3UAAA

Multicopper oxidase cueo mutant c500se506q (data1)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uaaA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uaaA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uaaA03
1A8ZA 4BWUA 4WKXA 3ABKB 1JVOA 1A4CA 1PCSA 3S8FB 1N70A 1XMEB 4M3HA 2IH8A 2VW4A 2BP0B 5B1JC 3S3CB 1OE3A 1ZDSA 1GY1A 1KGYE 2PP8A 1JZFA 3D12B 3MX0B 3FSAA 4A2HA 1PNCA 2XUWA 3NSYA 2VMJA 1JZGA 2Q9OA 4DP5X 2HLEB 1PLBA 2J55A 3PAZA 5FC9A 4NERA 4YSEA 2XU9A 2PPEA 5E9NA 3OMNB 3DKHA 1AZNA 2YAQA 3UADA 3SQRA 4BWTA 4KO7A 4YVUA 2IH9A 3N55A 3CVBA 3AG3B 1BYPA 2DWTA 1NWPA 3HEIB 4YSQA 4GP8B 4WTQA 2EIKB 3OD3A 3MBWB 2XXFA 3FSVA 3X1NA 1L9OA 2B08A 3PAUA 4UF7C 2ZWNA 1ET8A 2JFCA 5I26A 1AZUA 1PMYA 2FQFA 2JKWA 1J9RA 3IE9A 2J57A 3NP3A 2J5WA 1MG2C 1NIDA 3UAAA 1A4BA 2VSMB 3NJNA 1ET5A 4G70B 3QJTB 1BYOA 5AFAA 1NWOA 1ZDQA 4Q8BA 3WG7B 3NT0A 5B7FA 2YQBA 1AG0A 5D4JA 3BQVA 3NYKA 1HAUA 4YSCA 1SF5A 2XWZA 1BQ5A 2MTAA 3EF4A 2BW5A 4UAHA 5ANHA 1L9PA 4BXSV 1T5KA 4M4RB 4DPCX 2CALA 3SBRA 4GP5B 1AQ8A 1JZHA 4AZUA 3AG1B 4F2EA 3FYIB 1RZQA 2PPCA 3U25A 2H5UA 1SFDA 1ET7A 1NPNA 4TXVB 4AKPA 4QLWA 1L9SA 1FA4A 4DP9X 3ASNB 8PAZA 5AZUA 2OV0A 4E9WA 1KDJA 1WS7A 3FS9A 2YAMA 4E9QA 4W9ZA 3NJIA 1AACA 1ASQA 4HIPA 5I6NA 1XB8A 1W6WA 3TU6A 2GHZA 1ASOA 1TEFA 5I5MA 2YAHA 2YAPA 3KW7A 2FTAA 3DIVA 3QPKA 4PCYA 3EHBB 2XXGA 2RACA 2UXFA 5B1BB 1PY0A 4G7RB 4AKOA 2GSMB 2YAOA 4A2FA 3CDZA 4KO5A 4A67A 2VN3A 1A65A 1BQRA 3SBQA 1E5YA 1GYCA 1J5CA 4HHWA 1PLCA 5A7EA 2UXGA 1F56A 3HB3B 3JTBA 2FNWA 3T6VA 2TSBA 3FQYA 4HCFA 1EHKB 2EILB 4KNSA 4GXFA 1PZAA 3GYRA 1N68A 2VM4A 3OM3B 4YSAA 2IWKA 2AVFA 1CYWA 1SF3A 4BWWA 4DPAX 3JT2A 2NRDA 4DP0X 1MZYA 4HALA 4KNTA 2PPFA 4DP2X 2ZXWB 5F7BA 4G72B 4AKQA 1BXVA 2CAKA 1WA1X 5TK2A 2XLLA 4JHUA 1X9RA 4KOBA 5PCYA 1MZZA 1NPJA 1TEGA 2ZONA 5B1AB 1M9WA 3CG8A 3QJVB 3X1BA 2FJSA 2QPEB 2I85A 2TSAA 2BP8A 3FQ2A 5D4IA 1GY2A 3ZX1A 2OCCB 3OMIB 4UANA 4A2DA 1XB6A 5I28A 4YVNA 3GDCA 5B7EA 3CDZB 3NJJA 4JKNA 4Q89A 3NSFA 2FT7A 2HX8A 4DP4X 1B3IA 4G7SB 2FT8A 2XX0A 2P80D 1KYAA 1E65A 1OE2A 3CZUB 2UX7A 4K9JA 3FU7A 1EZLA 2FWLB 2PPAA 3X1FA 4DPBX 2UX6A 3CVDA 1X9UA 2PCYA 1OOWA 2CBPA 1BXAA 1WS8A 2QDVA 1GW0A 2AANA 1GS8A 4EF3A 3AY2A 1NIFA 1NDTA 4AX3A 4YL4A 2BW4A 1OV8A 2FQEA 3WNJA 4YSRA 1GSKA 3RYMA 4DP7X 2YARA 1GS7A 4PAZA 4W1TA 1OCZB 2EIJB 3ABMB 1A3ZA 4RH4A 1NIAA 5I5JA 2BZ7A 3AZUA 2Y1AA 3S8GB 1SFHA 1PZCA 2ZOOA 3ASOB 4KO9A 1V54B 2BWIA 2GB2A 4DP6X 1WAEA 1OCOB 3QJUB 2BP8B 2YAFA 2GC7C 7PAZA 2I7SA 2VSKB 1WA0X 2MRYA 1JXFA 1RZPA 2UXTA 2EIMB 3FPYA 2BWDA 3V9CA 2HX7A 2HXAA 5B1JA 2IDTA 2GI0A 2DWSA 1E30A 1W6LA 4CSPA 1WA2X 2PP9A 2XV0A 4BDVA 3FU7B 1AZCA 4E9RA 1AAJA 2HZHA 3GXUB 4HAKA 1YLBB 4YSUA 2AFNA 2E86A 2X88A 2WSDA 1KBVA 2PLTA 1OCCB 3C75A 3NJHA 3FSZA 1QHQA 4FA7B 3OQRA 3WKQA 1OF0A 2VW7A 2YXVA 2BO0A 2WO2B 3ZIYA 3QJQB 2CCWA 1J9SA 7PCYA 1JOIA 1PLAA 4JHVA 3S3BB 2IAAC 4E9YA 1ILSA 3X1EA 5B3SB 1RKRA 1PF3A 2IDFA 5D4HA 4YSPA 1AS6A 1IC0A 2DYSB 4YSTA 3ABGA 4E9TA 4X4KA 1ZIAA 1IKOP 4NB7A 2UXVA 3EH5B 1AZBA 4F7KA 3UABA 2I7OA 4KO6A 1JVLA 1NINA 2PP7A 3NSCA 1CUOA 3N2JA 5I6MA 2J56A 2Y69B 2GBAA 3NJGA 3KW8A 1OCRB 1KDIA 1ASPA 2CJ3A 3FQ1A 3PLYA 1SJMA 3PXLA 3PPSA 1QNIA 3WIAA 4E9VA 2VM3A 3PAVA 1NZRA 2IWEA 5AKRA 1XB3A 1AOZA 1E67A 2IDSA 4KOCA 3T9WA 3QJSB 4G7QB 4MFHA 3AG4B 4BDVB 3OMAB 2A3TA 3ZBMA 3H4HA 1OE1A 1R1CA 2FT6A 4GP4B 3FPXA 2AZUA 4CSZA 4P5SA 2P80A 2FQDA 1DYZA 1V10A 3NJLA 1PZBA 1J9QA 1JERA 1JZIA 3X1GA 3QQXA 3IN0A 4GYBA 2HRHA 1BXUA 2PCFA 3QJRB 4HCGA 3ABLB 1URIA 2CUAA 2VW6A 3FU9A 3IEAA 2GC4C 4HHGA 5B1KA 2QDWA 1PNDA 4BXVA 1AANA 2QPDB 2XYBA 1AS7A 2DYRB 2HRGA 1L9TA 1KCBA 1VLXA 2EINB 2FQGA 1L9RA 3CVCA 3V9EA 4A66A 4DP8X 3H4FA 3WKPA 1TU2A 3EH3B 1BEXA 3PCYA 2Q5BA 4G71B 1ID2A 3UAEA 3T6ZA 9PCYA 1KCWA 1L9QA 1DZ0A 1SDDB 3WI9A 3SBPA 3TBBA 1A4AA 1ZV2A 1AS8A 1QLEB 1GS6X 2LLNA 1V55B 3IN2A 3S3DB 1ZPUA 3NJFA 1RCYA 1SNRA 1AG6A 2R7EA 1JXGA 1NICA 3EH4B 4GY4A 6PAZA 5I6LA 5PAZA 4QKTA 1AR1B 4P5RA 3T6XA 1FWXA 2W8CA 3FYEB 5I6OA 3UGEA 4AI7A 6PCYA 5LDUA 1AIZA 4L0PB 1IBZA 2HX9A 1CURA 1ADWA 1NIEA 5F7AA 1PAZA 3FSWA 4E9SA 4E9XA 1KV7A 2XX1A 3DTUB 2XV3A 1JZEA 1SHXA 2H3XC 1IUZA 2DY2A 3IBOA 4HCIA 1JZJA 3NJMA 4HZ1A 1ILUA 3UACA 3X2QB 4DP1X 1CYXA 3BVDB 5EHFA 5I6KA 1KBWA 1AZRA 3G5WA 3H56A 2IDUA 2DV6A 3L45A 1UATA 3NP4A 2XV2A 3WNIA 1NTDA 4KNUA 1NIBA 1M57B 5I5IA 2BP0A 3ZDWA 2XVBA 1FFTB 5IY5B 2OJ1A 4ZK8A 1GR7A 1HFUA 1ZIBA 2WO3B 2IWFA 3NJKA 1MG3C 1MDAA 3ERXA 1TKWA 3TA4D 2BZCA 4A2GA 4A68A 2AZAA 4YSOA 4NAJA 1E5ZA 5I6PA 1BAWA 3AG2B 3AW5A 1HAWA 1I53A 3T6WA 1J5DA 2YXWA 2R7EB 5TK4A 2H47C 4YSDA 4FAAB 2GIMA 2YAEA 5B7MA 3FU8A 4BK5C 1JXDA 2N0MA 2QT6A 2B3IA 2IDQA 3T71A 1SDDA 4N8UA 1ETJA 4ENZA 1M56B 1IBYA 1SHWA 2BHFA 3FT0A 4YSSA 2PPDA 1J9TA 4F2FA 2JXMA 3TBCA 4N4YB 1CC3A 3NSDA 2X87A 4A2EA 1W8EA 3TASA 1BQKA 2W88A
chains in the Genus database with same CATH superfamily
