3UAAA

Multicopper oxidase cueo mutant c500se506q (data1)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uaaA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uaaA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uaaA03
2PP9A 1EHKB 2UX7A 2UX6A 3QJRB 4E9SA 1PLAA 1SNRA 3KW7A 1ET5A 1BQKA 4MFHA 3IN0A 3TBBA 3NJKA 4NERA 2HRHA 3FPYA 5TK2A 2QDWA 4BXSV 1RZPA 1A8ZA 3NJNA 3OM3B 1KYAA 1KCWA 4CSZA 5AKRA 1M57B 1OE3A 3RYMA 3UGEA 4E9QA 4HALA 4TXVB 3ABMB 1WA1X 4A2EA 1SF5A 3OQRA 2BWIA 3ZX1A 5B1KA 2IDUA 1TEFA 4YSSA 4E9RA 4G71B 2CCWA 4YSTA 2IDSA 2PPCA 2AZAA 1J9SA 4BWWA 2VM4A 1ZIBA 3FSVA 3NJLA 1XMEB 4NAJA 3WKPA 5IY5B 5I6KA 1JOIA 2YAFA 4UANA 3CDZA 2FTAA 3AZUA 3QQXA 3UACA 2Q9OA 3D12B 4E9YA 3N55A 2QPEB 3FQ1A 1NIBA 4DPCX 1RCYA 3S8GB 4G72B 5I6NA 3T71A 4DPAX 1AZRA 5TK4A 2GB2A 2OCCB 1NIEA 2CAKA 2I85A 5B1AB 1HAWA 2QPDB 2WSDA 1JERA 2FQDA 1PLCA 4E9TA 4G70B 3ERXA 1NDTA 5I26A 1AS8A 2OV0A 3TASA 2B3IA 2BW4A 2BP0A 1FWXA 3PPSA 1ZDQA 4JHUA 2PP7A 2PPEA 1BXAA 4P5RA 3IN2A 2X88A 3PAZA 3CVCA 3HEIB 1RKRA 3FSWA 4JKNA 1A4CA 1OF0A 3WIAA 3WKQA 1PCSA 3ZBMA 2A3TA 2FQEA 3X1BA 1JZHA 3PAVA 2XX0A 2JFCA 3BQVA 2VM3A 1PZAA 3JTBA 2LLNA 1AIZA 2FT7A 1AS7A 3JT2A 5PAZA 1PAZA 1GSKA 2HX7A 2XV0A 3NJFA 2FJSA 3FSZA 1NIFA 1OCOB 3QJUB 5B7MA 5A7EA 2XVBA 5I6OA 1BQRA 1SDDA 3NSYA 1EZLA 2IWEA 2CALA 2XWZA 1OV8A 3CG8A 3FS9A 2N0MA 1WS8A 4KO9A 1GYCA 3NJGA 4YSQA 5EHFA 1JXFA 2VSKB 1ASOA 2BW5A 2IWFA 1KGYE 5I6MA 1JZJA 1NICA 2DYSB 4KO7A 2J55A 1OOWA 1SHWA 4W9ZA 5F7AA 4BDVB 5B1BB 2HX9A 1AZCA 1ILSA 1TKWA 4WTQA 1WA0X 2XX1A 1ZV2A 2AFNA 4DP6X 2QT6A 3OD3A 1V10A 1NTDA 3ABKB 4DP7X 2GC4C 4FAAB 2AANA 1PY0A 3KW8A 1CUOA 1PZBA 4KOBA 3C75A 1CYWA 3AG1B 4PCYA 3NSDA 1GY2A 1PF3A 1WS7A 1FFTB 3TU6A 1QNIA 4HAKA 1BAWA 3X2QB 1AOZA 1AG0A 4Q8BA 3OMIB 5E9NA 3FU9A 1MZZA 1J9RA 4GY4A 1J5CA 5D4IA 3ABLB 1IUZA 3FQ2A 4YVUA 1KBWA 2FWLB 2GBAA 3FU8A 1E5YA 4M3HA 4KOCA 1HFUA 3FYEB 3X1EA 2DYRB 4EF3A 2EIJB 4AX3A 1NIAA 3ABGA 1SFDA 2IH8A 3WG7B 2FQGA 1ZPUA 5I6PA 4DPBX 4DP5X 8PAZA 2P80A 3S3DB 2BZ7A 1JZEA 3FT0A 3FYIB 5I5IA 4DP0X 3UAEA 2OJ1A 5B7EA 2H3XC 1PMYA 3NP4A 4AZUA 1E30A 2IWKA 2PPAA 2VMJA 3FU7B 1AR1B 1BYPA 3T6VA 2R7EB 1BYOA 4GP5B 2MRYA 1XB8A 4K9JA 2TSAA 4BK5C 2YXVA 2XU9A 3HB3B 3NJJA 1NZRA 1IBZA 1ID2A 2UXFA 2HLEB 2UXGA 3H4FA 3EF4A 4YSPA 4BWTA 1KDIA 2Q5BA 3NP3A 1DYZA 1FA4A 1RZQA 4Q89A 1GS8A 1GW0A 3SBQA 2GIMA 2P80D 5AZUA 4ENZA 2XYBA 1JZIA 3NJMA 1A3ZA 5D4JA 3G5WA 3AG4B 3UADA 1WAEA 1N70A 1JVOA 4DP9X 3EHBB 4A68A 1JXDA 4BDVA 2J56A 3X1GA 3V9EA 4BWUA 2VW6A 4KO5A 4HHGA 4UF7C 4A2FA 1HAUA 2YARA 1B3IA 2UXVA 4HCFA 2VW4A 1ZDSA 4DP2X 2WO2B 1N68A 3GDCA 4G7RB 1NPJA 5D4HA 1ET8A 1XB6A 3SBPA 2ZWNA 4CSPA 1M56B 3H4HA 4HIPA 1L9SA 2I7OA 3SBRA 4M4RB 1W6WA 2VN3A 4KNSA 3ZDWA 5F7BA 3GXUB 2GSMB 2IDQA 3FSAA 1PZCA 1JXGA 1BXVA 1OCCB 1AZNA 2ZXWB 1MDAA 1OCRB 4HCGA 2TSBA 1J9TA 2IAAC 1ILUA 4PAZA 3ZIYA 1VLXA 3AW5A 3ASOB 4YSDA 1W6LA 3WNIA 1NWPA 3QJQB 2XV3A 2YAOA 1PLBA 4YVNA 2Y1AA 2PCYA 1KBVA 3U25A 4E9XA 4YSEA 1SHXA 4A2GA 1AG6A 1OCZB 3IEAA 3CVBA 1J9QA 3T6XA 3X1FA 1A65A 2VSMB 4W1TA 2IH9A 2XV2A 2DWSA 1W8EA 3QJSB 5PCYA 1V54B 4F7KA 1T5KA 2PCFA 4YSRA 3NYKA 4HHWA 2UXTA 1ASQA 2PLTA 3BVDB 1ZIAA 3ASNB 4KNUA 2J5WA 2XXFA 3WNJA 4QKTA 3NSFA 2JXMA 2RACA 1IKOP 3AG2B 2PP8A 4GP8B 4G7QB 4A2HA 1PNDA 2DY2A 1L9OA 2VW7A 4NB7A 2EINB 2BO0A 1JVLA 2FQFA 1X9UA 3FU7A 1ASPA 2R7EA 4KNTA 1OE2A 1GY1A 4X4KA 4A2DA 3UAAA 3QPKA 4YSUA 2BP8B 4L0PB 1NINA 2GI0A 1E65A 2HZHA 1CC3A 3T9WA 1TEGA 4A67A 1I53A 2IDTA 2JKWA 9PCYA 4AKQA 1MG3C 2CJ3A 5I28A 2PPDA 1L9TA 1A4AA 3QJVB 4UAHA 3L45A 1ADWA 3TA4D 5I6LA 1V55B 2PPFA 6PAZA 3IE9A 1SF3A 3MBWB 1X9RA 1URIA 1XB3A 2H5UA 4YL4A 3S3BB 2GC7C 1L9RA 1UATA 1IBYA 2XXGA 7PCYA 1NWOA 5I5JA 1AAJA 2DV6A 3MX0B 4FA7B 3H56A 4GXFA 1AACA 4AKPA 2MTAA 2YAEA 1WA2X 5B3SB 4BXVA 2BZCA 4KO6A 1MG2C 2YXWA 1AS6A 2BWDA 2HRGA 5AFAA 1KCBA 3QJTB 1OE1A 2XLLA 3S3CB 1CURA 3UABA 2EIMB 5FC9A 4YSOA 3AG3B 4ZK8A 3DIVA 2H47C 1DZ0A 1BQ5A 2EIKB 1TU2A 2BHFA 3N2JA 3S8FB 3OMNB 4QLWA 2AZUA 2HX8A 2CUAA 1KDJA 3NSCA 3EH3B 5I5MA 1AZBA 1GS7A 1KV7A 2CBPA 4G7SB 2GHZA 2W8CA 4YSCA 3EH4B 3PAUA 1M9WA 1NIDA 2W88A 4N8UA 3GYRA 1AANA 2X87A 3OMAB 3CDZB 4DP8X 4YSAA 2Y69B 4HZ1A 1PNCA 1IC0A 3DKHA 1E5ZA 3WI9A 2AVFA 1QHQA 3X1NA 3PLYA 4HCIA 1ETJA 1CYXA 4E9VA 4F2EA 3T6ZA 1J5DA 2ZONA 3NJHA 5B1JA 4F2FA 3DTUB 4GYBA 3NJIA 5B1JC 3T6WA 1AQ8A 2YAPA 2E86A 1JZFA 1SJMA 1NPNA 2ZOOA 2YQBA 4AI7A 4E9WA 1JZGA 2IDFA 3EH5B 2FT8A 3AY2A 4P5SA 4AKOA 2QDVA 1E67A 2HXAA 2YAMA 4WKXA 2BP0B 2J57A 1SFHA 3SQRA 2FNWA 1BEXA 1YLBB 2FT6A 1MZYA 2WO3B 4RH4A 4N4YB 4DP4X 2YAHA 1ET7A 5LDUA 2BP8A 2YAQA 1AZUA 3FPXA 1L9PA 1L9QA 1F56A 2DWTA 4JHVA 1GS6X 3V9CA 3IBOA 3PCYA 3PXLA 2B08A 4A66A 6PCYA 4DP1X 3FQYA 3TBCA 5ANHA 1QLEB 2EILB 3CVDA 1SDDB 7PAZA 3CZUB 2NRDA 1R1CA 1GR7A 4GP4B 1BXUA 2XUWA 3NT0A 5B7FA 1A4BA 2I7SA
chains in the Genus database with same CATH superfamily
