGYC 2H26B 3VFGL 3V4PH 3WIIL 4R8WL 4XI5D 3ZHDA 4DW2H 1P5UA 3ZT7A 3VFSA 5SX5K 3VXUD 3MRMB 3W0WE 3KWWB 4ONOA 3VXRE 2HFTA 4PJ7B 1EFXA 3HR5A 1U8MA 1J0IA 2YA2A 3V4VL 3BI9X 4S1QH 3QIUD 1CQYA 1R3KA 5HYQA 1BF8A 5ESVB 4Z18A 4H26B 2NZIA 4ODVH 3IKCB 3U0WH 1CR9L 1EDQA 5IP4A 3CX2A 2Z31C 5T3XL 3V5DB 3ZDZF 4DGYH 2WQRA 5IM7B 5C7XH 5D7IA 3ARXA 1ZTXH 3P0GB 2XWJA 2DQIH 4NO0A 3TYGL 1OARL 2DYPA 3EYSH 5SX4H 4D0DA 3DV6A 4L3CA 3CSYA 4LLDA 5DLMH 5FYJE 1C16B 4KQ3L 1W0VA 3T3MF 3D1MC 4KRNA 5C0IB 4JREC 3BFOA 2DOCA 1T0MB 1YEFL 4LHUA 3QHZL 1VPOH 2WP3O 1QYGL 4P49A 3ZKQD 1U42A 4OAWA 4RIRA 5F7UA 2WBKA 4U6YB 2GJ6A 3NN8B 4Z7NE 1BIIA 3T0EA 1S7XA 5I8KL 1NAMH 4KKCC 4GAGL 3GSUB 4WGWB 4TSAH 1VSCA 3AVEA 3QUXB 5CP7B 4XRCB 4OGYL 1CVRA 1SEQH 3NPSB 1JYXA 3A6BH 5C71A 3LKRA 4JRXB 2XYCA 2WZPD 1G9MH 1MLBB 1M6OB 4JG1H 5C6TL 3HZVB 4I5BA 1IBGH 1NEZA 2CKBH 2DL9A 1A14L 4UAOC 3UTQB 4H20L 4KMTH 3UJIL 3CFIC 2A1WL 2CDGB 3P0YH 3PV7A 2DQEL 5GGTA 1FSKB 3SDAC 3U30B 2YPKA 4OZGF 3EOYG 4OV6F 4Y8DC 1ZT1B 4POUB 4LLVB 1ULVA 3RWDA 4U0RB 5IJKA 3NIGF 3D25A 2BVEA 1PY4A 4OLVH 5TDOA 2Z35B 3KPNA 5DJDB 4KUCD 4JPWH 3UBXB 5E1AB 1Z9OA 2HKHL 1B0GB 3LKNA 2DI9A 4MQSB 4EEEA 5GHWL 2XKNA 1E27B 1UJ3A 3IVKB 2D4DA 1XGYL 3OBAA 4MQ7A 4U6TA 4KUZH 4U1SB 3KNBB 1QR1A 2NZ9D 3RHWK 1YY9D 4K7FA 3UTTD 1A3LL 4NZUH 3TO2A 5BS0D 3KYOB 4RQQB 3DXAA 1DN0B 2C1PA 2FHFA 1YMHB 2MOVA 4Z9KB 2GTWB 1KPUB 4UOW0 3RDTA 4PJ7F 5TQ2H 2HN7A 2YR3A 3S88H 3LH2L 2OMBA 3QIBD 3JVGA 4LGPB 1QRND 4RGOL 2IAMB 2VSCA 3O8XA 4WU7A 5JTWA 1JK8A 4DFHA 5I17A 1S78C 2E6JA 5GJTH 4HWEH 2P42B 1VFAB 3EGSB 5F7LB 3VI4F 3DX6B 2X4TA 1F45A 5DHYB 1CGXA 5CGYD 1D5ZA 3BT2H 4Y16A 1PZ5A 3O6KH 4PRHE 1RULL 3VD3A 4QRUB 4BZ1H 2BOCB 2BJMH 4PLNC 4FZ8L 1DBJH 3BE1L 2CIIB 4ODHL 1A1NA 1FGVL 4X99A 5CZKA 1J0YA 1IGML 4D2NA 3QAZB 5GRYA 3ARFC 5I76A 5AAWA 3MV9D 4ORGB 3HI1A 5HY9A 2AEQH 2Z31D 3RWFB 1JWMA 1PLGL 1XGRB 1IQWL 1DVFA 4ZFOB 4M7JL 5GRJH 4CN4A 1QBBA 1TFHA 4PRDA 5GJSL 4QOKB 2V2WB 3CH8A 1Q72H 1BP3B 5FFLA 1BLNB 3QQ9D 3MLVH 5K9KB 3SKMB 3NFNB 2UZXB 1F8TH 4MSWA 5MENB 1KCVL 2AXFA 5EZIH 3KPLA 4PG9A 4X4YB 2VLRD 1JIBA 5LBSL 5C09A 2AV7B 2VDKL 4LPUA 3O2DL 3ULUD 5HHPB 2ICEB 2QKIA 4LSUL 5JIKA 1Y18B 1NMCC 4YE4H 3L3DB 2VXVH 2V17H 3GGWB 1IGIH 2NY5H 3CD4A 1T21A 4QT5B 5ANMA 2CRYA 2VQ1B 3N9GL 2DD8L 1CQKA 5E8NB 4RAHA 1S9XB 2E6PA 5JXED 4WW1A 2AK1H 5I1JL 4KVCH 3B43A 5CMAA 3LN4B 4YXHL 5JR1H 1N0XL 2ESVE 4UQ2B 1QSVA 3GKWL 4ZFFB 4HK0A 1FO0B 3BP5B 5LJYH 4PGBB 3BGMA 1FVCA 2OZ4H 3KPMA 2W9LA 3DX9A 4PRID 4PGEA 3KYMA 3BKCL 5EZOL 3ABZA 1U8NB 1LMKA 5T1DH 1CFQA 3VFWA 4U1HB 5T1MA 5TGBA 2QHRL 3MRKB 3OAZK 1TVBA 4ZUTB 3ARYA 4LEOB 1AD0A 5FIEA 2D03L 3MOQA 1WC7A 5JO5A 1RHHB 3HCVA 2G75B 2J3SA 3TIEB 1YNTA 3QXDA 3VRIB 4LSQL 4ZAKB 1ZK9A 43CAA 4YDKH 5KSUB 1B2WH 2B5IB 1T89C 3CVIL 3QFJD 1KYOK 1XZ0A 1U8LB 4ZDHB 5C07A 3JWDL 2Y23A 4BQBA 4PLOB 1YA5A 4OBRA 5C0BD 3BN3B 5DO2C 1AJ7H 1J10A 5KSBF 4JY6B 4LAJH 2VITB 3MLUL 5A43C 4UB0L 3MMEB 2BY0A 4BFIA 2XPGB 1EAJA 3E6FB 1H3PH 2V2XA 5CEYA 3FRPA 1I8LA 3X3FL 3VFRA 4PJXF 4NZRH 3LDBC 5I9QC 4PRPD 4OQTA 4XGZB 2DQGL 4MB3A 4BJLA 1SJHB 4WFFE 3QDGA 3QCVL 1SJEB 5HYSB 2CD0A 4EDXA 4JFFA 1MIEL 3SE9H 4RA3A 1ZWIA 32C2B 1PD6A 4NPYA 3IFNL 3MOBL 5HGGS 3WD5H 1E4KC 4NKDA 5HVGB 4HPOL 3NTCL 2A6IB 1EH9A 1OGAA 4PJXA 4Y7MA 1LWRA 3ZKND 4FFZL 3QEQD 2D7NA 4MNGA 5SWZD 3OKEB 3JWDC 4RGNB 4QRPA 1H3GA 2GJJA 5KVGL 5EU6E 1EZVY 1HILA 3RGVB 1BEYL 2N4IA 3UTPE 3HMXL 5BMFH 1ZT7A 3ULSB 5I8EA 1YEJL 3FZUC 3ARFD 1GZQB 3DYOA 4KHTL 1MCQA 3ULUH 3QJFB 2F19L 3IU4L 4OF0A 3U0TA 4M7LL 2X4UA 4FTVE 