2P7TB 3Q2LA 5DZNA 2XICA 4B0MB 5KUKA 3U1QA 5BVJA 1JIBA 5DHXB 5FO8B 3OPZH 1K5NA 5A40E 3D34A 1QFPA 4NQVA 4PJXA 4WNQA 3HZMA 1W80A 1FJ1A 3Q3GB 3HHMA 1GY1A 1KGYE 5SV4A 2F53B 3L17A 3KAAA 5T5FL 4M4RA 3SPJA 1U41A 4KAQH 3KL3A 5IQ9A 3H3PL 4YIQA 4ZPVA 1YPZA 5FWRA 1J0YA 1GPOL 3C60C 3G5YB 3KHQA 4X80H 2HLEB 1JF1A 4I89A 2DQFB 2QLYA 4EIBA 4NI6A 4YHNB 3RUGB 3TF4A 5C08A 5I5RA 1Y6NR 3M8OL 5JZ7C 4YE0A 3RVUD 4PWHA 3JWDH 4WO0A 1KCSL 2FSEB 2YAQA 1CXHA 3QA3B 4D3CL 4KO7A 5EU3B 3L3IA 4NUGL 2V2XB 3KLSA 1JG9A 3DX8B 4XO9A 4BSVA 5C9JA 3AREB 5B39A 2EDMA 3HEIB 1NMCB 3MBED 4ZMAT 4HJIA 4TLUA 4OF3A 2H4EA 4AYDC 1FGVL 1NDMA 1REIA 3CFTA 5I26A 4RGNB 4NO5A 4NUJA 2O6FA 1CMOA 5CP7B 5I76B 3ZE2F 5D6DC 4QJ3B 5JMRA 2EVGA 3PHQB 3WELA 4XHJC 4UQ9A 3UAAA 4P04A 5T5FH 3VXRD 2VSMB 1NGYB 2VUYA 5E6IA 1KGIA 1BYOA 4K71C 4WHDA 4PRNA 3FB5B 1ZDQA 3CZFB 4F8NA 2C9PA 3MV7E 2LFEA 3QI9A 4OCWH 4UQEA 5KZCD 4KHTL 1PGRB 4KTGA 3TEUA 1ZD6A 3M8OH 4B6ZA 3LN4B 2Z31A 1SYVB 4YC2C 3MLWL 2CIKA 1WE5A 1KCSH 4AZ8B 3C5XA 2BY1A 3DOSA 4PWEA 4D3CH 4PTUB 1XCQA 2WIMA 4NUGH 4BXSV 4AYSA 1P7QA 4Q9CA 4CDHA 1NC2D 4PJHF 1URLA 4OF8A 3OB8A 1ET7A 2BX5A 1MIML 1KCVH 4TXVB 4PG2C 3I2CL 1U3HA 3SDCA 1JPSL 2A6KB 2R29L 3CFDB 4E9QA 5M95B 3MROB 3BAYA 2HA1A 3BP5A 4TQ8A 4P4KC 4Y4FA 1AACA 4HIPA 2C4XA 2P3YA 1NANH 1FO0L 5FGCE 3QHTC 4G6FB 4OFPA 4ZUSA 4AJYV 1TEFA 2YZ1A 1IM9D 3EYQD 3IPEA 1HH9B 1HHHB 3NCJH 3EG9A 3F7PC 1MAJA 5I1CL 1ZHKA 1MFAL 2UXFA 4EN2A 2NZ9D 4DK3A 3T1FA 3G9VA 2Y5QA 5FUCE 3QYCA 1G87A 4Y7MA 5KAQF 3DHPA 3M1BA 3TCTA 4K7PY 5IHWA 2YGOA 3CHPA 2BSRA 2NW2B 1CDIA 2DTML 1R3KB 3PWPA 4U2ZA 4AJ0A 4APXB 3B43A 1MIMH 3KPLA 3MTRA 3I2CH 1IEBB 4XMLH 1JPSH 1OVZA 5I2IA 2I32A 5AW3B 3O81A 5E8NB 5DEFB 1WFMA 4A7UA 1NA8A 1PZAA 4DEPB 2NY6D 1FO0H 3REVB 3WE1A 3QUXB 4NJAL 3X3FL 3QQ4A 2CRIA 5TH2B 4ESKA 1BMWA 5C0GA 4BWWA 4OIIH 5IHZB 4YQXH 2EDDA 1H15A 1WBYB 1CD1B 1D5XB 3BKCL 3MJ8B 5I1CH 3H9SE 1DJIA 2H1PH 4G11A 1MFAH 3PL6B 2EC9U 1FZJA 3T4AC 3VU2A 1AO7D 2CAKA 3RU8L 4AOFA 1O5DT 3P69A 2C4FU 4QT5A 4JHUA 1B4JL 1F6AB 3BPCB 4ES8A 2O26U 2VDRB 4JQVC 2LGNA 2IQ9L 4M5TA 2DTMH 4YZFE 4NQDA 2V33A 4JY5L 2I85A 2XPYA 3D3VA 3FQ2A 1KB5A 2NTFA 3MNZB 5FS5A 2OCCB 2QQNL 3UJJL 4Z7UB 2X42A 1FFPB 3S37L 3SY6A 3VI4E 4Q6IA 1FAKT 3ZHLA 5C2BL 2HX8A 5KVDL 4NJAH 4DP4X 3X3FH 2VN7A 3QG6A 5K9OB 4HS6B 1TQBB 3R1GL 4PGBB 1NCTA 2BOCA 3S3SA 3TBSA 3HS0C 1VEOA 3MV9D 5B39G 3BEWB 4Z7WE 4C47A 3VWJC 1NGZA 2A6DB 3QIWD 5L0QB 4A37A 5CFAA 4HLZH 3GZPA 2CIIA 3THML 1B4JH 3EJYD 5ID0B 1QSEB 5DXWA 5HJGA 2IQ9H 3V10A 3VXTA 1XTLA 2VDMB 1FNHA 3B2UC 1V7MH 5AL0A 2WKLA 1R5WB 1AKJB 1MOEA 3RYMA 4DP7X 3DYOA 3BAWA 4ZSOA 1VFAB 3AQXA 3DO4A 5IHBA 4LF3A 3AY4C 1I8LA 3LSOB 1OGTB 4FMFA 4JVWA 5I5JA 3S37H 5JHDA 4M7LT 5IW3A 5BXFA 1QSZA 5F71A 5C2BH 5KVDH 3T0EC 1BMZA 2HJKB 4XXCC 3UDWA 2XFXA 1JHTA 3R1GH 1ODAA 4PSPA 3VWKC 1BBDL 2B20A 4DN3L 3A5VA 3RHWF 2GC7C 3B6SA 3MA7B 2W07B 1OT2A 3JZ7A 3C6LA 3OF6D 1I8IA 1MNUH 3IRPX 4OVVA 4ODWB 5CEZH 4F27A 4MASA 2VDLB 3FU5A 4QJ4B 1XDTT 1C5DB 1X4ZA 1D6EA 1DSWA 2P24A 1IT9H 4PIBA 3LIUA 4HK3J 2VDOB 1RSFA 4OKDA 3LKSB 2FGWL 5D9SB 4B41A 1OP5K 1CGWA 5C6PB 2Z64C 4KDVA 4EN3B 4JRFA 1F41A 4O58L 5T1LB 2OMWA 3U4KA 3NJHA 4PJEB 3SCMA 1OL0A 3ECWA 4LLYB 1DSYA 2CU9A 1FNSH 2WXKA 3K4DA 3MV8D 3QYNA 1OF2B 2WBXA 1TTRA 5CO1A 4AJWA 4X8JB 5KVEE 5DEJA 2VZTA 5I82A 3KPQA 3NEOA 4QXGH 3KXFD 3VB8A 2OJZL 3HG1E 2ZUUA 1X6LA 4MMYB 2FRGP 4PHXA 4R8WL 4JHVA 4MJ2A 5BQ7B 1MEXL 2G75B 3ILPB 1GOFA 3CN0A 3S0PA 3Q8CA 4PUBL 1KZQA 2IDFA 3MUY1 5A3ID 5IHUL 4P3CL 4AYFA 3Q01A 4JFOB 2ZOWA 3ZTJG 5I19L 4B50A 2EDJA 1HKLL 3VSUA 4ZAKC 5B21A 5HD8C 1K8IA 3VD4A 1CUOA 1UURA 4WI9A 2AQ1A 3WMQA 2XWBA 1DQIA 1DVFD 2DH3A 3JBG7 1TVHA 2JKJA 1KBBA 3FTWA 5I1DB 5HYQB 3VM7A 4EUPH 1I85C 5AB1A 3RPKA 3DYMA 4GSQA 3APDA 2A38A 2XETA 1F3RB 4KTDL 4XCFL 3P54A 3LQAL 3OX8B 3ESOA 3HI1B 1GSMA 2OJZH 3BH8B 4BSJA 1YNLL 1U95A 1ZHLA 1S5HB 4O5LL 1E28B 4X5XB 4JFFA 5C3TA 1MEXH 3ULSB 4Z3FA 3TFKD 3O3UN 1DDTA 4PUBH 5DVNA 1J5OH 5KYUB 5D1XD 2VZ1A 4PRIA 1BZEA 2GJRA 2DICA 5DD6A 2BHUA 3QPQC 3ARBB 2J3SA 4IBTA 4KZDL 1BWMA 1HKLH 5JTWA 3ZE1E 4NBZB 2DEXX 1H3VA 3ZDZE 2GIYA 1JPFB 4HHAB 5DVLA 4U7SA 4UT7L 2BNRA 1A9VA 4TL4A 4KQ4H 1IL1A 2YMXL 4QHNB 4PIRF 5GGVY 1CK0L 1T0NA 3FUEA 5ABAA 4UQCA 1U8KB 2KH2B 2WO4A 4N8CL 2GC4C 5B1KA 1J1OL 2HWZL 3MUUA 1JN6B 2YPLE 1JPTL 5F7YC 1WUZA 4OAWB 2FEEI 1TSRA 5IEHB 3RG1C 4KTDH 1LEKA 5JHMA 5KJRH 3IMTA 3LQAH 4FI6A 5DEGA 3EH3B 2X2UA 1A6AA 2EDYA 1A7OL 3K6FA 4RDQG 5DHVH 1AGFB 5D1QC 9PCYA 4JZNB 1MLBA 1MQ8A 3CGTA 5IOPB 1T89A 4ALAC 5D7LD 2DMGA 2H1XA 4GQ9L 3KWWA 5L8KB 1R9FA 1EAOA 3PWLB 3SE8L 4OZIE 1HC1A 1I4FB 3OAZK 2ICEC 2DJMA 1JGEA 1HU8A 5CMAA 3VXUD 3ZW3A 1P4LA 4J3WA 1U8PB 3VE0A 4QKTA 4BFOA 2HRLA 4QCIA 3TBVB 2V6HA 4FMKA 3UJIL 3AABA 4ALAL 1J1OH 4D2NA 1H5BB 1RZFH 3JYCA 1JPTH 4HD5A 5AOIA 1QFWM 1IBZA 3CSPA 4PJBE 3U2SA 1S9WA 1A47A 4JRYB 3BT2H 3RPIB 2J6EA 1OIOA 2JMRA 5FA3A 3ARWA 3ZKMD 4TUJB 2XQYA 4RNRA 1A7OH 2XV3A 4XX1E 4PJ5D 4LEOB 4Z7QE 2XCMC 5IB5A 1Z3GL 3VQLA 8FABA 1DVTA 4YLCA 4HCIA 2OZ4A 5IROA 1A6ZB 1HQRB 1VHPA 3S88L 2OSLB 3UTSA 3EYSH 1N8ZA 5D7KE 3VGBA 3C60A 1EPFA 1KUMA 2EACA 5E0FA 4PJ8A 3G5WA 3VFGL 1HXKA 3T65A 3DVIA 1P4UA 3FZUC 1BWWA 1YQVH 4KNUA 4MD4A 4F7PB 3BWUC 3O9WD 2EE6A 4QRUA 1UXMA 3KPSB 4F7MB 4MQXC 3L9RA 3V7AE 4LCWB 5K1JA 5DWPA 