1HI6A 3U6RB 4BZ2A 3OR6A 2R2EA 3UZVB 1UASA 1TETL 4QRBA 2PO6A 4XHJC 5GGUA 1IC5L 1SNRA 2ZWKA 4H8UA 4FGMA 5BOPA 1JNNL 2IPTH 4HMDA 1AGBA 3SE4A 4YBQC 3S37H 3B3IA 1IL1B 4AGLA 2VDPB 2L7QA 4WI5A 3T0ED 5DEGB 4JGNA 2DQCH 3QUXB 3NJNA 1O6SA 1LMKA 1A7RL 5TQ2L 1P1VA 3UJTL 1TCRB 3GSNH 4AJVA 5JDSA 4RWHA 2IQAB 3SKUD 1X5XA 3F6JA 2J7LA 2EDMA 4PWIA 5IHZB 3CXFA 1HXKA 3U6XS 4G9FE 3V0GA 5DQJB 3ZQWA 3B9KD 2DKMA 3ECUA 1PG7L 1Y18B 2IDUA 3CCHA 4P9HH 4HWBH 3VGAB 5DS1A 4YSSA 1D2OA 1B2YA 3QIUA 4IRZL 1GHFL 3EFDH 1LEKB 1BVLA 1FZKA 1UB6B 5EBWB 1PL3A 4LSSH 1X6LA 2IIJA 3NJLA 5I8KL 1IC7L 3D3VA 1NCCH 3G6AA 4OFDA 2OMXB 3BSZH 2GK0A 2WZ6A 1Y07A 3C8KB 2NY6B 2IXQA 3FT3A 1T0NA 1QRND 4GW1B 4B9PA 4HU8A 1FE8L 3FRPG 4BFGA 4OLUL 5DUMH 1CN4A 3HI5H 3V5HA 1HEZB 1ZLSL 2DQJL 3CWGA 5J6GB 4G72B 2RFXA 1KMGA 3STBA 1QG3A 4AYFA 3F01A 1AZRA 2Y1ZA 3NPSC 3GK8H 1CDGA 2M8XA 1NIEA 3MRLB 4PD4J 4ZNEA 1Q9OA 3C5SB 3F8UB 3FQUB 4WAFA 1N64L 3ESMA 2I85A 1A02N 3CSYA 4RGNC 4XGZA 2WSDA 5EF3A 2PTTA 5DTFA 1PAMA 2Y7LA 1NGWB 3OTTA 2RB8A 3O6MH 3G9AB 4I3GA 2ZSWB 1OGAB 1X4ZA 5IQ9A 2VDMH 5L0QC 1DQIA 4HUXA 1KIRB 3DBSA 4RMTA 4KNQA 1A6AA 4KK6D 4KKQA 1OF2B 2YPLD 3BX7C 3CNKA 4P5RA 3SIKA 5INCB 4WFED 2OTUB 3G5YA 3FSWA 3HRZA 4GAFB 4XMZA 5ETUA 5F89B 4PJGF 2JFCA 1BBJB 3SE3A 1PZAA 4M1DH 2ATKB 5KVFH 2JKLA 2XWDA 1AGEA 2EE3A 2H7WA 2AS5M 2XV0A 4GAGL 5AWNH 4ZW5A 2O6PA 1BHGA 4YZFF 4J1UB 1ZHBA 5DD1L 5SWZE 4AG4L 5E24E 5D5MB 5GGVY 3H8NA 2P42B 3L16A 4BSVA 1DJGA 2R4RH 2WW8A 3I6KA 2QFPA 5IBUG 4I0PD 4KO9A 4ZS6C 3VG9B 3NJGA 3OJVC 3U6RA 2WLZA 2V33A 3QUYC 3UZVA 4B60A 2DLGA 2BW5A 5K1NA 4I3SH 2NX5B 3QR0A 1NBYB 2WCSA 1RQ5A 3ASWA 1RIHH 1K3IA 3CFUA 5D72H 1IL1A 3PDOB 3SZKC 3WKNA 5DEGA 2A9NL 2AF2A 2ZJSL 3QUXA 3UP1A 5IJKC 3CQPA 1BFSA 2QT6A 1TCRA 2IQAA 3LPPA 4FA6A 1HOCB 2PTVA 4PWHA 5IHZA 4J4PD 3PXJA 1MCWW 1TZGH 1NEUA 5DQJA 1PZBA 1JZ8A 5A1AA 1Y18A 4HJSA 1YDPB 4KTGA 3QO0B 4L3AA 5BOJA 3PJSB 2DTSA 4M7KH 3CUPB 5FYLH 5B4MD 3S88L 1LEKA 3T0WA 1UB6A 5EBWA 4CJ0A 4WJG3 1PFOA 1SXCA 4MCYB 2OMXA 2IBZX 3C8KA 4PB9L 2VE6B 5KZCD 3MOBL 1GMEA 1X5IA 2DMBA 4GW1A 3RKDC 4GY4A 2YMOA 4H4NA 3OKDB 1HEZA 3M07A 1IUZA 5J6GA 3OXSB 5HJDA 3ARED 3MJ9H 3U2SB 4K9EH 3UMNA 2F18A 3TZVD 2N4IA 4DQAA 1U8KB 2WYTA 3MRLA 1P7QB 3C5SA 3RHWF 1DFXA 3FQUA 3UPCA 3UXFA 1R34A 1BJMA 5EF0A 1F18A 3F85A 4OLVH 5FEBA 5DEZA 1EZSA 1ZANL 1SZNA 1NGWA 4IKLA 3PGFH 3IRPX 3Q2NA 4I4WB 2P7TB 3VXUB 3U1QA 2ZSWA 1TSHA 1OGAA 5EC1B 1F3JB 2Z8RA 5ACZB 4L4VD 1OARH 4ONHB 1KIRA 5DHDA 1QFPA 2HMIC 2AQ1A 1OF2A 3DMMB 5D1QD 1SBSL 1JZ5A 5INCA 2OTUA 5GSRB 4HCRL 3ZHKA 2AQSA 3H9HB 5F89A 1BBJA 4DN3L 5FGRA 4IK6A 1M05B 2ATKA 3L1EA 2CJUH 4X6DE 3DARA 1UC6A 3NJJA 1ZHNB 3SCMB 5C8JB 5ABAA 1CD0A 1J5IA 1DJIA 4Y9CA 4H8PA 3V5KB 5I1DB 4J1UA 3RWJB 3FHQA 2I25N 5D5MA 3K6SB 3K7UA 2BSCA 3EYSL 2XIDA 4PUBH 3R19A 3VXNB 4RMQA 2Z1PA 3K8KA 5CSBA 4F7PB 4KRPD 2R56H 5EB9A 2NX5A 1NBYA 4IRJB 1P69B 4KVCH 4S1SL 3PDOA 4LL4A 5LWYL 3CC5B 2JLLA 1PJ9A 4EKJA 4XXWC 4KMTL 4GH7B 2FBJH 3S98A 3MYJB 4DUWA 4K2UL 3QHZL 1FNLA 4TVPH 1HAUA 1EFXD 2JKRM 3L1OL 4M02A 4ZS7H 2ZXEB 1HOCA 3MJ8B 1U8OB 4KXAA 5CZRA 3B5TA 3D08A 4HZAA 4K5OA 5FGBC 3T5WA 3D09A 2DQTH 5CCHE 1ET8A 1XB6A 4UOQA 3JZYA 3MCLL 4QWWD 3J8F7 1YDPA 2F54B 3QO0A 3PJSA 2R0ZH 2O5YH 2WLHA 3ZSSA 3CUPA 2R1YB 2DQUH 5LNDA 2HWZL 4FNLH 4W4OA 4QHKJ 2VN3A 1BD2D 5ISZB 4MCYA 1RK1B 2CO2A 4UQIM 1JCVA 3SPCA 2VE6A 4FNUA 3ZDZF 4NKQB 2ODIA 3EYFB 4KXCA 4CJ1A 3OKDA 5LJYH 1O7DE 3BUTA 4UM8B 2UZIH 3QULB 3OXSA 4XWOC 4TMPA 3UAJC 3CBKB 3U2SA 1X44A 3UYRH 1NAMB 5GGTA 2EUWA 3FK3A 2Y1AA 1U8KA 1P7QA 4LEXH 4B0MM 4NUQA 3PFUA 2BXYA 5BV7H 1W8EA 3FMGL 1OZUA 4ZOAA 1TMQA 4H1LB 1A3LL 4I4WA 1ASQA 2P7TA 5HGAB 3VXUA 4XTRC 3B2UC 5EC1A 5KYUB 1YMMB 1F3JA 2DDQL 5DZOA 5HJGA 5ACZA 4ONHA 2OLDA 2BSTB 4ICWA 3DMMA 5AYUH 4OU3A 2WUCL 1H9DA 2ZAGA 4XPBL 3ISRA 1KB3A 2AXJA 5GSRA 3BLBA 4FABL 4PN6A 1PSKH 3MO1B 3H9HA 1MCCA 1UKQA 4OIIL 2P49B 1M05A 3LQMA 3OMZA 2EUVA 1E43A 4JE4B 5A40E 3F6LA 3QNZB 1ZHNA 3SCMA 5C8JA 1BA9A 3RDJA 3V5KA 5I1DA 3MMEB 3BJ91 3RWJA 4AY0A 1LTXA 3AU1B 1H6TA 2HKHH 4QR7A 4KX9A 5ICYB 1VGEH 3K6SA 3H7BB 2KZWA 3O2VL 3WE1A 2CJ3A 1U8LB 3VXNA 2CBOA 2YD1A 5I28A 1MIML 3NJVA 4MX7B 3H9YA 1SYVB 1NFDF 4NZRH 2AQQA 4LCWE 3WFZA 3EJYC 2R0KL 4F7PA 1CGYA 3HPLB 4IRJA 1UA7A 2XXGA 1NMAH 3QC6X 2WAHA 3RQ3A 2VR7A 3CC5A 4MNQE 1FC1A 5C7XL 3HA0A 4IOFC 4J8QA 3MYJA 3CHRA 2XZZA 3WFHB 3MJ8A 1U8OA 3TJEL 1OP5K 3AS3A 2BVQB 4PJAB 4N90E 4GKOA 4ICXA 4KXZI 5E4OA 1TVHB 2WNXA 3FTYA 3VU1A 4YHYB 2IFFL 1T04B 2XT1B 2F54A 5CU5A 3UBXG 3N2JA 1KGIA 3DOSB 3L08A 2YRPA 4XNXL 3MXVL 4QLWA 5L9DL 2R1YA 4G7VL 5GGRY 3OJMB 4QRPB 3CFKB 3TEXA 4HKXB 1CB4A 4HBCL 4WCYL 5ISZA 3MUHL 3D5OF 2ZUVA 1RK1A 1MFDL 4PRNB 3EHBD 3SOTA 2DMCA 3CLWA 4FC3E 5C0BE 3NCJH 2J8HA 1IQWH 3OB8A 4FQQB 3EYFA 1UQSB 5FOJA 1QPPA 1ERNA 2WBXA 1REIA 4UM8A 3KYOB 3QULA 3D18B 5I75C 1UJTA 3NCBB 1DQJB 1NAMA 2KHAA 2V9TA 1E5ZA 3UBGA 4NO0B 4PRPE 3T6ZA 5EU7C 5EZOL 5FYKU 3H9SE 1RD6A 3WS6C 3Q8AA 4L0ZA 3LH9A 1AQ8A 4H1LA 8CGTA 1T20B 3DRTB 5HGAA 1BVZA 5MENB 2EDNA 5KYUA 1YMMA 3RX5A 3CQQA 4X4MA 4XMPH 2VXSL 3AY2A 2BSTA 4CILA 2QZ5A 1JV5B 4A6YB 2NY4C 3F00A 4HWZB 1NGQL 4HXBL 2ICEC 3MO1A 1A7OH 1KIPB 5I73C 4Q58C 2ICWJ 3PXHA 4FXKB 4G6AC 3FQ4A 3HUJF 5C70A 3QNZA 5JIIA 1ZLDA 4JG5A 3FPXA 1WAAA 2W81C 4Q0XH 3MMEA 2MQ0A 5C6TL 3MXWL 