3ARDC 4X5LA 2DKUA 4X9FA 1JRHH 2JB5L 3JTTA 3MUHL 3ZL4H 3LD8C 4NWUH 5DRWB 2MSPA 3QJHB 3WKNA 4WI6A 1A4KB 2VIRB 5EUOA 1F6AA 4OCRL 3CMOH 3DX7A 3PQYD 5HVWA 3ES6A 1NGPL 3QFDA 4PS4L 1O7VA 1KENH 4C56A 4P9HH 3DMMA 4LKXA 3ARBA 3G9AB 3MGOA 1OCWH 4X0KA 5C0JA 1BJMA 1YEHL 4JHAH 1KTLA 5E6ID 3U0PA 1WLHA 4DN4L 1IGCH 3UDWA 4PUBL 3L1OL 1MI5D 1UWEL 1M05A 2EDJA 3O4LA 4XMPL 3U1SH 4KGJA 1VEPA 1CE1H 4JAMA 4JQVA 1QHOA 1U8QB 3PHOB 3CH1A 4QXGH 4P4KC 3OG6B 2BSED 5EPMA 1MCOL 1NC2D 4Q2ZB 4NQVA 1JCKA 3I50L 1EO7A 4HZAA 5DTFB 2HT2C 5F1IB 1K85A 3SDXF 3MA7B 3NH7H 4LPXA 2PCPA 1EJOL 2VDLL 3V0VA 1FC1A 1MFAL 1JGVL 1W0YT 3RNKA 1U8OB 2R1WB 1XGTA 4FXGB 3MGTA 2G9HA 3ARQA 3CCHB 3OAUH 4NFBA 5DC0A 3SCMC 5J11C 3VFNB 3MXWL 2P8PB 2H8PA 2PN5A 2OR9H 4AZ8A 1HI6B 1KCUH 4MA8L 3ZT5A 3QPXL 4MJIA 1T2XA 1U8HB 4UDUB 1WBZA 3WYRA 1HHKA 4M6OL 5EA0H 2OP4L 4JDZA 2OTWA 3K8MA 4ZTPH 2ICCA 1TJGH 3BP4A 4OZFA 2YEZA 5MEPB 2NQCA 2ZCHH 4PD4K 4ERSL 4MDJA 3C87A 2FH6A 3IDYC 1MFCL 4P2OA 4MDIB 2VSDA 3QO1A 2YD2A 3MNWB 4JFZL 3RU8L 4JHZA 1OTSC 1S9KC 3WO3B 5LGHL 4QEGA 2XN9A 1K8DB 5FK9A 2DLEA 2GW5A 4PJGF 4XNYL 2Q6WB 1AE6L 4K3EL 5E1HB 2LTQB 1RUAL 1WIUA 4TUJA 1WIPA 2EEDA 3IF1A 1OWWA 5IMLB 1EUTA 5GS1B 5JNYA 4HKZB 3W39B 3PWUB 4NQTA 1OGTA 2EEBA 5FO8A 3HLAB 3DX8B 3GI8L 1UT9A 2ED8A 5D7LB 5DHVA 4LCIL 3BUTA 1J8HA 2CLZA 3Q3GA 2BRQA 1KIQB 4RZCA 3V52H 4YXKH 5EO1A 1GH7A 3MR9A 3GJFH 4PJ5B 4L9LB 3FZUD 3MLTB 3SDCA 1P4IH 3HPLA 3PGFL 5AYQA 3U4AA 3ZKMD 3VXMB 4P2QA 5F1OB 1KPVB 5ESAB 4F80A 2Y25A 3I6LE 3HPJA 2WV3A 5L8LB 3FRUA 3BDXA 4Q9BA 1FJ1A 1T3FA 3C8KA 2XG5A 3BESR 2GSGB 4C4KO 1KJ3L 3WFDH 3RA7L 4FQXD 5DYOB 4JPKL 3E2HB 2DQTL 3GUTA 4U1JA 4ONGL 1JZ2A 3MQIA 3GBMH 1NUDA 4P2RA 2O5YL 4M93B 3UTSB 3QB7C 3QQ3A 1TCRB 4WUUB 4ZQKA 3PF2A 2NY7L 5AZEL 1ZOXA 2A0LC 3BVNB 4AIZA 5DDHB 2Y5TB 2JKXA 4N8CL 2NNAA 2NR6C 4H25A 1BFOA 5HHVH 1BWMA 1YEGH 3CUPB 4P4KD 4EI5C 4PTUA 3AREA 2E7LC 5I1AA 2K7PA 1XF5B 2YUVA 3B6SB 3MJ6A 1EHNA 4MXVE 2HT2D 3IXTB 5BXFB 3GO1H 2SEBB 1NAMA 2F58L 2AK4B 2D2OA 4QRRB 4EI6A 1TJHL 4GFTB 1GIGH 3LAFA 1BVZA 5HHOB 3PGCB 3M17B 4JANB 1YNLL 4O9HH 4OCNC 5F72S 3DUUA 1WVZA 1WCBB 2B0SL 4N0YH 4DN3L 1HN1A 1AHWA 3WNPA 2CKBA 3SCMD 2EDQA 2MKLC 3CMGA 1BD2D 3K2MC 3EYQC 1AC6A 2CGRH 4N8VG 2E7MA 3SBWC 2VN4A 2XZAL 4EQ3A 5FKPB 3NZ8B 4X7DC 4G42B 3M8OL 1TZHB 5CZXC 1A6ZB 2BNRA 1OP9A 4CUCA 1MCPH 5IJVA 5D72L 2V5MA 3OWEA 5TDPA 5ITFA 1MHCB 4L8SA 4Y8AA 4LIQE 5KSAC 2K1MA 5L0QB 4QLRA 1X6NA 3X12B 2CRZA 4ZSOB 1JFQL 3DUHA 3ZDXF 2P8MB 5JHLH 4TVSa 4PJHB 2AI0L 3MRGB 1S8DB 3BD3A 3RWIB 4ORZC 2HAZA 5HGDA 1CXEA 5MHSD 1DBML 1OTSD 4Y4KC 1UM6L 4JZNA 4GMTL 1A2YA 2K9UA 3GB7B 3H9SD 1ZSDA 5IF0B 4AEIL 4WRLA 2B1AH 4ZPVB 4EUPB 2D7OA 4DGVH 2CDEB 2X4RA 2QTEA 4OFVA 3BMWA 2Y5EA 5SV3A 1L6ZA 4L1HA 4WV1C 2H2PC 5DD3L 4CVWA 5DZOA 4ZUWA 2CUIA 3TBYA 4GG6A 3BH9A 2XG4A 3BWUC 4J2XA 3BPCB 2GK0A 2GKIA 3AXLB 1DUYB 5I1CH 3ETBF 1VGKA 2BRRH 2X4OA 3FFDB 2M1KA 4JPIB 2Z8RA 3O6MH 4U31A 3DVGB 5ILTL 1T2QH 3OZ9L 5GS0L 1RIUL 3FONB 2GI7A 4KI5C 1IAKA 4J23A 4NO5A 1JBJA 4CVXA 3JTSA 1MAMH 4X7SH 2PF6A 4S11A 3OKDA 2YBRB 1F90H 3MJ8B 5C08B 1KB5B 3OX8B 4IS6A 2Y36L 5L6YH 1SVCP 3GSNL 4JR9H 3W0WA 1I85A 4UU9B 1LEKA 3VXRA 2BC4A 1C5DB 2VDQH 3MJ9A 4JZJB 1BQHB 3BZEB 2BVYA 4UIKH 2P5WB 4YO0A 4EVNB 4PJFF 1X5XA 4KPHL 1ZKAA 1XR8A 3DHJA 2HLAB 4DZBA 5D4QA 1FVDB 4IRJB 3MLXH 3I3EA 2VH5L 3IYLW 3MBXL 1XF3B 1YQ2A 2IPUG 3FN3A 1WTLA 4OCWL 2A0LD 4M43H 3P9MA 2OL3B 2XZCH 5AUMB 1WBYA 3VDCA 4JKPH 1CGUA 2NR6D 4LBEA 4KZEL 2BSRB 4EI5D 1AY1H 4X6CB 4XCYA 5GS0C 5JUEH 5LQBH 1DDHA 4JHBA 3TN0C 