3ERXA 4BZ1A 4KJYB 4ZUUB 1W16A 1A2YA 4N2LA 1I1AB 3ZZQA 2Y9RT 2R69L 4FXGC 4GRWF 2GSGB 2B7DT 3GMPB 1BPLB 1TQWA 2PR4H 2FX8H 4UNUA 5TK4A 2IGTA 4XOAA 3TWCH 3LKNA 2YD5A 2P5ED 5F88B 1CF8L 3M1CA 5D6DA 4DKEL 4GIOA 3GBEA 1Z3GH 1Z32X 3I3BA 2W38A 3KD4A 2F54E 4CMMA 1P5VA 1EFXA 5DD3L 4HUVA 3WOVA 5JIQA 2ZUYA 3VFGH 5HGHA 2XPGA 4NEHB 3VG9C 3QRBA 2XY2A 3BGFC 5IESL 2EYSB 4B9IA 3FRPB 2GSIA 4Z1PA 4LCVA 4JPSA 2WXLA 1QSFE 4X0KA 1SUHA 4A2EA 1W8EA 2BP5M 3BVXA 4MKTA 3TA3B 2OX5A 4BQBA 3P4MA 4XMKL 2R69H 4KDTA 3M46A 3TVMD 4BWUA 3D30A 4Q7DA 4FQ2H 3STZA 4X7TB 2ZD0A 2D7MA 4YK4B 4NX0A 1MHPH 2WVSA 4WV1A 4LIQE 3NDYE 5D2LF 4NLHA 4PJIF 3UBXI 1U3JA 4P4KA 4KI5E 5IFJB 4AM0B 5D72L 1NAKL 2Z65C 3U0WL 1NMAH 2H3NA 3B9VA 4GKNA 3RY4A 4PGJA 2YD1A 3WEOA 2P43B 3DV4B 2Y36L 1NGXA 4GW5B 5SX5K 2J2ZA 5C97A 3V6FB 5HDBB 3RZCC 3QJOA 1JNHB 4G8GD 3MGOB 3UADA 4BWTA 5JW5A 5FB8A 4U6HB 4LCWE 2ENJA 3AUVA 5EIIB 2OTPA 4GQQA 2BVQA 3IKKA 4CUCA 3TIEB 1Z5HA 5JIDA 3IDYC 2JFCA 4QHMB 1UXWB 4WI8A 5DTFA 1JFQL 5F3FA 3VVVA 4GAJL 5T1KB 2DLHA 4YDNA 4LCUA 3VFMB 1PMYA 4KKPA 2ZTBA 5CD3B 1QFHA 4F2MA 4YHYC 4YDLB 2FIKB 1N6UA 2KZBA 5D72H 4CN4A 1WWCA 2FH8A 2QFRA 4JCMA 3UO8B 4Y5XB 5A2AA 2E3VA 2ARJB 4UIMA 1JYVA 3ZRCC 4DESA 1MWAL 4XX5A 2DD8H 5A43C 3FHEA 3QNZA 4YDJA 4JREC 5K69A 3MUGB 3T4AA 5J6HA 3RY6C 5DMJB 4A6YL 1S78C 1BFTA 1WHPA 3LS5H 3VMPA 1UYWL 3KJ4C 1KYOJ 1XGRA 4U3CA 3GB7B 3MACL 3A4DA 2XQYG 3D0VB 3NA9H 4BQ6A 3BE1L 3Q6FA 3REWA 5ITFB 1CFVH 3DRTA 3U6RA 3DURB 3AG1B 4IOSD 1RZQA 4GW4A 4P2OC 3GQFA 3IKCB 1LYQA 5AW6B 3BZEA 1DQKA 3L95A 1AYOA 4YS4A 1MFCH 1T1ZB 2RH0A 3BZ4A 4IGBD 5TPWL 1AXSA 1ID5I 2X1OA 3HBQA 3IMWA 4WVRA 3JV5A 4D9LL 5AW7B 2X7LA 4PJ6A 3HR5A 2R39A 3PQYD 2F5BL 3Q9QA 1M71B 3TU6A 1WK0A 3ISYA 1NAMA 3CV5A 4PS8A 3FTZA 1K6QH 3HS0A 4OZHF 2W0PA 4HC1L 1PZUB 3KE0A 3VWJA 1DO5A 1G43A 2VR6A 4XOCA 12E8L 2Q7YB 3PNWB 1UWYA 1QKZL 1D7DA 1FZKB 3PE9A 4KVCH 1BZQK 5CP3H 5J11C 3CWGA 1FDLL 3MO1A 5E6RB 4G2AA 2PCPB 3DGGB 3CDGA 2VAAA 3QZBA 3KYAA 3S2CA 3EFOA 4TQHA 4MMXC 1U0QA 3JV4A 1CO1A 1F56A 5BNXD 2N0KA 3ATBA 5EUOB 4HPHA 1T66D 3AY4A 2MNUA 2XG5B 3ZKXC 1YUHB 1MVFA 1U93B 3VA6A 1I9EA 4D9LH 3T0EA 4HWBA 3KPPA 4XN5A 4XXCA 2F5BH 4MNQE 1RQ5A 3VWKA 2NY2B 4RAHA 1SF3A 3IRCA 5E8DL 4ZFZA 4HC1H 2VABB 4AMXA 2H26B 1VPOH 2YOAA 3Q2VA 1SMOA 4J27A 1KLFA 1XXFC 4JRWA 4X6BB 5HHQA 4DP2X 2HFFB 4G72B 4AKQA 4R90H 3ZT5A 1WAAF 4KKLC 3PHSA 3GJFA 3AU1B 3GSRB 1R6VA 3CG8A 1KWGA 1WSST 1KYOK 3M6DA 4NQEE 1U8LB 4BGLA 4FXLA 5ISZB 4NKOA 3U79A 3FB8B 3QDGE 3QXDA 1GH7A 2WKOA 1USZA 1FLTX 2QTVA 3KLHD 3QUZA 4DK5A 4X99B 5JDJA 2G30A 2ZP0T 2ITDB 4Y16A 3FCTA 3WKMH 1DUZA 2JQZA 2RBLA 1FNLA 3PYCA 4NO0D 1J8RA 1QPXA 2NY4D 3H6JA 4PH8A 5LKNA 1P7KA 1PJ9A 4GBXD 2UZIL 2J43A 4YHKL 2WLYA 5H37H 4QYAA 4ZAKA 3ZT7A 2Z1KA 4PM1A 5FYKD 5I1LB 1JFHA 4MS8D 2ESVE 5C0RH 4AL8C 4I1PA 4OLZH 2BPBA 4H0HB 4IS6A 4R5XA 3EGXB 3EJSA 4MXVF 2GUOB 5D7JD 4XVUC 3QUKA 2BNQD 3MRDB 5J3HC 1I85A 1MF2L 4RMSA 2CKBB 5KW9H 4GRWH 3GI8L 4OI9A 2Y1AA 2ZUVA 1D5BB 3BW9B 4JPVL 4EJ1C 2X3BA 2X2JA 4U1NB 3O45B 3BPNB 4M6OH 5F1IB 4DP6X 3GSUA 2PUQT 4JZOA 4TVSa 4KUCF 1C8QA 2BP8B 3CN2A 3P3YA 2EKSB 4I3GA 2O6EA 4LSTL 3VFRA 5JA8B 5B22A 3HHRB 3O4LE 2VSKB 2R2BA 3QEUB 4IQHA 1P1ZA 3CFCL 3MBEB 1BQHB 1LLAA 3H0TB 4MAUL 5FX3A 4RAVA 1OAJA 4O02L 3LZQA 5IVXB 5F97E 1E2ZA 4HUXB 3L6FB 3L3GB 4W9IC 4ELME 1EJOL 3CXDL 5FGBC 3A4EA 1H0DA 5CN1A 2GEQA 2JTDA 2CO4A 1UWXH 3M17B 1E3ZA 4FXKB 3VXRB 2R8SL 1MF2H 2WSDA 4XO8A 4AYEC 4PJCE 1CXEA 3ZMEA 1FNEB 2BIPA 1E4WH 5KZCB 1CDCA 5EUKB 4PJGF 3NJXA 2DF3A 3OR7B 4KV5E 5FHBL 4KZCA 4TNWF 3DX7A 3PIQA 5FECA 3FF8A 3OB0H 4L1HA 4DF9A 1PLAA 3IXAA 5D1QA 3AQYA 5HDLA 3VFVB 3X13A 4LSTH 4E9YA 1TQTA 1OK0A 4RGOL 3ABGA 1EGJA 1Q72H 1NC2B 3RWCB 4HUWA 1BIHA 1R3LB 4DO4A 2NCMA 4Q2ZA 3JWNC 1NEZA 4NQCE 1EJOH 3CXDH 3N2JA 4W9GC 5AL8A 2P5WA 2Y69B 3RKDC 4C57C 3KW8A 3F7VB 4NBXB 4DCQB 4OFDA 5F3BB 2WWKT 4UM8B 1AC0A 3JWOC 4TNGA 2R0WH 2JH2A 1M3IA 1OT4A 3MCKA 4OJAA 3BLPX 3QXAB 4PV9B 5A2LH 1WTGT 1UC6A 5E5MB 1IM9B 2IWEA 5G55A 4KITB 3BUPA 5KN5B 2ADIA 2IH3B 4M6AA 4XPHL 3VQ2C 3BP4A 1DEEA 3AG4B 3U2IA 2X12A 4ORZC 4X7CC 3U7WL 3VGGA 5LBVA 4XE0A 2A3TA 2CO2A 4LCYB 4MQSB 5AAWC 4GP4B 1BLNA 2Y5EA 1E27A 2VLJA 2CR6A 1QFWI 2DKSA 1DYZA 4WEMB 5D7IF 5EWIH 1J9QA 1WWWX 3Q5OA 1G9MC 2XKNB 5FF6A 1K2DB 4IHOB 1KLGB 4M7ZC 4I9XA 3QJRB 5CJXC 4NN6B 1BZ9B 1G0YR 3QE5A 4PG9A 5FK9B 5L8LB 3IXTA 2ADJB 2ZP9A 1NCIA 1FIGH 2NY6B 3T5WA 5IW6B 4X5WB 3IS0X 3EW3B 3IETB 1HEJC 5EEWA 2DYRB 4P23D 1V8HA 1WZAA 3D85D 4XRCB 1VLXA 4WFFD 4AUUA 1U8MA 4ZJ9A 3CQFA 3RB5A 1PZSA 1JGDA 3LRKA 4JFHD 4XPHH 1HZKA 5JHBA 2IANE 1BEXA 3RI5K 1JV5A 3IRZA 1UENA 4CVXA 1XCTB 4GI9A 2AXJA 4CC1A 4L3FA 4CVZA 1F11A 1H9VA 1U8IB 2PYEA 5BZDB 1C7TA 3KCPA 1G9NH 4PP1C 3T04D 3DBXB 1T6BX 1ZMYA 5IIEA 3QQ9C 4HIEB 1WBXB 1SNRA 4X6CB 1EAPA 3CMOL 4IOFD 4IBVA 1R47A 2Y1ZA 3QORC 2X6CA 3ULVD 2PW2B 2XVGA 4PS4H 3FQXB 5E5UB 5C0BE 2H0PA 4NCDA 1T2QH 1TYJA 2XVKA 1WFOA 5CJBA 4LSUL 5F7DA 5C0CA 3QJHA 5MHSE 5F3HB 4RDQF 4A04A 1MJ7L 4M9PA 3NUKA 1S7TB 4W6XB 5DJ6A 1FN4B 3E1F1 4ONFH 4JFPA 1XGTB 4M5ZL 4OIBA 4GW1B 1M4KA 3BJ91 3F7YB 5AVQB 