5AVXB 3V9CA 2LTQB 4XE5B 1CL7H 3AU1A 5ICYA 4YXHH 4HS8L 2CO3A 5FYKL 4D9RD 3H7BA 3PP4L 1UM6H 3GZOA 1AJ7L 3OF6A 4NC2B 4AQOA 1FGNL 1U8LA 3L4XA 5ANHA 2GBTA 4MX7A 2EDYA 1SYVA 4WGKA 4APQC 1HKLH 4LDEB 3B2XA 5ABDE 4Q9BA 3BZ4B 1KSRA 1AQKH 3L4ZA 1IEHA 4L23A 1N6VA 3HPLA 1I75A 3BI9X 4FQXD 4TULL 1I8LC 1NM4A 4K8RH 1XGYH 1EAJA 4GRLB 4HK3N 3UTTD 2E6PA 3EYQD 1VACB 1KTJA 1YSOA 4LVNC 5DQDH 4XMKH 3FOLB 4OJFL 2WBJB 3Q2CA 3WFHA 5FUCE 4C57C 1W15A 2VO5A 2X1XR 3A21A 3LNDA 2AQRA 4IW4C 5BZWB 3VTTA 2BVQA 3DO7B 4PJAA 1N5AB 1PY4A 1J5CA 1TVHA 1KCWA 1PZ5B 3ECQA 1NCGA 4J12A 3V52L 2XN2A 4LRIC 5BZXA 1T04A 3ZHFA 1JI2A 3DOSA 3ZTNH 3S7GA 2GIYA 2VXVH 4CDGC 4ZW3A 2Z92B 4QRPA 3CFKA 3HI1B 4MMZB 4HKXA 1DJHA 5SWZB 5D6DA 3V4UH 1CTOA 4XVJH 1T1ZB 4PRNA 1KTDB 4DGIL 1INEH 2J4WH 5IVXB 1RJLB 3IKCB 2AZAA 4X9GA 4L18A 5GZOC 4FQQA 4TOYH 5BRZE 1MQKH 3AY4C 4O02B 5KVDH 3KYOA 3US0A 1D6VL 5F9OH 3D18A 4N0CC 1DQJA 3OJDB 2EE6A 3QG7H 3N55A 5FUOH 4NO0A 4YXKL 3SJVD 3BFQG 3D2UB 2VZVA 2FJUB 5DURB 3BVVA 4L1SA 3F58L 3T71A 4CC1A 4PVNA 2BFVH 2C9AA 1JNLH 1N6UA 1E6OH 1JIBA 1T20A 3DRTA 5MENA 1ACZA 3LEVL 3E8UH 3D25B 3NCXA 3IU4L 4DKFH 1EMTH 3T2PA 1JV5A 1QLRB 1FHGA 4A6YA 3FFCE 2LQRA 1BFOB 2OV0A 4WO4B 3SGJA 1AKPA 3F7RA 2B1HH 4P5KB 1TLKA 3MNDA 2VN7A 4HWZA 3VFUB 4Q6IB 1KIPA 4XB8A 4FQJH 4NZUH 4JAMB 4FXKA 4YE0A 1ML0A 4FFVD 3IN2A 3BKMH 4S2SB 4WKZB 2FQEA 4ZD3L 3HG5A 3DTDA 4N0YL 1DL7H 3RWFB 1XCXA 3FUJA 1CDBA 1UH2A 5DRNB 5SWSD 1T4KB 1G9MH 4XMVA 1NIFA 5D7JD 2N0KA 2IWGA 5GISL 5B7MA 1ETB1 4J27A 2CCVA 4ADIA 3ULVH 2OM5A 2QKIB 2R0LL 3NSYA 3IFLL 1N8ZB 1DLFH 3BZ4A 3F04A 5J12C 5ANMB 3RU8L 1QEXA 3N3EA 1GYCA 1DBAH 1I7RB 1MLCB 3KJ4C 3HLAA 2AJXL 3VWJC 4GRLA 2PXYD 1XD1A 3I3DA 4NM4L 4AUUA 1VACA 2R8SH 3B9AA 1XL4A 2AEQL 3QW9A 1SHWA 3FOLA 1CICC 2WBJA 1B90A 5BZWA 2XZQL 1R5VB 4LIQE 4F7TB 3DO7A 1N5AA 2WC7A 1T03H 5I0VA 3OD3A 5EA0H 4P05A 2VDOB 5IHUH 3JWNE 2X4PB 1KGUA 1PZ5A 5D1ZB 5I16B 1HT6A 3U4AA 4F8PA 3NCWA 4PBXA 1G7PB 3HZMB 1CBVL 1IGCH 3RDTC 3RGVB 5L4FA 3LPFA 4KOBA 3EZJB 2DTMH 2Z92A 3HI1A 3HG2A 1DVTA 3B5GA 3IDYC 4MMZA 3LIZA 5DO2C 3EDKA 5DUPL 4OV6F 1C12B 1X5YA 1T1ZA 3FTXA 4OLXH 1KTDA 4V1DB 5IVXA 2VMDA 3QIWB 3CVHL 1RJLA 3IKCA 5D1XE 5IW3A 1ANUA 3EBIA 2F58L 4NP4L 4M1GH 4O02A 4JFED 3OMIB 4EBQL 3ZGHA 4LOFA 3ZHDA 3DSFH 4UOZA 2CUIA 2XPZA 1JV2B 4GINA 3QDGE 3ZKXC 4AMWA 4IRSD 3OJDA 3UYOD 1NUFA 2ZKHH 3D2UA 2HVBA 1QFWH 2GBAA 3DDFA 1JP5A 3ZVVA 3IFPB 3ARSA 4OT1L 5DMIL 3L3DB 4AEIH 1NGXB 2Y7SA 3IRZA 3KBEA 3HE7C 3K1KC 4X9YA 5ENWB 4OZIB 5KTEL 5EEUA 3D25A 3C5ZB 1LO5B 3QHTC 2BVEA 3WV0A 3MCYA 1GMIA 4MTMA 2BOLA 1QLRA 3HR5B 1BFOA 4PBWD 3GEWB 4WO4A 4QAMB 4P5KA 5I19L 2EC9U 3VFUA 3Q1SL 2UUDH 4PJ7B 4Q6IA 3JWDC 4AGOA 1XH1A 3VB8A 2R83A 2Q3XA 3Q06A 2NOYA 2HKFL 4JAMA 4N25A 4P23D 4K8RC 4S2SA 4TQPA 5FUZL 1CGUA 3RY4A 3RWCB 2WXJA 4WKZA 3ZTJH 4Y1AE 2OSWA 2GEEA 1YNTB 4L5FL 2NPLX 4IU2B 2WZPD 3RWFA 2CLZB 1RIVH 2X9ZA 4HK0B 1DBJH 2CGZA 5DRNA 1PVHA 1T4KA 3UG3A 5F1SA 5E56A 4V33A 1FDLL 2VR5A 1E42A 2BNQE 5FIEA 3KPTA 2CO7B 1I9IL 2QKIA 1QATA 4IJTA 1HNFA 1N8ZA 4MQ7B 3CZFB 3IJEB 5ANMA 5AOMA 3OWEA 4JFWA 3T2NH 5AG9A 4QXWA 1I7RA 1MLCA 1ZVHA 3FO2B 3DUSB 5CLXA 4N2IA 3ROLB 2ITEA 1WAEA 4OFQA 4BZ1H 4M00A 4XOCA 5KYXB 3O8XD 2YD7A 1W72H 4X98B 5EZIH 3WLWD 5DR5L 1KYUA 3IDNB 1R5VA 3FCGA 4XVOA 3KGTA 4F7TA 3KPPB 3PNWB 3ZKND 5EF2A 3PYCA 1A7QH 2X4PA 2J3SA 2FD6H 3HMWH 5D1ZA 1IAIM 2X4TB 2VO8A 5E2UL 5F44A 5FA3B 5HHXH 4LDCA 1G7PA 3HZMA 5T1LD 2GTWB 5ECJE 2IO5A 1OPOA 3RGVA 2R4SL 5GSVB 3RVVC 2YUXA 3CZEA 2RA1A 2X70B 4EZJA 3RGHA 3MBXH 1F4YL 1MCOH 3ATFA 4ELMF 5LKNA 1C12A 1OTTC 1A1MB 4V1DA 3QIWA 1LO2H 2AK1L 1I9RL 1RU9H 2QV2A 4L3EB 1SJEB 25C8H 2P28B 3FN0L 5GRJH 4EEEA 5AZEL 1OWWA 4BRJA 1IBFA 1A47A 1JV2A 1M9SA 3NRPA 2OK0L 3I6LE 1OP9A 4PCKA 1HU8A 5C08B 3FT2B 5BMFL 1EQWA 1UCTA 4YSDA 1W6LA 3IFPA 4PS3A 3E3QE 3L3DA 1NGXA 3DRQA 4S0SD 1F1GA 4FFWD 4Z78B 3SPGA 3BUQA 5ENWA 4OZIA 4AVKA 3BP5B 2E27L 3VB9A 3MRPB 3C5ZA 1LO5A 1TFHA 3FF8A 5FX3A 1YEGH 4ANVA 2X4NB 2CRMA 4N2EA 3UTOA 3HR5A 3C87A 1ZA3B 2QEJA 4EQ2A 5GGQL 3NCYP 1VFAB 4PJ7A 1KGCE 3EG9B 3WNNA 3GKWL 5HTSA 4HG4K 2A4ZA 4YFEA 4DGUA 1ZXQA 2EINB 4Z0XB 4B97A 4J23A 1U21A 1XR9B 1QKZL 1PPIA 3HW7A 4N5EC 4XN1A 1TVDA 3VD9A 4YEEA 5T5FA 3RWCA 1Z5HA 5EIQA 1TFPA 2HSIA 1YNTA 2A38A 4WSJA 5DJDB 5HI3D 3IMTA 4IU2A 3T77B 4KGLA 4LLQB 1J12A 1JPSH 2XTJE 3J07A 1E5AA 2EEAA 4HK0A 1CE1H 4FYSA 1BWMA 2L0DA 3ARRA 2VXQH 4P9MH 4Q6KA 3IMWA 4EI5C 2E0PA 4XHQA 1B4LA 2CO7A 3HNVL 3LMJL 3U9UB 4NZFA 2V5TA 4MQ7A 3AWEA 3CZFA 4LHUG 1G6RH 3IJEA 2PPDA 3PS6A 3HC2A 3MAWA 1MAML 3FO2A 4I9XA 2F08A 3D0LB 3DUSA 4MZ2A 3ROLA 1MREL 2BVOB 1X9RA 4JY5L 5B3JE 5EBMB 1XF3B 1IGMH 1JWMB 2CDGB 3I2CL 3ZDXF 5KYXA 3GEFA 3KHOA 2VLJB 3K6OA 2H0PA 4L48A 3BPLB 4R26L 4RMBA 4X98A 2DV6A 5ITBL 2H4EA 4HT1H 2C9SA 3IDNA 2E8ZA 3WJLC 4GXFA 2DS4A 3QQ4B 1N6QH 3KPPA 3PNWA 1OAYL 5D7LE 4FQIL 5FA3A 1ZGLB 2X4TA 1U6AL 2O6DA 1GGIL 4N0UB 2HRGA 3ULUC 4G6MH 2GTWA 3GTNA 5ERWB 5GSVA 4MGXA 2X70A 4AZ8B 1ORSB 2WQAA 2R69A 4HWEL 2XBDA 2J20A 2XZCH 1A1MA 4FTDA 5FFGA 2IG2H 3S8FB 4F57L 2RHEA 1XTLA 4PHZA 3TBVB 5IB5B 3D4ZA 4ECNA 3HMXA 