4X98A 4TULH 1KYOJ 1P6AB 4XVUC 2D31B 1CBVH 1SHMA 4R96A 2AJYL 3QI9C 4PR5B 3O9WC 3E6HB 5D5ME 3GSOB 4PJ9A 1EUUA 4PJ8A 3S98A 4AM0A 4NYLB 2FX7H 5CKAA 4G8EA 1NGWA 4JCMA 1QKZH 5M94B 5J1AA 1CFBA 2OZ4A 1UKSA 2DKSA 1K8IB 1NLDL 3AU1B 3EYQD 3S37X 1NEUA 2VDRH 2X1OA 2BMKB 1J5OL 3L3KB 4ZUSA 3EOBB 3U36A 4XH2B 5CZXD 4QTHB 3OKMB 1AD9B 1UEMA 3CC5B 4NO2B 4KKBC 1FDLH 3DTXA 3D39D 3HKFA 4M8QB 1RZIA 2XACC 1IGFH 5CINH 5I19L 2DLFL 4NSKA 5MI0B 4I0KA 4ZPTB 1Q9WB 5IK3A 3BKMH 3PWPE 3TZVB 1KACB 4X9HA 1YJDL 4NN7C 1FAIH 1CF8H 5GRUH 43C9A 1I3GL 2DTML 1KJMB 3C2AL 4S1RL 1HSAA 2X41A 5B8CC 2V9QA 4ZTOH 4HIXH 5DMJB 4P3DA 3RJDA 3O3EA 1IKFH 2UZIH 4D9QE 5I15H 4M7KH 3G5XA 4K9EL 4LIQH 3BO8B 3KYNB 4MZ3A 4UINL 4NRYA 4Y4KD 3BAEL 2DWEA 4YHYB 3S8WA 4M1DL 5KS9E 2VC2L 5FHBL 2O93L 3O3BA 1W2KT 4OUOA 4Y5VC 3GMNB 4UNVA 4XBEH 3QIWB 4LLWB 1FHGA 1T1XB 4PJIF 1U3JA 2XXMB 2Q76B 2H2PD 1OSZA 1TMCB 5KZCB 3S4SA 4OF3A 3VWKB 1K3ZA 4H1LB 1F4YH 2QSQA 4KDTA 2AXGA 3PHQA 5INDB 1BGXL 1P1ZA 2ADFL 3QXAB 1NGYA 1NBVH 1UQSB 5C0CE 1YJDC 2MPAL 5DSCA 1EHXA 3JUYA 3IU3B 2DJ4A 4GW4A 1YMMA 4KY1H 4HIEA 5D1ZA 2FJGA 4NZJA 4ONHA 4KI5D 2CXGA 1IM3A 4H88L 1RZGA 1MJJA 1OP5H 4K9EC 1BVLB 4Z7WA 4FOMA 3CVHA 4MA7H 3CDFA 2XRAL 2ZUQC 4I3RH 4I0PA 1IT9L 2R0KL 1Z3GH 2D0HA 3EJJX 4NT6B 1TDQA 3OJDB 4I18B 1YUHA 3EYUH 4PRHA 2YD9A 5E2JA 3JV0A 5CIPA 4P57B 5BOZG 5TFSL 2HRPL 1PBYA 4HT1L 1A6UH 3PNWA 1QPPA 3LQAL 3SE4A 3TWCL 5BV7H 3JWOH 5FF6B 4PJBE 3KPOB 1U3HB 4JFDB 4YPGB 3LOWA 4YAQA 4XWOC 4DFIA 1IJ9A 1BFVL 4JRYB 5HJ3A 3UC0H 4YHML 5BRZD 3RWCB 4DVRH 1EV2E 4KZDL 1EFXB 2GT9A 4XCCL 2NY6C 1KG0A 4RMWA 4ZUVA 5C2UB 5IG7A 1ES0A 3BPNC 1R3KB 3B9VA 3KVQA 4C58B 3TT1L 5GS0D 5JZ7C 1LD9A 1OM3L 3ZE0E 3TN0D 5IQ9B 3LS4L 2C4FU 4PP2A 5CSBA 4XVUD 2R69H 1Z6JT 1GOGA 4JFXB 4UTBH 2PYEA 1J8KA 1DBKH 2BCKA 5DEGB 4MWFA 2XTJE 3QI9D 3O9WD 3ZHKA 3P2TA 1D5BA 4TTDC 3VMOA 4DKFH 5D7IB 3W9DA 1QLEH 4XXCC 2XWJB 3HB3C 1Q94B 4Q6IA 4O58H 4XB7A 2VO5A 1IGJA 4WTXA 4D0DB 3KG5A 4NQEB 5F1SA 4L3CB 3CSYB 5DJ2B 4PD4J 1AXSA 3GBNH 4KMLB 4LPVA 1YN7B 3T8XA 3MXVL 3LQAC 4X7FC 1A9EA 4YEEA 5F70A 5F9JB 4K3GA 2ESVA 3RAJH 1LE5A 5EORH 4BSWB 4GT7A 1INDH 4OFPA 1NFKA 4RIRB 5BJTA 2X05A 5E2TL 4HF5L 5FGBA 4GH7B 5KVDL 5E00A 1KCSL 3QXWA 1BIIB 3T0EB 1R3HA 3B5GA 1S7XB 2VDNH 1BBJB 2CKNA 3HNTL 5C70A 1CU4H 5IQ7H 3H9YA 3U9PH 2MQ0A 3GK8L 3LKRB 4OF6A 1T03H 2D7TL 5ALBL 3TJHC 2R56H 4NKQB 1QVOB 2IGFL 4OD2B 5I1HH 2WBWB 4LOUC 1XIWA 2F54B 4WUKH 4U6HB 2AJVL 3S97C 2YPKB 4WI8A 3DUSB 3FT4A 2EXYC 4QNPF 2VLMD 3RWDB 1MNUH 4XCNA 4NUGL 5HYIA 1IAIM 3HUJB 3GM8A 3O3DA 1JPTL 3QP3A 5TDOB 4LCYB 2CLRA 4J6RH 3LKNB 4AIOA 4OSUH 5IFJA 1A3QA 4L8DA 1UJ3B 3VE0A 1FN4B 4MQ7B 3IKKA 3KPSE 3BSZH 4OLWL 4U7MA 3QCUL 3ROOA 5I1KH 3I6KA 3P40A 5FV1L 1FCCA 2Q7NA 3T09A 4YLQT 4LF3A 3TO2B 5DK3A 3DXAB 1DEEA 2C1PB 3SQBA 4EBQH 1T80A 1CL7H 3QUXC 5JHDE 3NPSC 5K93A 4E42A 1FBIL 1U95A 1D5IH 2AW2A 3MLRH 3RDTB 3GHBL 3HZMB 3BJ91 4MJ2A 4TPRL 4UV4L 5LGKA 3SOBL 3SDYL 4H8WH 3O8XB 5FUOL 4WW2A 4DOHB 1JK8B 4YBHA 2X09A 5EU6A 5I17B 3HN3A 1FSKC 1HHGA 4LNRA 3T2PA 3U30C 2B2XL 2E9BA 4YBLB 4L1DA 3DLQR 2X4TB 3BQUA 3QO0A 1RJZA 4TOYH 5EUKA 1D5ZB 1FL5A 4Y16B 3L3JA 1PZ5B 3SDDA 4I3GA 1XF4A 5FECA 3JXAA 1EMTH 2PW1A 4OKVA 4F7EA 4FTVA 1CICA 2PXYA 2NY6D 4HJ0C 5HDBF 4K2UL 3S37L 2F53D 2ZOKA 5D6CA 5KANG 1P2CB 1A1NB 5DRZA 4X99B 3KS0J 1AKJD 5JZ7D 3V0WL 5I76B 5HY9B 4N68A 5GIRA 4JFPA 3LCYA 3VMNA 3S34L 3CXDH 3RWHA 2IC2A 1JWMB 4M6NH 5EOTA 2X4NB 3IAGC 4TTDD 2N7BA 4PRDB 3HB3D 1RU9L 4Z0XB 4APQB 3HG1E 1BBDH 3DGGB 1F11A 1LVEA 5HBBA 4ZFOL 4MSWB 2AXFB 