1QABA 1KB9J 3ETTA 3GRBA 4HETA 1EHXA 2KS0A 1KPVA 4HK0B 5AAMC 3JTSB 2UWEA 2R1YB 3C5ZB 3ARGC 3G6AB 5HBBA 1QRNA 1DQTA 2OQJA 4HAFA 1P4IL 2YWZA 4HZ1A 1R5VB 1O6TA 5EDXA 3RNKA 5GGRY 4DVRL 5EHFA 3VFTA 1KYDA 3FN9A 4FYSA 1QNZL 4IJ3B 3EOBA 5I0XA 1JF6A 5JOFA 3CUPA 3V4PB 3V6ZA 2OJEB 3RZCA 3CMOH 1QEXA 2R4SH 3PWUB 4ZMOA 2KUTA 3AXIA 3CFNA 2DQEL 4XN1A 5DRNB 1GR7A 1RZ7L 1ZIBA 2WWMD 3NJKA 5HY9A 4LSUH 1XSKA 4B9ZA 4UQDA 1IFHL 5KBKA 1KPUB 1EEYA 4IMKC 4D0DA 5JPNB 1XF4A 3NSXA 1ZXQA 3AG2B 3HRPA 2OR9L 4J3BA 4JE0A 1OB0A 1OO2A 3CN3A 3HPLA 1ORQB 3HBPA 3PJLA 4YGVA 5DGRA 5H35B 3WS6C 4P5KA 2ZWLT 4JRXD 2ED7A 2WNGA 4EBQL 3KYMA 4U1JA 1NEZG 3N85L 3QHFL 5HVWA 2WLIB 2YAEA 5E1AB 1AO7E 4AV4A 1AGEB 4X98A 4AIZA 1RPKA 4ZUTB 1UOKA 1U8QB 2YPKB 4ENZA 3D18B 2J25A 3NQKA 4Y19A 3JUZA 1E8YA 4QRBA 1JI2A 1RHHB 5GJTL 2XN9E 4ONHA 3RY6A 1U21A 1AIFA 4MDIB 3RIFK 4DIXA 2WOBA 3I6KA 3FT4B 1VSCA 3UYPB 1F3DJ 2WWOA 3MV8B 3QZMA 2W88A 5C0JA 2A77L 2WYHA 3WNPA 3KXFB 2HTLC 2OR9H 5LBSL 1T03H 4ABUA 2IQAB 2R23B 3VG0L 4NCC2 2D31B 4M3HA 3LKOB 3MV9E 2VDQL 3I9AA 3L3HB 4EBQH 1OE3A 1S7SA 3N85H 1EANA 2O6DA 1FL3B 3CFEA 4IEFA 1TKWB 3CSYA 1T20A 1CE6A 3LDBB 4XP6L 1BVKA 4PY7A 4C56A 2VMJA 1MRFL 1KBPA 3KVPA 1DVFB 3O3EA 4RMTA 3LEYH 5GJTH 4YSEA 4UOZA 4N0UE 1HI6A 2V4LA 3WAKA 1D9KD 3OJDA 4ADGA 5DC0A 1INDL 3IFOB 4XNBA 5FUOL 3BEVB 1CIUA 3N55A 3BWAB 4DQAA 3AG3B 4FFVC 2F74A 1DN0A 4XWOD 3KPNA 2A77H 1E6JL 4HWEH 4S1SL 1NANI 3OD3A 4K8RD 2FH6A 2JCCF 1OHZA 4MA3A 2ENPA 3G6JA 4RX4D 2LU3A 3HMXH 4J6IA 2VDQH 3QO1A 5D1XB 3GKWL 4G9FD 3WNNA 1C12A 2HT3D 2FLBT 1S7VB 1A4BA 3K72B 4PJ9B 5KS9F 4W9CC 1EDHA 4MCYB 4NZUH 4U1HA 4XP6H 5C09A 1XQ4A 4AEEA 3AREC 3E6HB 1NMCC 5I75B 1MRFH 5FO7B 3MMEB 2JJUA 3DX9A 3W0WB 4F58L 1N9PA 1NGQL 3LZPA 1S7RB 3I6GB 2BJML 3QEQA 4RGNC 1RZJH 4LFHD 4X6EB 2WNKA 2F7IA 2FWOA 5I8CB 3RJDA 3FF7A 5GGUB 2NNCA 2QELA 1INDH 4FG2A 2EE9A 4L4TE 5AW8B 5FUOH 3SBRA 2A6JB 1DP0A 4AZUA 1MDTA 3KHOA 4F2EA 1J8HA 3KG5A 3L4TA 3O3BB 3ZGIA 3AS3A 4XMUA 5CILH 3QAZB 3W81A 1RHFA 5AWNL 5KSBA 4M43L 5F9JB 2BHYA 5D7LB 3L4ZA 2RD0A 3FS9A 1B2WL 4PGDB 4YDVA 3MLYL 2P8PA 4K9EH 5AENA 1IC4L 1FE8L 3K74B 4I18C 4AVJA 2BVPB 1G9EA 4LHUA 3AWEA 3PUCA 3ZTJH 3VXUB 1F0LA 2DLEA 3WDJA 1BIIA 1U92B 3DUUB 4PCSA 3TYFA 2OAAA 4F58H 2EUWA 1FVEA 3FB7B 3Q8EA 5FFOA 2BJMH 5A7BA 4PV8A 4EVNB 5KYXA 4UTAH 1I3UA 2RACA 3HE7B 4MA7L 4XMZA 5HHPA 2GABA 1NCOA 3KMDA 1HILA 3B1TA 5JHLL 3AM8A 4BQ8A 3U4EA 4QWWC 4DHLA 1R5IA 3DI3B 3IDXL 4NUMA 4QMEA 4DFIA 3WL9B 4X6FB 2XTSA 3MLPA 2CR3A 4ILDA 4PJ5B 5A7EA 1NCJA 2KPWA 4UDTA 5AWNH 3UGUA 1XF5B 2BRQA 5EC1A 5HHME 2FB4L 2E9JA 4BQCA 3CZEA 4RA0C 2Z0BA 2B9BA 1LK2A 1IC4H 1FE8H 2F7OA 4JVPA 1T5WA 1R24B 3QUYD 1YN6B 1YAZA 4CILA 4F80A 2UZXB 1CYWA 1KB5H 4RWYL 5I66B 3AT0A 3SJVA 2Q3ZA 3CMGA 1ZT4A 3KGUA 3FUIA 1U8HB 3M88A 3CXHJ 3O9WB 5B4MD 3FUHA 3RIKA 2CCVA 1JWMA 1ZA6A 3KLKA 3GINA 1S8DB 3E8UH 4F1ZA 4DEPC 5IFHL 1FVCA 2VR9A 1N2RB 5FGBA 1JTPA 1RMFL 1C16A 2P5EB 1UOVA 5EBLA 4CADB 1E5CA 2FATL 1CGSL 1DQJA 1K5WA 3KJ6H 5B8CB 4KQ0A 5D4IA 2CDFB 3MRHB 2Z7YA 4WFHE 3MJGX 1IC5L 5KSAD 1PBYA 3PL6C 2FB4H 2X70B 5H2BB 2LU5A 4LAQH 5D7LE 1HYRC 3CDZB 1KJ3H 4NRXB 2APWA 2XBDA 2YD8A 3NSFA 1F2QA 2GQHA 3L1FA 1IV8A 2MHAB 2VE6B 4W70A 2RIKA 2ZUXA 3CX2A 3UZEC 3FU7A 4HIIB 1VFBB 1OSEA 3DPBA 2RAMA 2HG0A 4H26B 1YNTA 3C5JA 2CBPA 1QEWB 5HHXL 3HE6C 3TVMB 1CDHA 3DDFA 1AQKL 4QGYA 2O5YH 4EF3A 4N22A 3OZLA 2Y7MA 4M1DL 1QA9A 5DC4B 5DLML 3IBEA 4FFWD 4YL4A 5L9DH 1ES0A 1TQBC 1TR7A 2CD0A 5C08D 4DUWA 1GSKA 2FATH 4N5EC 1CGSH 2F9BT 3OXSA 1YEWA 3ZKSD 4G8EA 1PIFA 4L1TA 4OZFB 2FO8A 3V0AC 1F4YH 4QF1B 1FFNA 1A3ZA 5L0QC 4PREA 1BM3L 5DWUH 3UC2A 3L3DA 4M1CC 2VISA 2COQA 3LRSA 4HV8B 3ASOB 2ZOOA 3HVDA 1WFTA 3P30H 5D70H 3D51A 2Y5TB 4PBXA 1J86A 4N0CC 3ZR5A 2DN7A 1UG9A 1EEUA 3HUJF 4JFED 5CR8A 1K9TA 4Y4HD 1W0VB 3CLFH 3FQTA 3FTSA 3QPXL 4G8GB 5TDNB 5IJVB 5IOKA 2NW3B 2WINB 3S5LA 3V4VB 2JI2A 3LZFL 3DI2B 1JXFA 4HKBA 1XH1A 1Y18A 1Z2KA 2OKMA 5E6ID 5AUMA 3UH8A 3T3PB 3VXME 2XC8A 4FFTA 4LPCA 1QI4A 2DKMA 4NENA 2QVTA 4QRSB 3CHSA 3O0RH 2WUCL 4LHUG 4YPGA 4U1IA 3VXPB 2Z31D 3OKDA 4P46D 3SDXA 2C3VB 4XVTL 2OYMA 2NXYD 4ELKB 5EU4B 1TZGL 4F3FA 2FK9A 1UD6A 5FR3A 1SM3L 5DUPL 3C75A 4KBPA 3WTVA 3WFHB 4KKAD 4B53A 1FGNL 3VXQB 3U7YL 4AC2A 1OF0A 2Q7NA 1UFUA 2HCZX 3SE3C 2BO0A 3UYRH 1A7PH 4TMPA 2HH0H 3SN6N 5EC2A 1JCKA 3CHQA 5DFVD 4JJHA 1JAEA 2WXQA 1RUPL 4OCXH 5E9DB 4PJAA 2G0KA 3SO3B 1IC0A 3LZFH 2H0JA 5EBWA 4CSTA 2WQUA 3NIGB 1P5UB 3L1GA 1X4YA 3VM5A 5JOPD 1H3PH 3BN9C 4LPYA 4AJVA 3K8KA 1LDPL 3UABA 4JFXA 1GHFL 1A4KA 3NSCA 5CD5C 2BERA 3ZUNC 2LABA 3QORA 4HJ1A 4Y0GA 4IGBB 2MCG1 3ZDXE 2JB6A 5LAPA 3ARYA 3N91A 3S34L 1J5HA 1XAUA 3FQ1A 1TZGH 5IFAH 3PQYB 2WM0A 3FUFA 4OCMC 1CLCA 3CPLB 1BP3B 1UXLA 3FUMA 3PAVA 1FGNH 4FG4A 4HU2A 4J6RH 4LCIL 4N1HB 3U7YH 3UTTA 3VD3A 4NT6B 2OW6A 1TNMA 2ZOLB 5AAMA 4WQOA 4S0TD 2HB0A 5AG8A 4U31A 4L37A 3ARGA 3ECQA 1RUPH 5CIPH 5GGTH 2IMMA 3ULUD 1N5YL 3UTQA 3C08L 5C07D 5BOZG 4JMXA 1Q9WB 2Q2EB 2YRPA 4G8GE 3N42F 3Q1SL 1JDAA 2V2TB 1TCRB 1ECYA 4P5SA 4HT1L 2ZKXA 3NJLA 1FNGB 2EYRA 2KDGA 1LDPH 4OIFA 3RGBA 3LQZA 3T3PE 2DKUA 