4L3EA 4QLRA 1SJEA 2DD8H 5I5MA 3STLB 1KEMH 2QMKA 3G6DH 2FO8A 1CU4L 1DDHB 4H0HB 1DQVA 3ZTCC 4AWJC 1NCAH 4JB9H 5LG1A 1OSYA 3N41F 5C08A 2JQZA 1TNMA 3FT2A 1FH5L 4YSAA 3QORD 2NUPB 3NTCL 4HZ1A 1LO3H 1DFBH 3DTXB 3ARWA 1VAHA 4Z78A 1J5DA 1MCJA 3BP5A 2GT9B 5HYJD 4RBPH 4Z7WB 3MRPA 3ME0B 2X4NA 4LAQH 5AVYB 4R0LB 1XH3B 4AQ8A 1ZA3A 3FUIA 3P9LB 3UO8B 1I1YB 3GLEA 1ZTXH 2Y5EA 1A22B 1VFAA 3EG9A 3AT9A 3B7TA 2XRAL 5A2FA 3L81A 4PS8A 4Z0XA 2YBRB 3U83A 3KPRB 3TN0B 1W9XA 1XR9A 2DBLH 4A7QA 1BMGA 1KPVB 3TTYA 3Q8BA 1UWYA 2FH8A 1KYFA 2YMXH 2ZKYA 4PJ8C 4Y9FA 5DJDA 2H32H 5AAWC 5I2IB 4AGNA 1IAIL 3T77A 1XIWC 4LLQA 2NY5H 4NSKB 4R6UA 4AC4A 5HVGB 3OB0H 1Z0MA 4H88L 2XYCA 2IJ0C 1DN0B 4WEEA 5BS0B 1KN4L 4Z7UE 3U4BH 5FB8B 5IBLD 3U9UA 2WWMC 1PD6A 2F0CA 1QHOA 3BISA 4BFKA 4LP4A 3K6NA 1OZTG 3GLZA 2PABA 3QZWG 1JTTA 4JHWL 3CVDA 4E42B 1J05B 2OMVB 3W2DL 3D0LA 3A4DA 3S36X 2IPUK 2BVOA 5EBMA 1O5DT 1XF3A 5HVHB 1JWMA 2CDGA 4N22A 5I18H 2WTPA 2VLJA 4A1RA 4PJDB 1F4WH 2DQGH 3MBEB 5DVPA 1BFVL 3D50A 3FFCB 1H19A 4LGRB 3QQ4A 3NCCB 2WN2A 2Y36H 1ZGLA 4P2QE 3ULVD 5EEYA 2XG5B 1PZDA 4N0UA 5D8JH 2K7QA 4FNPA 3TO2B 4C56B 4Y4FB 1J7VR 5ERWA 4Y4KC 4PLKD 4E9QA 4AZ8A 3CLFL 1ORSA 2VYRE 4F7EB 1P6FA 1ZMYA 4AE1A 1JGUL 2Q8AL 4AEHH 3S35X 1EHLL 3RIKA 3ZX1A 2NY3B 3TBVA 2ZCHL 5IB5A 3VFWB 4QOKB 3S8WA 1ED3B 2PWHA 3BDYH 3LNHA 4HFWB 5FGSA 4IOSD 4ES9A 3STLA 4JKPL 2PPCA 1S78C 2ADFL 1DDHA 5CJOL 3FSVA 5J6HB 1XMEB 4D7PA 5AW3B 1XHHA 1MCNA 3D07A 2QBWA 5IFJB 1J9CT 2NUPA 3QQXA 3BIAX 3MGAA 5GZNC 3DTXA 3OG4B 3UBFA 1OAXL 4JFPB 1WWBX 3ARYA 4H0LC 4W9FC 4ODTL 3PWNB 4HIXL 4KRNA 1PTZA 2GT9A 2RD0A 3INUH 4Y5VB 4CC4A 3O45B 2CBMA 2XIBA 4Z7WA 1ZPLA 3ME0A 4R0LA 1XH3A 3HOGA 4HJ0C 3NIFE 4WHDA 5FHAH 4HFUH 3RIFK 3P9LA 1CDIA 2N1TE 5AL8A 1I1YA 3ETBJ 1EANA 2EVJA 3BN9C 3V0DA 1X7QA 2FGWL 5F7YC 5E1HB 1KPUB 1QWNA 2WXMA 3DO4A 3KPRA 2ZKMX 3TN0A 1MIEH 1KPVA 3NK3A 2MH4A 4LNVA 2CBTA 4BA0A 5I2IA 4D2NA 4NSKA 1MRFH 1BQLL 3WIAA 4KK9D 1A21A 3MV9D 1R19A 2Y22A 2NW2B 3FRUB 1DN0A 1N67A 1Q1PA 4MRCA 5BS0A 5J06A 4XR8C 5FB8A 2NY1C 4IBQA 4YBLB 3BZEB 1PW3A 4UNUA 5KS9B 4DN4H 4JPKL 5D93C 2OYMA 4Z7QE 1I8IB 1H3XA 5ESQB 4E42A 1J05A 2OMVA 3NZHH 4KQ3L 4KROB 1JNJA 3MRHB 1WTLA 5E6YA 2QQNL 5A2JH 5F3BB 3TT3H 1L3WA 2WGXA 4JG0H 3W82A 2PYEB 3KPSB 5DK3A 4PRHB 5E7BA 3HE6C 4PJDA 4EUPH 4XNAA 1AY1H 3MBEA 1CXFA 4GIAA 3CAFA 5T3ZE 5L2KE 4ZTPH 4MAYC 1YNKH 2DYSB 2YQ2A 1TZOA 3BGMB 3NA9H 5FKAB 2IANE 3V6FB 4HDIB 5I1EL 3QEGH 1PGRB 3MRIB 1U8NB 2XG5A 2XKNB 3TO2A 4KY2A 1UH4A 5JHDE 4A7UA 4E41E 3EGSB 3VVVA 3TEWA 4C56A 4Y4FA 1NTDA 1COBA 3MRRB 4F7EA 3DYOA 3UIYA 5D1ZD 4WTWA 1G0DA 4FG2A 4NQDD 2X40A 3RGVD 5KUKA 4C4UA 2IC2A 1QFUH 4X6DF 4QOKA 3B9KC 1ED3A 3VFWA 1I1RA 4HFWA 1E0OB 1YEFL 4JO4H 1ZVYA 1EEYB 2RJMA 4LP5A 5J6HA 4NQVB 1MFCL 2F7QA 1LDPL 5IFJA 4IBVA 3OVUB 1SUHA 4FTVD 3FFDB 3L8QA 1YVLA 3FO0L 3HAEB 5C6WH 4JFPA 3SDAC 1D5RA 4K3HA 4U0RC 2VRAA 5D2NB 5FM4A 3PWNA 1A9VA 3FYEB 4Y5VA 1GPOL 3O45A 4L1HA 1SQMA 4L1BA 3H2PA 1OAUL 1BGXH 1T0OA 1IJNA 4TSAH 3PGDB 3WG7B 2C3WA 1XF5B 2YD4A 1P84J 3GJFK 5GXBB 3RZCB 1JZEA 1K4CB 1V3JA 2FCBA 1KPUA 3E2HB 5JW4Q 2B1OA 3JBG7 3JWOH 3ZKSD 3ARFB 2WWKT 5JXAL 5FM5M 1KEGL 4LSUL 4GRMB 2JWYA 2H0EA 4P46D 3VH8G 2Q87A 3QS2A 4R7LA 1AR1B 3GMNB 4BK4A 1EAPB 3FFOA 1GGCL 3T6VA 1WBYB 3VFVB 4GT7A 3PL6D 4WI0B 5I82A 4O2FB 2NW2A 3FRUA 3UFIA 3I9AA 4K3EL 4I87A 4K9JA 5IROA 4GQQA 5C3TA 1LXMA 3EF4A 4YSPA 4BWTA 2BIHA 3NP3A 5KS9A 1BJ8A 3BZEA 1CI5A 2VLRE 2RQ8A 1I8IA 4AYMC 5ESQA 4X7FC 5HGGS 1ZA6B 3GHEL 3MRHA 1NC2B 4ENZA 5F3BA 5AVRB 4JDEB 1T7XA 1ZVNA 4RMUA 3FDWA 4TUKH 4EN3B 3NJMA 3UC0H 2PYEA 2J1KA 3KPSA 4PRHA 4YDNA 5C7ZA 3SD2A 4OQTA 3FQTB 4LVOB 3VGDA 5FKAA 3BGMA 4RFNC 4P0DA 3V6FA 4HDIA 4U6VH 2BSDA 4L8SB 3MRIA 3X1GA 1QSEB 1U8NA 2XKNA 4OM0H 2GSGB 2R39A 1MCSA 3EGSA 3BKYL 4XAKE 5HY9B 3KEDA 3V8CA 2ICWB 4LOEA 4YHLH 4GMTL 3MRRA 4JO5A 2D03H 3HG4A 5D4HA 2Y3AA 5CU9A 1IC4H 2MNWA 3AB0B 5L4MA 3GSVB 1HQRB 1XGUB 4M8VA 4A7GF 3ILQD 4BKTC 1KV3A 3ZKMD 3L6FB 3OSKA 4OI8A 4DGWC 5ID1B 4J2QA 1Z3GH 3QFJE 1EEYA 3NFPB 3NK4A 4EZLA 4POYA 5B4MC 4X5WB 4BCXA 4NQVA 4KKBD 2K6ZA 5AOZA 3MV8B 4Z3GA 2J72A 4GJTB 3D1MC 1QSZA 4U3SB 3OZ9H 4X6EB 1FNAA 3FFDA 1OW0A 3OLEA 4PI2A 4HCGA 2VDRH 3HAEA 3ZIYA 1F13A 5D2NA 3AUVA 2W9DH 1PKOA 3AC0A 4DEUA 3AREC 3GINA 2H1PL 1AXIB 1BBDL 3PV7A 3TWCL 1UT9A 3B2MA 2GITB 3QHFL 5IK3B 2CHWA 4IU3B 1NANH 3GHPA 4XN5A 5ADPH 5IW6B 3PGDA 3ZQ9A 3QJSB 1XF5A 1E28B 3WFBH 1KCSH 3RZCA 4HHWA 2UXTA 1K4CA 5I6XC 1IFGA 3QR1A 2WAQA 2D9QB 4QKTA 1CFTB 1KXVC 3ARFA 3I9GL 3AG2B 3ZE1E 3SO3B 5LBSL 2CD0A 1PNDA 2HTLC 1ZT7B 1WZMA 1R24B 4GRMA 3QRGH 1BYNA 1FIGL 3MLRH 4JEGB 3B56A 3RIFF 3GMNA 4KWUA 3T8MA 1EAPA 4KV5E 5DLMH 1WBYA 3G6JB 3A0OA 2VR9A 3VFVA 4WI0A 4P07A 3WY1A 4O2FA 4DJMA 3ARDC 2P5WD 5GIRB 3IPFA 3SDCB 3O3EB 1Z32X 2NXZD 2Z1KA 3GB7B 2I32A 1L9NA 4U1SB 1A6ZB 2VC2L 2NY0D 1ZA6A 9PCYA 3ZYZA 3SQOL 2YS4A 4RGNE 1MG3C 1O6TA 2H6PB 1NC2A 4JDEA 4B9YA 4HIIB 4EN3A 2P5ED 4PMFA 3VFGH 5E94B 4HGWB 2VSDA 3FQTA 4FXGC 1K8IB 3K3QA 1S7VB 2CZNA 5LLIC 1N0LB 4NRXB 1TQVA 2B2XL 4AYGA 1AO7D 4L8SA 1AAJA 1PZ3A 1MOEA 4U3CA 3UBHA 1QSEA 5E9AA 