2E6QA 4JQXA 4O2EA 4PG9B 5HGBA 5C09B 3PL6D 1ZHKA 4RMQA 2IAMC 3W5NA 2QKIB 2VDOL 3NACL 1YYLL 4HX1B 4XVSH 4IOSD 2V7HA 1X5AA 3NFPA 4IJ3B 4RDQG 1T21B 2FGWL 4NBYB 4P5TA 5ANMB 4DQOH 5I30L 1NL0L 3ARGA 4CVZB 4ZS7H 1EERB 3HUJF 1JGDA 1RZ7H 1LO4H 2OBGA 4HK0B 2Q20A 3BGMB 5GXBB 1CDBA 3KPMB 3TJHD 4G8FA 5KW9L 3DX9B 4PGEB 2FZ3A 2W0PA 3QAZC 4LOUD 1SYVB 3AMLA 4EDWL 4TSBH 2V2TA 1JMXA 3D48R 3VFWB 3P0VH 1X7QA 1J1OH 5TGBB 1TVBB 3PGDA 1IC5H 2EXYD 5I1IL 1AD0B 3IFPB 1ZANH 4ZFZA 4LSPH 5JO5B 3LHPH 1A7PH 1NGXB 1QRNE 2WBJB 4PFEA 3HCVB 1YNTB 3QXDB 4M61A 1RI8A 1SY6L 2VDML 4NCC2 3QXTA 1X4ZA 1O7SA 2FJFA 2Y06H 4XC3H 2XQBH 3WHXA 1XZ0B 3IDXH 4CRPA 4JFYA 3W9EB 3UZEA 4XWGH 4X80H 2AJUL 4FFYL 5EWIL 4BFIB 4OZIB 1F2QA 5D1XA 3WLBA 5C9KA 1JPGB 1KEGH 1SVZA 2YPLE 5CEYB 3QUXD 3X17A 1UXWA 3KGRA 2J4WL 2NY4B 1OB1B 3VFRB 1HIML 4JRXD 4DCQA 1FNAA 3NIDE 2J12B 3PWVA 5I1LB 3THMH 4YDJB 3QZWB 3EW3B 5JOPE 2Q8AH 3S36H 2CQVA 3NCYP 4NHUA 2NX5E 5TE4H 3QPQC 4PJEF 4NPYB 3U4BH 1S7RA 4L4VB 3UYPA 2ZJSH 2R2CA 2R2EA 3DVNB 4NKDB 4PJDE 3TPUA 1OGAB 1KPRA 4MJ5A 3IDIA 5ADPH 1FQ9C 5D1QA 2YSSB 1EK3A 2J8OA 4Z7OE 4ZAKC 4CNIA 4IRSA 4QRPB 2JJVA 3HE6A 3E1F1 1SBSL 4HJ0D 5TF1H 3C8HA 3MC0A 1QHPA 5FOJA 1GC1L 5B21A 5FYLE 4G80A 2WUCL 2FR4A 5CZVH 2VMFA 4ETQA 4FMFA 5CAYB 1QSEE 1FIGH 3U0TB 2X4UB 2WIMA 7CGTA 3DOSA 3BKYH 5T3XE 1CTNA 4WO4B 2CLVA 1I8MA 2YKLL 1A1MA 3JTTB 5GZND 1A1OA 1BQLL 4N90E 3RWEB 4YDLB 3NMEA 2F15A 1J05A 1JNJA 1NCAL 3U82B 5J89A 5EUOB 1F6AB 3R06A 3VFMA 2IAMD 1FGNH 2NYYD 3D0LA 5FDYA 3DX7B 3ES6B 1NFDE 3QFDB 4HPYL 5J1TC 5T3ZL 4C56B 2YD5A 1FYTE 3E8UL 4LKXB 3ARBB 5MEOA 2JCCA 3MGOB 4X0KB 5C0JB 4BUGA 1GPOH 5C0AE 3IJSA 3U0PB 1YQVL 4OZHB 3GJFK 3I9GL 3OJMB 1GC1C 1M05B 2P24A 3O4LB 4RGNC 4RMTA 5C0BE 4JAMB 4HFWA 5T1KA 2QV2A 2H45A 3RGVC 3CH1B 5L88L 5I1DA 3EZJB 4K3JH 4YHKL 4EN3A 2PKDA 1LO2H 3DRTB 3I3BA 4NQVB 5CFHA 3KR3H 3QHTC 1MHPH 3FB7B 2ERJB 4WHCA 4KXZH 2XV6B 2EE9A 3HNVL 5AWNL 4MAYA 2GCYB 4HS3B 3RX7A 2PCPB 5D96B 5K9QI 4PRPE 1PKQB 2QQNH 2R4RL 4QWWD 5DMGD 4R3SB 1XGTB 1F4WL 4LLQA 1MCWM 4OZIF 2FO4A 4DK6A 3MGTB 2G9HB 4FXKA 1I4FA 4LQFL 5D8JH 5MEND 1JPFA 1JNLH 1QFHA 4LP4A 2H8PB 1FH5H 3WXWH 4JO4L 3F6IA 5SX4I 3FQWB 2VZVA 2CR3A 1KCKA 4MJIB 4KMQA 4XP1L 3WHE0 4JVWA 1U91A 1B4JH 1MQKH 1B0RA 1H15A 4JDZB 4HHAA 4NHCH 3ZLQC 2OTWB 1A64A 1TZGL 1ZGLP 5GGSY 3UCRA 3RWJB 3BP4B 2IALA 3HAEH 4OT1H 3N85L 2HLFD 1N4XH 4ZD3L 4XMKH 1J1PL 1EEYA 5E8EA 4OZFB 1KXQE 1MJUH 4L4TE 3GSXA 4MDJB 4GRMA 2DF3A 1OPGL 3LS5H 3SY0B 4XVJL 3QO1B 4U4BA 3ZKSD 3VH8A 2C7UA 5IV2A 1A6TA 3ESVF 1WUNT 4F7CA 1VFBA 1H3VA 3VDBA 3K81A 4NUJA 4P9MH 4X6DE 5DI8B 3BEVA 1WEJH 3Q1SH 3CFKA 2XWBA 5EC1A 3WUWB 5FK9B 5EBMA 2DBLL 3QPQD 3QNYA 3TVMB 3IF1B 3RZCC 3H3KA 1TNMA 3RY6A 5DJZB 4JFHE 3QQ4A 2P5EB 5LVEA 2IH3B 3HC3L 1OGTB 4ZAKD 5FO8B 2CR6A 2HKFL 3CFEA 3TF7C 3C60B 2DL2A 3ARUA 2EDOA 5IFAH 5AZ2H 3S3JA 1WFNA 2CLZB 2ZCLH 1N5AA 4M3KB 4OGZA 2A77H 2LAAA 5DD5H 5HGAA 5IIEA 3U4EB 4UZGA 2VN7A 4RZCB 3MRHA 4Y4FA 2J88L 3MR9B 1X4XA 2I60L 4YGVB 4P23D 3D85A 5KVEL 4YIQB 4JPVH 3PP3H 4L8CB 1RVFL 2RB8A 4AENB 1ORQA 2IFFH 1X5FA 3OR6A 2B4CL 2ITDA 5D7SH 4GLRH 4AMKL 2P48B 3PP4L 4HWZA 4OZHF 1KTKE 5FM4A 4P2QB 4ODWA 5FYLH 4J4PC 3S35X 2DJUA 1WZ1H 2Z92A 3HPJB 4GG8B 2R1XA 5LCVL 5IWLC 2W92A 1O5DT 1V7MH 1FJ1B 4HS8H 2ZPKH 1UWXK 1T3FB 1P4BH 3CZJA 3C8KB 1CR9H 4KV5F 1I3RB 4LAQH 1CI5A 3WS3A 1MREL 2BOBB 3FO2B 3OPZH 4ENEC 1QSFD 4RRPG 1BQHG 5T3XH 1MPAL 5MEQA 4WHYG 2ARWA 1RPQA 4P2RB 1TTFA 4MNQB 5I75B 1BFSA 3O3UN 5DQDH 3QQ3B 1OARH 5GS1C 5SWSE 2QR0B 5DUPL 1I75A 1FNHA 2KH2B 4AJ0A 