4V11A 1ADQA 4L4VD 3VTMA 4Y2DD 2G2RB 2L7QA 3NGBB 1KN2L 4PJDE 3ROLA 2KBGA 3JV6B 1DDHA 4IRJD 5DO2D 3ZE2E 2D7QA 4IMKA 4AG4H 4HDIA 1VCBC 4LCIH 3ARBC 4ZX5A 1KCBA 3I6LD 5CLXA 3VMOA 5C0DB 3ZE0B 4NM4L 3NCBB 5IREA 5B38B 5FEBA 3WS6A 3D3VD 1N5YH 4RA3A 5KJ4A 3L4UA 1L9QA 2I07A 3Q1SH 3GBML 1PKQB 1RJYA 4EXKA 5B3JF 1RJLB 2NR6C 4N9GA 5D6CB 3UL4A 3DNKA 2OPCA 3NIGE 5E2TH 3ZDYF 1VADA 6PAZA 1DBBH 5GXBB 4GPVA 2OZ4H 2AI0L 4YR6A 4N2AA 4Y1AD 1UADC 4N0RA 4NM8L 4WUUB 2OTWA 3EH1A 3PDOB 4XNUH 1WJ3A 1N59B 2WZPD 3LHAA 3QQ3B 1XR9A 5F7AA 1C08B 4NM4H 4NO0B 5GIRA 1HCVA 2JKTM 2NY4B 2HKHH 4XNYH 3SQOL 2I5YH 3LNEA 4GBXB 3WEXB 2KKQA 3OAUL 2L7JA 1SPDA 4LNVA 2VMDA 3RNQB 4O9HH 3GBMH 1G1KA 3H85A 4P05A 2Q2LA 3QNXB 5DDHA 2D73A 3UACA 5JHDD 1H5BC 5IKCA 4DP1X 2WQRA 1CG9A 2P7TA 3K2UH 4RSVA 3VQMA 3L45A 4XP5L 1JPEA 5AKVA 5D7JB 1WT5C 5FO8A 4GKLA 2BNQB 5I74B 1RVFH 1FFTB 3ZL2A 3Q3GA 1E3FA 2F53A 5FW6A 1M3JA 2AZAA 2F5AL 4TPRL 3Q43A 1E9PB 3T1WA 2WB1A 1WWBX 3RX8A 1MHCB 3G5YA 4P5TD 4L3ED 2GUYA 43CAB 1G9HA 2DQFA 4ONGL 3RUGA 3O2VL 4RESB 4AM0Q 2R7EB 3U36B 3SQOH 2MMXA 1QYGL 3MRJB 3OAUH 2FSEA 1R4XA 2P9RA 1UM6H 2ZWYA 4WUKL 3TXAA 4EO5A 2H2SD 1UJTA 3QA3A 4NQTA 3ATEA 5EU3A 4BE5A 4DTGH 3EDDA 5E8PB 2V2XA 5EU7C 3GRWA 3DX8A 5DVPA 3AREA 1JXJA 1I1AC 4M5SA 1Z1WA 2GITB 2VRQA 4OIAA 4ZNEA 5FHAL 4DO5A 3Q0HA 2PTTB 4D0CB 3VGEA 2X2HA 5CP7A 5I76A 1F4WL 1AZZC 3PHQA 3ARQA 3WXVL 1NSNL 1NGYA 3E3QC 4TPRH 4L2LA 3CHRA 1NDGB 1VERA 3CZFA 3FB5A 3NRFA 2OR7A 2XQBL 1LQBC 1MJ8L 3T2QA 3LN4A 2WSKA 1AHMA 1IGMH 2BP0B 2FJHB 5KBDA 4NUPA 1YEEL 4WUKH 4AZ8A 3FN3A 3N06B 5L6YL 2OR8A 4Q58C 4PTUA 4M29A 1OHQA 3QW9A 4KC3B 3X12B 3TA3C 1CT8B 5HJ3B 5C0ND 1J0JA 4ECNA 1NCUA 1NPUA 4I0PD 5AVRB 5FHAH 1UQSB 3WGUB 2KQMA 2XZQH 4JFFD 2A6KA 4YK4C 4OZGF 4JY4B 4ZQKA 2BNQE 3CFDA 3HC2A 3F2LA 4Y9GA 3MROA 4PRID 1YQ2A 4H8HA 4ANXA 1VAHA 1CXIA 2L0DA 3TONA 1BYPA 3WNLA 1E0OB 4O00A 3K6SB 3UO1H 1PL3A 5I1EL 1C5BL 3MLVH 2XQBH 3FSVA 4HOWA 2ADYA 1ET8A 1MJ8H 1SY6L 1HHHA 1HH9A 1HEZB 1M05B 2X9YA 3BUQA 4MJID 1BOYA 3OKNB 3F83A 3LRHA 1E8XA 1NLDL 1RZGB 1B2YA 2RALA 3DARA 1MCHA 3HFFA 3UROR 4KXAA 3VO0A 3QJTB 1FAIH 3VX0A 2NW2A 1R3KA 4APXA 2AGJL 5JUEL 3QCVH 3CSTA 1U2CA 1HK6A 1IEBA 3BQUD 4GIPD 3ILQD 2BDNL 3LV3B 3ESPA 1BQ5A 4HJEA 4LDEB 3C5SB 5E8NA 5DEFA 4IBZA 3LYRA 4P23B 2OCFD 3D85B 1IAMA 1NAMH 4YDLC 4YBQD 3H55A 4N0YL 4UTCA 1KXHA 3QUXA 5TH2A 2OFQA 3T3MF 2BCKB 5IT2H 5EZPA 5IHZA 1WBYA 1CD1A 1UT9A 1SY6H 4R83A 5GRZA 1D5XA 3NH7L 1O7VA 4HKXB 3MJ8A 3PL6A 8PAZA 5C9KA 4G5AA 2JV6A 1LP9E 2CO7B 4LASH 5J7CC 2N01B 1DJYA 1H3XA 2DL2A 1GJIA 3VW3L 1OTSC 1F6AA 3BPCA 5J06A 3T0XA 5D2NB 2JJWA 3VD9A 4GXVH 2RQEA 2G3XA 4G9DB 4G6JL 4NP4L 5JUEH 5IQNA 3UZEA 2Y2WA 2X4PB 4FCAA 1IM3D 4PS7A 3O6KL 3MNZA 4PGEB 1EJ8A 4Z7UA 3VFUB 1CDYA 1FFPA 1NC4B 3FHQA 3MR9B 3V6OE 3U9PH 1W0YT 1LO3L 3CLEL 5J13B 3IPBA 3C60D 3ESMA 5K9OA 5E99H 4HS6A 4PGBA 4G5ZL 5JZ7D 2VIRB 5E2WL 2E75C 3BEWA 3L1OL 4NKMB 1KGJA 2NNXA 2A6DA 2DWYA 3ME0B 4GLRH 3P40A 5AKTA 4POZC 4HCFA 1BFSA 2PWFA 1MPAH 1NFDF 3IJSB 1PZ5B 4OBSA 3VW3H 2ICWI 4GXFA 2WXOA 5FYJE 1QSEA 5ID0A 3AXLB 2EXYC 4AUYA 4DPAX 4QRPE 4ODVH 1SQ2N 4TNEA 5JXAL 1R5WA 1AKJA 3TCLA 1ZVYA 3O6KH 4AQAB 4ADJA 4QRFA 1VFAA 3MFFB 2PPFA 3IF1B 7TAAA 1BXVA 4XHJD 3LSOA 5TK2A 1IBFA 1OGTA 2PN5A 1YJDC 3VQ1C 1LO3H 2OMYB 2FX9L 3CLEH 1BJ8A 4KOBA 4ODUB 1A1MB 1QR4A 4ACPA 1ZTXE 2E6PA 1QLRB 2FWUA 3EGSB 4M5YL 5DK2B 2HJKA 3W5MA 4WFFE 1J05B 3CVHH 2NY2C 4G5ZH 5SWSB 5DFWH 1CVRA 1EEZB 1AC6A 2FGZA 4JRXB 5E2WH 1X5JA 5DVMA 4HJSA 4N8PA 5I1KL 4G82A 1ZY9A 2ROXA 3X17A 3MA7A 2W07A 3FONB 4LKCB 4UANA 4LESA 4ODWA 5K1VA 1OPOA 4UV7H 1G4MA 4JFTA 1C5DA 2F7PA 3SE3A 3OWEA 1GC1H 2XX0A 5I73B 4OFYD 5JXAH 4GSDL 3LKSA 3SPVB 5D9SA 2GBUA 1YAIA 2VSDA 4P49A 2PCYA 4EN3A 4JDZB 5AW1B 3MODL 1JZ5A 2W9DH 5T1LA 1JVKA 2YEZB 4ODSL 4AGQA 4PJEA 1H3WM 5ID1B 4ZS7H 4J8RB 4LLYA 4M5YH 5DRWB 1HINL 1OF2A 4N2NA 5EH1A 4AX3A 4X8JA 4L5FL 3F64A 3ZHNA 2AQTA 2V5TA 2NX5B 2VLLB 5J12B 2E4TA 4MMYA 1X3DA 5BQ7A 2I9TB 1LWJA 2G75A 3ILPA 3GIVB 4TN9A 3ABMB 4BUHA 3F7KA 4JFOA 3IGFA 4NAMA 2OMBA 4LMQE 1MNNA 1HCFX 1ETA1 2MOGA 2Y2YA 1ZSHA 4MKMA 4S2SB 1PFCA 2XN0A 4AENB 3WTWA 1MJUL 1D9KB 1Q9KB 4HJJL 3GTNA 4U4IA 5CWSB 3OKLB 2XQ0A 5I1DA 3AWGA 4UT9L 5HYQA 1ZSDB 2VDPH 3B2VH 4Q14A 5HDWA 4ODSH 1RZPA 4UWQB 1GYVA 2C3GA 2AJUH 1L7TL 2FVNA 3ALPA 1HINH 3MRBB 5GQBA 1FVDB 5FYKU 5B1JA 1D5IH 3OX8A 4GRWE 3HI1A 4GKSB 4NN5B 2PR9A 3BH8A 4ZODA 4KH9A 1XTMA 1E9QB 4G9FB 5AOLA 2E9WA 1E28A 4KJPD 4X5XA 2I69A 3RVUC 3ULSA 4E9RA 3GXUB 5KYUA 2E86A 1DUYB 2X89D 3WO3B 3ARBA 2A83B 1IZJA 1EH9A 2EO1A 2F2HA 2FYVA 4HHAA 2C7UB 1BF5A 2HLFD 3DRQB 3J2PA 4P8QA 2CCWA 5ABZA 3C8KB 4QHNA 5FA4B 4HJJH 3V0WL 1J12A 3GF8A 2EXSA 4JFYB 1T7WA 1U8KA 1VEMA 4AV5A 1RUQL 2Z6FA 3RL1B 3K6OA 2DM4A 4FXKC 5E1GA 2EE3A 1JN6A 4FNRA 2Z92B 2NR6A 1KN4H 4NHCL 3VNYA 3IGAB 1L7TH 3FCUB 5K9JH 4JZJB 4OAWA 4RCAA 5IEHA 2IC2A 3VGAC 4TVPL 4DT2A 1MCSA 5FW7A 2Z4TA 2N3JA 3FFOA 1AGFA 2ED8A 4YFLI 3A6BH 4JZNA 4WI2A 2QVIA 2PTVA 1CL7H 5IOPA 1F97A 1YG9A 1KEMH 4PJIE 4GSRA 1WGVA 1RUAL 3PWLA 3D69B 1I4FA 4UOW1 1KZYA 2VUKA 2X4OB 1KACB 4JQIL 5DR5L 