3BGFB 2GSGA 4CN1A 4AVIA 3EO0B 4OKDA 1AACA 4TUUA 2EE9A 2D3JA 5HY9A 3JSSA 2NXYB 1A0QL 2ICWA 1QZ1A 3PNRB 1QFWI 3RWIB 4MDJB 4M7LL 1PCXA 1H6FA 2ESVE 3GS7A 4ZXBB 1FL6B 3S3CB 4LMQE 1MJJB 3GSVA 4GMSH 1HQRA 1XGUA 2CPCA 1BQ5A 3L6FA 1S7XB 4GQZA 5ID1A 2WZ5A 4QTIL 2AZUA 4IGBC 3G04B 1FH2A 5GRUL 3NFPA 2WINB 2D2CC 4X5WA 3RX9A 3D39B 3MV8A 1RJZB 4NS0A 4Q2ZB 1QR1B 1GOGA 3BKJH 4U3SA 4X6EA 1NH6A 4N5UA 4JHZA 4J3VA 5FO2A 1FO0L 1MCBA 1CXEA 1NLBH 1PBYA 2YIHA 3PAUA 3L7FB 2ORBH 3PP3K 3VFPB 1W0VB 1GZHA 2A4EA 2WQUA 2YD0A 4TTDD 2VDPH 4C4BA 1E4XH 1CYXA 2GITA 3ZY7A 5EU4B 5IK3A 4P5MB 4IU3A 5IW6A 5CN1A 1A6VH 1U42A 3C08H 1E28A 1BJ1H 1I7UB 1NPNA 1SOSA 2YQBA 4OGAD 3WTYA 1WJ3A 1CFTA 1F58L 3JQOB 1OAZH 3QJXA 1U8CB 3REVB 3LZRA 1ZSHA 4AKOA 4RGOL 1ZT7A 4IBLT 1R24A 3D34A 3S36H 3WU1A 2BP0B 5AYQA 3VWKD 2IGLA 5CSGA 5IUSA 4XNYH 3SQRA 2Y6SD 3G6JA 4TVSa 5GGVH 4RMSA 1MZYA 4XH2B 4Y9EA 3VD7A 2GABA 2WXNA 5FF6B 4PWFA 4PR5B 1HINH 3P77B 5GIRA 2MHAB 3SDCA 3TURA 1P4BH 3WNMA 4YHMH 3GB7A 1F56A 1WAPA 3ESNA 4U1SA 4WGVB 1A6ZA 3S3PA 3FC8A 1NLDL 1BF2A 2J25A 2C9RA 3IDJB 2FX7L 2H6PA 1S7UB 4A66A 6PCYA 3WUWG 2X38A 3FQYA 5HHMB 4HIJA 4HIIA 3AGVA 4BH8B 4D9LH 3T0XA 5K9QG 2IOOA 4P48A 3LD8B 5E94A 1QSFB 1UWEL 4HGWA 3QZLA 4PEEA 2AMGA 1K8IA 5C0CB 1S7VA 1N0LA 4NRXA 2I7SA 2DQEH 2YK1H 1LQSR 4LPXA 3T3PB 4LOUD 4LL1A 4E9SA 2XBTA 3EO0A 2B4CH 4RA3A 1J0HA 3VXQB 1QACA 1E7VA 1THCA 2DEXX 2EZ0D 3NJKA 2VZ1A 3N1PC 2G5BB 3FPYA 4BINA 4PCTA 2PO6C 4ZFQA 5BVPH 4FNQA 5LVEA 3RWIA 2ED8A 4ERSH 1B2WL 4GAJH 4MDJA 5IGXH 3SE4C 1V7NH 4X8GA 5E8DL 3T65B 1FL6A 4ZXBA 1MJJA 4U1JB 3RYMA 3RY5A 2AV7B 4L4TE 4JQIA 1E4WH 1S7XA 1NCNA 3N50A 4XAWL 5TD4A 2K6YA 1E2ZA 4J3XA 3IMRA 4AIEA 4U3HA 3G04A 3GO1H 4M43H 1EIBA 3EDEA 2WINA 4WFHE 2QFRA 1KPRB 3BUBA 4BQ8A 3D39A 3MCKB 4JRLA 1A9EA 1UD2A 1RJZA 2ID5A 4Q2ZA 4YSTA 4BHUI 2I5YH 1QR1A 1T0MB 3EHBC 4BWWA 2F8OA 3DHMA 3L7FA 3QIUC 3VFPA 3W3BA 4UDTB 5FYJL 1W0VA 5JIKA 2FTAA 1HEHC 4HSQA 5HHQB 1MRCL 2ZAIA 3B83A 4Q6YA 3WXVH 3DECA 1E5CA 3KPMB 3TVMD 4MRBA 1NIBA 3F7LA 3K1DA 5EU4A 4P5MA 5IBTL 2R2CA 2Z31D 4FRWA 35C8L 2YHGA 1TTFA 4OF6A 5IMMB 1CDJA 1WFNA 3NIGB 4FG0A 1I7UA 5IOPB 4LHQB 4FEIA 4M6AA 2BJML 2OW6A 2FWUA 4PYHA 2CLVB 4Z3TA 1YZZA 4NEHB 4TNGA 3QZWB 2KH2B 2ZAHA 1OP5H 3ZMEA 5KEZA 1JJUA 1U8CA 3REVA 4DEPC 3BKCH 1U36A 4G70B 2JIXD 5E7FA 3DJ9A 4WUKH 3BZ5A 5F7MC 4AIZB 1NFIB 5KVGL 3P0YH 2DKUA 3RWEB 1JVKA 2LABA 2BP0A 1FWXA 4F7CB 1ZDQA 5FM5O 4G3YH 5L88H 5E70A 3GKZA 4G9DB 2Z0UA 2BY2A 12E8L 2X88A 5FF6A 1RLBA 2F74B 3P77A 4PR5A 3SO5A 2MHAA 2F9BT 1IAOB 2O6EA 2WZ0A 5JUEL 3W9DB 2DQCL 2GCYB 3CHSA 3OPZL 5E0QA 3WHXB 3U7WL 2EVIA 3UP6A 3GSNL 3SGDH 2GEQA 1E6JL 3IDJA 2X6MA 1S7WB 5FW6A 2OYLA 3KZ8A 1S7UA 3IKKA 3MUGB 4BH8A 4AGMA 1HQ4B 1A6TB 3I3BA 5JQ6H 3BHBB 1QVOB 2RAMA 4H8WH 4ZSOB 1QSFA 1K72A 3H53A 4P9HL 3A67H 5C0CA 2X7LB 1NSNH 5BW7A 2NR6D 4Y19B 4FQXC 2MSPA 5IFHH 4LSSL 5E2JA 3VXQA 3MV7E 3O4OB 4YBHA 3BSZL 2X09A 5EUOE 4UB0H 4FQLH 4YDLB 3EYQC 2G5BA 2F53E 5DUML 2AFNA 1VZIA 2BVTA 3T65A 3MYZA 4U1JA 4DGYL 1CFVL 2AV7A 3VFMB 3QUXC 2D9CA 1PY0A 4RFOL 4AV4A 2DI8A 4N8VB 3GK8L 2R29A 5C2BL 3PQYE 5IWLA 4WW2B 4G11A 4G5ZH 1QBBA 1KPRA 4OLWH 4RLDA 2XFXB 3MCKA 4M1CD 4X80L 5FYLE 2A9ML 4AVJA 4PCYA 1T0MA 4F8NA 1D7FA 3VGAC 1BREA 4ZW6A 2X6UA 1GJUA 4LLUB 4M56A 3KLLA 1AOZA 4UDTA 5HHQA 1OT2A 1HHJB 3HC4L 3TBYB 1F6LL 3KPMA 2NY6C 5CIPH 2XWTB 1Z9PA 3RVTC 1PKQB 5KJ4A 1ZXKA 4RX4A 5KVFL 4M1DL 1DEDA 2RTTA 3FTGB 3GS0A 1T0PB 4JRXD 3RG1C 1SXAA 4PBDA 4M7JH 3WCYA 5IMMA 3MQIA 5M95B 3WKYA 4FNRA 5IOPA 1MQ8A 4I77L 2NUTB 1D5IH 2CLVA 2E56A 4JY6B 4DFHA 3QZWA 3TFBA 5FLVA 2EDLA 4WEUD 5TDPB 1RFDH 4TQIA 1U3ZA 4AIZA 3QI9D 1NFIA 2R4RL 5GRVL 3RWEA 4IHBA 1R3LB 5F0PB 4F7CA 3IPBA 2DMKA 2JXMB 4UU9B 4G9DA 3GBLA 1RJYB 1CQYA 2H9GB 4N9GB 1N12A 5CEZE 5C0JB 4I3SL 5JZ7C 2WVTA 1INDH 1RIHL 2F74A 2QVTA 4FFVC 5D72L 1WZAA 1YPZB 1BYPA 2GKIA 1IAOA 4JRYB 3HKZA 3VFOB 2LLGA 2LW3A 5DHMC 3O4LD 3W9DA 2GCYA 1XB8A 5EU7E 3WHXA 5CP3A 5C0IB 4LBAA 1RERA 1IBZA 1ID2A 2UXFA 1S7WA 4MZIA 5EZJB 2F8XC 3MUGA 3X3FL 5I1IH 1HQ4A 1TZGL 1A6TA 5KVMC 3IE4A 3BHBA 4JMXA 1QVOA 3ZHNA 1UGNA 3D06A 4ZSOA 4P59L 3W56A 5EH1A 2JKXA 4WEBH 2X7LA 5C07E 4DVBB 4F8LA 4M7KL 4E5XB 3AG4B 3UADA 4FQCL 4Y19A 5F1NB 3T0DA 2NY2B 1FG2B 1YYMH 5LN8A 1JVOA 1DR9A 3VG9C 3WGUB 3W11D 2FEEI 2F68X 2PXYC 2UY6B 1JXDA 1J8HE 2VLKD 2MOGA 4P49A 4DT2A 4PS4H 4JPIB 4B7IA 4UM9D 4BWUA 4TVPE 1EPFA 1HH9B 5GJSH 1EGJH 4J39A 3MJ9L 3VFMA 4OGXH 4K9EL 2WO2B 5HYIA 1G7IB 2PR9A 4N8VA 2X4RB 3AACA 3LEXB 2KS0A 3QCTH 4WW2A 4L0YA 2CR3A 1M56B 4OLVL 4PBVC 5SX5K 2XFXA 4OJYA 1M71B 2QVIA 1A3QA 4ANXA 4PI0A 4I0KA 4LLUA 1PZCA 2CBQA 1HJCA 1OARL 2XKSA 4NN6B 5C0RH 1N5YH 3UX9B 5L0QB 3F7VB 1DQDH 3JWNG 4HQQL 1FPTL 1HHJA 3LN4B 5BOZG 3TBYA 3KYKL 1MJUH 3EJCA 4JCWA 5D7SL 2I9TB 2XWTA 3WO4B 5B3JF 3ASOB 1PKQA 4JFDE 1U3YA 4PJCE 4ZX5A 2YAOA 3VNZA 3QQDB 3FTGA 3V55A 2Q86B 4F58H 5E6SB 1RMFH 2F6AA 4U1IB 4WW1B 1SEQL 4PGBB 1NC4D 4JHAH 4IRZA 2XVKA 5JOEA 2NUTA 4JY6A 3O0RH 4MD5B 3VXOB 1FQ9C 2XZAH 5AVZB 4FLHA 5TDPA 5EMYA 4B5ZA 3W0WE 3PDDA 4WFFE 1OK0A 2PETA 4KC3B 1JGVH 3ASNB 2MNJB 3BAWA 2FUTA 