4EKXA 4O5LH 1CFTA 2NTFB 4RGND 5D5MA 5DMKA 5E08H 3HMWL 3WJLC 1E6OL 2NNAB 2WIIB 3RGVD 1MQ8A 1TETL 3RUGB 4PTUB 3AREB 4XPAL 1AGDA 3F6LA 3U7AA 5EIIA 2B4CC 4L9LC 3LKQB 4OM0L 4IMLB 1VADB 4LLYB 4JKKA 1MLCA 2Q1EA 3HFMH 1PJ9A 1NAMB 2OCFD 3L3IB 5I8KH 4PB0L 1KCRH 3MTRA 1GYAA 2MKWA 1CLOL 2VXSH 2NXZC 4PJAE 3BDBA 4X5WA 2YN5A 3D2UB 3DUUB 1KIPA 3ALPA 4G9FE 4LVHB 2CKBB 5DS8A 1IQDA 3BIKA 5L8KB 5T3ZD 3MODL 3PWPA 4H20H 3MRNA 3ROLA 1IRAY 1IC4H 1E28A 3FN0H 5ISZD 1CDCA 2HVJA 3E2HC 1YY8B 2BNRB 4OLEA 2E7HA 2ATKA 2Y1VA 2I5YH 5DR5L 3G6JF 5IJVB 4XBPB 4NRZA 3PE9A 5TDPB 5ITFB 3SQOH 4L8SB 5D2LB 3MRRA 3VU2A 2ED7A 2BXZA 4ZFGH 1IC7H 3CDGA 3RL2B 5KS9A 4YQXL 4XT1C 3WBDA 3O2WL 3QUZB 4NBZB 3W5MA 5KAQF 1ORSA 3MCLH 3QDMB 1Q0XL 1F00I 4B53A 3KLHC 2YMXH 2JB6A 3K2UH 1NJ9B 4UQ3A 1I9RL 3BRGC 4FQLH 4GUPA 1A2YB 1GAFL 3VWJB 3NCMA 1IILE 5FGCE 4L8BA 1FNEA 2X4RB 2NCMA 1GL4B 5C0CA 4P5KA 2DQUH 4TN9A 3V7AG 3O6FA 3RQ3A 1QACA 1INEL 5E6ZA 4ZUWB 1U36A 3MV8B 4GMSL 3L5IA 4FNLL 3WFEH 4PV9A 4RFEA 1JF1A 4WWKA 5DFTA 2H3NA 5EG6C 4FQQA 3HE7A 2HJLA 2HFGH 2IQ9L 4UV7L 4GKOA 2DDQL 1I8KA 4P2YA 1A0QL 1OAQL 1D5XB 4N0RA 4Y19E 4HXBH 1P9MA 2ZUUA 4TUKH 3J8F7 1PQZA 1BFTA 4UT9L 5L0QC 3V6BR 4X9IA 1NDGA 1TVHA 1IAKB 1R3LB 4CVXB 4RFOL 1G7PB 3JTSB 3EUUA 4KGLA 3OKDB 3WIHH 4PJBA 5ID1A 4J4PD 1EBPA 1JZ3A 1DQMH 4DZ8A 1E6JL 5DJ6A 2X89D 4XX1G 3W0WB 3PWJA 1LEKB 3VXRB 3SGJC 3Q6FB 3RUGF 3MLYL 4NO3B 1KB5L 5J13B 4Q74A 1CDHA 1L7IH 1LO0L 4ENED 4JVUA 1PLGH 1T20B 5EOQL 4YO0B 4M7JH 1QFWM 4GKSB 4ZXBC 5GISL 2FIRT 4DZBB 1HH6A 4KKAC 4PGDA 2FB4H 3HTLX 3RTQA 1H8OA 3MLSL 1GHFL 4X4ZA 3QUYC 3FT2A 5J6HA 4ZO8A 4MJ6A 4PJCE 4GRWE 2MCPH 4AIXA 5B4MC 1WBYB 5D7LD 4HZLB 4JO2H 2ZG2A 2A9MH 4P46B 1U6AH 1OP5K 3IDNA 2OL3L 3WFZA 2EDKA 1II4E 4M3JA 4PJ5D 3UTZB 1I9IL 2DIJA 3MLPA 4Y5YA 2W60A 4J12A 3V5KA 4GRLA 2GEEA 5J3HC 5DFWH 1LK2A 4PJ9B 4D8PB 4AM0B 5C8JA 5D2LF 2FHCA 2EIDA 3V5HA 3VA6A 3VXMD 5I8OL 1M7IA 5FYKU 1NGWB 3GKWH 4FABH 4G5ZH 1N7MH 5IB2B 1OHQA 4G9DA 3RNQA 1EHLH 5J1AB 4U1KB 3U7YH 1ZS8A 4L9DA 3BKCH 4OLXL 2G60L 2VR4A 1V7NL 4LHUG 3ULVF 1B6DA 3PWNB 5I1EL 4PRNA 4ZUSB 1H3TA 3U36B 5CD5C 4V1DE 4W70A 4RX4D 5T5FH 1RJCA 3DTXB 3MUJA 4LP5A 3GMRA 1IKNA 1DLHB 1RZIB 3DVFA 3UTSD 4NSKB 4IRJC 3QCTL 4NNXA 2J8HA 5IK3B 1N0LA 3VW3L 1JZ8A 3FCTB 2DQDH 4QHUB 2B39A 2ZUXA 3BDYL 3TT3H 4QHMA 4P3DB 4JM2A 2PO6A 3U9UA 3JWDH 2DIBA 1BZQK 2EDWA 1SM3H 2CJUH 3VD9A 3I3DA 1NEZG 3FAWA 4NRYB 3VG9C 2CO7B 4KQ4L 3C2SA 2DWEB 1WK0A 3MLUH 4UB0H 4NQSA 1OAUL 4HK3J 2AK4D 4QRRD 5CP3H 3M1BB 5F9OH 4AL8H 5HHOD 4ZMAT 4K94H 3VXPA 2BX5A 2BVOB 5F96L 2D3VA 1KLUB 3VRLF 3S35L 1OSZB 5K59E 3CJJA 3UJTL 2DQGH 3EDEA 2AXGB 1EAPB 1ZGLA 1TJIL 5J0BA 1VEOA 3BISA 1EO5A 3KPTA 4KC3B 1NGYB 3VRJA 5F8RC 4DGIH 5DSCB 3H0TA 3O3AA 4G8GE 4P2CG 2VXUL 4HV8A 4GW4B 5MI0C 2AJSH 5HHXL 4FFZH 4HIEB 5D1ZB 2FJGB 3QWQB 4Y2DA 5IVXE 3TZVC 1RZGB 1MJJB 5KVGH 3EO9H 3CU7A 3QEUB 4UIMA 4K3DH 3D3VD 2HJKA 3NZHH 4M03A 3MPCA 3OKKA 2DM3A 3LQMA 3QG6A 4Y5XB 3GJEA 4U2YA 1YUHB 2WINA 4MXWH 4PRHB 2JJTA 4J3WA 2YC1A 4QF1A 4YHYC 1S5IH 2LU7A 2GAZB 4H5SA 1BZ9A 5DJAB 2UY7A 2ADIB 1UM5L 1ZHBB 3FMGH 3K1DA 5C0DA 3PNWB 4F58L 5AG8A 4M8VA 1ZLUH 1DR9A 1RZFH 3QIWC 5DJ0B 3IGAA 3V6OC 4YAQB 3OJVC 1NH6A 3H3PL 5HJ3B 2W0FA 4M5ZH 3DYPA 3IJHA 2GT9B 2NW3A 3VXTA 4ZUVB 4OCRH 5ICXA 5B4MD 5BVPH 1M1SA 1RQ5A 4HIIA 3U7WH 5L2JA 4AY0A 4PS4H 5FO7A 3HG1A 1X6LA 5JMOC 4KUCF 3WFCL 1LD9B 4NM4L 3WIFA 3LMJH 1JNNL 4AT6A 3D69A 4PP2B 2AVGA 3L9RA 2J6EL 3WL9A 4D3CH 4IRZL 4GRWH 2BCKB 3REWA 5CCKH 2VLJE 5MERB 4JFQA 4F7MA 4OGXL 5CD3A 4PRBB 2ZSVA 