5E6SB 3UBXB 1G6RL 3OHMB 1U8PA 3DJRA 5BS0D 2X40A 3V0WH 4BFEA 3TBVA 5AZEL 3MCLH 1H5BA 4NHCH 1QO3B 3ARRA 4HQQL 4LOVA 1X5XA 3VWKD 3RPIA 4JRYA 1JERA 1WT5A 3KH3A 3LKPB 1ZLWH 3QSKB 4TVPH 2Y22A 2MTPA 2NY1D 3AGWA 4LSSL 4TUJA 2HRHA 3TV3L 4L8DB 1MCJA 4LEOA 2NZ9C 1MAKA 2E7BA 4GI8A 2VW6A 3Q2CA 4HHGA 5TQ2H 2VSCA 3B7TA 3PXHA 2OP4L 3VRLE 3NZSA 1A6ZA 1HQRA 1OQXA 1PZ3A 2OSLA 1JWSB 4V1DE 3K46A 1AQDB 1RUAH 1BGXL 1O6VA 4H8VA 3S96B 3D4ZA 4F1SA 2EINB 1D2OA 1AKPA 1JZ3A 3PWNB 3AGVA 4F7PA 1GCFA 3FHAA 4F7MA 3KPSA 2RTTA 4LCWA 3DUSB 2J1XA 1HN1A 4KJYA 1HJBC 4ZUUA 2NY6C 1AQHA 1I1AA 3MCG1 3VSVA 4LEBA 3DYPA 1QLEB 4HQQH 5D8JH 2GSGA 2QGCA 4OCNC 4KKNA 3GMPA 5IMKB 2HMIC 1AG6A 1HL5A 1JXGA 1N64L 3QGVA 1LL1A 3FQNB 3GIZH 4HFUH 6FABH 5JW3H 5F88A 5KSAB 3QCUL 2O5ZH 2W8CA 2B8OT 3TBWB 2VXQL 3NCYS 2EKJA 1WVZA 2XI9A 3RLSA 4JCWA 3JVFC 4HPYL 3RWFB 1ZS2A 3Q8BA 4KK8D 1NOFA 4G59C 2MWCA 2DIBA 1HCZA 1BGXH 2LLLA 1ADWA 2EIDA 2LQRA 3ARFC 1FFQA 3ZPDA 4LLWB 4ZOCA 2NCEA 5EU6E 5A6LA 5JW4R 4OV6F 3D39D 5KVGE 2EYSA 5JIPA 3WMSA 2DM3A 3FRPA 3ZXAC 4AYMC 2JLLA 4WKZB 1SMAA 3GS0A 4XX1G 4DZ8B 5JQHC 1QRKA 1Y7VA 4QRRD 1W8OA 4B5ZA 4KX9A 1ILUA 4V33A 3TA3A 2YUWA 3N40F 5I6KA 1ETB1 4NKDB 4FX5A 3PNRB 1UGNA 4X7TA 1ZPLA 4NPJA 3QIBC 5DFAA 1ERNA 3W9EB 7FABL 1I1YB 2YA1A 4RFNB 4YHOL 1NUNB 4EI6B 3C5ZC 3V7AG 5IFJA 4AM0A 4CC4C 1EERB 2JKRM 4HPYH 1B4RA 2HAZA 3VTAA 2P5PA 1EUUA 1YY9C 3JVGC 3MLXL 3DV4A 4JFEB 3DROB 1HAWA 4IJ3C 4Y4HB 3GS7A 4GW5A 4JFQB 3V6FA 4JGMA 4AIOA 1JHKH 1JNHA 3BPOB 4YXLH 3MGOA 3NIDB 2LVCA 2BS9A 5KVFL 4KXCA 1JXDA 4JGUA 4OF0A 4U6HA 5TE4L 5TTRA 1PAMA 3WIIL 3GBDA 5E2JA 4JVUA 5FFGA 3TIEA 3ZOAA 2AQSA 4QHMA 1UXWA 4P46B 3V4PL 2CIKB 5T1KA 2W65B 3VFMA 2NXYB 2JLPA 7FABH 1ZLSL 2APBA 4PJAF 4XCYB 2WXJA 4YHOH 2NYZA 2ZCHL 1V5JA 2OMZB 4LEXH 2FIKA 5GRVL 5E08H 2UUDH 2AK4E 3NIFF 2WUBH 4Y5XA 2ARJA 1E2VA 2DMKA 3TH2T 1A8ZA 2VMFA 1XBDA 2IBZX 2P5WD 3L4YA 1XMEB 3MUGA 4D8OA 1HIML 1BECA 4GXUN 3DIDA 4PJXE 4NOFA 5HDRA 3PF2A 3RZWA 3GB7A 3D0VA 3VCLB 5CN2A 5ITFA 3O3DB 5KOVC 5AB9A 5AOMA 3IMUA 5TE4H 3DURA 3F04A 3WIIH 1VGEL 4MXWL 1YPZE 3IKCA 1JZGA 2Z8WC 3J8F7 2W1NA 3KGTA 3US1A 5TDPB 3AB0B 1E42A 1N7ML 1EVUA 4NNPL 2Q87A 1KWKA 5EOCH 5C08E 1Q0EA 1ZLSH 4YL9A 1T1ZA 1ONQB 3EJQA 3OMNB 4C4BA 1SJEB 2WGNB 1UKQA 1IBDA 3M1BB 5DK3A 2ZCKL 5CXPA 5IW1B 5G4MA 4KUZH 4H25B 1MCWM 5C7XH 1M71A 5MI0B 2IBBA 2NPLX 3K81A 3LDBC 4L4JA 2J1WA 3FZUD 2NY5H 3U30B 2JWYA 1HYSD 1DVFC 1Z9NA 5FYLL 3RIAK 1WDAA 5C07B 1HIMH 4RQQB 1TMCB 2Q7YA 5EZIL 3PNWA 1FZKA 3I6SA 3OZ9L 2KERA 2PCPA 3DGGA 2CJUH 4YNYB 5BRZD 5L4FA 3K0WA 1VGEH 4AGOA 4L4VB 2FJFB 4Y2DB 4XNXL 4OB5L 5LCVH 4NNPH 1N7MH 4CGTA 4FQ1L 4HU8A 4HJ0C 4PYHA 4Q74A 1IAOB 5EUOA 4IRJB 3D4GA 2XG5A 1YUHA 3LIZL 1LD9B 1U93A 2ZCKH 3V4LA 4XHQA 4QXWA 3BFQG 5IB1B 3FRPG 3N04A 2W60B 4WWID 4PJ9C 1G84A 2E9IA 5D71L 2GT9B 4AH2B 1F42A 3LHPL 2ADGB 1OM3L 5I75C 4FLRA 2VABA 2H26A 2W59A 3WNMA 4X6BA 1Q0XL 2CXGA 5J6GB 5EZIH 2HFFA 4KY1L 4ADIA 2WWNA 2Y7OA 3OZ9H 5C0CD 1CICD 4LB8A 1RIHL 3IK2A 4KRPB 2KLRA 4LGSB 1U8NB 3ZUCA 3F01A 3HS9A 1XB8A 1RXLA 1L9MA 4LSQH 3AU1A 3GSRA 4ZXBC 2Y1VA 2BIOA 1XGZA 4YXKL 4PVBA 4G43B 2P4AB 1XGQB 4OB5H 4DVBB 1U8LA 1BSIA 5ISZA 3QAZC 3ECUA 3FB8A 3Q6GL 4Y1AB 1TZAA 5ADOL 2OMTB 1QRND 1G7PB 5ALBH 3LIZH 3B9EA 4G7RB 3RDTD 3BCFA 1R46A 2GSMB 1P1VA 4CW1B 4BFJA 4FG0A 1KMGA 2ISDA 3ZHDA 1RIUH 4X99A 5F9WC 4JN1L 2ITDA 3PWPE 1OM3H 1A7RL 4N2OA 4CGUB 2CZNA 1PLCA 3N1MC 5EIIG 1XF2B 1T4WA 4HD9A 3VI3B 3B8YA 1LO0L 4KY1H 3T6VA 2TSBA 4JG1L 3HE7C 5I71C 5C07E 1WEJL 1CTNA 1RIHH 4NWTH 2E76C 1SJHB 4JO1L 1YYLL 5I1LA 1FP5A 4JO5A 2AMUA 1EMTL 3EGXA 4H40A 3ZKMC 3S36H 5CCKH 2GUOA 4QTIH 4IK6A 1VZGA 1T0PB 4PJFA 1BG1A 4H20H 1KJ2B 3DJZA 2BLFA 3MRDA 3ZKQD 3GHEL 5C70A 1M42A 2CKBA 3HC4L 4JS7A 4NZRL 1D5BA 3BW9A 1X9RA 1EVTC 3EYOB 3LNDA 4P5TB 4ATWA 4L3EB 4U6YB 4U1NA 3O2WL 3SEPA 1YY8B 3O45A 4A1RA 5F1IA 2G4EA 4TTDD 4JN1H 5DF0A 5B1AB 3I6LE 2QZQA 3UTOA 1A7RH 4J3OC 4NQDE 5FPIA 4E0RB 2BP8A 1S78D 4PJ7B 2EKSA 3D3VE 1IGYB 4W93A 3QEUA 2V17L 4HWZB 4JG1H 5BUAA 3MBEA 1BQHA 1W72B 3H0TA 3HI6L 1M7IB 5IVXA 1G94A 4P2OD 3MKKA 4HUXA 1B3IA 3ZVVA 3L6FA 3L3GA 1TTFA 1EMTH 2G0LA 4P2QD 1P6WA 1ICTA 3UP1A 4HOMA 1UWEL 3DSFL 2Y0SA 2AABH 3M17A 1KJMB 4FXKA 3VXRA 4UIKL 5B8CC 4PRAB 4NZRH 4YZFF 4ZUWB 1JK8B 2WY3B 3TYGL 1FNEA 2V5YA 5EUKA 1MCRA 3OR7A 4JQIA 3WBDA 3ATFA 4E41D 1PD6A 3HNTL 2X4QB 4FKEA 4TS6A 4HOZA 1I1FB 2UZPA 2VOTA 3UTPE 3BGMB 2WXIA 3GS4A 3VFVA 3VI4F 1A6TB 2MEJB 2XJKA 2CNZA 2FJGB 4ZSOE 1NC2A 1W8NA 3RWCA 3SKNB 3AACA 3HI6H 2B15A 5F1NB 5JHDE 1A6WL 1R3LA 2FDBP 4I0PB 4Z7WF 1E7UA 4YWGL 3B8SA 4PI0A 4FF9A 3F7VA 4DCQA 5F3BA 5I8KL 5JW4Q 4UIKH 4UM8A 1O7DC 4UMSA 1LM8V 3V5HB 5I18L 1NM4A 3PABB 1ROCA 2P46B 3QXAA 1NOAA 3NTCL 4PV9A 3B7RL 3TYGH 5E5MA 4CVWA 1IM9A 1NJ9B 5C09D 3LH9A 4HUKB 4XBMA 5KN5A 3RY5A 5DS2A 2IH3A 1P84K 5I9QB 2VN6A 1O9ZA 3US9A 4MJIB 4CSPA 4WNJA 4B60A 1WG3A 3FT1A 4LCYA 4HAKA 4KKLD 2X88A 2FE0A 4PFEA 2EVJA 2VR8A 3ELQA 1F4AA 2VGLM 4QHLB 3H9HB 3L5WA 3FSZA 1A6WH 5IMMA 3ATDA 4MYWB 4A7QA 1U3ZA 1LVEA 3QP3A 2XKNA 5MEQB 1K2DA 4IHOA 1KLGA 3BQUB 4XAKE 4IIQB 5E6YA 1NQBA 