1R3LA 5K9JL 1YHPA 4K7FB 1O75A 2JXMA 4UU9A 4PJXB 1RJYA 2H9GA 4N9GA 1A6UH 5SX4I 4A2HA 2R56L 5C0JA 1XO8A 2K0RA 4PJ5D 3V95A 2ZG3A 4KVCL 3G9VA 1E4JA 1RZJL 4C59B 1UUNA 1YPZA 3DMMC 4XZ4A 4JRYA 1ZGLP 4GUOA 2F7IA 3VFOA 2J5LC 4JFQB 5HYSB 3EKCA 2KZBA 1QPKA 1FFOB 2CH8A 1RUMH 1KC5L 2FBJL 5KJ7E 5FO8B 5C0IA 5ICXB 2AQTA 3B3BA 3VQLA 4NWUH 2UVFA 4B9FA 5EZJA 1U93B 4B9CA 3FU6A 3SCMC 2DQTL 3LS5H 2DIJA 2FECL 3R18A 3DETD 1MKFA 3HRPA 4XCNB 5KBPA 2YFNA 2WKOA 4DVBA 2R0ZL 2O5YL 3AFLA 1SJHB 4AYID 2DQUL 3G7TA 4E5XA 1BVKB 4MA1B 3I6GB 3ML9A 1SF3A 4KDTA 1UD3A 4P2RB 4ZAKD 5F1NA 1FG2A 4CW1B 1DSYA 1OB0A 1RP9A 4QHPA 4WI3A 2J71A 4A6YH 2UY6A 7PCYA 2V17H 4FD0A 3LZFH 1BCIA 1XSJA 4IRJC 1UM4H 4JPIA 3VFRB 2JCWA 4QXTB 2UZIL 4X7EC 1HH9A 3HB3D 3VD3A 1E9PB 3ZPDA 3UYRL 1AS6A 4LAJH 5JXED 2EACA 4HJ1A 1G7IA 2VN5A 5E6ID 2DYPD 2X4RA 4HS6B 3LEXA 5C09D 4LEXL 1YMHB 3BEWB 4GSUA 2EXWD 1FFQA 2OR8A 4Y2LA 2WXHA 4U6HB 5BV7L 2PWEA 1M71A 3TXAA 5EFIB 5ESAB 3PPEA 3VXMD 4Z7UF 5CZVL 1GZQB 2P8PB 3H3KA 4P2OB 3IJ9A 1QUPA 3LDBB 1KV7A 5AYUL 4G7SB 3F7VA 3LN4A 4M7ZC 3MLXH 3BP4B 2I9TA 3OMAB 3ET9F 4OF0A 4O51B 2C9QA 3QQDA 2Q86A 1HCYA 2WGNB 3P2TA 1QHQA 2JB6B 3PWPD 4WW1A 4U1IA 4PGBA 1FLTX 2Y1VA 1CVRA 2EUXA 3WFDH 2HKHL 3Q8EA 4MD5A 2VISB 3HNTH 3EGXB 3VXOA 1MUJB 3CMOL 1B0WA 4FQ1L 4JPQA 1FL5B 3ATDA 4K7FA 4JRFA 4NZRL 4FE9A 3LIZH 5FHBH 4LHUD 4PJXA 2F19L 1E67A 2Y24A 3LYRA 4RRPM 2YAMA 2G9HB 1M2VB 1NMAL 1KBBA 5B1CA 4O02H 5HYSA 4JFQA 1LM8V 3C2AH 1FFOA 4NJ9H 2CCLA 4J3OG 4RH4A 5HI3C 5FO8A 5ICXA 1NCBL 4MS6A 5LDUA 4HJJH 1L9PA 1U93A 1MWOA 4PP1D 4WJKB 4XBPB 1TQWA 4KU1A 5IB4B 1ZJBA 4XCNA 3CQFA 3QWQB 5HYEA 4OCLC 3N40P 4DP1X 2D4DA 3MRDB 1L0YA 1SJHA 1BVKA 1KWGA 4HCRA 3PWUB 4IBWA 4P2RA 1BMZA 4CW1A 5LGHL 3OZLA 4F27A 5IFAL 1AQMA 2XUWA 1Y1DA 3SGKA 2AERT 1T1XB 3SY0B 3NIFF 3CFEB 2UX7A 1NBQA 4OZGB 4FN0A 5D6CB 5KSUB 1MVFA 5HHPB 3VFRA 5BO1H 3UPRB 4QXTA 4O9HH 4ZTOL 5IV2B 4LEEA 1FYTD 1HIMH 3VSUA 2ODHA 1A64A 1E9PA 5C6PB 4Y0GA 5HDLA 1BPVA 3QO1B 4MHHI 4HS6A 1LO4L 5JLZB 5DVLA 1T4WA 1YMHA 2F1EA 3BEWA 4KVNH 3D48R 4HUMB 5DJAB 1OP3K 4DAGH 43C9B 4TS6A 4ZW8A 2MKWA 4U6HA 1AYOA 1NANI 4DZBB 2BNRB 1Q1JH 2P8LB 4YHYC 2JQAA 5EFIA 5ESAA 2WLYA 3STZB 1OO2A 4JDVB 1GZQA 2P8PA 3QXDB 4LSVH 4P2OA 4UOW0 4GUCA 4XMPL 5CZKA 1CPUA 2ZCLL 5T3XH 4Z7QF 4J5VA 5TQ0H 2N7AA 3BP4A 2YAFA 5GS3A 1UOLA 1UFUA 4O51A 3K2KA 4B96A 1PZ2A 1S7TB 5DZPA 4JG1H 3MRFB 4OGYH 1JD7A 5I1JH 2JB6A 3U1PA 4HOWA 2WXKA 3TCLB 4P3WA 1YRKA 2GJJA 1RUKL 2UWEB 3CFQA 5I6NA 1QLFB 4MJIB 4PM1A 2CRIA 4AYBA 1CL7L 3UG5A 4Z7VE 2ZG2A 2VISA 5CZXD 3EGXA 4YXHL 1MUJA 4QRTB 3PUUA 4J3WA 5KJRH 2Q20A 1FL5A 1QEWB 1AHWC 1NOAA 2QPDB 3D87B 3RPBA 1HKLL 4XVSH 2FQDA 5HHOB 5HDQL 4F1ZA 4XCYB 5J1SC 1RPQA 5I26A 1CGTA 2DEWX 1WCQA 1UUSA 1VZHA 2E3VA 2G9HA 5CJQH 1M2VA 3ZYOA 3DYPA 3BQUB 1XGYL 3SGJC 5FWRA 4N20A 5DDHB 2DJSA 4KQ4H 3VAEA 4F20A 2AK4D 3CVCA 5DQDL 4XMKL 5DWUH 3EF7A 1NM9A 3LZNA 4R90L 3KH4A 3FU5A 1YEIL 1HL9A 4XBPA 3DC0A 5ACLA 5IB4A 1PAZA 5FGBA 3D7PA 5BPPA 1F6FB 3DK2A 3MRDA 4AT6B 5FDYA 3ZTNL 2G2RB 5JHBA 3UERA 4F37K 1X5MA 2VXVL 4UTBH 2LAAA 3PWUA 4IMLB 1ZVSB 1MCFA 3ECVA 2XWZA 3WFCH 4XVJL 4AMKL 1ADQH 1T1XA 3SY0A 5I0XA 2J4WL 3BH9B 3CFEA 1L3NA 2D2OA 4OZGA 4W9LC 5D6CA 5KSUA 3B7UX 3MROB 5HHPA 4IKIA 4TOYL 3LB6C 3MJ6A 1SUJA 3ULSB 4PPTA 5KVDL 3UPRA 1UTDA 5DYOB 2JELL 5IV2A 2V37A 4OZHB 5F9OL 4KKPA 5M7QA 1MCLA 5FDWB 4CVXB 1N2RB 3QG7L 3QO1A 2LVEA 2DQMA 3A5VA 1N0XH 3HC3H 5JLZA 5AZ2H 1TJGL 5DJAA 43C9A 5TE6L 1E4XI 1FBIL 4PLKC 4FJYA 5E2TH 3ZUCA 4DZBA 2BNRA 2P8LA 1E6OL 5CN3A 5IEKB 1FCGA 5AKVA 4NUPA 3STZA 2ZOKB 1NGPL 3E8UL 2OXHB 1K5NB 2G3ZA 3KPOB 5FECB 4JDVA 5F70A 3HZYB 3QXDA 1EMTL 3CVIH 1OANA 5EV7A 3I02B 4MMZC 1C7TA 1VB9A 3CLEH 4FI7A 2D4FA 4OTXL 2KLRA 3CU1A 1NKGA 3KYNB 1TEYA 4BFBD 1AG0A 4UBDD 4Y2DB 1Q72H 1I1AA 2EIEA 4NZUL 3FHAA 2ARJB 3BKML 5EU6E 4XB7A 1AKJB 5MHSD 1S7TA 4U7KA 1TZAA 3MRFA 1UKSA 3ULUE 2FWLB 2DOCA 2GJ6D 2MPAH 4KKAC 4XCCH 3TCLA 1E5YA 4URKA 1T2XA 2ARWA 1DL7L 2QPSA 2UWEA 1QLFA 4MJIA 1IBDA 5M94B 5HI4C 4NUGH 4AIXA 2EIJB 2WBWB 4NYLB 4YOKA 1G9ML 2OMZB 4QRTA 4H20H 3WIFB 2J43A 2HFGH 2VJXA 2YRLA 4WUUB 3PFQA 4YUEL 1F86A 1QEWA 3KM2A 4BUGA 4LLVB 3CXDL 2IAMD 3ULVL 3QEQD 5DO8A 2F5BL 1EZVX 3P3SA 5HHOA 3WY2A 4DP5X 1CDUA 1XGPB 4XCYA 4I9WE 2NMSA 4GIPD 4BUQA 3P0GB 3A6CL 3F12B 2I9LB 4AQ1B 1DBAL 3BQUA 3HMXH 4JKMA 4NKIH 5E8OB 4B9GA 4WO4C 1AGFB 5DDHA 3D4YA 2GBUA 4KHTH 2VMEA 2R8SL 4C47A 4Q6IC 1BQHG 1AXTH 5J13B 4WHYG 3BN3B 3M17B 1T6WA 4TM9A 3BZDA 5GJTH 3ZQXA 2WLMA 2J8UB 1BYOA 3FZUD 4KK9C 5EA0L 2TSAA 1TJIL 1GKEA 5CD5C 5I1CH 3ZE2B 3QQ9D 1X5LA 3IGLA 5JR1L 4AT6A 5LCVH 5H4ZA 1OQOA 2G2RA 2CE6A 3CBRA 4UZUA 5DWPA 1GS8A 2VQUA 2DTML 3EDFA 1C5BH 1ZVSA 2P80D 4IMLA 4QXVA 2NSXA 3VXRD 4L3FA 2X9YA 4C55A 2QKIC 2G75B 3DX7B 4OLXL 1CDCA 1WH0A 1JE6A 3BH9A 1AVAA 2XPGB 4HOMA 2YWYA 5MEPB 3W0WB 3MROA 4ATTA 4FADA 4HUUB 2VERA 3SOBH 2Y06L 3ULSA 3RBSA 2NY2D 3I9IA 2P5PA 3NEEA 5DYOA 4OZHA 1CK0H 1BX2B 2YJQA 4AGPA 3DXAB 5FDWA 4CVXA 1N2RA 1GIGH 3V9EA 4N1EA 2IGFL 3ZE1F 2ZKHL 2OYPA 1QFWL 1TYEB 2X10A 4R8WH 3V5DB 3UAFA 1KFGA 2V5RA 3ROOB 4AEIL 5JHLH 2NYZA 