4TNVK 5EULV 3Q5YA 4Q6IB 1NCDH 4Y4HC 2ADGA 1CLZL 5CJXC 2XA3A 1ZVSA 4HXAL 3I50H 4I18C 3T8XB 4LRIA 1BM3H 2DI7A 1A9EB 5E8OA 4OCLC 4TNWK 2DRUA 1FP5A 5JPMB 3DBXA 1LE5B 2AXHA 2VL5B 2ZCKL 1ETZA 1MFAH 5CD5D 2P5WD 5F9WC 3UTTA 4ZO9A 4F3FA 4NQDE 4NBXB 5BJTB 1HWHB 4BH7A 3SGEH 3ZTJG 5IT2L 3JBG7 4FXLA 5E00B 3AB0B 5HI4C 3NIFE 1T4KA 3U79A 1IZKA 4X7EC 1EXUB 3A0OA 3QIBA 4YXLH 1LK3L 2FATH 4MA8H 4OLUL 2KZ1B 2CUHA 4XAWL 4E41E 1QRNA 1MFBL 3NPZB 3K46A 4M6OH 1JGUL 3L5XL 4M6ML 3VG0H 2IF7A 1CG9A 4ELKA 4LPCA 1XIWB 3HAEA 2J8UE 3N1PC 3MACH 5LXGL 3E3QC 1OAYL 5D7JC 5C6PB 2I07A 1OSPL 3LZFH 3N1QC 4TVPL 1RK1A 4YDVA 4XCNB 4Z7QE 1JN6B 4KK8D 5GGTL 4QYOB 2IADB 4OGAC 2HWZL 2YWYA 4XPTH 4FFWC 1I7ZA 4TUOA 3L5WB 4FQ2L 1T5XA 3UO1L 4JDTL 1WZLA 1GGTA 1VA9A 2OQJA 2YPLA 3ORJA 5HI3C 4XPBL 5KBNC 1YZZA 1T0PB 1MH5A 1TNNA 3ULUF 4MGXA 2Z93A 3V7AE 1RUAH 3VFVA 5KOMC 1CLYH 3ROOB 2MFNA 5DD1L 3GZKA 1DLFH 1I7UB 1ND0A 1S3KH 1RZKL 3T0EC 4OFYD 1AGEA 1DSFL 1DEEB 2GQHA 2NX5A 3TZVD 3GRWA 2X4QA 2Z9TA 4B41A 5EO0B 2FEEI 1K9TA 4E42B 3FRPG 1U95B 1R0AL 1UH4A 4MYWB 2WWKO 1AXIB 1XCQA 3GJFB 5JW4Q 3GNMH 4HWBH 3RPIB 4NN5B 1NPUA 4D0BB 3PQYB 4WW2B 1OL0A 4L5FL 3O45A 1CFNB 2AJ3B 3I02B 4RBPK 1KN4L 1TITA 2EH8L 4ISVB 4LNRB 4XB8A 4MD0A 1K2DA 3IDJB 1AFVL 4ONFH 3QO0B 1RJZB 4Z77A 1AXTL 3I2CL 5E6IB 1FL5B 3QIWD 1L0XA 3L3JB 4OIIH 2BVTA 3HS0B 3SDDB 1JHTB 5FHAL 1XF4B 1QSEA 1MI5B 2WUBH 1CZ8H 2PW1B 4F7EB 3CNKA 4FTVB 4I77H 2NY2C 5KZCD 1CICB 2PXYB 3VWKD 3G6DL 5DEFA 3BPLB 5IESL 5JW5A 2ZOKB 4YX2L 1NC2B 5DRZB 3ZYZA 3EHBD 3DO7A 1UJ3C 1RZKC 3UYRL 2C5DC 2OTPA 4TRPL 3WXVL 3SDAA 3HI5L 3C5SB 2O5YH 1QNZL 4OBSA 5JMRA 2QSVA 1P5VA 4X6FA 2GUOB 4XXDA 3BRFA 2IANE 4UBDD 1QTYT 4AG4L 3RWHB 1V8HA 1A9BA 4JZOA 7FABL 2Q3ZA 4GO6B 5EOTB 1NFDA 1IMHC 4PGJA 4V2CB 1FYTA 3WO4B 3FN9A 5TJWK 3U46B 2FO1A 2R8SH 1F11B 3RDTC 1UKQA 4IDLA 1T5WA 3BXNA 5C0AA 4HJJH 5GGSA 2P49B 4O2EB 3DGCR 5HGBB 4MVBC 1ZHKB 1LE9A 4HLZG 3O8XC 1MIML 5C0BA 3S3SA 4OCXL 1TJHH 4ZO7A 1RUKH 1S9YA 1YEEL 2V7HB 4O00A 3NFPB 5CJ8A 4YBLC 2XY2A 1WBXB 3MO1A 5HHNA 4P5TB 1U3HD 4JFDD 4UTAL 1FORL 1EJ6A 5E24E 5ECJE 2B0SH 4DN3H 1MF2H 1F42A 2EE6A 3SKJH 4MXQD 4JRYD 4N1EA 1A7RL 1UA6L 1JUFA 2NY3B 3VCLA 1A7NL 4IMKC 4JDVA 1MFDL 1EFXD 4PRPA 8CGTA 2EIZA 1JYWA 2OR7A 1IAMA 2QQQA 4WU5B 1I1YA 1J0JA 4G8FB 5EC2A 1MELA 2FZ3B 3NA9L 4FFVC 2IPUK 3T3ME 1MEXL 4JKWA 3CK0H 3RWGA 1S7WA 4Q9QH 4R26L 3T2OA 4ZFZB 1KIUA 1DBBH 4APQC 3QEQA 3OKLA 2XT1B 3MRQB 5H94A 3KYKL 4KHXL 2DYPD 5A2IH 2AEIT 4M61B 4OGAD 4NQED 4OCYH 3BP6A 4PTTB 5JXAH 3DHMA 1SMOA 4FFWD 4D9RD 4HUVA 3MLWH 5C0GB 5IMMA 4L4TA 2FJFB 4LHUD 1VCAA 4DTGL 5HDQL 5CGMA 5HI3D 1KJ2B 3WHXB 3B2UC 1V05A 3ARFA 3SKUD 4JFYB 2QADB 5EFIA 2PYFA 4TQEL 1XGQB 3BYYA 4IJ3C 5EBWA 1UEYA 5FYJU 2OK0L 4JN2A 1ZHNB 2GJ6D 4X6DA 4WY7H 3DSNA 4NQCE 4XNUH 3T0ED 3WLBB 2G5BB 4I8DA 4OZFG 4XMLL 2NY0B 5E8DH 1XMWA 2HJFA 3EJYC 1UC6A 4LSSH 4OZGE 3U6RA 1PG7H 2AJXH 5EN2A 2CDFA 2O26U 4ALAH 4F7TA 4XP6L 3PWVB 3PJSA 4YHIA 2EYSA 1ZLVH 3NIGE 3C08L 5DF0A 2VE6A 4MHHI 5D70L 4F8TA 4FQXB 3VA2C 4TVPD 4NHUB 1RIUH 4OD3L 3UYOD 3JWNC 3MYZA 4OQTL 1UZ8A 3IFLH 2VDPL 5FUCC 3K8KA 4UILH 3WIHA 1NFIA 2R2EB 1X5IA 2JJUA 2WBJC 1KPRB 3CZFA 3IDIB 4MJ5B 4ODSH 4BFGA 5D1QB 5CLTA 4DJMA 4KK9C 3GSNH 3WSQL 4CNIB 3C5ZB 4GW5A 4IRSB 1GOFA 4A6YH 3HE6B 3D0VA 5JIHA 3HNSL 3EJZC 5F6IB 3T4YB 1QBMH 3OKOA 3P73A 4G80B 4FQIL 2UUDH 1JHLL 1BJ1H 3FAXA 4PJ7E 2X70B 1QQDB 1MRDH 2D7QA 4ETQB 1KFAL 3QISA 1T7YA 2I9TB 4LLUA 4O02L 3O2DA 3G9VA 3DXAD 2R0WH 4YJZL 5A40E 2CLVB 4WHTA 1I8MB 1A1MB 1RHFA 3RDTD 3VI4E 1A1OB 