1FL6B 4NO2B 2AQPA 2J44A 5FK9A 5I8KH 3H7LA 2ADJA 1NUDA 2H6OA 3TT3L 5AW5B 3M86A 3V4VL 3L48A 4X5WA 3QDMD 3IETA 5IW6A 5D5MB 1XF3B 5E1QA 3NTCH 4HPOL 5F7EH 3UMTA 4XRCA 3B2DC 2JKXA 3EKCA 2DS4A 3OV6A 1WP6A 4IKNA 1OP3H 2G5UA 4LL4A 4DUVA 2XQYK 3SGKC 2E9GA 5I6MA 1MY5A 2J56A 4XPAL 1CU4L 3PG2A 1FC2D 3F84A 4KI1A 1ASPA 1XCTA 4K5PA 4Z7VB 1WV7T 5ECGA 4BJLA 3SO3C 1SJMA 1U8IA 4LOFA 2VR4A 3PPSA 4ZDHB 3ARFA 3RVTC 2BSSB 5BZDA 3DBXA 3T2LA 2R51A 4KMTH 3ARUA 1IM3B 1WBXA 4HIEA 2ROYA 4N8VB 3IWUA 3EYUH 4X6CA 1JHLL 4WJ5B 5FGSA 4LXFA 4XVUD 4XZUA 5J3HD 2B1OA 2PW2A 2WKGA 3FQXA 1OGSA 4JFFE 1NFKA 1L4IA 2P1YA 2QSQA 2CR0A 3BESR 5C0IB 3KLDA 4JPWH 4PRIE 5ITBL 5F3HA 4HPOH 2ZP8A 4URTB 1S7TA 1P6AB 2CJTA 1FN4A 2CHXA 5I1GL 3KS0J 4L29B 1XGTA 4GW1A 2KMWA 3D25B 3F7YA 3S5YA 1YEJL 3QQXA 3GMLB 2BNRE 4HK0A 3JTSA 4WWOA 1X5LA 2R1YA 2XWJB 3C5ZA 3G6AA 1UZ6E 3S5ZA 3S6CA 4L1DA 1MW2A 3IEAA 4CC4A 1DSFH 3F6LA 4GG6B 4PRPB 2I24N 5DZLA 1R5VA 2BVYA 5SWZD 3JVGA 1AI1L 4H8QA 2WXMA 3HS8A 3MUZ1 4HS8L 1EEQA 2BK8A 1DE4B 3NSJA 4ERSL 1UCBL 4Z7OB 4J2XA 3V4PA 4HOXA 2H41A 2OJEA 3WKPA 3PWUA 1UM5L 4YEEA 5DRNA 3UP6A 2A9NL 4P5MB 3RP1A 3ZE1F 4LDLB 1P5VB 1X4XA 3ZDZF 2GBTA 5JXED 4NJ9L 5ITBH 3LKRB 1KPUA 1QP1A 3BD5A 3OWRA 4A39A 5JPNA 5JO5B 2Z3FA 3TT1L 3WIHL 5I1GH 1CPUA 1UD2A 3IN2A 2BS71 4YC2B 4MNHB 1RCYA 1OT1A 1QACA 1YEJH 3OSKA 1ORQA 5H35A 3FTVA 1R3HB 3H9ZA 3OF6A 3QK0A 4H44C 4G6KL 1L6XA 2WLIA 4H13C 1FO0B 3QIUC 3P4MB 1AGEA 1Z9LA 1ZTMA 4ZUTA 2ZSWB 1U8QA 2YPKA 1E50A 4X5QA 3D18A 4J12A 4ZFOL 4ERSH 1UCBH 2BVTA 1GAFL 3QFGA 3QFJB 4M61B 2WANA 1RHHA 1V7NL 2EDNA 3RKDD 4ZI8A 1UM5H 2Y3AA 3UJTH 4ODHL 2MQ0A 1QBML 1WUNT 3TF7C 4PY8I 4MDIA 1NKOA 4MB1A 4UNTA 3LPOA 4JO2L 4M8RA 2GEEA 3FT4A 3UYPA 4N2KA 4HIJB 4LKXA 4A38A 1QOKA 3MV8A 4XOBA 3RWGB 2E7DA 3MRIB 2Q76B 3NQIA 3P3TA 4X9YA 3UTSE 3WIHH 1AZRA 1RAMA 3KXFA 2RFXB 4RDBA 1MFVA 2IQAA 2CA3A 2R23A 1X6NA 4MYPA 3WNIA 2D31A 2NY4C 1SYSB 3LKOA 3ET9F 4HGKC 4RSYA 5I8EB 3S35L 3L3HA 8CGTA 5IR1B 1C9SA 2OJ1A 4G6KH 4PJBF 1FL3A 1TKWA 3WNKA 2BZCA 4Y1SA 3PGCB 4JR9H 5DQJB 3VDAA 5CLZA 5KJ7E 4Z7QF 3QRFM 1DVFA 3T6WA 3QNYB 1V7NH 1ZLVH 3O6ML 3FQWA 2VXTL 2AJYL 3QHZL 1QBMH 3QJFB 4J5VA 2W81C 4J4PC 4JO2H 4U6TA 4MHHI 3MJWA 1ETZB 6TAAA 3ZU8A 4FNPA 3O2DH 4BK5C 2G9HB 3IFOA 4F33B 5IB2B 3BWAA 3BAEL 4N8UA 3L9YA 5JIHA 5AW0B 4FQHB 1M56B 2PETA 2CPCA 4F2FA 3APCA 2DZEA 2QQKH 1GMIA 5D1XA 4AYID 2NDFA 2XSKA 1UFGA 4Q4IA 1S7VA 3STBA 2WXGA 1UB5B 3K72A 4PJ9A 4MCYA 2XWCA 4LLQB 4KKRA 4PP1D 3SDAD 2WXHA 3E6HA 3QQ9D 4LP8A 3OKYA 4IIZA 5FO7A 5BMFL 4LP5A 4QO1B 1OXYA 3MMEA 3W0WA 5JR1H 1MFUA 1PCSA 5DMIH 1I7TB 1S7RA 3I6GA 3ARPA 2VXTH 2AJYH 4X6EA 5FO2A 1SN0A 1JGLH 4FNQA 5HYIA 3OC8A 5I8CA 2QHRL 4MA8H 4XN9A 5GGUA 4XBEH 1LWHA 2R4RH 2X4SB 2A6JA 1GGBL 3BAEH 1I9RH 4HMDA 5CSBA 3O3BA 1OD9A 4LARL 5HGGS 3ARGD 5I8OL 2R56L 5F9JA 5E9AA 3NESA 5D7LA 4A7GA 1JZ7A 4AQ1C 2YKLH 3A23A 4X2UA 1N0LB 1C1EL 3DJ9A 5LAXB 5T3XE 4PGDA 1ECZA 2X4RB 4PEEA 1JGVL 2OMXB 2BVPA 3T4YB 4J39A 3K4AA 4TUOB 1NWPA 3VXUA 3CK0H 1HJCA 5BMFH 1U92A 3DUUA 2WMPB 4UCFA 3MBWB 4UV4H 5BS0B 1RURL 2VQTA 1L9OA 1XCWA 3FB7A 1YSOA 2ZWNA 4KI5F 4EVNA 2VUOA 3MRKB 4IBUA 5ILTL 3EDKA 1S3KH 1MCWW 1NBZB 2FQFA 2P42B 3HE7A 1J9RA 2QHRH 4J1UB 4F2ME 2COVD 3GJFK 3K8LA 4FFYL 2AQ3A 4KUCD 2NY1B 3B2PA 4X6FA 3WL9A 4F92B 2A9MH 4PJ5A 4LARH 5K39B 2AJZB 4EUPB 1XF5A 2CO6B 4ZW5A 2VDRH 3BD4A 3FTXA 4W81A 4L9DA 4YLBA 1C1EH 1BX2B 4GLRI 1L9PA 1R24A 4GJTB 4MJJA 4XZ4A 1GIGH 5INCB 3ZO0A 2EIEA 3VTTA 1YN6A 4DEWA 1MRDL 2UZXA 5I66A 1SLUA 2NT1A 5FCUL 1CFSB 4NKOB 1U8HA 3O9WA 4OD2B 4NFDA 4DP9X 2YD3A 5KVEH 5ILTH 3G7TA 4QY8A 1S7QB 1WS7A 4MCZB 2AJ3B 2YAMA 2PWDA 3VMNA 1UH3A 4P23C 4FOMA 4FN0A 1ASQA 1S8DA 2F8OA 1A4JB 3LEVL 4FFYH 1N2RA 4UBDC 2D7OA 2ZXBA 1YMHA 2P5EA 4Y2LA 4CADA 5IJKC 3D9AL 1WZ1H 1SLWA 3ESVF 5B8CA 1NCDL 4PJHB 2CDFA 3MRHA 5JMOC 3R18A 2XXGA 4S1QL 2X70A 5H2BA 2A99A 4D7PA 4HYTB 2VDMH 1Z3RA 3CDZA 3FFCD 4NRXA 3A47A 1TVDA 1BD2D 1NKGA 3SB3A 1MRDH 3BZFB 5FCUH 1GYCA 3D39B 4HUUB 2VE6A 1UOWA 1J5CA 3BSZL 3ZL4H 3C9NB 5A2IH 3W38A 3ULVC 4HIIA 1VFBA 2FX7H 3HNSL 2YXFA 1KTDB 4I77L 1OTUC 1CBVL 4H26A 4QRRB 25C8H 1QEWA 4WEBH 2F53D 4FQIL 4FFVD 1M1SA 4PWKA 3NBNA 4Q9QL 3TVMA 4GAGH 1VACB 3OM3B 3T0EE 5J13C 1KB3A 3LEVH 3TL5A 3RGHA 3QZPA 4M1GL 4JZOB 1IBBA 4M9OA 4L2YA 3D9AH 2B39A 1E2WA 1A6VH 1RV6X 2PW1B 2NTSP 4OZFA 4QF1A 1EX0A 2EZ0D 3AWFA 2V37A 2J1KA 3ARED 4Z7NE 4HV8A 2AC0A 2YEVB 1FHGA 1NPJA 2JELL 2X6UA 4GMSL 2APFA 4ZMYA 2Y5TA 2GBVA 3L5XL 3BSZH 4M8VA 1DBJL 1W0VA 3HNSH 3N0PB 3ESUF 4G8GA 5ECJE 5TDNA 5IJVA 2NW3A 2WINA 1CBVH 4M3JA 5E7BA 5EORL 1T7ZA 4JPIB 3V4VA 1J1PL 1UT1A 4TTGA 4FQIH 3AT8A 3EOTL 4Q9QH 3KBFA 5BO1L 5B3JE 1OP5H 4ES9A 3EFFB 2EUXA 2Y7SA 4QRSA 1DR9A 4Y89A 3QULB 4ICWA 5CJQL 3L3OB 3TP4A 1QPPA 4M56A 5MENB 3VXPA 2B2XH 3JV0A 2FWLB 2C3VA 5JQ6H 4ELKA 5EU4A 1XVSA 3CSGA 2ICEB 2VRKA 3S9DB 1MVYA 1OW0C 2ZKYA 3WFHA 2IV9A 3VXQA 4GEIA 2JELH 4GMSH 1NIFA 3KWUA 2J88L 2FQEA 5I73C 3I50L 1DBJH 2VKWA 1TIUA 4M8UA 1SBSH 5E9DA 2CLVA 2EIJB 2FEEL 4HW6A 4B9PA 4E9SA 5J1AB 3EOTH 1TXKA 4ABWA 4QWWD 4IOSA 4LE8A 2YPVA 3IU4L 1P5UA 1FORL 3NPSB 4MXQD 