1NMBL 4ODVH 4ZDHB 3NSXA 3T2LA 1GGUA 4G9FD 3OAZH 4KV5F 2FLBT 5D1ZC 4ZUTB 3QDME 3WS6A 5IEKA 3RVXD 3VO0A 3UC2A 2ZOKA 2OXHA 2KZKA 1K5NA 3HVNA 3KXFE 3KPOA 3J27A 3NFSL 3RGVC 5FECA 3HZYA 2I7OA 4HPOH 4ATWA 4ZPTB 3H42L 3I02A 4M4RB 4FP8H 3E8VA 3GXUB 1PD1A 3QT2A 4X9HA 3KYNA 5IQLA 3QIWC 4CVUA 4Y2DA 3VXSB 5HGHB 4EIBA 2KKQA 3P3UA 3X3GL 5EF1A 2ARJA 3QXAB 1AKJA 2FK9A 3K2UH 5HD8D 1CF8H 3AS1A 1MFNA 2AC0A 2OJEB 1ZV9A 3QRBA 1RIVL 1DBJL 3LKNB 3MUJA 4E9XA 4JR9H 4NYLA 4A2GA 5C1MB 2OMZA 2RALA 4G6KH 2D0HA 3WIFA 3N1GC 3SGDI 4WUUA 1A65A 2L8AA 3CVHB 4LLVA 3ZZ1A 4I3RH 4POZC 2BIOA 5I30H 2A7BA 3WE6B 1XGPA 1WFJA 5EN3A 4RDQG 4PRIB 1IJ9A 3F12A 2I9LA 1MELA 4AQ1A 4I85A 3L3GB 4PSPA 5E8OA 3BFWA 1QLEL 1L9OA 1AGFA 4Z7NB 2L04A 3UZQB 4Z7IA 3VWJB 5EZIL 3KL5A 1J11A 3NFNB 3M17A 3TA3B 2J8UA 1OT4A 1GY1A 3LQZB 4YFDB 4RWYL 1UD6A 1XQ4A 1A7QL 3IJSB 3HMWL 5IVOA 2FD6L 4KTEH 1C5CH 4OF5A 5AKTA 5HHXL 2FYVA 2ZYHA 2HZHA 3LCYA 1TZIB 4K7PY 2A5UA 3MFFB 4LRIA 5CP7B 2XBZA 3UTSE 3MTRA 3MBXL 4NP9A 7FABH 1MCOL 4HV8B 2W9LA 2G75A 3DX7A 3S34L 2XPGA 3SDDD 5MEPA 3W0WA 4HUUA 2ITCB 3OBAA 2X05A 1R46A 1RU9L 4QXUL 4QRRB 2YSSB 25C8L 4GXUN 2NNCA 1ZGLM 5GRJL 2B0SH 3GJFH 3DJSA 1BX2A 2OA9A 4HAFA 5HJ3B 3RILA 2D0GA 3DXAA 4S1QH 5E9DE 1H3GA 3RBGA 4F37F 3BH4A 1MWAL 3IB4A 4BM7A 3RUGB 3V5DA 2FEJA 4CAGA 4V11A 4PJHB 3RAJL 3ROOA 3OLIA 1TDQA 4ZDHA 1KCBA 4NLHA 4ZUTA 3WTVA 3H0TA 1AIFB 3BAKA 3F2LA 1RPKA 2H47C 3LXAA 2N1KA 5DEJA 1YEGL 5F3FA 4N0RA 4ZPTA 2WCGA 4M4RA 1A6WH 1RZKH 2WVVB 3FCSB 2CUAA 4MQSB 2V7HB 5DFVD 3TNMB 3VXSA 3QDJB 1AZBA 5HGHA 2JJTA 3IBEA 3ESVF 2NY7H 3QXAA 2GG1A 4TYUA 3V4VL 2DLFL 1CD1B 2PCPB 4P4RB 2BP5M 1OY3B 1OSEA 2HUEA 3CZKA 3GUFA 4IOIB 5DZLA 5AW4B 4CDHA 1TSRA 2O5ZH 2OJEA 4X2UA 1CJYA 6CGTA 3HPJB 1JPSL 3LKNA 3QJHB 1RAMA 2VL4A 1HK6A 1II4E 1J10A 3KCWA 4AL8H 2XN9B 1FI8C 3CVHA 3IAPA 1DUZB 3UGXA 4KAQH 3WE6A 1SJMA 1ZTXE 4PRIA 1G6RL 5IHWA 3QWOB 4FNTA 1JF1B 5C0AB 3KNBB 3L3GA 4AQ8C 2FX8H 1IGML 2J2ZB 1YAZA 3UZQA 3VWJA 4XBEL 1H9VA 1MFMA 2BC4B 2WXOA 3NFNA 2FNWA 4HT1L 4AM0B 3TA3A 1K5WA 1CQKA 4ZW7A 1DVFB 1B0GB 3C60D 3LQZA 2OS7A 3VVWA 1N6QL 4PIBA 4C83B 4LSTH 3QWRD 4XNBA 3IJSA 4LDLB 3KGRA 4LARL 1GS6X 1TQCC 1TZIA 1Z0NA 2RGSA 3JVGA 2CM5A 4G6ML 3MFFA 5CP7A 3I85A 4KKCD 4L1LA 1CZ8L 3BWSA 2NY0C 2XQYK 4OF7A 3JWNH 4HV8A 1XCWA 3VM7A 2WOYA 2XZCL 2IG2L 1M6OB 4IHOB 1R1CA 3CZNA 2ITCA 3KDMB 4GBXD 3TO4D 4EI0A 4PJBB 4QRRA 2YSSA 4ZMTA 2EAEA 3GMRB 5B7FA 2BIMA 5DGRA 3ZKQD 3UZEA 1EHKB 5DK2B 5HJ3A 3B9EA 2JKNA 4XO4A 4P2AA 3ZRFC 4WFEE 3Q01A 4RAHA 2ENSA 3BPLC 3IN0A 1MXGA 5F7DB 2QADD 1KB9J 1L7TH 1W2KT 4Z9KB 3RUGA 4PJHA 4FKKA 4WWKD 2WK2A 4I88A 3HG0A 1EHNA 5D70H 2YGPA 5AW1B 5TE4H 4XN2A 1AIFA 4IBSA 2WQVA 1QFHA 4WTZA 3SDXB 4W6YB 5IQMA 1C16B 4GSQA 1QR4A 4LAQL 4U6TA 3OQRA 3Q7JA 3O6FD 2WVVA 3FCSA 2A4CA 2X1PA 5F0JB 2V7HA 3P4NB 3LZQA 1JYNA 3TNMA 3QDJA 3TIDB 1CGSH 5AW6B 1DVZA 4R5TA 2DBLL 4GKNB 1MVUB 2E9GA 1CD1A 3LY6A 4OSUL 2DH3A 4AJ0A 2PCPA 1TJXA 4P4RA 4PV8B 3U79A 2YMXL 4IOIA 4BKSC 5EWIL 1I1AD 4G8GB 2NY5L 1RZ7H 2WXGA 1U2CA 3QJHA 4XC3H 4TTDC 4NIKB 3MRGB 1MI5B 1OK8A 4DPCX 4KZDH 4GKSB 4KITB 2FX9H 5D7IB 2XN9A 1TQBB 5EUOF 1DUZA 1HCZA 4HU2A 5DUJA 3TF4A 4GG6B 4HH8A 3ILEA 4NGHH 2BXZA 4LSDA 4FZEL 4G83A 3QS3A 5HDBE 4CC4C 5IMOB 2RMNA 5B1AB 5AB9A 1B4TA 2FBOJ 1P4LB 3QWOA 4R0LC 1JF1A 4Y2NA 1RUAL 3DROB 3KNBA 1IM9B 5C0AA 1ZWIB 3HG1B 3P3YA 1H3PL 4JGMA 4MD4B 1U4EA 2CMRL 5HP5A 5I18L 2J2ZA 4YPGA 4GO9A 3V0WH 1EXGA 3N1QC 2BC4A 1U3JA 2R9HD 3K81A 2DQGL 4HISA 1T5WB 4AM0A 3TN0C 5A2IH 2V0AA 3DDGA 5D96B 1DVFA 1B0GA 3LQAC 3W81A 3KDPB 4NQCE 4A2MA 4C83A 4R83A 1MHEB 4JKNA 1OF0A 1G9NC 1L4IA 4JM2B 3HAEH 2Y0SA 1B4RA 2H1XA 2A73B 3PP3H 1CDYA 1AS7A 4ETQB 3JV6B 3FSZA 3GXIA 1AE6L 4YN3A 5K9KB 1B4JH 1FNSL 4G6FB 2ZQKA 3Q2LA 1D5BB 3G5ZB 4AEHL 1M6OA 4LCWD 3VGGA 4ODSH 4IHOA 1SOQA 2R23B 2IWEA 4HXAH 2WB7A 3KDMA 3FS9A 1OV8A 4PJBA 4LCYB 2YD2A 2N0MA 1BLNB 1RZKC 1X3DA 3GMRA 4YLBA 1VEPA 1Z9LA 5DK2A 2IBZY 4MNQD 1QFOA 4JDTH 1D6EB 5DXWA 5F7DA 2CK0H 3MBEC 5F7AA 5B1BB 2HX9A 3O9WB 1ILSA 4WTQA 1ZLEA 4N90D 1EVTC 3DA0A 1CFMA 3RTLA 1PG7X 5DMGC 1V10A 5AG8A 5DLLA 3TOPA 4DP7X 1RZFH 4FAAB 5BJTB 3OKKB 5BRQA 3SDXA 2E6JA 1ZJAA 3QEHB 4Q4IA 4Y4FC 4YE4H 1C16A 1XSKA 2FATH 2DF3A 3NG5A 2YRBA 5IB2B 2NTFB 1CFBA 2ZP9A 3P4NA 1WTGT 2XDHA 2FAUA 2XY2A 3VQ2C 3TIDA 4I5BB 2A6KB 1S9XB 5C0BD 1GY2A 1OT1A 4GKNA 1MVUA 5EEXA 4HAKA 4F5CE 3GLDA 1B9ZA 1YC8A 2CO1A 1CF1A 4H8VA 4PV8A 5J11B 2CXKA 4G8GA 2ZUTA 2P3YA 1U58B 4PRPD 4WGWB 3MRGA 1MI5A 3TH3T 2J1ZA 1XIWB 2H2SD 4X7TB 4GKSA 5D7IA 4PVBA 3H9SD 4KOCA 2G5UA 1KCUH 2Z31C 3CSTA 4GG6A 5EEWA 2V4LA 4YWGL 3KR3H 3TEZA 1FP5A 4DN4L 4Y5VC 5IMOA 4CKVX 3T04D 1P4LA 5E1AB 3DROA 3NZHL 2BSBA 1IM9A 4LO9A 3RNQB 1ZWIA 3HG1A 4DF9A 1WEJH 4MD4A 2K70A 2V2TB 1FAIL 3S5LG 3LRKA 1KULA 1E4KC 2OJ1A 1DQML 3FXIC 3N5AA 3NZUA 1LWRA 4GKLA 3NP4A 1T5WA 1CLZL 1YNKL 2ETWA 1JNHB 4XVUD 1MHEA 2W94A 3QEGL 4UINL 3KWXA 4JM2A 5E4IA 3ISWA 3MKGA 4WQOA 1GKOA 2DIBA 4LCUB 1ZY9A 2C3HA 3L17A 1N8OE 4PREB 3ALXA 5B3NA 4KJWC 2A73A 4ETQA 4FQ2L 4PFEA 3H4FA 3JV6A 5FAAA 1YY9D 4JVWA 5GQBA 5K9KA 5IROC 4Y8DC 3T09A 1D5BA 4Q89A 