4ODTL 5F3HB 4HMEA 3OGOE 6FABH 1T89A 3QDHA 5SWSA 1J05B 1ONQA 4MVBD 3VFMB 1NLBL 3O8XD 5A16B 2AJYH 3B5TA 1INQA 2LFGA 5MEOB 1G7JB 4JJHA 1MHEA 2A6KA 3FO0L 2W9EL 3V95A 4Y16D 2EIBA 4L4JA 2YOCA 1EGJH 4YFEA 1HQ4A 1X5KA 4CADA 4BA8A 4RAVA 4X4XA 3BH8A 4HFWB 1WIOA 5T1KB 5GS2D 1J5OH 4YDIH 1AH1A 4JY4A 2RJMA 3QWOB 5ICZA 1U8JA 1VKXB 2ICWI 4G9FA 5IHZA 1OTTC 1MRFL 2I9LA 4FFVD 5CHNA 5TF0A 3DROB 4R90L 1E4KA 3OV6A 4QKXB 1DVFD 3SGKC 2A74B 2DTMH 4QHNA 4JGUA 2YS4A 5D7KD 4LLQB 2UYLA 4APQD 4WO4C 2FO4B 3CFCL 2DTSA 4FXKB 1I4FB 1K6QH 1AI1L 4S0SD 1JPFB 3I75A 3X14B 2CRIA 3T3PF 1YEIH 4UINH 5C09D 4F2MA 2GSIA 2YD1A 3B9KA 1OAKL 2X7LA 1U8KA 3N1GC 2DQHL 4QXUL 2CMRL 3B2UD 1WQVT 5CP3A 1YECH 1H15B 4ODBD 3TM6A 4Z95L 3E0GA 4R2GB 3W2DL 3DURB 4RWYL 5F7HA 4JM4L 4P3CH 4TTGA 3ARDA 4FQHA 5CEXB 4NRXA 1ZEAL 1EEYB 4G7VL 5E8EB 1FL3A 2FWOA 3GSXB 4GRMB 3UZVB 4JQVC 5CJQL 1Y0LA 3VH8B 1KNOA 2Q8BH 5FA3A 2C7UB 4F7CB 5DRNB 4L29B 4NUJB 4KTYA 2BVPA 1BZ7A 3BEVB 2XQYG 4XBGA 2XWBB 5EC1B 3FT3B 5EBMB 1JPST 2UWEF 2H6PA 1J7VR 4DKEL 1P7KA 3MROA 5I16A 1ACZA 2OJEA 2Y7QA 3MJ7A 2VLLA 2WBJD 5TE6L 4Y19A 4NDMA 3WJJC 4KK9D 3CFEB 5KSBE 1C7TA 3MOAL 2BNUB 4IDJL 3QDGE 1WFTA 4P4KA 5HHME 2N1KA 1KB9K 2QQKL 1N5AB 3EJZD 3PV6A 5B22A 3JSSA 3VGHA 5FYKE 5HGAB 5BV7B 5C07D 2H9GA 1NBYA 2XTLA 1MCDA 4Y4FB 2E8ZA 4PJXE 3D85B 4OLYH 2O5ZH 5ACZB 4MNGE 1ORQB 5DVNA 3CFJA 5BZWA 4GJTB 4LVEA 4J7RA 5DQJA 4Y89A 3V4PL 4DW2L 4HSQA 4KZDH 4HWZB 4IHOB 4NWTH 2NY4D 1KLGA 1U9KA 4F33A 1TZIA 2Z92B 4NOFA 2NXYB 2R1XB 4O4YL 1QFUH 4F37F 2CIKA 4ODUA 4S1QL 4KRLB 4M7ZB 4HH8A 4I1NB 4PJCA 4QOKE 3WS3B 3MRCB 2IQAA 4ODVL 5MEQB 1I3UA 1U93A 2FJHA 3QWRD 3U0WL 3LKOB 1AO7E 1FYHB 5MENE 4L4VD 3TVMC 1CIDA 1U8PB 4DGYL 2D0GA 4NCDA 1OGAD 1NMBH 4XP4L 5C7XL 4LQ1A 3TA3B 5K9OA 1ZTXL 4RFNB 2DQIL 2IBZX 5ICYA 5BCAA 3MUZ1 3C60C 3EYSL 4QRPD 5D5MB 5DMKB 2MNUA 4NJ9H 5DLML 4N1HB 3TH4T 5JORA 1UB6A 4LHJB 4BH8B 1AGDB 3EOTH 4NC2B 1F4HA 3VFPA 1OTTD 2V9TA 1VPOL 3GSVA 5EBLB 3L3HB 5KVDH 1FVEA 1KCSH 1MRCH 4HGMA 4ELMF 3ZE1E 4XNQA 1PDKA 3MBEB 1C12A 2WANA 3D9AH 4V1DA 1J11A 3ZTJH 4X5WB 3BN9D 3ZDYF 1NAML 1L4IA 1KIPB 2WAHA 1SEQL 2EKJA 3A6BL 4OD1L 1LGVA 4YBQC 3RX5A 3PWPB 3MRNB 3ROLB 1G9ML 1YNKH 35C8L 5EOCH 4JG1L 4R0LA 4JGJA 1KN2H 5I2IA 1QRKA 4CW1B 2CKBL 1DQQA 5C0RL 1PVHA 4JY5L 4KMTL 4C56D 1F3JA 3ARBD 4HK3N 1RIHH 3P0YL 4NRZB 5DEZA 1OD9A 4HMDA 3T65B 3WFBH 3MRRB 1FZMA 5AYUH 1JPTH 5E5MA 1FPTH 3ZSTA 4KTEL 3CDGB 4HFUH 1H3WM 2F74A 3BW9B 5KS9B 3OGCB 4FG6C 3SDXE 3O4LD 5EU3B 3B9EA 5I18H 1URLA 4X6EB 1ORSB 1JTPA 4OLVL 2VWEC 5DK0B 3AREC 2VAAA 4JPWL 4LLMA 2JB6B 1A7QH 1JGEA 4GUPB 4QY8A 2LVEA 1AGBA 4KUZL 5BVJA 2EDFA 5FKAA 1PGRB 1CDJA 2XFXA 4L8BB 1FNEB 4NZUL 5C0CB 3CXHK 3HC4H 4G3YH 4LNVA 1G9MC 3LV3A 3O6FB 3FHQA 4G8GA 5FB8A 1GGIH 3GMOA 4LCWE 4R97B 4HWBA 4LVHC 5E2UH 1H0DA 3SOBH 3QXVA 4EI5A 3N0PB 5IVXA 5TQ2L 3JV6B 5FUOH 5A3IC 3MNZA 3S88L 3S4SG 4PV9B 2E7LA 4RFEB 1JF1B 3K3QA 1CT8B 4MJID 3GM0A 2P7TA 1HCFX 4WEMB 2HJLB 1I9JL 3IJYA 3UJJL 1T0NA 2R9HC 1I8KB 1YC7A 2ORBH 4HWEL 4FQCH 1GZPA 4P5MA 1PQZB 2QLVB 3VXOA 5FOBA 2B7DT 1NDGB 1TVHB 4LPYA 2D7MA 3BT2L 4RNRA 2YD6A 4UMGA 5FYKH 1EVUA 4K2UH 1EZVX 4P2OD 2AGJH 1HEZA 3QUZC 4PJGE 4PJBB 5ID0A 4CU7A 3T0WA 3TFKC 4DZ8B 5DJ6B 1NDMA 1MUJA 4BZ1L 3SBWA 4NM8H 2X42A 3MV01 5HVHC 3OJ2C 2BJML 3V0WH 3PWJB 1DBJL 1FNGB 1FZKA 4HWNA 4RRPA 2FL5A 3S34H 3VWJC 5IMOA 4YHOH 4LKCA 2YD3A 1N6QH 4WJ5A 3MNVA 3QNZA 5KSAA 1T04A 2AEQL 2VZUA 4Z0BH 2COQA 2IEPA 5D9SA 1HH9A 3TP4A 4BKLA 4PGDB 1ZGLM 5GRJL 2K3TA 3RTQB 2FCBA 3ZO0A 1RJLB 3SGDI 2P4AB 1Q72L 3QYCA 