3LH2H 2IMNA 4PB9L 5BO1H 4BHUI 3HOGA 1CXKA 3G04B 4QTFA 5CJQH 2XRAL 2FL5B 1CDJA 4BZ2A 3LZLA 1WAEA 4IGBA 3AT9A 4C55A 3AMLA 4GFXA 3HN5A 4E9LA 4TSAH 4F15B 4F8PA 1DTUA 3PQYA 4OLXL 1TQUA 4OTXH 4IBSA 1I9IL 3CPLA 1T04B 2EDRA 3WUWB 4PBWD 5FKPB 4KI5C 4BUQA 4NT6A 4FHBD 1CD0A 2J88H 2ZOLA 3I50H 4JPQA 4AVKA 2YD7A 1CXLA 1MFEH 3NZ8B 4K7PL 1Q9WA 1IKNC 1A02N 4FXGB 2V2TA 5BRZB 1G7JB 1KBVA 1TCRA 3GPSA 4P2RD 4ZZFA 4LIQL 3UTZB 3UX9B 3R4RA 3KNBB 1UZGA 5AOJA 4K8RC 1FNGA 4FA7B 3WKQA 1JMXA 3U6XA 4LGRB 4MWFB 2XRAH 4WF7A 3WSQL 2JSFA 4KTYA 5A1AA 2JIXD 2G2RA 2K8QA 5D1QE 3UEZA 4D9QD 1R33A 3X1EA 2FECL 2YBGA 2CHWA 1Z6JT 3RVVC 1AD0B 5B3SB 3JV6A 4YSPA 4TSCL 3U0TB 3GGWB 1YRKA 4OLXH 5GRJL 4GOSA 5T1JA 1I9IH 2OLDA 3ARTA 3EHBC 4JN2B 3VG9B 5IIEB 5SX4H 1FH5H 3ZZLA 3ZR6A 4NB7A 1D5ZB 1Z7JA 5C0DA 1I82A 1AZBA 5EEUA 4LU5L 4X5LA 2PP7A 3V55A 3MYJA 3W56A 2KI6A 5B38A 3W37A 1I8UA 4PJCF 3CE1A 1HHJB 4ZW8A 4YMPA 2P5WE 3WKYA 2VTFA 1CICB 2WAQA 2CJ3A 3QEGL 1IU1A 1RY7B 2C26A 4KV5F 3VYOA 1PKQA 3HE6D 2M1KA 4NSKB 3WJMB 2BP3A 5L2JB 4OF6A 1RJLA 3FO0L 4LIQH 4OZFG 4JFPB 3QR0A 4JJ5B 3B9KD 5F1OB 5D6CA 1KIQB 5EF2A 1AXTH 2A4EA 3GUTB 1L7IH 3P77B 4N5ED 3WSQH 1MXDA 1RK0B 3T9WA 5H4ZA 3QC6X 3NA4A 1CF1A 2EH7H 3RDTB 4W9FC 4UUJB 4TSCH 4M1CD 4LRNL 2QGEA 2VL5B 1DVYA 4RRPA 4WUUA 2ICWJ 3PDOA 4TSBL 1ACYL 1N59A 3CFKB 3QQ3A 4N0CD 2CQVA 4HZAA 2EADA 3QG7L 1C08A 4LU5H 1A7QL 4NO0A 4CJ1A 4MZ3A 4OM1L 5ANMB 3QNFA 4GO8A 5LNDA 5C6TH 1AKJD 4GBXA 1BXUA 3WEXA 1UD5A 2UV3A 4JFDD 4KQ3L 4U0QB 5E03A 2OYLA 1D6VL 3I9GL 3RNQA 5J0BA 3UOAB 2VERN 2KL6A 3QUGA 3QNXA 3R0MA 1NGPH 1G5AA 2QPDB 5CEYB 1MWAB 4JK0D 4TULL 2A9BA 4PS3A 2E4FA 4PVLA 2ZXGA 5D7JA 4A6YB 4J4PA 1JF5A 2CXKA 5BCAA 5E70A 1PLGL 1V3MA 3R19A 1K4DB 4AIZB 5BO0D 2ZOKB 2Q3XA 2AF2A 5IVXF 2H7WA 1EV2E 2GCYA 1E9PA 4TSBH 3QH3B 4JREB 1S9YB 1PDKB 2PYEE 43CAA 3GSNL 1A7QH 5LB1A 1ZLUH 2R7EA 3U36A 3FDWA 1MIEL 4GRMB 4LPVA 3MRJA 1ACCA 5D93B 2E27L 1I1CA 3QS3A 4Z3TA 3FYEB 4KQ3H 1YN7B 3I9GH 4X8XA 5D55A 1COBA 4HIXH 1KULA 3L4CA 3PP4L 4P2OB 5E8PA 5C0CE 5BVPL 4ZW7A 4TULH 4N2BA 4P2QB 4Z7AA 2GITA 4HP5A 1X5MA 5CD5D 2UUDK 2IG2L 2V3FA 3GNML 2W0FB 3O41B 3Q48A 4X42A 2PTTA 5CCGE 4D0CA 2DQDH 5KYWB 4AWJC 5BZXA 4H8WC 2UWEE 2VLMD 3KPOB 3RL2B 1QRNE 2AK1L 4DFHA 4JL2A 4E41B 1NDGA 2KZKA 4GXUM 1CYXA 4PW4A 1QLEL 5KANI 4R3SB 3H56A 3EF7A 4OQTL 5F7HA 1EO7A 1SXSA 5I0DA 3GSNH 3U4BH 3GM8A 5GZOC 3NP4A 2NT0A 1KGCD 2ITCB 1MIEH 2E27H 4H8WL 5I5IA 2BP0A 2FJHA 3TJEL 3QXUA 3CC5B 4ZBJA 4YX2L 4ZK8A 3SKOB 5IY5B 2OI9B 4TUKH 2OM5A 2VZVA 5BVPH 3X12A 1CT8A 4LPUA 4FJYA 5HJ3A 1UEYA 4MMXB 4I3RL 4N3TA 1UQSA 5FGRA 1ND0B 2AEWA 2ICWB 4IMLB 4YUEH 3QCTL 1B6UA 2EDOA 4JY4A 4P3DB 1U4FA 3PJNA 1N19A 2G2NA 2GIMA 3I84A 4RFNC 3HZ3A 3FU8A 5B38G 5MP6H 5EO9B 3D1MC 3CN1A 3K6SA 1IMHC 3BP7B 3HKZA 5LXGL 5DD0L 1P9MC 4U1GB 3FBKA 3B5TA 1BQSA 1IBYA 4Y19E 1MW1A 3SIKA 4DOHB 2K45A 4YBLB 4YDKL 4Y4HC 4KVPA 1HEZA 1XZ0B 3NCYP 3RAJL 1M05A 2CO1A 2DQUL 5FOJA 4FNSA 3TBCA 3OKNA 4YX2H 1CC3A 1AHWB 4RMQA 2VXSL 1RZGA 1N26A 2GK2A 2NR6D 4FLQA 4OLWL 1A3LL 5GRUL 4MA1B 5BUGA 4ENED 2VLRD 4PWGA 1IIKA 4ANKA 3FMGL 4RRPG 3VXSD 2LAAA 5DT1L 4YXHL 3L7FB 1GCYA 2NXYC 4R2GB 3RGVC 3QDMB 3C5SA 5IV2B 4P23A 4FERA 3D85A 1GOHA 3QXWA 1EHNA 5LXGH 2F18A 4NKQB 2BCKA 4C56E 5IJKA 2ORBL 2DL9A 1INEL 5DFVC 3RI5F 2DMCA 3QXVA 4YDKH 4NERA 4HKXA 5E00B 4NLAA 3RAJH 2DQUH 3V0GA 3P0VH 2F7RA 1XIWD 2NZIA 2CO7A 4K73A 4OKVB 3SQRA 3VD1A 1CTOA 1XHHA 2VR3A 1XWVA 2DWTA 4WJG3 2LT9A 5D2NA 4OLWH 1LNUB 5D2LB 5GRUH 4FL4C 4PVMA 1KYFA 3ARXA 1E4XL 5EEXA 4G9DA 4AV0A 3X1NA 2QQQA 1KF9B 4MVBC 2D03L 1KXQA 3FMGH 4UF7C 5I1HL 3LVTA 2X4PA 5EV7A 3G6JE 1KC5H 4XVJL 5DT1H 3EZ8A 4PGEA 5HGAB 3VFUA 4O02B 1NC4A 3MR9A 4OW6A 3NP3A 4B7LA 3WFCL 4RETB 4OZ4B 5F72S 3SQBB 2NXZB 1BLIA 2EQDA 3EXLA 5C09E 5MI0C 4YJZL 2PNDA 1Q1PA 1INEH 2VIRA 1NFIB 1JPST 1Z5YD 4KK5C 4NKMA 4ZW6A 4CNIB 5EEZA 3ME0A 5INDB 2IFFL 5GS0C 1E9OB 5SWZB 2MTAA 1QFUH 4LLDB 3ZQ9A 3IJSA 3NCXA 1PZ5A 3POHA 1GYAA 2B1AL 4UAHA 2MFNA 3AXLA 1T5KA 5IGXL 3CFUA 4BFIB 5C0AD 3HJ0A 2Q0ZX 1J8HE 4PW3A 4ZTEA 3WXWL 4Y2DC 2OTUB 1TJIL 2VJXA 5IK3B 4AQAA 1ACZA 2Y1YA 5GS0L 3MFFA 2HFTA 2GAZB 3AFLA 3IF1A 3N44F 2XZAH 5KSBE 4HF5L 4IRJC 5CU5A 3U1SH 2OMYA 4UTBL 4ODUA 1A1MA 5CZRA 1QLRA 3EGSA 2IVFC 1RP8A 5DK2A 2DQJH 1J05A 5SWSA 1IGFL 1D7BA 2GPZA 4FFZL 1EEZA 1N0XL 2ZX7A 4JRXA 4DWHA 4X5PA 4YHIB 1YNTB 3L5JA 2IFFH 5GHWL 1E4KC 2VXVH 3FONA 4LKCA 5HYJB 2NY0B 4OFIA 2K0RA 4Z76B 1TTBA 5J8OA 2B1AH 5IGXH 5HI5C 2J8OA 4KRPC 4FQXC 4XMVA 1CS6A 2AV1B 3P3UA 4R7NB 3L8QA 1E5YA 2UY6B 3RIFF 3SPVA 5DZVA 2IIJA 2UXGA 5CEXB 4UYQA 4OLVL 5D7SL 4GEJA 1DQLL 1J88A 2MOVA 4GAYB 4HF5H 4JDZA 4OZHB 1EHKB 3FNKA 2YEZA 4K3DH 4MSWB 4ZPTB 5GGSY 3L7EB 4HCRA 5ID1A 4J8RA 3MRCB 4D7BA 4FQPA 4MCNA 5DRWA 4CA4A 4OV5B 2VO5A 2XDHA 4D9RD 1IGFH 2NX5A 3MRPB 2VLLA 3SJVE 3R06B 3WE6B 4FA6A 2I9TA 2CHZA 1EXUB 3GIVA 5GHWH 3FH5A 2DQHL 2ZXWB 1B0WA 4WK2B 1AY1L 5L4IA 3SKUD 5EO1B 1OM9A 1ANUA 1Q1JH 1KLUB 1T1YB 2VLKD 4M7ZB 1NCCH 3DXAB 2PO6C 2ZYRA 3OAWA 3MJ6A 4S2SA 1KENL 4JM2F 4AENA 1D9KA 1Q9KA 4G7VH 2TSAA 2TRYA 1DANT 4OLVH 4HBCL 2NQCA 4LLMB 5CWSA