3G5ZA 4YBLC 2AJSL 4YEFA 2V5MA 2R23A 4PJCF 2BSSB 5J0BA 1UOWA 4P5TD 3V6OA 3B2DC 1FV1B 1MLBB 4LCYA 3MLYL 1BLNA 4KTDH 2ADIB 3PJNA 3IDXH 4LRNH 3GI9H 4OB5L 3WHE0 3FN9A 3GBMH 1S2EA 4JO4L 4KROC 4BIKA 1DBMH 2HFTA 4J3TA 5KSBE 2OZ4H 4JFFB 1VPOL 1E8XA 1K4DB 1N70A 1QOKA 1D6EA 2AMUA 3EOAB 3MOAH 4CSTA 2ZUSA 4EE2A 1S6NA 3O9WA 4FMVA 4HSAC 2COVD 3IS0X 2X5PA 3MLTB 5BJTA 1ZDSA 3VGEA 3QEHA 3W37A 5K5YA 2DQHH 4UIKH 1LWJA 3RI5K 5IB2A 2GYSA 4TSAL 5F97E 1R5IB 1IX2A 5DVKA 2NTFA 3KS0H 4Y5XB 3KVDD 4I5BA 3BAJA 2A6KA 1S9XA 5F7BA 5EBLB 5BRZD 5HHNB 1IFHL 2O5NA 3GTVA 3U9PH 4ZX6A 3TS8A 3JWOL 4OBSA 4DKAA 3J2PA 1UOKA 2CGRL 3F64A 2E9JA 3WELA 5FCSH 4KJYB 5DHVB 4YDIH 2ZUYA 4KZ0A 4Y88A 4M61B 1U58A 3EADA 3RY6A 4KJPD 1EA9C 1BQHB 1VLXA 1TOXA 1XIWA 4DVRH 4X7TA 1NWPA 1OW0C 3MSPA 4GIOA 2ZX6A 1PLBA 4XPAH 1ZLUH 4YDZA 3V10A 4F15B 4M5YL 4MDIB 5EORH 4XN8A 5D2NC 2WXLA 2DAVA 1OCZB 3DJRA 4X7SH 2JI3A 4W93A 4Z18A 4E36A 3O6LH 3UOAB 1OSPL 4HPYH 5E1AA 3RNQA 1DJWA 4YZWA 1KWKA 3L48A 3BVDB 1KXQA 2J5WA 2V2TA 1WSST 2L7JA 2XXFA 4PJEB 3QI9C 5CLZA 4UQ2B 1L5GB 3UC0L 3RZCC 5CLTA 3EOTH 4Q9CA 3E2HC 4KZEH 3LRGA 4J7RA 2X9WA 4K5LA 4ZFFB 4XP5H 2FQFA 3ARFC 3L2LA 1JNHA 3VX1A 4U6VL 3D3VE 4W81A 1CLVA 1NEPA 4D94A 4OM0L 2IQ9L 3GMOB 4LCUA 3LKPB 4PREA 3QUGA 3DVFA 3O2DH 2CRZA 4PRDB 2P52A 5A2KH 1GC1L 3ABZA 3QPKA 4HS3B 1M53A 2E7MA 3DWTA 3MACH 3T0EB 4B9JA 4YHLL 1X4XA 1WQVT 4N85A 1TMCB 2D03L 4LCCB 3H1ZA 5FXCH 1IC4L 1KCKA 4FYQA 1FF5A 4AKQA 2BSSA 3K4ZA 3B4NA 3B7RL 1PX3A 3FU0A 4C8XA 1FV1A 1MLBA 2YD5A 2ADIA 4OFKA 1L9TA 3CFNA 2UUDK 3QJVB 4PW3A 2V9UA 3B9KB 3T1FB 4U3XA 3V6ZB 3AM8A 3IE9A 4JFFA 3CFMA 1EZUA 2H5UA 5GGSY 3S3BB 3DVGB 1K4DA 2B5IB 4EN3C 2VITB 3EOAA 3FHEA 4QJ3B 1YQVH 5C97A 5DMJB 1RY7B 1P6AB 3MX0B 1Q38A 3OZ9L 3Q5TA 5MEQB 3KLHD 4LVOC 1AQDB 2O6FA 3B2VH 3VMNA 2PCXA 4AKPA 2VDRL 4L8SC 2HTKC 4ALAH 2YAEA 5GZNA 3MLTA 1A3RH 3WXWH 1QRNB 2W9DL 4DKDC 3LNFA 5IB3B 5J89A 4PGCB 2QQQA 5K93A 4NBZB 3WTTA 3GZKA 3O3UN 3C5XA 3UABA 3HZKB 5FC9A 1R5IA 2VSCA 2FO1A 2Y5QA 1MHCB 4Y5XA 3WFBL 1KCSL 5D1XD 5EBLA 5HHNA 1KDJA 4WWPA 1U2HA 3IJ7A 4PW9A 4DPRA 3ILPB 3NSCA 1U3HD 4XRCB 3EH3B 1XZ0B 3HLKA 1UM5H 3L9RB 3QDGD 2O61A 1MPAH 3QRGL 4KJYA 5DHVA 4WFGE 3MLRL 4M61A 2ROYA 4N8UA 2AEPH 1BQHA 1DBKH 1DVXA 5DLML 1QBAA 2YPLB 3GMLB 3CIAA 3P9WB 3PJLA 3DKHA 1SYSB 3QUHA 1E5BA 4MDIA 1GZHC 3FO1B 4IMKC 4OBRA 2IALB 1BOYA 5KW9L 5GS0C 4S0HA 4L8BB 1BM3H 1E3FA 2R29H 1YJDH 3IDUA 4Q14A 3P9MB 1L5GA 4PJEA 4R7XA 4UQ2A 2EO1A 4WV1B 1WPCA 5G2NA 2B9BA 3VFGL 1DLHB 3PREA 4NAQA 1MCPL 1TO5A 4ZFFA 4QTFA 1YECL 4I0PB 2ZYIA 5SX5H 3SO3C 4ZQTA 1SFHA 4Y1AD 1MW2A 1P0SE 4ZMNA 1YLBB 4RFNB 3VJ6B 3Q6GH 3GMOA 3LKPA 2K6WA 5T3ZH 4LSPH 2AJYL 4MA7L 4PRDA 5F9WB 1ET7A 4DKEH 4HS3A 1WZ1H 2VJ0A 5KBDA 3MGOB 3T0EA 1L9QA 2VR8A 3L13A 5AOIA 4NNPL 2BNQD 2XQYG 4LCCA 5TE7H 3PCYA 4PJIB 1ICTA 3EBGA 4XNUL 3TIEB 2F1AA 1ND0B 1XDTT 4KX7A 2VZSA 2GY7B 4CC0A 1FVDB 3B9KA 3T1FA 3V6ZA 3NPZB 5FFLA 2YLKA 4M5SA 1QYGH 4R4FL 3DVGA 4Z7VF 4LQFH 4TLKA 3DK0A 2VITA 1OGAE 4AYSA 3BKJL 1ODUA 1G6VK 3QJRB 1TTCA 3MX0A 1GRWA 2KL6A 5MEQA 1AQDA 4LPYA 1TO4A 3R1GL 3VI3B 3D33A 2WXIA 5KZCB 2VC2B 4DOHB 1QRNA 3BGFC 5E99H 4MJ5B 1G94A 5IB3A 1HHKB 1A8ZA 4PGCA 2NXYC 5JXEC 5BZZA 5CP3H 5E6IC 1OE3A 1R4XA 3HZKA 1LL1A 1BMWA 4TXVB 5JHMA 1A6VL 1QNZL 2AITA 2EXWC 1MHCA 3Q44A 3C08L 3T0VA 3TZVB 1T1YB 1JRHH 3FB7B 1TF4A 4XI5D 1HZLA 3LSOB 4MCZB 5D5ME 1YO4A 5KWYC 5B1KA 2VWEE 3TTSA 1WBXB 4J8RB 4A7SA 4E9RA 1A6PA 3ILPA 4QGYA 4XRCA 5I6XB 4K94L 1E8ZA 1XZ0A 4H2CA 4XO3A 3L9RA 1MW1A 3MNZB 2Z8SA 2W0KA 3I6LD 3S2AA 1MRDL 4L4VB 3WKPA 1WGOA 1NFAA 2NX5E 3RI5F 1S7RB 2HRPH 5D1QB 2YPLA 3GMLA 3IGFA 2D0FA 3P69A 2YQGA 3BSHA 5GGVL 3TV8A 3ZT7A 3ZO9A 1SYSA 4R4NC 5EC2B 1P4BL 5J9PB 2QVKA 3FO1A 3MA9H 4GAAA 4X5RA 1C7SA 4J3OD 5DHXB 4ZMOA 2CNYA 2IALA 2DKSA 5I66B 2KPNA 3CPLB 2D73A 5AB1A 4L8BA 4J3UA 3VRJB 1M7DB 1MCKA 2ZWZA 4HC1L 3P9MA 4D9LL 5I1HH 5B39G 5CCGE 4WV1A 1KGCD 1FO0B 1DLHA 2W38A 4S1DD 1TETH 2OCJA 2X4OB 1K2DB 3ERXA 4G59C 4QHLB 1KXHA 4I0PA 1JNNH 2UZYB 5DS2A 4FXGB 3VTAA 4JPWL 1WFOA 4KRPB 3VJ6A 2LOEA 3WDHA 3VD1A 2Z6FA 2B4CL 2XTJD 3HG3A 5TQ2H 4QYOB 3UJTH 3O6KH 4N3TA 3GXMA 3PF2A 3MGOA 3NIDB 2LHAA 4O5LL 3X1BA 5BVPL 5JIDA 1LD9B 4LXFA 3T08A 4ERSL 4GAJL 5IGXL 1V7NL 1F6AB 4PJIA 1IV8A 1EFXB 4XZUB 4OD1L 3TIEA 5I0ZA 2IOMA 1ND0A 5LBSA 4J4PA 3QBTB 3WAJA 3ULUF 4NM8H 4IRZH 1FVDA 4UQ3B 3GO1L 3KLQA 1MFUA 5I8KH 4BUHA 1U8MB 3VXUE 1WS8A 5G55A 4HPHA 2J8OA 3LD8C 3ARBD 2YEVB 3MREB 4GXVH 4A63A 4XE0A 1BD2B 4IBTA 1UZGA 4NRZB 3HZ3A 5DC9B 4OLUH 2IWFA 4ORGB 3RA7L 1B0IA 1ZLSH 5D7LD 4RGMB 5MI0B 2DQJH 3VI3A 5BW7C 4AYEC 5KSAD 3IAGC 2WXFA 1UZ6E 4NFCA 2E7LA 1VFMA 2VR4A 4MJ5A 1HHKA 1M42A 3DX9B 4AOFA 1IEAB 4OZFB 2BSED 2YO3A 1E3XA 2HVJB 4FG6D 2Q2EB 1JHKL 3DLQR 4ONGH 3TZVA 1IE5A 5DT1L 5IT2H 4D7BA 2AHIA 1T1YA 3EBHA 4GAYB 1RULL 3FB7A 3KW8A 3LSOA 4MCZA 1WBXA 5G5DB 1QI3A 3BEVB 4J8RA 4YMPA 4K55A 4B9ZA 1YNLH 4CADB 5C0FB 4PWGA 1PG7W 3BKCL 5IWLC 4FS0A 3MNZA 4WUKL 1U33A 4DSYA 3P0YL 3QH3B 1FFTB 3DGCR 3MLUH 4L4VA 5FLUA 4PHXA 2BY1A 3OKEB 4Z3JA 1S7RA 2HYMA 5L88L 2CR0A 4HF5L 1VESA 1E90A 5D1QA 3FU9A