3FT2B 2OS7A 2XTJB 3MLVL 5J6HB 1KGCD 2VLJA 4KH2A 1HHJB 1HYSD 3G04B 1F8TL 1VERA 3NACH 3QIUC 1FLTX 5EZIL 1J8HD 4Y4KA 1OAXH 1P6FA 3IDNB 4MD4A 3C6LB 3NCFB 4HLZH 4E5XA 2QHLA 1G7HA 1MAKA 3SDCD 4YE4L 1NL0H 2VXVL 4LEXH 2V17L 2MHAA 2W60B 2E7BA 1IGIL 2NY5L 1MHHA 3V5KB 4JKMA 4GRLB 4RISH 1BMGA 1IM9A 1LK2B 4LRNH 4PYHA 3V5HB 4WV1A 1MFEH 2EXWD 4KI5F 1B4RA 4NQDA 4P2QD 2AK1L 1AR1D 5JR1L 2L0DA 3TBVB 5INCA 4N8VB 1KF9B 5IHLB 1I85C 4E0RA 5DD6A 2GYSA 3RBGA 4P4RA 4Z5RB 3TH3T 1HWGB 4PRNB 3FQXA 2Z8WC 4HGWA 4E41A 4BFEA 4KDWA 4NZDA 4WFHE 5I1IH 5T1DL 4P2RD 1F13A 4MNQD 3GMRB 4OZ4A 1A6VH 2BDNH 2HFEA 3V6FA 3AAZB 2F8OA 2HFFA 2VDMH 4X7TA 2J8UA 2DB8A 3ALWA 1I1CA 1PEZA 3OKNA 3ARPA 3VMPA 1DQLH 5IB3A 5E03A 4QHMB 2W65A 4JM2B 4LSVL 4YDKL 1B2WL 4P46C 3BPOB 5DD0H 4Z76B 2NY5C 3ARED 4TNVF 1OW0C 4L3AA 3PHSA 4NQSB 4GXUM 5DVLA 2PTUA 4QHKJ 4MD5A 1XH3A 4WFEE 3G08B 3OXRA 3L6FB 4I9WD 3MRFB 4J3XA 5CILH 4K23H 4TNWF 4G8IA 4UUJA 3KPSB 1CDUA 4X8JA 3I6GB 1PX3A 4GW1A 4XPGH 3VXPB 3D2UD 1H3PL 3WNNA 1HDMB 1DFBH 4JG0H 2VISA 5HVFB 2GIYA 4NZRL 3CLFL 4OIAA 5ESQB 4H0GA 4GAYA 4L3EE 1MFNA 1DE4A 1JPSH 2W07A 1A6WL 3TN0A 1R6VA 3ZDXE 5JHDB 2E3VA 2BNRD 1XGUA 2EC8A 2R9HD 3O3AB 3LRSA 3O9WA 1YY9C 2LU4A 3VXNB 2O61B 3SE9L 2X44D 3F65A 1GGBH 1Q9LB 3GSNA 1HXMA 4XZUA 3VGGA 4Y2DB 3WD5L 1JNHB 2ZOLA 3AFLA 1MCNA 1B3JA 4UIMB 3HZKB 5JOFB 3QUZD 3TFKD 5EU5A 3QDMD 2NW2A 3PL6B 1TQBB 3MRBA 5I8CA 2WINB 4K71B 5F71A 5DHVH 4QF1B 2BK8A 2YC1B 1VGEH 1BZ9B 3VWJD 3RZWA 3KXFE 5C0DB 2VLKE 4LPWA 1TQCB 4Z7UF 3ECBA 3ULUL 3UBXI 5HGHA 1X5GA 1S9WA 1LP9F 1PZUB 1HQRB 5MP6H 2W0FB 2IANA 3IJHB 1IGTA 1FLRH 1JL8A 2NW3B 3MV8D 2OTUA 3ZL4L 4NWUL 4NP4H 2FD6H 2P47B 5FO7B 3HG1B 4WUUE 1DUZB 2Q7YB 1SYSA 4HJGB 3L7FB 3B3IB 3CMOL 1HZHH 2OSLB 5BW7C 3FQNB 2X5PA 3D69B 4AT6B 4HW6A 1CTOA 3WL9B 1KENL 1QR4A 3DRQB 4S2SA 1EGJA 4P9HL 3REWB 5D1ZC 1OCWL 2E27H 2V5RA 4JFQB 5CEZE 2VOTA 4JHAL 2VABB 3QQ9C 4RMRA 4LCUA 4Q58C 5GRZA 3OHXB 2ADGB 4PJFE 1PX4A 2YUWA 3U1SL 2BXYA 1ZVSB 4AYFA 1CE1L 5F88A 4FRWA 4O51A 5KVFH 4Y5XC 3L3OA 3EIFA 3WDIA 4QXGL 3W0WD 3TCLB 3ULUC 4JFOA 3VXRD 5HHOE 5AWNH 5E8OB 2RBLA 4ZUUA 3LKPA 1G7QB 3JV4A 4K7PY 2QEJA 3DBXB 4MS8C 1ETZB 4GKNB 3SE4C 5IEKB 2FEDC 4F3FB 3IDMA 3ILQC 1F4WH 2DQFA 3NH7L 1P84K 3TYFA 3P4NA 2W91A 5JXEC 2ITCB 1T4KB 3F7YA 3QEGH 4Z7VB 1C1EH 4HUNB 3K4AA 3BJLA 4JO4H 4W4NA 3OAUL 3OL2A 2FIKB 1IARB 3NCJH 1N2RB 4P46D 4P9HC 3TJEH 2AS5M 4M00A 1NAKH 1KCUL 3GBLA 5IW1A 3BZ4A 4I13B 1CG9B 4ELKB 1S7VA 5HI5C 3FQUA 5CSZA 2YK1H 3HAEB 4H0IA 2C3HA 1YEKH 4ZD3H 2W9DH 3ET9F 2FH8A 4ZTPL 2I07B 4PJ9D 3RGHA 1TJGL 4MLIA 3IB4A 1I1RA 1RK1B 4YDVB 1RAMA 3P4LA 2JIXB 2H1PH 2FSEA 4NQCA 5F7NC 5DJ8B 1T5XB 3TNMA 3G5ZA 5GSVB 2OQJB 4G43B 2LE9A 3BUYB 1MH5B 3CAFA 4MA1C 3LY6A 4OZGA 5F7MC 4OLZH 2Z93B 3VFVB 5JPNA 3ILPA 5E2VL 3WLWD 5FGBC 1VFOA 2FGZA 1RY7B 1ND0B 3RIFF 3GMMA 3AB0C 1AGEB 2QSCH 5JW4N 2ED9A 4PJDB 4NKIH 1F02I 5D2NE 4NNYB 4I0CC 2M2DA 2XOTA 1YMME 4AEFA 1RVFH 1JV5B 4PJIE 1Z5LA 3V52L 3CFBA 4C55A 1X5ZA 5C08E 4MD0B 2PETA 4Z7WE 3QG7H 3CLEH 4AMKH 1CDGA 2ZZUT 4Z77B 3MRMA 3KWWA 1P4IL 4PJ7A 1X9QA 3ZKNC 2EDYA 3IETA 1QSEB 1AR2A 5IBTH 3JUZA 2ZUWA 4K7PH 5DEFB 4I4WB 4JGMA 5JW5B 4HKJB 5T1LB 5BO1H 4H26A 1CK0H 3IKCA 1MSPA 1XF2A 1DTUA 2AEPH 4XCEB 3SDAB 3LEYH 3RVUC 3V5DA 4X6FB 4XXDB 3WN5C 5DA0B 2BFVH 3MJ9H 4YFDB 1LNUA 5DJXA 2NTSP 3GBML 4KJQD 1A9BB 1BECA 4JZOB 5D1ZD 1ZLVK 1NFDB 3BGFB 1JZ5A 4R4BB 1G7LA 1FYTB 1PY9A 1FL6B 3KLDA 4LSTH 4BSVA 4OM1H 4CN1A 3SE3A 3U2SA 1ERNA 5GGRY 2X9XA 1JTTA 2Q3AA 4Z7VF 5C0IA 1N64H 1T5WB 3WKMH 5C0AB 4ZOEA